5BNVB

Crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.3
total genus 27
structure length 79
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnvB00
3AZID 5B0ZB 5B0ZA 3AZMC 1TAFA 1M19D 5E5AA 1EQZA 4R8PC 5B2JB 3KSYA 3B6FA 3LELD 1P34D 2PYOA 4XZQB 3X1SD 3REHB 3AZKB 3RELC 5B1LC 3TU4C 1P3KA 1P3PB 1P3AB 4R8PD 5E5AC 2PYOB 5E5AD 2AROB 3W99C 4H9PA 5B33B 3MGPC 5CP6B 3W97D 1P3IB 4WU9B 4J8WA 2L5AA 1P3GB 1KU5A 1P3GA 2F8NB 5BO0B 3WTPD 2F8NA 3MGSC 3WA9C 2F8NK 3AZFA 3C1BB 5B32A 3NQJB 5FUGB 3W96A 1TAFB 3AZHD 1S32C 2BYKB 4Z2MH 4WU9A 4CSRB 4YM6C 1KX4C 5AY8C 5AV9D 2AROA 3AZLB 1P3OB 3B6GA 3X1UB 5GT0B 2CWEA 5AV5B 3A6NA 4Z66D 4XZQD 5F99C 3V9RB 4Z5TB 1P3AA 5KDMB 4G91C 2IO5C 1M19B 4WU9D 5AVBC 4J8XC 3REID 5GT3C 5GXQA 3X1VD 3AZEC 4WU8C 3AZHC 4H9SC 4WU8D 2NQBB 1A7WA 3AFAC 4Z5TA 1AOIC 3KWQA 3AN2D 5BNXA 3KUYC 5E5AB 3KUYD 3AYWA 5B40B 5B0ZC 3C1BA 1P3MD 2CV5A 4X23B 4H9PB 5C3IB 5B2JC 5CPKC 3AYWB 3WKJB 5JRGB 3LZ1B 5AV6B 5JA4A 2RVQD 4J8VD 3AZLC 1P3OC 3REKB 1N1JA 3VH5T 4HGAC 5GT0C 2HIOC 3LZ0B 1P3IA 3RELA 3AZNA 4YM6D 3RELB 4EO5B 4ZUXB 3LZ0D 3AZKA 4WNNB 1M18D 1F66A 4YS3A 3AZEB 5JA4B 1M19A 3B6FB 1P3KC 1KX5B 2NQBC 3MVDA 1M1AB 5AV6D 2IO5B 5BS7C 3AZLA 1P3OA 5CHLB 5AV8D 5G49B 4XZQA 3WTPE 3AZJB 5GSUB 3MGQC 3W96B 3MVDD 1P3GC 5AVCB 3KXBD 2NZDC 3MGSA 3AZFC 3MGSB 4DRBA 3KUYB 1HTAA 1M18A 2NQBD 3AV1C 1P3FC 2NQBA 3AN2B 5BS7A 3REIB 3LZ0C 5DNNB 3AZMD 5GXQD 3X1VA 4KUDC 3MGQD 5B31A 3MNNC 4J8WD 4G91B 3B6GC 1BH8B 5CPKB 5AVBB 3AZLD 1P3OD 3WKJC 3AV2B 5B24B 1N1JB 3LZ0A 3AZKD 4WV4B 3WAAC 2BYMA 4CAYB 3VH5W 5B31D 5AVBD 3AZMB 1P3LA 2CV5B 3O62D 3MGRA 3C1BC 4QLCA 5JRGC 3X1UC 1P3PD 5AV5C 3R45B 4HGAB 5GSUD 4WNNA 5B1MC 3WTPC 3WA9D 3AYWD 5B1MD 3KXBB 5B1LB 3O62C 4H9NA 4EO5C 4ZUXC 4J8UA 4H9RB 1P3BD 5AV9C 4G92C 3W96D 1TZYD 5GXQC 4KUDD 3W97C 3AZKC 1BH8A 4H9SA 3X1SB 3V9RA 4XUJB 4WU9C 4LD9A 2PYOC 1KX4A 3X1TB 1ID3C 1ZLAC 3W99B 5AY8D 5JRGD 4Z2MG 3WAAB 4X23D 1B6WA 3VH6T 5AV6C 4AWLB 3LELC 5G49A 1KX3B 5BT1D 1R4VA 1HQ3D 4KUDB 1Q9CA 3AV2A 2JSSA 1F66C 4YS3B 4KGCD 2FJ7D 1P3KB 1P3PA 4DRAA 2RVQC 2LY8A 4J8VC 3AV1D 4JJNB 1P3FD 3UT9A 3AZNB 4E44A 5B24C 5DNNA 4M6BA 5BNVB 1P3MC 5BO0A 3MNND 3LZ1A 3MGQA 3B0BA 5AVCC 3WAAA 2NZDA 1F1EA 2PYOD 4XUJC 5CPJB 1BH9B 2HIOD 1P3BB 5GT0D 3AV2D 5BT1C 4H9QB 3UT9C 5B32D 2F8NG 4WU8A 5DNNC 2NZDD 3MVDC 1P3GD 3MNNA 4J8XD 3WTPB 3UTAA 1WWSA 3AYWC 5B1MA 1F66B 4G92B 5B33D 5CPIB 5DNMA 3REHC 4ZUXA 4J8UC 2AROD 4JJNC 5AV9A 1KX4D 4YS3D 3W98A 3R45A 3C1CC 5GT0A 1P3IC 2HIOA 5B2IB 5CPKA 3MGSD 1HQ3B 1P3LC 1P3LD 3MGPB 5B33C 4KHAA 3MGRC 5CPJC 1P3BA 4ZBJB 5AV8B 5CPKD 4E45A 3WA9A 1EQZD 1H3OB 4NE6A 3C1CA 4ZUXD 2FJ7A 5B0ZD 3AZJA 3B0DB 3X1TA 3UT9B 3AZGD 4YM6B 3RELD 4UUZA 1BFMA 3AFAD 3TU4A 3UTAB 4J8VA 4J8VB 3X1SA 2YFWB 1TZYB 3AZEA 1ULYA 5GT3D 4J8UD 4H9RA 5B40C 4CSRA 3X1TC 1M1AD 1ID3B 1ZLAB 5B0YB 3WAAD 3B6GD 3AFAB 3WA9B 4QLCD 3REJB 1H3OA 3AZGB 5AVCA 5C3IC 3W99D 5BNVA 1HQ3C 3REKC 3UT9D 2CV5C 5CP6A 3REKD 3MGRB 3TU4D 5CPID 1TZYA 1F66D 4X23C 3KXBC 5AV9B 1P34C 3MGPD 3UTAC 5B1MB 5B40D 3W98C 3LJAD 5DNMB 4R8PA 3REHA 1M19C 3C1CB 5AV6A 3NQUB 3WTPA 3VH6A 4QLCC 5JRGA 5B0YC 4WU8B 5AV5A 3B0CT 3X1VB 1P3BC 3UTBB 3AZGC 3AV1B 1P3FB 3KWQD 3AN2A 4H9OB 4Z5TD 4KGCB 5AV5D 1M18C 3C1CD 2NZDB 2BYMB 3REJC 5DNMD 3LJAB 4LD9C 4R8PB 5B0YA 5B24A 1U35D 3B0DC 1ID3A 3REHD 1ZLAA 3W99A 1ID3D 1KX3D 3C1BD 1P3MA 5CPJD 2YFVA 1ZLAD 3LZ1C 1KX3C 3A6ND 4J8UB 5B2JD 4JJNA 2HUEB 1JFIA 1KX5C 1M1AA 3MNNB 3W98B 1EQZC 3TU4B 1S32A 3AZED 4YM6A 5CPIA 3AZND 3MGRD 2AROC 4JJND 3W96C 3AV2C 2BYKA 3A6NC 2FJ7B 3LZ1D 5CPJA 1KX3A 3AZFB 3WKJD 5AVCD 1U35A 5B0YD 3AZJD 5GSUA 3AV1A 1P3FA 3REIC 4KHAB 3LJAC 4LD9B 4WZSB 3MGPA 1BH9A 3UTBC 4Z5TC 1AOIA 3KWQC 1S32B 3AZHA 5B1LD 4KGCC 4J8WC 4CAYA 5B31C 3AZFD 1B67A 1JFIB 5AY8B 4XUJA 3O62A 3X1SC 1P34A 5B32C 5B1LA 3W97A 3REIA 2CV5D 3X1TD 5B2IC 3LJAA 3UTBD 4NE5A 3W98D 5AY8A 5B2JA 4H9OA 4KGCA 1WWIA 3A6NB 2FJ7C 1EQZB 1AOIB 4Z66B 3AZIA 5AV8C 5B24D 1HQ3A 3AZMA 1P3LB 5B2ID 5B32G 2F8ND 1U35B 2HIOB 5B2IA 3REJA 3B0CW 4ZBJC 3AFAA 3LELA 3KWQB 4J8WB 5B31G 1KX4B 3AZIC 5GXQB 4NE3A 3W97B 5B33A 1M1AC 2YFWA 5F99B 5KDMA 1P3PC 3O62B 3X1UD 4J8XA 1P3KD 5B31B 4J8XB 4QLCB 3REJD 2YFVB 3AZJC 3VH5A 3AZHB 4H9QA 3X1VC 4KUDA 1TZYC 3NQJA 5B32B 3AZGA 3KUYA 3B6FD 3AN2C 5F99D 1AOID 1M18B 5GSUC 3MGQB 3LELB 1P3ID 1U35C 5CP6D 3UTBA 5DNND 5B40A 1P3AC 4AWLC 3NQUA 4XZQC 3AZIB 4Z66A 1P3AD 2F8NH 2HUEC 5BNXB 5AVBA 3MVDB 4UUZB 4XUJD 1KX5A 5F99A 3AZNC 5DNMC 4LD9D 3B6GB 5CP6C 1S32D 5GT3B 5GT3A 5CPIC 1P3MB 4YS3C 1P34B 4H9NB 3REKA 3KXBA 3VH6W 5FUGA 1KX5D 3B6FC 4NFTA 4X23A 4Z66C 3X1UA 5AV8A 3UTAD 3WKJA
