5BNVB

Crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 79
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnvB00
5CPIB 3X1UB 3C1BD 3AZLD 2F8NH 3MGSB 1M18A 5GXQA 5GT0D 4ZUXC 2BYKB 3REKA 5B31C 3REJC 3B0DB 3AV1C 5JA4B 3X1VD 3VH5T 5B0YC 3UT9B 3UTAA 3NQJB 3AN2C 4UUZB 3WTPC 3MGRA 4J8VC 5B2JC 5AV9C 3AZEB 4Z66C 3TU4D 4Z5TC 4J8WB 5DNNC 3W96A 1HQ3B 3X1UA 3C1BB 1H3OA 1N1JB 3MGSA 3RELC 1P3LD 3AZLB 3MNNA 3AZJA 2HIOC 2BYKA 5DNMD 5JA4A 3REHC 3AZMD 3AYWC 3UT9A 1P3AD 3NQJA 3VH5A 5BNXB 4H9RA 3AZEA 2AROC 5GT3D 1F66C 3W98D 3X1TC 5FUGB 3TU4B 1P3BD 5B0ZD 1HQ3A 1M19D 5CPKD 3W97B 3B6FC 3C1BA 1N1JA 5AY8C 1P3LB 3UTBC 4YM6D 1P3IC 5GXQC 1AOIB 5DNMB 3WAAC 1R4VA 5AV6D 3AZMB 4WNNB 5BNXA 3REIC 1P3AB 2PYOB 3B6GD 3UTAC 5B1LD 5JRGD 5GT3B 4LD9D 3TU4A 3W98B 4XZQD 3W97A 1P3BB 1P3PD 5B0ZB 1M19B 5CPKB 4E44A 4HGAC 4YM6B 1AOIA 1S32D 3AZJC 1P3KD 1ZLAC 2CWEA 5B40A 3VH6T 3AFAC 3AZMA 5AV6B 4WNNA 3MGPC 1P3AA 4J8UA 2PYOA 4X23C 4JJND 3LJAC 5B1LB 5GSUC 4ZUXD 3W98A 5AV8D 4LD9B 4EO5B 5B31D 4Z2MH 3REJD 3AV1D 1P3PB 1M19A 4KHAB 5B0YD 1BH8B 3WTPD 3MVDD 3MGQC 3AZKA 4WU8C 5AV9D 4H9NB 1S32B 5B24D 4Z5TD 3V9RB 5DNND 1BFMA 4G91B 3KUYC 3RELD 1P3OD 2F8NK 3AZIC 2NQBC 4JJNB 2NZDB 1P3MC 1P3GD 4LD9A 5AV8B 1P3PA 4KHAA 3C1CB 5B31B 3REJB 5BO0B 3AV1B 3AYWD 3KWQC 4R8PC 4AWLC 3MVDB 2AROD 4H9NA 3AV2D 1TAFA 5AV9B 1S32A 1ID3A 3X1TD 5B24B 3V9RA 4Z5TB 5DNNB 5B40C 1U35D 4QLCD 2NZDA 5AY8D 5AVCD 4JJNA 5CP6C 3UTBD 1P3OB 3AZGA 4KGCC 1P3GB 5AV8A 1KU5A 3C1CA 4XUJD 5BO0A 5AV5D 3AYWB 1P34A 1EQZD 1TZYA 2FJ7D 5B1MC 3MVDA 2F8ND 2AROB 3AZHC 3AV2B 4KUDB 1HTAA 3AZKC 3WA9C 4M6BA 3B0CT 5E5AC 3AZFC 3X1SA 3O62C 1U35B 4QLCB 2IO5C 5B33A 5AVCB 4WU9D 5CPJD 5F99C 1KX4C 5KDMA 1ZLAD 4XUJB 3AFAD 3R45B 5AV5B 3MGPD 4YS3C 1EQZB 2HUEC 3LZ1C 5B2IC 2FJ7B 3LJAD 3AV2A 1M1AD 4KUDA 1KX5C 1KX3A 2CV5C 5C3IC 3LZ0C 5B32D 5CPIA 1U35A 4QLCA 5AVCA 3MGQD 3LELC 4WU8D 5GT0B 4ZBJC 4WU9B 5CPJB 1ULYA 3R45A 3AFAB 5AV5A 3MGPB 3X1VB 1WWSA 4H9SA 4UUZA 3KUYD 2FJ7A 1M1AB 3W99C 4J8WA 5AVBC 4J8XC 5B32B 3A6NC 3X1SC 1P3FD 3AZLA 3KWQD 4R8PD 5GT0A 4WU8B 3MGQB 5B33C 5B32G 3AZND 4WU9A 3KXBD 1M18C 3X1VA 3REKC 1M1AA 4H9QB 3MGRC 2LY8A 5FUGA 5B32A 4E45A 3W96C 5CPIC 3X1UC 1P3FB 1P3LA 4R8PB 3MGSC 3WKJD 3AZHD 3AZNB 3MNNC 3KXBB 2RVQD 5DNMA 5E5AD 3B0DC 3UT9C 4G92B 3B6GB 5GT3A 5JRGB 5F99D 1KX4D 3AZEC 1P3BA 5B0ZA 4XZQB 4J8WC 5CPKA 1HQ3C 1P3FA 3C1BC 3AN2D 5B2ID 4YM6A 4J8VD 5B2JD 3AZNA 3WKJB 3KXBA 4Z66D 1P3KB 2CV5D 5E5AB 4WV4B 5AV6A 3VH6A 3B6GA 5B1LA 5JRGA 2HIOD 3LELD 3NQUB 4ZUXB 5F99B 4XZQA 1KX4B 3TU4C 5G49B 3REHD 4H9PB 1BH8A 3W97C 5B0YB 2HUEB 5BS7A 3WTPB 5B2IB 3AN2B 5B31G 4J8VB 5B2JB 1F66D 1P3KA 5AVBD 4Z66B 1AOIC 2CV5B 5C3IB 3B6FD 3AZMC 1P3AC 3RELB 4J8UC 2PYOC 3NQUA 4ZUXA 2HIOB 3LELB 1P3ID 4CAYB 5GXQD 5G49A 5B31A 2YFWB 3REJA 3AV1A 3W98C 3REHB 3WAAD 1P3BC 3REKD 5CHLB 5B0YA 1M19C 3REID 3AN2A 3WTPA 4J8VA 3UTAD 5B2JA 5AV9A 1F66B 5B24A 4Z5TA 5AVBB 3X1TB 5DNNA 2YFVB 3B6FB 4NE3A 3W96D 3X1UD 3RELA 1P3OA 5AY8B 2HIOA 3UTBB 4CAYA 1P3GA 1P3IB 3MNND 3AZJD 2YFWA 5GXQB 4LD9C 3AYWA 3WAAB 1P3PC 3REKB 3REIB 3UT9D 4X23D 2AROA 3UTAB 5GSUD 1F66A 2F8NB 3X1TA 1S32C 1ID3C 3B6FA 2F8NG 1HQ3D 5AY8A 4HGAB 3W96B 3UTBA 2L5AA 4G91C 1H3OB 1P3IA 2NZDC 4JJNC 3MNNB 3AZJB 3AZGC 4XUJA 1ZLAB 5AV8C 3WAAA 3C1CC 3REIA 4NE5A 1EQZA 4CSRB 4X23B 3AZID 1P34C 2F8NA 2NQBD 1TZYC 3LJAB 1P3MD 5GSUB 3MVDC 4H9RB 5B24C 3W97D 3B0BA 1P3OC 5CPJA 3B0CW 3WTPE 1P3GC 1ZLAA 1AOID 4DRBA 3AFAA 1BH9B 1Q9CA 3MGPA 5B40D 1B6WA 1F1EA 4CSRA 4X23A 3KUYB 5CP6D 3LJAA 4NFTA 4J8UD 4DRAA 5GSUA 3AZIB 2PYOD 2NQBB 1P3MB 4KGCD 3AV2C 2JSSA 4KUDC 3VH5W 1KX3C 1U35C 2BYMB 5B1MD 4QLCC 4WU8A 3KWQB 3MGQA 5AVCC 4AWLB 3AZKD 3WA9D 1BH9A 3AZFD 3O62D 4XUJC 5B40B 5AV5C 3KUYA 4H9QA 3AZIA 2NQBA 5CP6B 4H9SC 4J8UB 1P3MA 1EQZC 5BT1C 2FJ7C 1JFIB 4KGCB 1B67A 2BYMA 