chains in the Genus database with same CATH superfamily
3AZID 5B0ZB 5B0ZA 3AZMC 1TAFA 1M19D 5E5AA 1EQZA 4R8PC 5B2JB 3KSYA 3B6FA 3LELD 1P34D 2PYOA 2DF4C 4XZQB 3X1SD 3REHB 3AZKB 3RELC 5B1LC 3TU4C 1P3KA 1P3PB 1P3AB 4R8PD 5E5AC 2PYOB 2Y2MA 5E5AD 2AROB 3W99C 4H9PA 5B33B 3MGPC 5CP6B 3W97D 2ZY4A 1P3IB 4WU9B 4J8WA 2L5AA 1P3GB 1KU5A 1P3GA 2F8NB 5BO0B 3WTPD 2F8NA 3MGSC 3WA9C 2F8NK 3AZFA 3C1BB 5B32A 3NQJB 5FUGB 3W96A 1TAFB 3AZHD 1S32C 2BYKB 4Z2MH 4WU9A 4CSRB 4YM6C 1KX4C 5AY8C 2Y2JA 5AV9D 2AROA 3AZLB 1P3OB 3B6GA 3X1UB 5GT0B 2CWEA 5AV5B 3A6NA 4Z66D 4XZQD 5F99C 2Y2NA 4Z5TB 3V9RB 1P3AA 5KDMB 4G91C 2IO5C 1M19B 4WU9D 5AVBC 4J8XC 3REID 5GT3C 5GXQA 3X1VD 3AZEC 2Y2HA 4WU8C 3AZHC 4H9SC 4WU8D 2NQBB 1A7WA 3AFAC 4Z5TA 1AOIC 3KWQA 3AN2D 5BNXA 3KUYC 5E5AB 3KUYD 3AYWA 5B40B 5B0ZC 3C1BA 2DQNC 1P3MD 2CV5A 4X23B 4H9PB 5C3IB 5B2JC 5CPKC 3AYWB 3WKJB 5JRGB 2FFFB 3LZ1B 5AV6B 5JA4A 2RVQD 4J8VD 3AZLC 1P3OC 3REKB 1N1JA 3VH5T 4HGAC 5GT0C 2HIOC 3LZ0B 1P3IA 3RELA 3AZNA 4YM6D 3RELB 4EO5B 4ZUXB 3LZ0D 3AZKA 4WNNB 2JE5A 1M18D 1F66A 1T3UA 4YS3A 3AZEB 5JA4B 1M19A 3B6FB 1P3KC 1KX5B 2NQBC 3MVDA 1M1AB 5AV6D 2IO5B 5BS7C 3AZLA 1P3OA 5CHLB 5AV8D 5G49B 4XZQA 3WTPE 2G5IC 5GSUB 3MGQC 3AZJB 3W96B 3MVDD 1P3GC 5AVCB 3KXBD 2NZDC 3MGSA 3AZFC 3MGSB 4DRBA 3F6TA 1HTAA 3KUYB 1M18A 2NQBD 3AV1C 1P3FC 2NQBA 3AN2B 2Y2PA 5BS7A 3REIB 3LZ0C 5DNNB 1PZRA 3AZMD 5GXQD 3X1VA 4KUDC 3MGQD 5B31A 3MNNC 4J8WD 4G91B 3B6GC 1BH8B 5CPKB 5AVBB 3AZLD 2UWXA 1P3OD 3WKJC 3AV2B 5B24B 1N1JB 3LZ0A 3AZKD 4WV4B 2JCHA 3WAAC 2BYMA 3FDDA 4CAYB 3VH5W 5B31D 5AVBD 3AZMB 1P3LA 2CV5B 3O62D 3MGRA 3C1BC 3IP4C 4QLCA 5JRGC 3X1UC 1P3PD 5AV5C 3R45B 4HGAB 5GSUD 4WNNA 5B1MC 3WTPC 3WA9D 3AYWD 5B1MD 3KXBB 5B1LB 3O62C 4H9NA 4ZUXC 2ZY5A 4EO5C 4J8UA 4H9RB 1P3BD 5AV9C 4G92C 3W96D 1TZYD 5GXQC 4KUDD 3W97C 3AZKC 1BH8A 4H9SA 3X1SB 3V9RA 3EPLA 4XUJB 4WU9C 4LD9A 2PYOC 1KX4A 2VQRA 3X1TB 1ID3C 1ZLAC 3W99B 5AY8D 5JRGD 4Z2MG 3WAAB 2J8PA 4X23D 1B6WA 3VH6T 5AV6C 4AWLB 3LELC 5G49A 1KX3B 2Y2LA 5BT1D 1R4VA 1HQ3D 4KUDB 1Q9CA 3AV2A 2JSSA 1F66C 4YS3B 4KGCD 2FJ7D 1P3KB 1P3PA 4DRAA 2RVQC 2G5HC 2LY8A 4J8VC 4JJNB 3AV1D 3UT9A 1P3FD 3AZNB 4E44A 5B24C 5DNNA 4M6BA 5BNVB 1P3MC 5BO0A 3MNND 3LZ1A 3MGQA 3B0BA 5AVCC 3WAAA 2NZDA 1F1EA 2PYOD 4XUJC 5CPJB 1BH9B 2HIOD 1P3BB 5GT0D 3AV2D 5BT1C 4H9QB 3UT9C 5B32D 2F8NG 4WU8A 5DNNC 2NZDD 2Y2IA 3MVDC 1P3GD 2Y2OA 3MNNA 4J8XD 3WTPB 3UTAA 3AL0C 1WWSA 1Z2CB 3AYWC 5B1MA 1F66B 4G92B 5B33D 5CPIB 5DNMA 3REHC 4ZUXA 4J8UC 2AROD 4JJNC 5AV9A 1KX4D 4YS3D 3W98A 3R45A 3C1CC 5GT0A 1P3IC 2HIOA 5B2IB 5CPKA 3MGSD 1HQ3B 1P3LC 1P3LD 3MGPB 5B33C 3P5JB 4KHAA 3MGRC 4UPKA 5CPJC 1P3BA 4ZBJB 5AV8B 5CPKD 4E45A 3WA9A 1EQZD 1H3OB 2W8SA 4NE6A 3C1CA 4ZUXD 2FJ7A 5B0ZD 3AZJA 3B0DB 3X1TA 3UT9B 3AZGD 4YM6B 3RELD 4UUZA 1BFMA 3AFAD 3TU4A 3UTAB 4J8VA 4J8VB 3X1SA 2Y2QA 2YFWB 1TZYB 3AZEA 1ULYA 5GT3D 4J8UD 3EPJA 4H9RA 5B40C 4CSRA 3X1TC 1M1AD 1ID3B 1ZLAB 5B0YB 3WAAD 3B6GD 1W2EA 3AFAB 3WA9B 4QLCD 3REJB 1H3OA 3EPHA 3AZGB 5AVCA 5C3IC 3W99D 5BNVA 1HQ3C 3REKC 3UT9D 2CV5C 5CP6A 3REKD 3MGRB 3TU4D 5CPID 1TZYA 1F66D 4X23C 3KXBC 2XD5A 5AV9B 1P34C 3MGPD 3UTAC 5B1MB 5B40D 3W98C 3LJAD 5DNMB 4R8PA 3REHA 1M19C 2XD1A 3C1CB 5AV6A 3NQUB 3VH6A 4QLCC 5JRGA 3WTPA 5B0YC 4WU8B 5AV5A 3B0CT 3X1VB 1P3BC 3UTBB 3AZGC 3AV1B 1P3FB 2F2AC 3KWQD 3AN2A 4H9OB 4Z5TD 4KGCB 3H0LC 5AV5D 1M18C 3C1CD 2NZDB 2BYMB 3REJC 5DNMD 3LJAB 4LD9C 4R8PB 5B0YA 5B24A 1U35D 3B0DC 1ID3A 3REHD 1ZLAA 3W99A 1ID3D 1KX3D 3C1BD 1P3MA 5CPJD 2YFVA 1ZLAD 3LZ1C 1KX3C 3A6ND 4J8UB 5B2JD 4JJNA 2HUEB 1JFIA 1KX5C 1M1AA 3MNNB 3W98B 1EQZC 3TU4B 1S32A 3A1IA 3AZED 4YM6A 5CPIA 3AZND 2BG1A 3MGRD 2AROC 4JJND 3W96C 3AV2C 2BYKA 3A6NC 2FJ7B 3LZ1D 5CPJA 1KX3A 3AZFB 3WKJD 5AVCD 2RIQA 1U35A 5B0YD 3H0MC 3AZJD 5GSUA 3AV1A 1P3FA 3REIC 2Y2KA 2ZY3A 4KHAB 3LJAC 4LD9B 4WZSB 3MGPA 1BH9A 3UTBC 4Z5TC 1AOIA 3EPKA 3KWQC 1S32B 3AZHA 5B1LD 4KGCC 4J8WC 4CAYA 5B31C 3AZFD 1B67A 1JFIB 5AY8B 4XUJA 3O62A 2Y2GA 3X1SC 1P34A 5B32C 5B1LA 3W97A 3REIA 2CV5D 3X1TD 5B2IC 3LJAA 3UTBD 4NE5A 3W98D 5AY8A 5B2JA 4H9OA 4KGCA 1WWIA 3A6NB 2FJ7C 1EQZB 1AOIB 4Z66B 3AZIA 5AV8C 4WJ3C 2ZY2A 5B24D 1HQ3A 3AZMA 1P3LB 5B2ID 5B32G 2F8ND 1U35B 2HIOB 5B2IA 3REJA 3B0CW 4ZBJC 3AFAA 3LELA 3KWQB 4J8WB 5B31G 3EG5B 3AZIC 1KX4B 5GXQB 4NE3A 3W97B 5B33A 1M1AC 2YFWA 5F99B 5KDMA 1P3PC 3O62B 3X1UD 4J8XA 1P3KD 5B31B 4J8XB 4QLCB 2ZM5A 3REJD 2YFVB 3AZJC 3VH5A 3AZHB 4H9QA 3X1VC 4KUDA 1TZYC 3NQJA 5B32B 3AZGA 3KUYA 3B6FD 3AN2C 5F99D 1AOID 1M18B 5GSUC 3H0RC 3LELB 3MGQB 1P3ID 1U35C 5CP6D 3UTBA 5DNND 4DQYB 5B40A 1P3AC 4AWLC 3NQUA 4XZQC 3AZIB 4Z66A 1P3AD 2F8NH 2HUEC 5BNXB 5AVBA 3MVDB 4UUZB 4XUJD 1KX5A 5F99A 3AZNC 5DNMC 4LD9D 3B6GB 5CP6C 1S32D 5GT3B 5GT3A 5CPIC 1P3MB 4YS3C 1P34B 4H9NB 3REKA 3KXBA 3VH6W 5FUGA 1KX5D 3B6FC 3KFUG 4NFTA 3A1KA 4Z66C 4X23A 3X1UA 5AV8A 3UTAD 3WKJA
chains in the Genus database with same CATH topology
3AZID 5B0ZB 5B0ZA 3AZMC 1TAFA 1M19D 5E5AA 1EQZA 4R8PC 5B2JB 3KSYA 3B6FA 3LELD 1P34D 2PYOA 2DF4C 4XZQB 3X1SD 3REHB 3AZKB 3RELC 5B1LC 3TU4C 1P3KA 1P3PB 1P3AB 4R8PD 5E5AC 2PYOB 2Y2MA 5E5AD 2AROB 3W99C 4H9PA 5B33B 3MGPC 5CP6B 3W97D 2ZY4A 1P3IB 4WU9B 4J8WA 2L5AA 1P3GB 1KU5A 1P3GA 2F8NB 5BO0B 3WTPD 2F8NA 3MGSC 3WA9C 2F8NK 3AZFA 3C1BB 5B32A 3NQJB 5FUGB 3W96A 1TAFB 3AZHD 1S32C 2BYKB 4Z2MH 4WU9A 4CSRB 4YM6C 1KX4C 5AY8C 2Y2JA 5AV9D 2AROA 3AZLB 1P3OB 3B6GA 3X1UB 5GT0B 2CWEA 5AV5B 3A6NA 4Z66D 4XZQD 5F99C 2Y2NA 4Z5TB 3V9RB 1P3AA 5KDMB 4G91C 2IO5C 1M19B 4WU9D 5AVBC 4J8XC 3REID 5GT3C 5GXQA 3X1VD 3AZEC 2Y2HA 4WU8C 3AZHC 4H9SC 4WU8D 2NQBB 1A7WA 3AFAC 4Z5TA 1AOIC 3KWQA 3AN2D 5BNXA 3KUYC 5E5AB 3KUYD 3AYWA 5B40B 5B0ZC 3C1BA 2DQNC 1P3MD 2CV5A 4X23B 4H9PB 5C3IB 5B2JC 5CPKC 3AYWB 3WKJB 5JRGB 2FFFB 3LZ1B 5AV6B 5JA4A 2RVQD 4J8VD 3AZLC 1P3OC 3REKB 1N1JA 3VH5T 4HGAC 5GT0C 2HIOC 3LZ0B 1P3IA 3RELA 3AZNA 4YM6D 3RELB 4EO5B 4ZUXB 3LZ0D 3AZKA 4WNNB 2JE5A 1M18D 1F66A 1T3UA 4YS3A 3AZEB 5JA4B 1M19A 3B6FB 1P3KC 1KX5B 2NQBC 3MVDA 1M1AB 5AV6D 2IO5B 5BS7C 3AZLA 1P3OA 5CHLB 5AV8D 5G49B 4XZQA 3WTPE 2G5IC 5GSUB 3MGQC 3AZJB 3W96B 3MVDD 1P3GC 5AVCB 3KXBD 2NZDC 3MGSA 3AZFC 3MGSB 4DRBA 3F6TA 1HTAA 3KUYB 1M18A 2NQBD 3AV1C 1P3FC 2NQBA 3AN2B 2Y2PA 5BS7A 3REIB 3LZ0C 5DNNB 1PZRA 3AZMD 5GXQD 3X1VA 4KUDC 3MGQD 5B31A 3MNNC 4J8WD 4G91B 3B6GC 1BH8B 5CPKB 5AVBB 3AZLD 2UWXA 1P3OD 3WKJC 3AV2B 5B24B 1N1JB 3LZ0A 3AZKD 4WV4B 2JCHA 3WAAC 2BYMA 3FDDA 4CAYB 3VH5W 5B31D 5AVBD 3AZMB 1P3LA 2CV5B 3O62D 3MGRA 3C1BC 3IP4C 4QLCA 5JRGC 3X1UC 1P3PD 5AV5C 3R45B 4HGAB 5GSUD 4WNNA 5B1MC 3WTPC 3WA9D 3AYWD 5B1MD 3KXBB 5B1LB 3O62C 4H9NA 4ZUXC 2ZY5A 4EO5C 4J8UA 4H9RB 1P3BD 5AV9C 4G92C 3W96D 1TZYD 5GXQC 4KUDD 3W97C 3AZKC 1BH8A 4H9SA 3X1SB 3V9RA 3EPLA 4XUJB 4WU9C 4LD9A 2PYOC 1KX4A 2VQRA 3X1TB 1ID3C 1ZLAC 3W99B 5AY8D 5JRGD 4Z2MG 3WAAB 2J8PA 4X23D 1B6WA 3VH6T 5AV6C 4AWLB 3LELC 5G49A 1KX3B 2Y2LA 5BT1D 1R4VA 1HQ3D 4KUDB 1Q9CA 3AV2A 2JSSA 1F66C 4YS3B 4KGCD 2FJ7D 1P3KB 1P3PA 4DRAA 2RVQC 2G5HC 2LY8A 4J8VC 4JJNB 3AV1D 3UT9A 1P3FD 3AZNB 4E44A 5B24C 5DNNA 4M6BA 5BNVB 1P3MC 5BO0A 3MNND 3LZ1A 3MGQA 3B0BA 5AVCC 3WAAA 2NZDA 1F1EA 2PYOD 4XUJC 5CPJB 1BH9B 2HIOD 1P3BB 5GT0D 3AV2D 5BT1C 4H9QB 3UT9C 5B32D 2F8NG 4WU8A 5DNNC 2NZDD 2Y2IA 3MVDC 1P3GD 2Y2OA 3MNNA 4J8XD 3WTPB 3UTAA 3AL0C 1WWSA 1Z2CB 3AYWC 5B1MA 1F66B 4G92B 5B33D 5CPIB 5DNMA 3REHC 4ZUXA 4J8UC 2AROD 4JJNC 5AV9A 1KX4D 4YS3D 3W98A 3R45A 3C1CC 5GT0A 1P3IC 2HIOA 5B2IB 5CPKA 3MGSD 1HQ3B 1P3LC 1P3LD 3MGPB 5B33C 3P5JB 4KHAA 3MGRC 4UPKA 5CPJC 1P3BA 4ZBJB 5AV8B 5CPKD 4E45A 3WA9A 1EQZD 1H3OB 2W8SA 4NE6A 3C1CA 4ZUXD 2FJ7A 5B0ZD 3AZJA 3B0DB 3X1TA 3UT9B 3AZGD 4YM6B 3RELD 4UUZA 1BFMA 3AFAD 3TU4A 3UTAB 4J8VA 4J8VB 3X1SA 2Y2QA 2YFWB 1TZYB 3AZEA 1ULYA 5GT3D 4J8UD 3EPJA 4H9RA 5B40C 4CSRA 3X1TC 1M1AD 1ID3B 1ZLAB 5B0YB 3WAAD 3B6GD 1W2EA 3AFAB 3WA9B 4QLCD 3REJB 1H3OA 3EPHA 3AZGB 5AVCA 5C3IC 3W99D 5BNVA 1HQ3C 3REKC 3UT9D 2CV5C 5CP6A 3REKD 3MGRB 3TU4D 5CPID 1TZYA 1F66D 4X23C 3KXBC 2XD5A 5AV9B 1P34C 3MGPD 3UTAC 5B1MB 5B40D 3W98C 3LJAD 5DNMB 4R8PA 3REHA 1M19C 2XD1A 3C1CB 5AV6A 3NQUB 3VH6A 4QLCC 5JRGA 3WTPA 5B0YC 4WU8B 5AV5A 3B0CT 3X1VB 1P3BC 3UTBB 3AZGC 3AV1B 1P3FB 2F2AC 3KWQD 3AN2A 4H9OB 4Z5TD 4KGCB 3H0LC 5AV5D 1M18C 3C1CD 2NZDB 2BYMB 3REJC 5DNMD 3LJAB 4LD9C 4R8PB 5B0YA 5B24A 1U35D 3B0DC 1ID3A 3REHD 1ZLAA 3W99A 1ID3D 1KX3D 3C1BD 1P3MA 5CPJD 2YFVA 1ZLAD 3LZ1C 1KX3C 3A6ND 4J8UB 5B2JD 4JJNA 2HUEB 1JFIA 1KX5C 1M1AA 3MNNB 3W98B 1EQZC 3TU4B 1S32A 3A1IA 3AZED 4YM6A 5CPIA 3AZND 2BG1A 3MGRD 2AROC 4JJND 3W96C 3AV2C 2BYKA 3A6NC 2FJ7B 3LZ1D 5CPJA 1KX3A 3AZFB 3WKJD 5AVCD 2RIQA 1U35A 5B0YD 3H0MC 3AZJD 5GSUA 3AV1A 1P3FA 3REIC 2Y2KA 2ZY3A 4KHAB 3LJAC 4LD9B 4WZSB 3MGPA 1BH9A 3UTBC 4Z5TC 1AOIA 3EPKA 3KWQC 