4YS3D 3KWQA 4R8PA 3LZ1D 5B1MB 3AZLC 1KX5D 3AZHB 5GT0C 4WU9C 5CPJC 3AZKB 3WA9B 1ID3D 3LZ0D 3AZFB 3O62B 3X1VC 5CP6A 2IO5B 1JFIA 2NZDD 4KGCA 4Z2MG 1M1AC 3AZGD 3C1CD 5B32C 4YS3B 5B1MA 3LZ1B 1P34D 3WKJA 1P3LC 1TZYD 3AZHA 1KX5B 3W99D 3WA9A 4H9OB 5E5AA 4J8XD 1TAFB 3O62A 3AZFA 1ID3B 3LZ0B 5DNMC 3A6ND 3X1SD 1A7WA 4WZSB 5B33D 5F99A 3VH6W 1KX4A 4ZBJB 1M18D 5GT3C 3AZGB 4H9PA 5B0ZC 5CPKC 4YS3A 3LZ1A 5B2IA 1P3FC 1WWIA 1P34B 1KX5A 1TZYB 3MGRD 4NE6A 4YM6C 4Z66A 4H9OA 3W99B 4KUDD 5BNVB 3AZNC 2CV5A 3KXBC 3LZ0A 4J8XB 1KX3D 3A6NB 5AV6C 3X1SB 5CPID 3LELA 4G92C 3MGSD 3B6GC 5B33B 3KSYA 5B1LC 5JRGC 1M18B 3REHA 4EO5C 4XZQC 5KDMB 5BT1D 3W99A 5BS7C 5BNVA 5AVBA 3MGRB 3WKJC 3AZED 4J8XA 1P3KC 2YFVA 4J8WD 2RVQC 3A6NA 1KX3B
chains in the Genus database with same CATH superfamily
5CPIB 2Y2QA 3X1UB 3C1BD 3AZLD 2F8NH 3MGSB 1M18A 5GXQA 5GT0D 4ZUXC 2BYKB 3REKA 5B31C 3REJC 3B0DB 3AV1C 2ZY4A 5JA4B 3X1VD 3VH5T 1PZRA 5B0YC 3UT9B 3UTAA 3NQJB 3AN2C 4UUZB 3WTPC 3MGRA 4J8VC 5B2JC 5AV9C 3AZEB 4Z66C 3TU4D 4Z5TC 4J8WB 5DNNC 3W96A 1HQ3B 3X1UA 3C1BB 1H3OA 1N1JB 3MGSA 3RELC 1P3LD 3AZLB 3MNNA 3AZJA 2HIOC 3F6TA 2BYKA 5DNMD 5JA4A 3REHC 3AZMD 3AYWC 3UT9A 1P3AD 3NQJA 3VH5A 5BNXB 4H9RA 3AZEA 2AROC 5GT3D 1F66C 3W98D 3X1TC 5FUGB 3TU4B 1P3BD 5B0ZD 1HQ3A 1Z2CB 1M19D 5CPKD 3W97B 3B6FC 3C1BA 1N1JA 5AY8C 1P3LB 3UTBC 4YM6D 3KFUG 1P3IC 5GXQC 1AOIB 2ZY5A 5DNMB 3WAAC 1R4VA 5AV6D 3AZMB 4WNNB 5BNXA 3REIC 1P3AB 2PYOB 3B6GD 3UTAC 5B1LD 5JRGD 5GT3B 4LD9D 3TU4A 3W98B 4XZQD 3W97A 1P3BB 1P3PD 5B0ZB 1M19B 5CPKB 4E44A 2XD1A 4HGAC 1W2EA 4YM6B 1AOIA 1S32D 3AZJC 1P3KD 2Y2NA 1ZLAC 2CWEA 5B40A 3VH6T 3AFAC 3AZMA 5AV6B 4WNNA 3MGPC 1P3AA 4J8UA 2PYOA 4X23C 4JJND 3LJAC 5B1LB 5GSUC 4ZUXD 3W98A 5AV8D 4LD9B 4EO5B 3P5JB 5B31D 4Z2MH 3REJD 3AV1D 1P3PB 1M19A 4KHAB 5B0YD 1BH8B 3WTPD 3MVDD 3MGQC 3AZKA 4WU8C 5AV9D 4H9NB 1S32B 5B24D 4Z5TD 3V9RB 5DNND 1BFMA 4G91B 3H0LC 3KUYC 3RELD 1P3OD 2F8NK 3AZIC 2NQBC 4JJNB 2NZDB 1P3MC 1P3GD 4LD9A 2BG1A 5AV8B 1P3PA 4KHAA 3C1CB 5B31B 3REJB 5BO0B 3AV1B 3AYWD 3KWQC 4R8PC 2Y2KA 4AWLC 3MVDB 2AROD 4H9NA 3AV2D 1TAFA 5AV9B 1S32A 1ID3A 3X1TD 5B24B 3V9RA 4Z5TB 5DNNB 5B40C 1U35D 4QLCD 2NZDA 5AY8D 5AVCD 4JJNA 5CP6C 3UTBD 1P3OB 3AZGA 4KGCC 1P3GB 5AV8A 1KU5A 3C1CA 4XUJD 5BO0A 5AV5D 3AYWB 1P34A 1EQZD 1TZYA 2FJ7D 5B1MC 3MVDA 2F8ND 2AROB 3AZHC 2G5IC 3AV2B 4KUDB 1HTAA 3AZKC 3WA9C 4M6BA 3B0CT 5E5AC 3AZFC 3X1SA 3O62C 3EPKA 1U35B 4QLCB 2IO5C 5B33A 5AVCB 4WU9D 5CPJD 5F99C 1KX4C 5KDMA 2VQRA 1ZLAD 4XUJB 3AFAD 3R45B 5AV5B 3MGPD 4YS3C 1EQZB 2HUEC 3LZ1C 5B2IC 2FJ7B 3LJAD 3AV2A 1M1AD 4KUDA 1KX5C 2Y2JA 1KX3A 2CV5C 5C3IC 3LZ0C 5B32D 5CPIA 1U35A 4QLCA 5AVCA 3IP4C 3MGQD 3LELC 4WU8D 5GT0B 4ZBJC 4WU9B 1T3UA 5CPJB 1ULYA 3R45A 3AFAB 5AV5A 3MGPB 3X1VB 3EPHA 1WWSA 4H9SA 4UUZA 3KUYD 2FJ7A 1M1AB 4UPKA 3W99C 4J8WA 5AVBC 4J8XC 5B32B 3A6NC 3X1SC 1P3FD 3AZLA 2JE5A 3KWQD 4R8PD 5GT0A 4WU8B 3MGQB 5B33C 5B32G 3AZND 4WU9A 3KXBD 1M18C 3A1KA 3X1VA 3REKC 1M1AA 4H9QB 3MGRC 2LY8A 5FUGA 5B32A 4E45A 3W96C 5CPIC 3X1UC 1P3FB 1P3LA 4R8PB 3MGSC 3WKJD 3AZHD 3AZNB 3MNNC 3KXBB 2RVQD 5DNMA 5E5AD 3B0DC 3UT9C 4G92B 3B6GB 5GT3A 5JRGB 5F99D 2W8SA 3AZEC 1KX4D 2Y2MA 1P3BA 5B0ZA 4XZQB 4J8WC 5CPKA 2Y2HA 1HQ3C 1P3FA 3C1BC 3AN2D 5B2ID 4YM6A 4J8VD 5B2JD 3AZNA 3WKJB 3KXBA 4Z66D 1P3KB 2CV5D 5E5AB 4WV4B 5AV6A 3VH6A 3B6GA 5B1LA 5JRGA 2HIOD 3LELD 3NQUB 4ZUXB 5F99B 4XZQA 1KX4B 2Y2IA 3EPLA 5G49B 3REHD 3TU4C 4H9PB 1BH8A 3W97C 5B0YB 2JCHA 2HUEB 5BS7A 3WTPB 5B2IB 3AN2B 5B31G 4J8VB 5B2JB 1F66D 1P3KA 5AVBD 4Z66B 1AOIC 2CV5B 2J8PA 5C3IB 3B6FD 3AZMC 1P3AC 3RELB 4J8UC 2PYOC 3NQUA 4ZUXA 2HIOB 3LELB 1P3ID 4CAYB 5GXQD 5G49A 5B31A 2YFWB 3REJA 3AV1A 3W98C 3REHB 3WAAD 1P3BC 2FFFB 3REKD 5CHLB 5B0YA 1M19C 3REID 3AN2A 3WTPA 4J8VA 3UTAD 5B2JA 5AV9A 1F66B 5B24A 4Z5TA 5AVBB 3H0RC 3X1TB 