1S32B 3AZHA 5B1LD 4KGCC 4J8WC 4CAYA 5B31C 3AZFD 1B67A 1JFIB 5AY8B 4XUJA 3O62A 2Y2GA 3X1SC 1P34A 5B32C 5B1LA 3W97A 3REIA 2CV5D 3X1TD 5B2IC 3LJAA 3UTBD 4NE5A 3W98D 5AY8A 5B2JA 4H9OA 4KGCA 1WWIA 3A6NB 2FJ7C 1EQZB 1AOIB 4Z66B 3AZIA 5AV8C 4WJ3C 2ZY2A 5B24D 1HQ3A 3AZMA 1P3LB 5B2ID 5B32G 2F8ND 1U35B 2HIOB 5B2IA 3REJA 3B0CW 4ZBJC 3AFAA 3LELA 3KWQB 4J8WB 5B31G 3EG5B 3AZIC 1KX4B 5GXQB 4NE3A 3W97B 5B33A 1M1AC 2YFWA 5F99B 5KDMA 1P3PC 3O62B 3X1UD 4J8XA 1P3KD 5B31B 4J8XB 4QLCB 2ZM5A 3REJD 2YFVB 3AZJC 3VH5A 3AZHB 4H9QA 3X1VC 4KUDA 1TZYC 3NQJA 5B32B 3AZGA 3KUYA 3B6FD 3AN2C 5F99D 1AOID 1M18B 5GSUC 3H0RC 3LELB 3MGQB 1P3ID 1U35C 5CP6D 3UTBA 5DNND 4DQYB 5B40A 1P3AC 4AWLC 3NQUA 4XZQC 3AZIB 4Z66A 1P3AD 2F8NH 2HUEC 5BNXB 5AVBA 3MVDB 4UUZB 4XUJD 1KX5A 5F99A 3AZNC 5DNMC 4LD9D 3B6GB 5CP6C 1S32D 5GT3B 5GT3A 5CPIC 1P3MB 4YS3C 1P34B 4H9NB 3REKA 3KXBA 3VH6W 5FUGA 1KX5D 3B6FC 3KFUG 4NFTA 3A1KA 4Z66C 4X23A 3X1UA 5AV8A 3UTAD 3WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI D;  5B0Z B;  5B0Z A;  3AZM C;  1TAF A;  1M19 D;  5E5A A;  1EQZ A;  4R8P C;  5B2J B;  3KSY A;  3B6F A;  3LEL D;  1P34 D;  2PYO A;  4XZQ B;  3X1S D;  3REH B;  3AZK B;  3REL C;  5B1L C;  3TU4 C;  1P3K A;  1P3P B;  1P3A B;  4R8P D;  5E5A C;  2PYO B;  5E5A D;  2ARO B;  3W99 C;  4H9P A;  5B33 B;  3MGP C;  5CP6 B;  3W97 D;  1P3I B;  4WU9 B;  4J8W A;  2L5A A;  1P3G B;  1KU5 A;  1P3G A;  2F8N B;  5BO0 B;  3WTP D;  2F8N A;  3MGS C;  3WA9 C;  2F8N K;  3AZF A;  3C1B B;  5B32 A;  3NQJ B;  5FUG B;  3W96 A;  1TAF B;  3AZH D;  1S32 C;  2BYK B;  4Z2M H;  4WU9 A;  4CSR B;  4YM6 C;  1KX4 C;  5AY8 C;  5AV9 D;  2ARO A;  3AZL B;  1P3O B;  3B6G A;  3X1U B;  5GT0 B;  2CWE A;  5AV5 B;  3A6N A;  4Z66 D;  4XZQ D;  5F99 C;  3V9R B;  4Z5T B;  1P3A A;  5KDM B;  4G91 C;  2IO5 C;  1M19 B;  4WU9 D;  5AVB C;  4J8X C;  3REI D;  5GT3 C;  5GXQ A;  3X1V D;  3AZE C;  4WU8 C;  3AZH C;  4H9S C;  4WU8 D;  2NQB B;  1A7W A;  3AFA C;  4Z5T A;  1AOI C;  3KWQ A;  3AN2 D;  5BNX A;  3KUY C;  5E5A B;  3KUY D;  3AYW A;  5B40 B;  5B0Z C;  3C1B A;  1P3M D;  2CV5 A;  4X23 B;  4H9P B;  5C3I B;  5B2J C;  5CPK C;  3AYW B;  3WKJ B;  5JRG B;  3LZ1 B;  5AV6 B;  5JA4 A;  2RVQ D;  4J8V D;  3AZL C;  1P3O C;  3REK B;  1N1J A;  3VH5 T;  4HGA C;  5GT0 C;  2HIO C;  3LZ0 B;  1P3I A;  3REL A;  3AZN A;  4YM6 D;  3REL B;  4EO5 B;  4ZUX B;  3LZ0 D;  3AZK A;  4WNN B;  1M18 D;  1F66 A;  4YS3 A;  3AZE B;  5JA4 B;  1M19 A;  3B6F B;  1P3K C;  1KX5 B;  2NQB C;  3MVD A;  1M1A B;  5AV6 D;  2IO5 B;  5BS7 C;  3AZL A;  1P3O A;  5CHL B;  5AV8 D;  5G49 B;  4XZQ A;  3WTP E;  3AZJ B;  5GSU B;  3MGQ C;  3W96 B;  3MVD D;  1P3G C;  5AVC B;  3KXB D;  2NZD C;  3MGS A;  3AZF C;  3MGS B;  4DRB A;  3KUY B;  1HTA A;  1M18 A;  2NQB D;  3AV1 C;  1P3F C;  2NQB A;  3AN2 B;  5BS7 A;  3REI B;  3LZ0 C;  5DNN B;  3AZM D;  5GXQ D;  3X1V A;  4KUD C;  3MGQ D;  5B31 A;  3MNN C;  4J8W D;  4G91 B;  3B6G C;  1BH8 B;  5CPK B;  5AVB B;  3AZL D;  1P3O D;  3WKJ C;  3AV2 B;  5B24 B;  1N1J B;  3LZ0 A;  3AZK D;  4WV4 B;  3WAA C;  2BYM A;  4CAY B;  3VH5 W;  5B31 D;  5AVB D;  3AZM B;  1P3L A;  2CV5 B;  3O62 D;  3MGR A;  3C1B C;  4QLC A;  5JRG C;  3X1U C;  1P3P D;  5AV5 C;  3R45 B;  4HGA B;  5GSU D;  4WNN A;  5B1M C;  3WTP C;  3WA9 D;  3AYW D;  5B1M D;  3KXB B;  5B1L B;  3O62 C;  4H9N A;  4EO5 C;  4ZUX C;  4J8U A;  4H9R B;  1P3B D;  5AV9 C;  4G92 C;  3W96 D;  1TZY D;  5GXQ C;  4KUD D;  3W97 C;  3AZK C;  1BH8 A;  4H9S A;  3X1S B;  3V9R A;  4XUJ B;  4WU9 C;  4LD9 A;  2PYO C;  1KX4 A;  3X1T B;  1ID3 C;  1ZLA C;  3W99 B;  5AY8 D;  5JRG D;  4Z2M G;  3WAA B;  4X23 D;  1B6W A;  3VH6 T;  5AV6 C;  4AWL B;  3LEL C;  5G49 A;  1KX3 B;  5BT1 D;  1R4V A;  1HQ3 D;  4KUD B;  1Q9C A;  3AV2 A;  2JSS A;  1F66 C;  4YS3 B;  4KGC D;  2FJ7 D;  1P3K B;  1P3P A;  4DRA A;  2RVQ C;  2LY8 A;  4J8V C;  3AV1 D;  4JJN B;  1P3F D;  3UT9 A;  3AZN B;  4E44 A;  5B24 C;  5DNN A;  4M6B A;  5BNV B;  1P3M C;  5BO0 A;  3MNN D;  3LZ1 A;  3MGQ A;  3B0B A;  5AVC C;  3WAA A;  2NZD A;  1F1E A;  2PYO D;  4XUJ C;  5CPJ B;  1BH9 B;  2HIO D;  1P3B B;  5GT0 D;  3AV2 D;  5BT1 C;  4H9Q B;  3UT9 C;  5B32 D;  2F8N G;  4WU8 A;  5DNN C;  2NZD D;  3MVD C;  1P3G D;  3MNN A;  4J8X D;  3WTP B;  3UTA A;  1WWS A;  3AYW C;  5B1M A;  1F66 B;  4G92 B;  5B33 D;  5CPI B;  5DNM A;  3REH C;  4ZUX A;  4J8U C;  2ARO D;  4JJN C;  5AV9 A;  1KX4 D;  4YS3 D;  3W98 A;  3R45 A;  3C1C C;  5GT0 A;  1P3I C;  2HIO A;  5B2I B;  5CPK A;  3MGS D;  1HQ3 B;  1P3L C;  1P3L D;  3MGP B;  5B33 C;  4KHA A;  3MGR C;  5CPJ C;  1P3B A;  4ZBJ B;  5AV8 B;  5CPK D;  4E45 A;  3WA9 A;  1EQZ D;  1H3O B;  4NE6 A;  3C1C A;  4ZUX D;  2FJ7 A;  5B0Z D;  3AZJ A;  3B0D B;  3X1T A;  3UT9 B;  3AZG D;  4YM6 B;  3REL D;  4UUZ A;  1BFM A;  3AFA D;  3TU4 A;  3UTA B;  4J8V A;  4J8V B;  3X1S A;  2YFW B;  1TZY B;  3AZE A;  1ULY A;  5GT3 D;  4J8U D;  4H9R A;  5B40 C;  4CSR A;  3X1T C;  1M1A D;  1ID3 B;  1ZLA B;  5B0Y B;  3WAA D;  3B6G D;  3AFA B;  3WA9 B;  4QLC D;  3REJ B;  1H3O A;  3AZG B;  5AVC A;  5C3I C;  3W99 D;  5BNV A;  1HQ3 C;  3REK C;  3UT9 D;  2CV5 C;  5CP6 A;  3REK D;  3MGR B;  3TU4 D;  5CPI D;  1TZY A;  1F66 D;  4X23 C;  3KXB C;  5AV9 B;  1P34 C;  3MGP D;  3UTA C;  5B1M B;  5B40 D;  3W98 C;  3LJA D;  5DNM B;  4R8P A;  3REH A;  1M19 C;  3C1C B;  5AV6 A;  3NQU B;  3WTP A;  3VH6 A;  4QLC C;  5JRG A;  5B0Y C;  4WU8 B;  5AV5 A;  3B0C T;  3X1V B;  1P3B C;  3UTB B;  3AZG C;  3AV1 B;  1P3F B;  3KWQ D;  3AN2 A;  4H9O B;  4Z5T D;  4KGC B;  5AV5 D;  1M18 C;  3C1C D;  2NZD B;  2BYM B;  3REJ C;  5DNM D;  3LJA B;  4LD9 C;  4R8P B;  5B0Y A;  5B24 A;  1U35 D;  3B0D C;  1ID3 A;  3REH D;  1ZLA A;  3W99 A;  1ID3 D;  1KX3 D;  3C1B D;  1P3M A;  5CPJ D;  2YFV A;  1ZLA D;  3LZ1 C;  1KX3 C;  3A6N D;  4J8U B;  5B2J D;  4JJN A;  2HUE B;  1JFI A;  1KX5 C;  1M1A A;  3MNN B;  3W98 B;  1EQZ C;  3TU4 B;  1S32 A;  3AZE D;  4YM6 A;  5CPI A;  3AZN D;  3MGR D;  2ARO C;  4JJN D;  3W96 C;  3AV2 C;  2BYK A;  3A6N C;  2FJ7 B;  3LZ1 D;  5CPJ A;  1KX3 A;  3AZF B;  3WKJ D;  5AVC D;  1U35 A;  5B0Y D;  3AZJ D;  5GSU A;  3AV1 A;  1P3F A;  3REI C;  4KHA B;  3LJA C;  4LD9 B;  4WZS B;  3MGP A;  1BH9 A;  3UTB C;  4Z5T C;  1AOI A;  3KWQ C;  1S32 B;  3AZH A;  5B1L D;  4KGC C;  4J8W C;  4CAY A;  5B31 C;  3AZF D;  1B67 A;  1JFI B;  5AY8 B;  4XUJ A;  3O62 A;  3X1S C;  1P34 A;  5B32 C;  5B1L A;  3W97 A;  3REI A;  2CV5 D;  3X1T D;  5B2I C;  3LJA A;  3UTB D;  4NE5 A;  3W98 D;  5AY8 A;  5B2J A;  4H9O A;  4KGC A;  1WWI A;  3A6N B;  2FJ7 C;  1EQZ B;  1AOI B;  4Z66 B;  3AZI A;  5AV8 C;  5B24 D;  1HQ3 A;  3AZM A;  1P3L B;  5B2I D;  5B32 G;  2F8N D;  1U35 B;  2HIO B;  5B2I A;  3REJ A;  3B0C W;  4ZBJ C;  3AFA A;  3LEL A;  3KWQ B;  4J8W B;  5B31 G;  1KX4 B;  3AZI C;  5GXQ B;  4NE3 A;  3W97 B;  5B33 A;  1M1A C;  2YFW A;  5F99 B;  5KDM A;  1P3P C;  3O62 B;  3X1U D;  4J8X A;  1P3K D;  5B31 B;  4J8X B;  4QLC B;  3REJ D;  2YFV B;  3AZJ C;  3VH5 A;  3AZH B;  4H9Q A;  3X1V C;  4KUD A;  1TZY C;  3NQJ A;  5B32 B;  3AZG A;  3KUY A;  3B6F D;  3AN2 C;  5F99 D;  1AOI D;  1M18 B;  5GSU C;  3MGQ B;  3LEL B;  1P3I D;  1U35 C;  5CP6 D;  3UTB A;  5DNN D;  5B40 A;  1P3A C;  4AWL C;  3NQU A;  4XZQ C;  3AZI B;  4Z66 A;  1P3A D;  2F8N H;  2HUE C;  5BNX B;  5AVB A;  3MVD B;  4UUZ B;  4XUJ D;  1KX5 A;  5F99 A;  3AZN C;  5DNM C;  4LD9 D;  3B6G B;  5CP6 C;  1S32 D;  5GT3 B;  5GT3 A;  5CPI C;  1P3M B;  4YS3 C;  1P34 B;  4H9N B;  3REK A;  3KXB A;  3VH6 W;  5FUG A;  1KX5 D;  3B6F C;  4NFT A;  4X23 A;  4Z66 C;  3X1U A;  5AV8 A;  3UTA D;  3WKJ A; 
#chains in the Genus database with same CATH topology
 3AZI D;  5B0Z B;  5B0Z A;  3AZM C;  1TAF A;  1M19 D;  5E5A A;  1EQZ A;  4R8P C;  5B2J B;  3KSY A;  3B6F A;  3LEL D;  1P34 D;  2PYO A;  2DF4 C;  4XZQ B;  3X1S D;  3REH B;  3AZK B;  3REL C;  5B1L C;  3TU4 C;  1P3K A;  1P3P B;  1P3A B;  4R8P D;  5E5A C;  2PYO B;  2Y2M A;  5E5A D;  2ARO B;  3W99 C;  4H9P A;  5B33 B;  3MGP C;  5CP6 B;  3W97 D;  2ZY4 A;  1P3I B;  4WU9 B;  4J8W A;  2L5A A;  1P3G B;  1KU5 A;  1P3G A;  2F8N B;  5BO0 B;  3WTP D;  2F8N A;  3MGS C;  3WA9 C;  2F8N K;  3AZF A;  3C1B B;  5B32 A;  3NQJ B;  5FUG B;  3W96 A;  1TAF B;  3AZH D;  1S32 C;  2BYK B;  4Z2M H;  4WU9 A;  4CSR B;  4YM6 C;  1KX4 C;  5AY8 C;  2Y2J A;  5AV9 D;  2ARO A;  3AZL B;  1P3O B;  3B6G A;  3X1U B;  5GT0 B;  2CWE A;  5AV5 B;  3A6N A;  4Z66 D;  4XZQ D;  5F99 C;  2Y2N A;  4Z5T B;  3V9R B;  1P3A A;  5KDM B;  4G91 C;  2IO5 C;  1M19 B;  4WU9 D;  5AVB C;  4J8X C;  3REI D;  5GT3 C;  5GXQ A;  3X1V D;  3AZE C;  2Y2H A;  4WU8 C;  3AZH C;  4H9S C;  4WU8 D;  2NQB B;  1A7W A;  3AFA C;  4Z5T A;  1AOI C;  3KWQ A;  3AN2 D;  5BNX A;  3KUY C;  5E5A B;  3KUY D;  3AYW A;  5B40 B;  5B0Z C;  3C1B A;  2DQN C;  