5DNNA 2YFVB 3B6FB 4NE3A 3W96D 3X1UD 3RELA 1P3OA 5AY8B 2HIOA 3UTBB 4CAYA 1P3GA 1P3IB 2UWXA 3MNND 3AZJD 2YFWA 5GXQB 4LD9C 3AYWA 3WAAB 1P3PC 3REKB 3REIB 3UT9D 4X23D 2AROA 3UTAB 5GSUD 1F66A 2F8NB 3X1TA 2Y2OA 1S32C 1ID3C 3B6FA 2F8NG 1HQ3D 5AY8A 4HGAB 3W96B 3UTBA 2L5AA 4G91C 1H3OB 2Y2PA 1P3IA 4JJNC 2NZDC 3EG5B 3MNNB 3AZJB 3AZGC 4XUJA 1ZLAB 5AV8C 3WAAA 3C1CC 3REIA 4NE5A 1EQZA 2F2AC 4CSRB 4X23B 3AZID 1P34C 2F8NA 2NQBD 1TZYC 3LJAB 1P3MD 5GSUB 3MVDC 4H9RB 5B24C 3W97D 2XD5A 3B0BA 1P3OC 5CPJA 3B0CW 3WTPE 1P3GC 1ZLAA 1AOID 4DRBA 3AFAA 2DQNC 1BH9B 1Q9CA 3MGPA 5B40D 2RIQA 1B6WA 1F1EA 4CSRA 4X23A 3KUYB 5CP6D 3LJAA 4NFTA 4J8UD 4DRAA 5GSUA 3AZIB 2PYOD 2NQBB 1P3MB 4KGCD 3AV2C 2JSSA 4KUDC 3VH5W 1KX3C 1U35C 2BYMB 2ZY2A 5B1MD 4QLCC 4WU8A 3KWQB 2Y2LA 5AVCC 3MGQA 4AWLB 3AZKD 3EPJA 3WA9D 1BH9A 3AZFD 2ZY3A 3O62D 4XUJC 5B40B 5AV5C 3KUYA 4H9QA 3AZIA 2NQBA 5CP6B 4H9SC 4J8UB 1P3MA 1EQZC 5BT1C 2FJ7C 1JFIB 3FDDA 4KGCB 1B67A 2BYMA 4YS3D 3KWQA 4R8PA 3LZ1D 5B1MB 3AZLC 2DF4C 2Y2GA 1KX5D 3AZHB 5GT0C 2ZM5A 4WU9C 5CPJC 3AZKB 3WA9B 1ID3D 3LZ0D 3AZFB 3O62B 3X1VC 2G5HC 5CP6A 2IO5B 1JFIA 2NZDD 4KGCA 4Z2MG 1M1AC 3AZGD 3C1CD 5B32C 4YS3B 5B1MA 3LZ1B 1P34D 3AL0C 3WKJA 1P3LC 1TZYD 3AZHA 1KX5B 3W99D 3WA9A 4H9OB 5E5AA 4J8XD 1TAFB 3O62A 3AZFA 1ID3B 3LZ0B 5DNMC 3A6ND 3X1SD 1A7WA 4WJ3C 4WZSB 5B33D 5F99A 3VH6W 1KX4A 4ZBJB 1M18D 5GT3C 3AZGB 4H9PA 5B0ZC 5CPKC 4YS3A 3LZ1A 5B2IA 1P3FC 1WWIA 1P34B 1KX5A 1TZYB 3MGRD 4NE6A 4YM6C 4Z66A 4H9OA 3W99B 4KUDD 5BNVB 3AZNC 2CV5A 3KXBC 3LZ0A 4J8XB 1KX3D 3A1IA 3A6NB 5AV6C 3X1SB 5CPID 3LELA 4G92C 3MGSD 3B6GC 5B33B 3KSYA 5B1LC 5JRGC 1M18B 3REHA 4EO5C 4XZQC 5KDMB 4DQYB 5BT1D 3W99A 5BS7C 5BNVA 5AVBA 3MGRB 3WKJC 3AZED 4J8XA 1P3KC 2YFVA 4J8WD 2RVQC 3A6NA 1KX3B 3H0MC
chains in the Genus database with same CATH topology
5CPIB 2Y2QA 3X1UB 3C1BD 3AZLD 2F8NH 3MGSB 1M18A 5GXQA 5GT0D 4ZUXC 2BYKB 3REKA 5B31C 3REJC 3B0DB 3AV1C 2ZY4A 5JA4B 3X1VD 3VH5T 1PZRA 5B0YC 3UT9B 3UTAA 3NQJB 3AN2C 4UUZB 3WTPC 3MGRA 4J8VC 5B2JC 5AV9C 3AZEB 4Z66C 3TU4D 4Z5TC 4J8WB 5DNNC 3W96A 1HQ3B 3X1UA 3C1BB 1H3OA 1N1JB 3MGSA 3RELC 1P3LD 3AZLB 3MNNA 3AZJA 2HIOC 3F6TA 2BYKA 5DNMD 5JA4A 3REHC 3AZMD 3AYWC 3UT9A 1P3AD 3NQJA 3VH5A 5BNXB 4H9RA 3AZEA 2AROC 5GT3D 1F66C 3W98D 3X1TC 5FUGB 3TU4B 1P3BD 5B0ZD 1HQ3A 1Z2CB 1M19D 5CPKD 3W97B 3B6FC 3C1BA 1N1JA 5AY8C 1P3LB 3UTBC 4YM6D 3KFUG 1P3IC 5GXQC 1AOIB 2ZY5A 5DNMB 3WAAC 1R4VA 5AV6D 3AZMB 4WNNB 5BNXA 3REIC 1P3AB 2PYOB 3B6GD 3UTAC 5B1LD 5JRGD 5GT3B 4LD9D 3TU4A 3W98B 4XZQD 3W97A 1P3BB 1P3PD 5B0ZB 1M19B 5CPKB 4E44A 2XD1A 4HGAC 1W2EA 4YM6B 1AOIA 1S32D 3AZJC 1P3KD 2Y2NA 1ZLAC 2CWEA 5B40A 3VH6T 3AFAC 3AZMA 5AV6B 4WNNA 3MGPC 1P3AA 4J8UA 2PYOA 4X23C 4JJND 3LJAC 5B1LB 5GSUC 4ZUXD 3W98A 5AV8D 4LD9B 4EO5B 3P5JB 5B31D 4Z2MH 3REJD 3AV1D 1P3PB 1M19A 4KHAB 5B0YD 1BH8B 3WTPD 3MVDD 3MGQC 3AZKA 4WU8C 5AV9D 4H9NB 1S32B 5B24D 4Z5TD 3V9RB 5DNND 1BFMA 4G91B 3H0LC 3KUYC 3RELD 1P3OD 2F8NK 3AZIC 2NQBC 4JJNB 2NZDB 1P3MC 1P3GD 4LD9A 2BG1A 5AV8B 1P3PA 4KHAA 3C1CB 5B31B 3REJB 5BO0B 3AV1B 3AYWD 3KWQC 4R8PC 2Y2KA 4AWLC 3MVDB 2AROD 4H9NA 3AV2D 1TAFA 5AV9B 1S32A 1ID3A 3X1TD 5B24B 3V9RA 4Z5TB 5DNNB 5B40C 1U35D 4QLCD 2NZDA 5AY8D 5AVCD 4JJNA 5CP6C 3UTBD 1P3OB 3AZGA 4KGCC 1P3GB 5AV8A 1KU5A 3C1CA 4XUJD 5BO0A 5AV5D 3AYWB 1P34A 1EQZD 1TZYA 2FJ7D 5B1MC 3MVDA 2F8ND 2AROB 3AZHC 2G5IC 3AV2B 4KUDB 1HTAA 3AZKC 3WA9C 4M6BA 3B0CT 5E5AC 3AZFC 3X1SA 3O62C 3EPKA 1U35B 4QLCB 2IO5C 5B33A 5AVCB 4WU9D 5CPJD 5F99C 1KX4C 5KDMA 2VQRA 1ZLAD 4XUJB 3AFAD 3R45B 5AV5B 3MGPD 4YS3C 1EQZB 2HUEC 3LZ1C 5B2IC 2FJ7B 3LJAD 3AV2A 1M1AD 4KUDA 1KX5C 2Y2JA 1KX3A 2CV5C 5C3IC 3LZ0C 5B32D 5CPIA 1U35A 4QLCA 5AVCA 3IP4C 3MGQD 3LELC 4WU8D 5GT0B 4ZBJC 4WU9B 1T3UA 5CPJB 1ULYA 3R45A 3AFAB 5AV5A 3MGPB 3X1VB 3EPHA 1WWSA 4H9SA 4UUZA 3KUYD 2FJ7A 1M1AB 4UPKA 3W99C 4J8WA 5AVBC 4J8XC 5B32B 3A6NC 3X1SC 1P3FD 3AZLA 2JE5A 3KWQD 4R8PD 5GT0A 4WU8B 3MGQB 5B33C 5B32G 3AZND 4WU9A 3KXBD 1M18C 3A1KA 3X1VA 3REKC 1M1AA 4H9QB 3MGRC 2LY8A 5FUGA 5B32A 4E45A 3W96C 5CPIC 3X1UC 1P3FB 1P3LA 4R8PB 3MGSC 3WKJD 3AZHD 3AZNB 3MNNC 3KXBB 2RVQD 5DNMA 5E5AD 3B0DC 3UT9C 4G92B 3B6GB 5GT3A 5JRGB 5F99D 2W8SA 3AZEC 1KX4D 2Y2MA 1P3BA 5B0ZA 4XZQB 4J8WC 5CPKA 2Y2HA 1HQ3C 1P3FA 3C1BC 3AN2D 5B2ID 4YM6A 4J8VD 5B2JD 3AZNA 3WKJB 3KXBA 4Z66D 1P3KB 2CV5D 5E5AB 4WV4B 5AV6A 3VH6A 3B6GA 5B1LA 5JRGA 2HIOD 3LELD 3NQUB 4ZUXB 5F99B 4XZQA 1KX4B 2Y2IA 3EPLA 5G49B 3REHD 3TU4C 4H9PB 1BH8A 3W97C 5B0YB 2JCHA 2HUEB 5BS7A 3WTPB 5B2IB 3AN2B 5B31G 4J8VB 5B2JB 1F66D 1P3KA 5AVBD 4Z66B 1AOIC 2CV5B 2J8PA 5C3IB 3B6FD 3AZMC 1P3AC 3RELB 4J8UC 2PYOC 3NQUA 4ZUXA 2HIOB 3LELB 1P3ID 4CAYB 5GXQD 5G49A 5B31A 2YFWB 3REJA 3AV1A 3W98C 3REHB 3WAAD 1P3BC 2FFFB 3REKD 5CHLB 5B0YA 1M19C 3REID 3AN2A 3WTPA 4J8VA 3UTAD 5B2JA 5AV9A 1F66B 5B24A 4Z5TA 5AVBB 3H0RC 3X1TB 5DNNA 2YFVB 3B6FB 4NE3A 3W96D 3X1UD 3RELA 1P3OA 5AY8B 2HIOA 3UTBB 4CAYA 1P3GA 1P3IB 2UWXA 3MNND 3AZJD 2YFWA 5GXQB 4LD9C 3AYWA 3WAAB 1P3PC 3REKB 3REIB 3UT9D 4X23D 2AROA 3UTAB 5GSUD 1F66A 2F8NB 3X1TA 2Y2OA 1S32C 1ID3C 3B6FA 2F8NG 1HQ3D 5AY8A 4HGAB 3W96B 3UTBA 2L5AA 4G91C 1H3OB 2Y2PA 1P3IA 4JJNC 2NZDC 3EG5B 3MNNB 3AZJB 3AZGC 4XUJA 1ZLAB 5AV8C 3WAAA 3C1CC 3REIA 4NE5A 1EQZA 2F2AC 4CSRB 4X23B 3AZID 1P34C 2F8NA 2NQBD 1TZYC 3LJAB 1P3MD 5GSUB 3MVDC 4H9RB 5B24C 3W97D 2XD5A 3B0BA 1P3OC 5CPJA 3B0CW 3WTPE 1P3GC 1ZLAA 1AOID 4DRBA 3AFAA 2DQNC 1BH9B 1Q9CA 3MGPA 5B40D 2RIQA 1B6WA 1F1EA 4CSRA 4X23A 3KUYB 5CP6D 3LJAA 4NFTA 4J8UD 4DRAA 5GSUA 3AZIB 2PYOD 2NQBB 1P3MB 4KGCD 3AV2C 2JSSA 4KUDC 3VH5W 1KX3C 1U35C 2BYMB 2ZY2A 5B1MD 4QLCC 4WU8A 3KWQB 2Y2LA 5AVCC 3MGQA 4AWLB 3AZKD 3EPJA 3WA9D 1BH9A 3AZFD 2ZY3A 3O62D 4XUJC 5B40B 5AV5C 3KUYA 4H9QA 3AZIA 2NQBA 5CP6B 4H9SC 4J8UB 1P3MA 1EQZC 5BT1C 2FJ7C 1JFIB 3FDDA 4KGCB 1B67A 2BYMA 4YS3D 3KWQA 4R8PA 3LZ1D 5B1MB 3AZLC 2DF4C 2Y2GA 1KX5D 3AZHB 5GT0C 2ZM5A 4WU9C 5CPJC 3AZKB 3WA9B 1ID3D 3LZ0D 3AZFB 3O62B 3X1VC 2G5HC 5CP6A 2IO5B 1JFIA 2NZDD 4KGCA 4Z2MG 1M1AC 3AZGD 3C1CD 5B32C 4YS3B 5B1MA 3LZ1B 1P34D 3AL0C 3WKJA 1P3LC 1TZYD 3AZHA 1KX5B 3W99D 3WA9A 4H9OB 5E5AA 4J8XD 1TAFB 3O62A 3AZFA 1ID3B 3LZ0B 5DNMC 3A6ND 3X1SD 1A7WA 4WJ3C 4WZSB 5B33D 5F99A 3VH6W 1KX4A 4ZBJB 1M18D 5GT3C 3AZGB 4H9PA 5B0ZC 5CPKC 4YS3A 3LZ1A 5B2IA 1P3FC 1WWIA 1P34B 1KX5A 1TZYB 3MGRD 4NE6A 4YM6C 4Z66A 4H9OA 3W99B 4KUDD 5BNVB 3AZNC 2CV5A 3KXBC 3LZ0A 4J8XB 1KX3D 3A1IA 3A6NB 5AV6C 3X1SB 5CPID 3LELA 4G92C 3MGSD 3B6GC 5B33B 3KSYA 5B1LC 5JRGC 1M18B 3REHA 4EO5C 4XZQC 5KDMB 4DQYB 5BT1D 3W99A 5BS7C 5BNVA 5AVBA 3MGRB 3WKJC 3AZED 4J8XA 1P3KC 2YFVA 4J8WD 2RVQC 3A6NA 1KX3B 3H0MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI B;  3X1U B;  3C1B D;  3AZL D;  2F8N H;  3MGS B;  1M18 A;  5GXQ A;  5GT0 D;  4ZUX C;  2BYK B;  3REK A;  5B31 C;  3REJ C;  3B0D B;  3AV1 C;  5JA4 B;  3X1V D;  3VH5 T;  5B0Y C;  3UT9 B;  3UTA A;  3NQJ B;  3AN2 C;  4UUZ B;  3WTP C;  3MGR A;  4J8V C;  5B2J C;  5AV9 C;  3AZE B;  4Z66 C;  3TU4 D;  4Z5T C;  4J8W B;  5DNN C;  3W96 A;  1HQ3 B;  3X1U A;  3C1B B;  1H3O A;  1N1J B;  3MGS A;  3REL C;  1P3L D;  3AZL B;  3MNN A;  3AZJ A;  2HIO C;  2BYK A;  5DNM D;  5JA4 A;  3REH C;  3AZM D;  3AYW C;  3UT9 A;  1P3A D;  3NQJ A;  3VH5 A;  5BNX B;  4H9R A;  3AZE A;  2ARO C;  5GT3 D;  1F66 C;  3W98 D;  3X1T C;  5FUG B;  3TU4 B;  1P3B D;  5B0Z D;  1HQ3 A;  1M19 D;  5CPK D;  3W97 B;  3B6F C;  3C1B A;  1N1J A;  5AY8 C;  1P3L B;  3UTB C;  4YM6 D;  1P3I C;  5GXQ C;  1AOI B;  5DNM B;  3WAA C;  1R4V A;  5AV6 D;  3AZM B;  4WNN B;  5BNX A;  3REI C;  1P3A B;  2PYO B;  3B6G D;  3UTA C;  5B1L D;  5JRG D;  5GT3 B;  4LD9 D;  3TU4 