1P3M D;  2CV5 A;  4X23 B;  4H9P B;  5C3I B;  5B2J C;  5CPK C;  3AYW B;  3WKJ B;  5JRG B;  2FFF B;  3LZ1 B;  5AV6 B;  5JA4 A;  2RVQ D;  4J8V D;  3AZL C;  1P3O C;  3REK B;  1N1J A;  3VH5 T;  4HGA C;  5GT0 C;  2HIO C;  3LZ0 B;  1P3I A;  3REL A;  3AZN A;  4YM6 D;  3REL B;  4EO5 B;  4ZUX B;  3LZ0 D;  3AZK A;  4WNN B;  2JE5 A;  1M18 D;  1F66 A;  1T3U A;  4YS3 A;  3AZE B;  5JA4 B;  1M19 A;  3B6F B;  1P3K C;  1KX5 B;  2NQB C;  3MVD A;  1M1A B;  5AV6 D;  2IO5 B;  5BS7 C;  3AZL A;  1P3O A;  5CHL B;  5AV8 D;  5G49 B;  4XZQ A;  3WTP E;  2G5I C;  5GSU B;  3MGQ C;  3AZJ B;  3W96 B;  3MVD D;  1P3G C;  5AVC B;  3KXB D;  2NZD C;  3MGS A;  3AZF C;  3MGS B;  4DRB A;  3F6T A;  1HTA A;  3KUY B;  1M18 A;  2NQB D;  3AV1 C;  1P3F C;  2NQB A;  3AN2 B;  2Y2P A;  5BS7 A;  3REI B;  3LZ0 C;  5DNN B;  1PZR A;  3AZM D;  5GXQ D;  3X1V A;  4KUD C;  3MGQ D;  5B31 A;  3MNN C;  4J8W D;  4G91 B;  3B6G C;  1BH8 B;  5CPK B;  5AVB B;  3AZL D;  2UWX A;  1P3O D;  3WKJ C;  3AV2 B;  5B24 B;  1N1J B;  3LZ0 A;  3AZK D;  4WV4 B;  2JCH A;  3WAA C;  2BYM A;  3FDD A;  4CAY B;  3VH5 W;  5B31 D;  5AVB D;  3AZM B;  1P3L A;  2CV5 B;  3O62 D;  3MGR A;  3C1B C;  3IP4 C;  4QLC A;  5JRG C;  3X1U C;  1P3P D;  5AV5 C;  3R45 B;  4HGA B;  5GSU D;  4WNN A;  5B1M C;  3WTP C;  3WA9 D;  3AYW D;  5B1M D;  3KXB B;  5B1L B;  3O62 C;  4H9N A;  4ZUX C;  2ZY5 A;  4EO5 C;  4J8U A;  4H9R B;  1P3B D;  5AV9 C;  4G92 C;  3W96 D;  1TZY D;  5GXQ C;  4KUD D;  3W97 C;  3AZK C;  1BH8 A;  4H9S A;  3X1S B;  3V9R A;  3EPL A;  4XUJ B;  4WU9 C;  4LD9 A;  2PYO C;  1KX4 A;  2VQR A;  3X1T B;  1ID3 C;  1ZLA C;  3W99 B;  5AY8 D;  5JRG D;  4Z2M G;  3WAA B;  2J8P A;  4X23 D;  1B6W A;  3VH6 T;  5AV6 C;  4AWL B;  3LEL C;  5G49 A;  1KX3 B;  2Y2L A;  5BT1 D;  1R4V A;  1HQ3 D;  4KUD B;  1Q9C A;  3AV2 A;  2JSS A;  1F66 C;  4YS3 B;  4KGC D;  2FJ7 D;  1P3K B;  1P3P A;  4DRA A;  2RVQ C;  2G5H C;  2LY8 A;  4J8V C;  4JJN B;  3AV1 D;  3UT9 A;  1P3F D;  3AZN B;  4E44 A;  5B24 C;  5DNN A;  4M6B A;  5BNV B;  1P3M C;  5BO0 A;  3MNN D;  3LZ1 A;  3MGQ A;  3B0B A;  5AVC C;  3WAA A;  2NZD A;  1F1E A;  2PYO D;  4XUJ C;  5CPJ B;  1BH9 B;  2HIO D;  1P3B B;  5GT0 D;  3AV2 D;  5BT1 C;  4H9Q B;  3UT9 C;  5B32 D;  2F8N G;  4WU8 A;  5DNN C;  2NZD D;  2Y2I A;  3MVD C;  1P3G D;  2Y2O A;  3MNN A;  4J8X D;  3WTP B;  3UTA A;  3AL0 C;  1WWS A;  1Z2C B;  3AYW C;  5B1M A;  1F66 B;  4G92 B;  5B33 D;  5CPI B;  5DNM A;  3REH C;  4ZUX A;  4J8U C;  2ARO D;  4JJN C;  5AV9 A;  1KX4 D;  4YS3 D;  3W98 A;  3R45 A;  3C1C C;  5GT0 A;  1P3I C;  2HIO A;  5B2I B;  5CPK A;  3MGS D;  1HQ3 B;  1P3L C;  1P3L D;  3MGP B;  5B33 C;  3P5J B;  4KHA A;  3MGR C;  4UPK A;  5CPJ C;  1P3B A;  4ZBJ B;  5AV8 B;  5CPK D;  4E45 A;  3WA9 A;  1EQZ D;  1H3O B;  2W8S A;  4NE6 A;  3C1C A;  4ZUX D;  2FJ7 A;  5B0Z D;  3AZJ A;  3B0D B;  3X1T A;  3UT9 B;  3AZG D;  4YM6 B;  3REL D;  4UUZ A;  1BFM A;  3AFA D;  3TU4 A;  3UTA B;  4J8V A;  4J8V B;  3X1S A;  2Y2Q A;  2YFW B;  1TZY B;  3AZE A;  1ULY A;  5GT3 D;  4J8U D;  3EPJ A;  4H9R A;  5B40 C;  4CSR A;  3X1T C;  1M1A D;  1ID3 B;  1ZLA B;  5B0Y B;  3WAA D;  3B6G D;  1W2E A;  3AFA B;  3WA9 B;  4QLC D;  3REJ B;  1H3O A;  3EPH A;  3AZG B;  5AVC A;  5C3I C;  3W99 D;  5BNV A;  1HQ3 C;  3REK C;  3UT9 D;  2CV5 C;  5CP6 A;  3REK D;  3MGR B;  3TU4 D;  5CPI D;  1TZY A;  1F66 D;  4X23 C;  3KXB C;  2XD5 A;  5AV9 B;  1P34 C;  3MGP D;  3UTA C;  5B1M B;  5B40 D;  3W98 C;  3LJA D;  5DNM B;  4R8P A;  3REH A;  1M19 C;  2XD1 A;  3C1C B;  5AV6 A;  3NQU B;  3VH6 A;  4QLC C;  5JRG A;  3WTP A;  5B0Y C;  4WU8 B;  5AV5 A;  3B0C T;  3X1V B;  1P3B C;  3UTB B;  3AZG C;  3AV1 B;  1P3F B;  2F2A C;  3KWQ D;  3AN2 A;  4H9O B;  4Z5T D;  4KGC B;  3H0L C;  5AV5 D;  1M18 C;  3C1C D;  2NZD B;  2BYM B;  3REJ C;  5DNM D;  3LJA B;  4LD9 C;  4R8P B;  5B0Y A;  5B24 A;  1U35 D;  3B0D C;  1ID3 A;  3REH D;  1ZLA A;  3W99 A;  1ID3 D;  1KX3 D;  3C1B D;  1P3M A;  5CPJ D;  2YFV A;  1ZLA D;  3LZ1 C;  1KX3 C;  3A6N D;  4J8U B;  5B2J D;  4JJN A;  2HUE B;  1JFI A;  1KX5 C;  1M1A A;  3MNN B;  3W98 B;  1EQZ C;  3TU4 B;  1S32 A;  3A1I A;  3AZE D;  4YM6 A;  5CPI A;  3AZN D;  2BG1 A;  3MGR D;  2ARO C;  4JJN D;  3W96 C;  3AV2 C;  2BYK A;  3A6N C;  2FJ7 B;  3LZ1 D;  5CPJ A;  1KX3 A;  3AZF B;  3WKJ D;  5AVC D;  2RIQ A;  1U35 A;  5B0Y D;  3H0M C;  3AZJ D;  5GSU A;  3AV1 A;  1P3F A;  