A;  3W98 B;  4XZQ D;  3W97 A;  1P3B B;  1P3P D;  5B0Z B;  1M19 B;  5CPK B;  4E44 A;  4HGA C;  4YM6 B;  1AOI A;  1S32 D;  3AZJ C;  1P3K D;  1ZLA C;  2CWE A;  5B40 A;  3VH6 T;  3AFA C;  3AZM A;  5AV6 B;  4WNN A;  3MGP C;  1P3A A;  4J8U A;  2PYO A;  4X23 C;  4JJN D;  3LJA C;  5B1L B;  5GSU C;  4ZUX D;  3W98 A;  5AV8 D;  4LD9 B;  4EO5 B;  5B31 D;  4Z2M H;  3REJ D;  3AV1 D;  1P3P B;  1M19 A;  4KHA B;  5B0Y D;  1BH8 B;  3WTP D;  3MVD D;  3MGQ C;  3AZK A;  4WU8 C;  5AV9 D;  4H9N B;  1S32 B;  5B24 D;  4Z5T D;  3V9R B;  5DNN D;  1BFM A;  4G91 B;  3KUY C;  3REL D;  1P3O D;  2F8N K;  3AZI C;  2NQB C;  4JJN B;  2NZD B;  1P3M C;  1P3G D;  4LD9 A;  5AV8 B;  1P3P A;  4KHA A;  3C1C B;  5B31 B;  3REJ B;  5BO0 B;  3AV1 B;  3AYW D;  3KWQ C;  4R8P C;  4AWL C;  3MVD B;  2ARO D;  4H9N A;  3AV2 D;  1TAF A;  5AV9 B;  1S32 A;  1ID3 A;  3X1T D;  5B24 B;  3V9R A;  4Z5T B;  5DNN B;  5B40 C;  1U35 D;  4QLC D;  2NZD A;  5AY8 D;  5AVC D;  4JJN A;  5CP6 C;  3UTB D;  1P3O B;  3AZG A;  4KGC C;  1P3G B;  5AV8 A;  1KU5 A;  3C1C A;  4XUJ D;  5BO0 A;  5AV5 D;  3AYW B;  1P34 A;  1EQZ D;  1TZY A;  2FJ7 D;  5B1M C;  3MVD A;  2F8N D;  2ARO B;  3AZH C;  3AV2 B;  4KUD B;  1HTA A;  3AZK C;  3WA9 C;  4M6B A;  3B0C T;  5E5A C;  3AZF C;  3X1S A;  3O62 C;  1U35 B;  4QLC B;  2IO5 C;  5B33 A;  5AVC B;  4WU9 D;  5CPJ D;  5F99 C;  1KX4 C;  5KDM A;  1ZLA D;  4XUJ B;  3AFA D;  3R45 B;  5AV5 B;  3MGP D;  4YS3 C;  1EQZ B;  2HUE C;  3LZ1 C;  5B2I C;  2FJ7 B;  3LJA D;  3AV2 A;  1M1A D;  4KUD A;  1KX5 C;  1KX3 A;  2CV5 C;  5C3I C;  3LZ0 C;  5B32 D;  5CPI A;  1U35 A;  4QLC A;  5AVC A;  3MGQ D;  3LEL C;  4WU8 D;  5GT0 B;  4ZBJ C;  4WU9 B;  5CPJ B;  1ULY A;  3R45 A;  3AFA B;  5AV5 A;  3MGP B;  3X1V B;  1WWS A;  4H9S A;  4UUZ A;  3KUY D;  2FJ7 A;  1M1A B;  3W99 C;  4J8W A;  5AVB C;  4J8X C;  5B32 B;  3A6N C;  3X1S C;  1P3F D;  3AZL A;  3KWQ D;  4R8P D;  5GT0 A;  4WU8 B;  3MGQ B;  5B33 C;  5B32 G;  3AZN D;  4WU9 A;  3KXB D;  1M18 C;  3X1V A;  3REK C;  1M1A A;  4H9Q B;  3MGR C;  2LY8 A;  5FUG A;  5B32 A;  4E45 A;  3W96 C;  5CPI C;  3X1U C;  1P3F B;  1P3L A;  4R8P B;  3MGS C;  3WKJ D;  3AZH D;  3AZN B;  3MNN C;  3KXB B;  2RVQ D;  5DNM A;  5E5A D;  3B0D C;  3UT9 C;  4G92 B;  3B6G B;  5GT3 A;  5JRG B;  5F99 D;  1KX4 D;  3AZE C;  1P3B A;  5B0Z A;  4XZQ B;  4J8W C;  5CPK A;  1HQ3 C;  1P3F A;  3C1B C;  3AN2 D;  5B2I D;  4YM6 A;  4J8V D;  5B2J D;  3AZN A;  3WKJ B;  3KXB A;  4Z66 D;  1P3K B;  2CV5 D;  5E5A B;  4WV4 B;  5AV6 A;  3VH6 A;  3B6G A;  5B1L A;  5JRG A;  2HIO D;  3LEL D;  3NQU B;  4ZUX B;  5F99 B;  4XZQ A;  1KX4 B;  3TU4 C;  5G49 B;  3REH D;  4H9P B;  1BH8 A;  3W97 C;  5B0Y B;  2HUE B;  5BS7 A;  3WTP B;  5B2I B;  3AN2 B;  5B31 G;  4J8V B;  5B2J B;  1F66 D;  1P3K A;  5AVB D;  4Z66 B;  1AOI C;  2CV5 B;  5C3I B;  3B6F D;  3AZM C;  1P3A C;  3REL B;  4J8U C;  2PYO C;  3NQU A;  4ZUX A;  2HIO B;  3LEL B;  1P3I D;  4CAY B;  5GXQ D;  5G49 A;  5B31 A;  2YFW B;  3REJ A;  3AV1 A;  3W98 C;  3REH B;  3WAA D;  1P3B C;  3REK D;  5CHL B;  5B0Y A;  1M19 C;  3REI D;  3AN2 A;  3WTP A;  4J8V A;  3UTA D;  5B2J A;  5AV9 A;  1F66 B;  5B24 A;  4Z5T A;  5AVB B;  3X1T B;  5DNN A;  2YFV B;  3B6F B;  4NE3 A;  3W96 D;  3X1U D;  3REL A;  1P3O A;  5AY8 B;  2HIO A;  3UTB B;  4CAY A;  1P3G A;  1P3I B;  3MNN D;  3AZJ D;  2YFW A;  5GXQ B;  4LD9 C;  3AYW A;  3WAA B;  1P3P C;  3REK B;  3REI B;  3UT9 D;  4X23 D;  2ARO A;  3UTA B;  5GSU D;  1F66 A;  2F8N B;  3X1T A;  1S32 C;  1ID3 C;  3B6F A;  2F8N G;  1HQ3 D;  5AY8 A;  4HGA B;  3W96 B;  3UTB A;  2L5A A;  4G91 C;  1H3O B;  1P3I A;  2NZD C;  4JJN C;  3MNN B;  3AZJ B;  3AZG C;  4XUJ A;  1ZLA B;  5AV8 C;  3WAA A;  3C1C C;  3REI A;  4NE5 A;  1EQZ A;  4CSR B;  4X23 B;  3AZI D;  1P34 