3REI C;  2Y2K A;  2ZY3 A;  4KHA B;  3LJA C;  4LD9 B;  4WZS B;  3MGP A;  1BH9 A;  3UTB C;  4Z5T C;  1AOI A;  3EPK A;  3KWQ C;  1S32 B;  3AZH A;  5B1L D;  4KGC C;  4J8W C;  4CAY A;  5B31 C;  3AZF D;  1B67 A;  1JFI B;  5AY8 B;  4XUJ A;  3O62 A;  2Y2G A;  3X1S C;  1P34 A;  5B32 C;  5B1L A;  3W97 A;  3REI A;  2CV5 D;  3X1T D;  5B2I C;  3LJA A;  3UTB D;  4NE5 A;  3W98 D;  5AY8 A;  5B2J A;  4H9O A;  4KGC A;  1WWI A;  3A6N B;  2FJ7 C;  1EQZ B;  1AOI B;  4Z66 B;  3AZI A;  5AV8 C;  4WJ3 C;  2ZY2 A;  5B24 D;  1HQ3 A;  3AZM A;  1P3L B;  5B2I D;  5B32 G;  2F8N D;  1U35 B;  2HIO B;  5B2I A;  3REJ A;  3B0C W;  4ZBJ C;  3AFA A;  3LEL A;  3KWQ B;  4J8W B;  5B31 G;  3EG5 B;  3AZI C;  1KX4 B;  5GXQ B;  4NE3 A;  3W97 B;  5B33 A;  1M1A C;  2YFW A;  5F99 B;  5KDM A;  1P3P C;  3O62 B;  3X1U D;  4J8X A;  1P3K D;  5B31 B;  4J8X B;  4QLC B;  2ZM5 A;  3REJ D;  2YFV B;  3AZJ C;  3VH5 A;  3AZH B;  4H9Q A;  3X1V C;  4KUD A;  1TZY C;  3NQJ A;  5B32 B;  3AZG A;  3KUY A;  3B6F D;  3AN2 C;  5F99 D;  1AOI D;  1M18 B;  5GSU C;  3H0R C;  3LEL B;  3MGQ B;  1P3I D;  1U35 C;  5CP6 D;  3UTB A;  5DNN D;  4DQY B;  5B40 A;  1P3A C;  4AWL C;  3NQU A;  4XZQ C;  3AZI B;  4Z66 A;  1P3A D;  2F8N H;  2HUE C;  5BNX B;  5AVB A;  3MVD B;  4UUZ B;  4XUJ D;  1KX5 A;  5F99 A;  3AZN C;  5DNM C;  4LD9 D;  3B6G B;  5CP6 C;  1S32 D;  5GT3 B;  5GT3 A;  5CPI C;  1P3M B;  4YS3 C;  1P34 B;  4H9N B;  3REK A;  3KXB A;  3VH6 W;  5FUG A;  1KX5 D;  3B6F C;  3KFU G;  4NFT A;  3A1K A;  4Z66 C;  4X23 A;  3X1U A;  5AV8 A;  3UTA D;  3WKJ A; 
#chains in the Genus database with same CATH homology
 3AZI D;  5B0Z B;  5B0Z A;  3AZM C;  1TAF A;  1M19 D;  5E5A A;  1EQZ A;  4R8P C;  5B2J B;  3KSY A;  3B6F A;  3LEL D;  1P34 D;  2PYO A;  2DF4 C;  4XZQ B;  3X1S D;  3REH B;  3AZK B;  3REL C;  5B1L C;  3TU4 C;  1P3K A;  1P3P B;  1P3A B;  4R8P D;  5E5A C;  2PYO B;  2Y2M A;  5E5A D;  2ARO B;  3W99 C;  4H9P A;  5B33 B;  3MGP C;  5CP6 B;  3W97 D;  2ZY4 A;  1P3I B;  4WU9 B;  4J8W A;  2L5A A;  1P3G B;  1KU5 A;  1P3G A;  2F8N B;  5BO0 B;  3WTP D;  2F8N A;  3MGS C;  3WA9 C;  2F8N K;  3AZF A;  3C1B B;  5B32 A;  3NQJ B;  5FUG B;  3W96 A;  1TAF B;  3AZH D;  1S32 C;  2BYK B;  4Z2M H;  4WU9 A;  4CSR B;  4YM6 C;  1KX4 C;  5AY8 C;  2Y2J A;  5AV9 D;  2ARO A;  3AZL B;  1P3O B;  3B6G A;  3X1U B;  5GT0 B;  2CWE A;  5AV5 B;  3A6N A;  4Z66 D;  4XZQ D;  5F99 C;  2Y2N A;  4Z5T B;  3V9R B;  1P3A A;  5KDM B;  4G91 C;  2IO5 C;  1M19 B;  4WU9 D;  5AVB C;  4J8X C;  3REI D;  5GT3 C;  5GXQ A;  3X1V D;  3AZE C;  2Y2H A;  4WU8 C;  3AZH C;  4H9S C;  4WU8 D;  2NQB B;  1A7W A;  3AFA C;  4Z5T A;  1AOI C;  3KWQ A;  3AN2 D;  5BNX A;  3KUY C;  5E5A B;  3KUY D;  3AYW A;  5B40 B;  5B0Z C;  3C1B A;  2DQN C;  1P3M D;  2CV5 A;  4X23 B;  4H9P B;  5C3I B;  5B2J C;  5CPK C;  3AYW B;  3WKJ B;  5JRG B;  2FFF B;  3LZ1 B;  5AV6 B;  5JA4 A;  2RVQ D;  4J8V D;  3AZL C;  1P3O C;  3REK B;  1N1J A;  3VH5 T;  4HGA C;  5GT0 C;  2HIO C;  3LZ0 B;  1P3I A;  3REL A;  3AZN A;  4YM6 D;  3REL B;  4EO5 B;  4ZUX B;  3LZ0 D;  3AZK A;  4WNN B;  2JE5 A;  1M18 D;  1F66 A;  1T3U A;  4YS3 A;  3AZE B;  5JA4 B;  1M19 A;  3B6F B;  1P3K C;  1KX5 B;  2NQB C;  3MVD A;  1M1A B;  5AV6 D;  2IO5 B;  5BS7 C;  3AZL A;  1P3O A;  5CHL B;  5AV8 D;  5G49 B;  4XZQ A;  3WTP E;  2G5I C;  5GSU B;  3MGQ C;  3AZJ B;  3W96 B;  3MVD D;  1P3G C;  5AVC B;  3KXB D;  2NZD C;  3MGS A;  3AZF C;  3MGS B;  4DRB A;  3F6T A;  1HTA A;  3KUY B;  1M18 A;  2NQB D;  3AV1 C;  1P3F C;  2NQB A;  3AN2 B;  2Y2P A;  5BS7 A;  3REI B;  3LZ0 C;  5DNN B;  1PZR A;  3AZM D;  5GXQ D;  3X1V A;  4KUD C;  3MGQ D;  5B31 A;  3MNN C;  4J8W D;  4G91 B;  3B6G C;  1BH8 B;  5CPK B;  5AVB B;  3AZL D;  2UWX A;  1P3O D;  3WKJ C;  3AV2 B;  5B24 B;  1N1J B;  3LZ0 A;  3AZK D;  4WV4 B;  2JCH A;  3WAA C;  2BYM A;  3FDD A;  4CAY B;  3VH5 W;  5B31 D;  5AVB D;  3AZM B;  1P3L A;  2CV5 B;  3O62 D;  3MGR A;  3C1B C;  3IP4 C;  4QLC A;  5JRG C;  3X1U C;  1P3P D;  5AV5 C;  3R45 B;  4HGA B;  5GSU D;  4WNN A;  5B1M C;  3WTP C;  3WA9 D;  3AYW D;  5B1M D;  3KXB B;  5B1L B;  3O62 C;  4H9N A;  4ZUX C;  2ZY5 A;  4EO5 C;  4J8U A;  4H9R B;  1P3B D;  5AV9 C;  4G92 C;  3W96 D;  1TZY D;  5GXQ C;  4KUD D;  3W97 C;  3AZK C;  1BH8 A;  4H9S A;  3X1S B;  3V9R A;  3EPL A;  4XUJ B;  4WU9 C;  4LD9 A;  2PYO C;  1KX4 A;  2VQR A;  3X1T B;  1ID3 C;  1ZLA