C;  2F8N A;  2NQB D;  1TZY C;  3LJA B;  1P3M D;  5GSU B;  3MVD C;  4H9R B;  5B24 C;  3W97 D;  3B0B A;  1P3O C;  5CPJ A;  3B0C W;  3WTP E;  1P3G C;  1ZLA A;  1AOI D;  4DRB A;  3AFA A;  1BH9 B;  1Q9C A;  3MGP A;  5B40 D;  1B6W A;  1F1E A;  4CSR A;  4X23 A;  3KUY B;  5CP6 D;  3LJA A;  4NFT A;  4J8U D;  4DRA A;  5GSU A;  3AZI B;  2PYO D;  2NQB B;  1P3M B;  4KGC D;  3AV2 C;  2JSS A;  4KUD C;  3VH5 W;  1KX3 C;  1U35 C;  2BYM B;  5B1M D;  4QLC C;  4WU8 A;  3KWQ B;  3MGQ A;  5AVC C;  4AWL B;  3AZK D;  3WA9 D;  1BH9 A;  3AZF D;  3O62 D;  4XUJ C;  5B40 B;  5AV5 C;  3KUY A;  4H9Q A;  3AZI A;  2NQB A;  5CP6 B;  4H9S C;  4J8U B;  1P3M A;  1EQZ C;  5BT1 C;  2FJ7 C;  1JFI B;  4KGC B;  1B67 A;  2BYM A;  4YS3 D;  3KWQ A;  4R8P A;  3LZ1 D;  5B1M B;  3AZL C;  1KX5 D;  3AZH B;  5GT0 C;  4WU9 C;  5CPJ C;  3AZK B;  3WA9 B;  1ID3 D;  3LZ0 D;  3AZF B;  3O62 B;  3X1V C;  5CP6 A;  2IO5 B;  1JFI A;  2NZD D;  4KGC A;  4Z2M G;  1M1A C;  3AZG D;  3C1C D;  5B32 C;  4YS3 B;  5B1M A;  3LZ1 B;  1P34 D;  3WKJ A;  1P3L C;  1TZY D;  3AZH A;  1KX5 B;  3W99 D;  3WA9 A;  4H9O B;  5E5A A;  4J8X D;  1TAF B;  3O62 A;  3AZF A;  1ID3 B;  3LZ0 B;  5DNM C;  3A6N D;  3X1S D;  1A7W A;  4WZS B;  5B33 D;  5F99 A;  3VH6 W;  1KX4 A;  4ZBJ B;  1M18 D;  5GT3 C;  3AZG B;  4H9P A;  5B0Z C;  5CPK C;  4YS3 A;  3LZ1 A;  5B2I A;  1P3F C;  1WWI A;  1P34 B;  1KX5 A;  1TZY B;  3MGR D;  4NE6 A;  4YM6 C;  4Z66 A;  4H9O A;  3W99 B;  4KUD D;  5BNV B;  3AZN C;  2CV5 A;  3KXB C;  3LZ0 A;  4J8X B;  1KX3 D;  3A6N B;  5AV6 C;  3X1S B;  5CPI D;  3LEL A;  4G92 C;  3MGS D;  3B6G C;  5B33 B;  3KSY A;  5B1L C;  5JRG C;  1M18 B;  3REH A;  4EO5 C;  4XZQ C;  5KDM B;  5BT1 D;  3W99 A;  5BS7 C;  5BNV A;  5AVB A;  3MGR B;  3WKJ C;  3AZE D;  4J8X A;  1P3K C;  2YFV A;  4J8W D;  2RVQ C;  3A6N A;  1KX3 B; 
#chains in the Genus database with same CATH topology
 5CPI B;  2Y2Q A;  3X1U B;  3C1B D;  3AZL D;  2F8N H;  3MGS B;  1M18 A;  5GXQ A;  5GT0 D;  4ZUX C;  2BYK B;  3REK A;  5B31 C;  3REJ C;  3B0D B;  3AV1 C;  2ZY4 A;  5JA4 B;  3X1V D;  3VH5 T;  1PZR A;  5B0Y C;  3UT9 B;  3UTA A;  3NQJ B;  3AN2 C;  4UUZ B;  3WTP C;  3MGR A;  4J8V C;  5B2J C;  5AV9 C;  3AZE B;  4Z66 C;  3TU4 D;  4Z5T C;  4J8W B;  5DNN C;  3W96 A;  1HQ3 B;  3X1U A;  3C1B B;  1H3O A;  1N1J B;  3MGS A;  3REL C;  1P3L D;  3AZL B;  3MNN A;  3AZJ A;  2HIO C;  3F6T A;  2BYK A;  5DNM D;  5JA4 A;  3REH C;  3AZM D;  3AYW C;  3UT9 A;  1P3A D;  3NQJ A;  3VH5 A;  5BNX B;  4H9R A;  3AZE A;  2ARO C;  5GT3 D;  1F66 C;  3W98 D;  3X1T C;  5FUG B;  3TU4 B;  1P3B D;  5B0Z D;  1HQ3 A;  1Z2C B;  1M19 D;  5CPK D;  3W97 B;  3B6F C;  3C1B A;  1N1J A;  5AY8 C;  1P3L B;  3UTB C;  4YM6 D;  3KFU G;  1P3I C;  5GXQ C;  1AOI B;  2ZY5 A;  5DNM B;  3WAA C;  1R4V A;  5AV6 D;  3AZM B;  4WNN B;  5BNX A;  3REI C;  1P3A B;  2PYO B;  3B6G D;  3UTA C;  5B1L D;  5JRG D;  5GT3 B;  4LD9 D;  3TU4 A;  3W98 B;  4XZQ D;  3W97 A;  1P3B B;  1P3P D;  5B0Z B;  1M19 B;  5CPK B;  4E44 A;  2XD1 A;  4HGA C;  1W2E A;  4YM6 B;  1AOI A;  1S32 D;  3AZJ C;  1P3K D;  2Y2N A;  1ZLA C;  2CWE A;  5B40 A;  3VH6 T;  3AFA C;  3AZM A;  5AV6 B;  4WNN A;  3MGP C;  1P3A A;  4J8U A;  2PYO A;  4X23 C;  4JJN D;  3LJA C;  5B1L B;  5GSU C;  4ZUX D;  3W98 A;  5AV8 D;  4LD9 B;  4EO5 B;  3P5J B;  5B31 D;  4Z2M H;  3REJ D;  3AV1 D;  1P3P B;  1M19 A;  4KHA B;  5B0Y D;  1BH8 B;  3WTP D;  3MVD D;  3MGQ C;  3AZK A;  4WU8 C;  5AV9 D;  4H9N B;  1S32 B;  5B24 D;  4Z5T D;  3V9R B;  5DNN D;  1BFM A;  4G91 B;  3H0L C;  3KUY C;  3REL D;  1P3O D;  2F8N K;  3AZI C;  2NQB C;  4JJN B;  2NZD B;  1P3M C;  1P3G D;  4LD9 A;  2BG1 A;  5AV8 B;  1P3P A;  4KHA A;  3C1C B;  5B31 B;  3REJ B;  5BO0 B;  3AV1 B;  3AYW D;  3KWQ C;  4R8P C;  2Y2K A;  4AWL C;  3MVD B;  2ARO D;  4H9N A;  3AV2 D;  1TAF A;  5AV9 B;  1S32 A;  1ID3 A;  3X1T D;  5B24 B;  3V9R A;  4Z5T B;  5DNN B;  5B40 C;  1U35 D;  4QLC D;  2NZD A;  5AY8 D;  5AVC D;  4JJN A;  5CP6 C;  3UTB D;  1P3O B;  3AZG A;  4KGC C;  1P3G B;  5AV8 A;  1KU5 A;  3C1C A;  4XUJ D;  5BO0 A;  5AV5 D;  3AYW B;  1P34 A;  1EQZ D;  1TZY A;  2FJ7 D;  5B1M C;  3MVD A;  2F8N D;  2ARO B;  3AZH C;  2G5I C;  3AV2 B;  4KUD B;  1HTA A;  3AZK C;  3WA9 C;  4M6B A;  3B0C T;  5E5A C;  3AZF C;  3X1S A;  3O62 C;  3EPK A;  1U35 B;  4QLC B;  2IO5 C;  5B33 A;  5AVC B;  4WU9 D;  5CPJ D;  5F99 C;  1KX4 C;  5KDM A;  2VQR A;  1ZLA D;  4XUJ B;  3AFA D;  3R45 B;  5AV5 B;  3MGP D;  4YS3 C;  1EQZ B;  2HUE C;  3LZ1 C;  5B2I C;  2FJ7 B;  3LJA D;  3AV2 A;  1M1A D;  4KUD A;  1KX5 C;  2Y2J A;  1KX3 A;  2CV5 C;  5C3I C;  3LZ0 C;  5B32 D;  5CPI A;  1U35 A;  4QLC A;  5AVC A;  3IP4 C;  3MGQ D;  3LEL C;  4WU8 D;  5GT0 B;  4ZBJ C;  4WU9 B;  1T3U A;  5CPJ B;  1ULY A;  3R45 A;  3AFA B;  5AV5 A;  3MGP B;  3X1V B;  3EPH A;  1WWS A;  4H9S A;  4UUZ A;  3KUY D;  2FJ7 A;  1M1A B;  4UPK A;  3W99 C;  4J8W A;  5AVB C;  4J8X C;  5B32 B;  3A6N C;  3X1S C;  1P3F D;  3AZL A;  2JE5 A;  3KWQ D;  4R8P D;  5GT0 A;  4WU8 B;  3MGQ B;  5B33 C;  5B32 G;  3AZN D;  4WU9 A;  3KXB D;  1M18 C;  3A1K A;  3X1V A;  3REK C;  1M1A A;  4H9Q B;  3MGR C;  2LY8 A;  5FUG A;  5B32 A;  4E45 A;  3W96 C;  5CPI C;  3X1U C;  1P3F B;  1P3L A;  4R8P B;  3MGS C;  3WKJ D;  3AZH D;  3AZN B;  3MNN C;  3KXB B;  2RVQ D;  5DNM A;  5E5A D;  3B0D C;  3UT9 C;  4G92 B;  3B6G B;  5GT3 A;  5JRG B;  5F99 D;  2W8S A;  3AZE C;  1KX4 D;  2Y2M A;  1P3B A;  5B0Z A;  4XZQ B;  4J8W C;  5CPK A;  2Y2H A;  1HQ3 C;  1P3F A;  3C1B C;  3AN2 D;  5B2I D;  4YM6 A;  4J8V D;  5B2J D;  3AZN A;  3WKJ B;  3KXB A;  4Z66 D;  1P3K B;  2CV5 D;  5E5A B;  4WV4 B;  5AV6 A;  3VH6 A;  3B6G A;  5B1L A;  5JRG A;  2HIO D;  3LEL D;  3NQU B;  4ZUX B;  5F99 B;  4XZQ A;  1KX4 B;  2Y2I A;  3EPL A;  5G49 B;  3REH D;  3TU4 C;  4H9P B;  1BH8 A;  3W97 C;  5B0Y B;  2JCH A;  2HUE B;  5BS7 A;  3WTP B;  5B2I B;  3AN2 B;  5B31 G;  4J8V B;  5B2J B;  1F66 D;  1P3K A;  5AVB D;  4Z66 B;  1AOI C;  2CV5 B;  2J8P A;  5C3I B;  3B6F D;  3AZM C;  1P3A C;  3REL B;  4J8U C;  2PYO C;  3NQU A;  4ZUX A;  2HIO B;  3LEL B;  1P3I D;  4CAY B;  5GXQ D;  5G49 A;  5B31 A;  2YFW B;  3REJ A;  3AV1 A;  3W98 C;  3REH B;  3WAA D;  1P3B C;  2FFF B;  3REK D;  5CHL B;  5B0Y A;  1M19 C;  3REI D;  3AN2 A;  3WTP A;  4J8V A;  3UTA D;  5B2J A;  5AV9 A;  1F66 B;  5B24 A;  4Z5T A;  5AVB B;  3H0R C;  3X1T B;  5DNN A;  2YFV B;  3B6F B;  4NE3 A;  3W96 D;  3X1U D;  3REL A;  1P3O A;  5AY8 B;  2HIO A;  3UTB B;  4CAY A;  1P3G A;  1P3I B;  2UWX A;  3MNN D;  3AZJ D;  2YFW A;  5GXQ B;  4LD9 C;  3AYW A;  3WAA B;  1P3P C;  3REK B;  3REI B;  3UT9 D;  4X23 D;  2ARO A;  3UTA B;  5GSU D;  1F66 A;  2F8N B;  3X1T A;  2Y2O A;  1S32 C;  1ID3 C;  3B6F A;  2F8N G;  1HQ3 D;  5AY8 A;  4HGA B;  3W96 B;  3UTB A;  2L5A A;  4G91 C;  1H3O B;  2Y2P A;  1P3I A;  4JJN C;  2NZD C;  3EG5 B;  3MNN B;  3AZJ B;  3AZG C;  4XUJ A;  1ZLA B;  5AV8 C;  3WAA A;  3C1C C;  3REI A;  4NE5 A;  1EQZ A;  2F2A C;  4CSR B;  4X23 B;  3AZI D;  1P34 C;  2F8N A;  2NQB D;  1TZY C;  3LJA B;  1P3M D;  5GSU B;  3MVD C;  4H9R B;  5B24 C;  3W97 D;  2XD5 A;  3B0B A;  1P3O C;  5CPJ A;  3B0C W;  3WTP E;  1P3G C;  1ZLA A;  1AOI D;  4DRB A;  3AFA A;  2DQN C;  1BH9 B;  1Q9C A;  3MGP A;  5B40 D;  2RIQ A;  1B6W A;  1F1E A;  4CSR A;  4X23 A;  3KUY B;  5CP6 D;  3LJA A;  4NFT A;  4J8U D;  4DRA A;  5GSU A;  3AZI B;  2PYO D;  2NQB B;  1P3M B;  4KGC D;  3AV2 C;  2JSS A;  4KUD C;  3VH5 W;  1KX3 C;  1U35 C;  2BYM B;  2ZY2 A;  5B1M D;  4QLC C;  4WU8 A;  3KWQ B;  2Y2L A;  5AVC C;  3MGQ A;  4AWL