C;  3W99 B;  5AY8 D;  5JRG D;  4Z2M G;  3WAA B;  2J8P A;  4X23 D;  1B6W A;  3VH6 T;  5AV6 C;  4AWL B;  3LEL C;  5G49 A;  1KX3 B;  2Y2L A;  5BT1 D;  1R4V A;  1HQ3 D;  4KUD B;  1Q9C A;  3AV2 A;  2JSS A;  1F66 C;  4YS3 B;  4KGC D;  2FJ7 D;  1P3K B;  1P3P A;  4DRA A;  2RVQ C;  2G5H C;  2LY8 A;  4J8V C;  4JJN B;  3AV1 D;  3UT9 A;  1P3F D;  3AZN B;  4E44 A;  5B24 C;  5DNN A;  4M6B A;  5BNV B;  1P3M C;  5BO0 A;  3MNN D;  3LZ1 A;  3MGQ A;  3B0B A;  5AVC C;  3WAA A;  2NZD A;  1F1E A;  2PYO D;  4XUJ C;  5CPJ B;  1BH9 B;  2HIO D;  1P3B B;  5GT0 D;  3AV2 D;  5BT1 C;  4H9Q B;  3UT9 C;  5B32 D;  2F8N G;  4WU8 A;  5DNN C;  2NZD D;  2Y2I A;  3MVD C;  1P3G D;  2Y2O A;  3MNN A;  4J8X D;  3WTP B;  3UTA A;  3AL0 C;  1WWS A;  1Z2C B;  3AYW C;  5B1M A;  1F66 B;  4G92 B;  5B33 D;  5CPI B;  5DNM A;  3REH C;  4ZUX A;  4J8U C;  2ARO D;  4JJN C;  5AV9 A;  1KX4 D;  4YS3 D;  3W98 A;  3R45 A;  3C1C C;  5GT0 A;  1P3I C;  2HIO A;  5B2I B;  5CPK A;  3MGS D;  1HQ3 B;  1P3L C;  1P3L D;  3MGP B;  5B33 C;  3P5J B;  4KHA A;  3MGR C;  4UPK A;  5CPJ C;  1P3B A;  4ZBJ B;  5AV8 B;  5CPK D;  4E45 A;  3WA9 A;  1EQZ D;  1H3O B;  2W8S A;  4NE6 A;  3C1C A;  4ZUX D;  2FJ7 A;  5B0Z D;  3AZJ A;  3B0D B;  3X1T A;  3UT9 B;  3AZG D;  4YM6 B;  3REL D;  4UUZ A;  1BFM A;  3AFA D;  3TU4 A;  3UTA B;  4J8V A;  4J8V B;  3X1S A;  2Y2Q A;  2YFW B;  1TZY B;  3AZE A;  1ULY A;  5GT3 D;  4J8U D;  3EPJ A;  4H9R A;  5B40 C;  4CSR A;  3X1T C;  1M1A D;  1ID3 B;  1ZLA B;  5B0Y B;  3WAA D;  3B6G D;  1W2E A;  3AFA B;  3WA9 B;  4QLC D;  3REJ B;  1H3O A;  3EPH A;  3AZG B;  5AVC A;  5C3I C;  3W99 D;  5BNV A;  1HQ3 C;  3REK C;  3UT9 D;  2CV5 C;  5CP6 A;  3REK D;  3MGR B;  3TU4 D;  5CPI D;  1TZY A;  1F66 D;  4X23 C;  3KXB C;  2XD5 A;  5AV9 B;  1P34 C;  3MGP D;  3UTA C;  5B1M B;  5B40 D;  3W98 C;  3LJA D;  5DNM B;  4R8P A;  3REH A;  1M19 C;  2XD1 A;  3C1C B;  5AV6 A;  3NQU B;  3VH6 A;  4QLC C;  5JRG A;  3WTP A;  5B0Y C;  4WU8 B;  5AV5 A;  3B0C T;  3X1V B;  1P3B C;  3UTB B;  3AZG C;  3AV1 B;  1P3F B;  2F2A C;  3KWQ D;  3AN2 A;  4H9O B;  4Z5T D;  4KGC B;  3H0L C;  5AV5 D;  1M18 C;  3C1C D;  2NZD B;  2BYM B;  3REJ C;  5DNM D;  3LJA B;  4LD9 C;  4R8P B;  5B0Y A;  5B24 A;  1U35 D;  3B0D C;  1ID3 A;  3REH D;  1ZLA A;  3W99 A;  1ID3 D;  1KX3 D;  3C1B D;  1P3M A;  5CPJ D;  2YFV A;  1ZLA D;  3LZ1 C;  1KX3 C;  3A6N D;  4J8U B;  5B2J D;  4JJN A;  2HUE B;  1JFI A;  1KX5 C;  1M1A A;  3MNN B;  3W98 B;  1EQZ C;  3TU4 B;  1S32 A;  3A1I A;  3AZE D;  4YM6 A;  5CPI A;  3AZN D;  2BG1 A;  3MGR D;  2ARO C;  4JJN D;  3W96 C;  3AV2 C;  2BYK A;  3A6N C;  2FJ7 B;  3LZ1 D;  5CPJ A;  1KX3 A;  3AZF B;  3WKJ D;  5AVC D;  2RIQ A;  1U35 A;  5B0Y D;  3H0M C;  3AZJ D;  5GSU A;  3AV1 A;  1P3F A;  3REI C;  2Y2K A;  2ZY3 A;  4KHA B;  3LJA C;  4LD9 B;  4WZS B;  3MGP A;  1BH9 A;  3UTB C;  4Z5T C;  1AOI A;  3EPK A;  3KWQ C;  1S32 B;  3AZH A;  5B1L D;  4KGC C;  4J8W C;  4CAY A;  5B31 C;  3AZF D;  1B67 A;  1JFI B;  5AY8 B;  4XUJ A;  3O62 A;  2Y2G A;  3X1S C;  1P34 A;  5B32 C;  5B1L A;  3W97 A;  3REI A;  2CV5 D;  3X1T D;  5B2I C;  3LJA A;  3UTB D;  4NE5 A;  3W98 D;  5AY8 A;  5B2J A;  4H9O A;  4KGC A;  1WWI A;  3A6N B;  2FJ7 C;  1EQZ B;  1AOI B;  4Z66 B;  3AZI A;  5AV8 C;  4WJ3 C;  2ZY2 A;  5B24 D;  1HQ3 A;  3AZM A;  1P3L B;  5B2I D;  5B32 G;  2F8N D;  1U35 B;  2HIO B;  5B2I A;  3REJ A;  3B0C W;  4ZBJ C;  3AFA A;  3LEL A;  3KWQ B;  4J8W B;  5B31 G;  3EG5 B;  3AZI C;  1KX4 B;  5GXQ B;  4NE3 A;  3W97 B;  5B33 A;  1M1A C;  2YFW A;  5F99 B;  5KDM A;  1P3P C;  3O62 B;  3X1U D;  4J8X A;  1P3K D;  5B31 B;  4J8X B;  4QLC B;  2ZM5 A;  3REJ D;  2YFV B;  3AZJ C;  3VH5 A;  3AZH B;  4H9Q A;  3X1V C;  4KUD A;  1TZY C;  3NQJ A;  5B32 B;  3AZG A;  3KUY A;  3B6F D;  3AN2 C;  5F99 D;  1AOI D;  1M18 B;  5GSU C;  3H0R C;  3LEL B;  3MGQ B;  1P3I D;  1U35 C;  5CP6 D;  3UTB A;  5DNN D;  4DQY B;  5B40 A;  1P3A C;  4AWL C;  3NQU A;  4XZQ C;  3AZI B;  4Z66 A;  1P3A D;  2F8N H;  2HUE C;  5BNX B;  5AVB A;  3MVD B;  4UUZ B;  4XUJ D;  1KX5 A;  5F99 A;  3AZN C;  5DNM C;  4LD9 D;  3B6G B;  5CP6 C;  1S32 D;  5GT3 B;  5GT3 A;  5CPI C;  1P3M B;  4YS3 C;  1P34 B;  4H9N B;  3REK A;  3KXB A;  3VH6 W;  5FUG A;  1KX5 D;  3B6F C;  3KFU G;  4NFT A;  3A1K A;  4Z66 C;  4X23 A;  3X1U A;  5AV8 A;  3UTA D;  3WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...