B;  3AZK D;  3EPJ A;  3WA9 D;  1BH9 A;  3AZF D;  2ZY3 A;  3O62 D;  4XUJ C;  5B40 B;  5AV5 C;  3KUY A;  4H9Q A;  3AZI A;  2NQB A;  5CP6 B;  4H9S C;  4J8U B;  1P3M A;  1EQZ C;  5BT1 C;  2FJ7 C;  1JFI B;  3FDD A;  4KGC B;  1B67 A;  2BYM A;  4YS3 D;  3KWQ A;  4R8P A;  3LZ1 D;  5B1M B;  3AZL C;  2DF4 C;  2Y2G A;  1KX5 D;  3AZH B;  5GT0 C;  2ZM5 A;  4WU9 C;  5CPJ C;  3AZK B;  3WA9 B;  1ID3 D;  3LZ0 D;  3AZF B;  3O62 B;  3X1V C;  2G5H C;  5CP6 A;  2IO5 B;  1JFI A;  2NZD D;  4KGC A;  4Z2M G;  1M1A C;  3AZG D;  3C1C D;  5B32 C;  4YS3 B;  5B1M A;  3LZ1 B;  1P34 D;  3AL0 C;  3WKJ A;  1P3L C;  1TZY D;  3AZH A;  1KX5 B;  3W99 D;  3WA9 A;  4H9O B;  5E5A A;  4J8X D;  1TAF B;  3O62 A;  3AZF A;  1ID3 B;  3LZ0 B;  5DNM C;  3A6N D;  3X1S D;  1A7W A;  4WJ3 C;  4WZS B;  5B33 D;  5F99 A;  3VH6 W;  1KX4 A;  4ZBJ B;  1M18 D;  5GT3 C;  3AZG B;  4H9P A;  5B0Z C;  5CPK C;  4YS3 A;  3LZ1 A;  5B2I A;  1P3F C;  1WWI A;  1P34 B;  1KX5 A;  1TZY B;  3MGR D;  4NE6 A;  4YM6 C;  4Z66 A;  4H9O A;  3W99 B;  4KUD D;  5BNV B;  3AZN C;  2CV5 A;  3KXB C;  3LZ0 A;  4J8X B;  1KX3 D;  3A1I A;  3A6N B;  5AV6 C;  3X1S B;  5CPI D;  3LEL A;  4G92 C;  3MGS D;  3B6G C;  5B33 B;  3KSY A;  5B1L C;  5JRG C;  1M18 B;  3REH A;  4EO5 C;  4XZQ C;  5KDM B;  4DQY B;  5BT1 D;  3W99 A;  5BS7 C;  5BNV A;  5AVB A;  3MGR B;  3WKJ C;  3AZE D;  4J8X A;  1P3K C;  2YFV A;  4J8W D;  2RVQ C;  3A6N A;  1KX3 B;  3H0M C; 
#chains in the Genus database with same CATH homology
 5CPI B;  2Y2Q A;  3X1U B;  3C1B D;  3AZL D;  2F8N H;  3MGS B;  1M18 A;  5GXQ A;  5GT0 D;  4ZUX C;  2BYK B;  3REK A;  5B31 C;  3REJ C;  3B0D B;  3AV1 C;  2ZY4 A;  5JA4 B;  3X1V D;  3VH5 T;  1PZR A;  5B0Y C;  3UT9 B;  3UTA A;  3NQJ B;  3AN2 C;  4UUZ B;  3WTP C;  3MGR A;  4J8V C;  5B2J C;  5AV9 C;  3AZE B;  4Z66 C;  3TU4 D;  4Z5T C;  4J8W B;  5DNN C;  3W96 A;  1HQ3 B;  3X1U A;  3C1B B;  1H3O A;  1N1J B;  3MGS A;  3REL C;  1P3L D;  3AZL B;  3MNN A;  3AZJ A;  2HIO C;  3F6T A;  2BYK A;  5DNM D;  5JA4 A;  3REH C;  3AZM D;  3AYW C;  3UT9 A;  1P3A D;  3NQJ A;  3VH5 A;  5BNX B;  4H9R A;  3AZE A;  2ARO C;  5GT3 D;  1F66 C;  3W98 D;  3X1T C;  5FUG B;  3TU4 B;  1P3B D;  5B0Z D;  1HQ3 A;  1Z2C B;  1M19 D;  5CPK D;  3W97 B;  3B6F C;  3C1B A;  1N1J A;  5AY8 C;  1P3L B;  3UTB C;  4YM6 D;  3KFU G;  1P3I C;  5GXQ C;  1AOI B;  2ZY5 A;  5DNM B;  3WAA C;  1R4V A;  5AV6 D;  3AZM B;  4WNN B;  5BNX A;  3REI C;  1P3A B;  2PYO B;  3B6G D;  3UTA C;  5B1L D;  5JRG D;  5GT3 B;  4LD9 D;  3TU4 A;  3W98 B;  4XZQ D;  3W97 A;  1P3B B;  1P3P D;  5B0Z B;  1M19 B;  5CPK B;  4E44 A;  2XD1 A;  4HGA C;  1W2E A;  4YM6 B;  1AOI A;  1S32 D;  3AZJ C;  1P3K D;  2Y2N A;  1ZLA C;  2CWE A;  5B40 A;  3VH6 T;  3AFA C;  3AZM A;  5AV6 B;  4WNN A;  3MGP C;  1P3A A;  4J8U A;  2PYO A;  4X23 C;  4JJN D;  3LJA C;  5B1L B;  5GSU C;  4ZUX D;  3W98 A;  5AV8 D;  4LD9 B;  4EO5 B;  3P5J B;  5B31 D;  4Z2M H;  3REJ D;  3AV1 D;  1P3P B;  1M19 A;  4KHA B;  5B0Y D;  1BH8 B;  3WTP D;  3MVD D;  3MGQ C;  3AZK A;  4WU8 C;  5AV9 D;  4H9N B;  1S32 B;  5B24 D;  4Z5T D;  3V9R B;  5DNN D;  1BFM A;  4G91 B;  3H0L C;  3KUY C;  3REL D;  1P3O D;  2F8N K;  3AZI C;  2NQB C;  4JJN B;  2NZD B;  1P3M C;  1P3G D;  4LD9 A;  2BG1 A;  5AV8 B;  1P3P A;  4KHA A;  3C1C B;  5B31 B;  3REJ B;  5BO0 B;  3AV1 B;  3AYW D;  3KWQ C;  4R8P C;  2Y2K A;  4AWL C;  3MVD B;  2ARO D;  4H9N A;  3AV2 D;  1TAF A;  5AV9 B;  1S32 A;  1ID3 A;  3X1T D;  5B24 B;  3V9R A;  4Z5T B;  5DNN B;  5B40 C;  1U35 D;  4QLC D;  2NZD A;  5AY8 D;  5AVC D;  4JJN A;  5CP6 C;  3UTB D;  1P3O B;  3AZG A;  4KGC C;  1P3G B;  5AV8 A;  1KU5 A;  3C1C A;  4XUJ D;  5BO0 A;  5AV5 D;  3AYW B;  1P34 A;  1EQZ D;  1TZY A;  2FJ7 D;  5B1M C;  3MVD A;  2F8N D;  2ARO B;  3AZH C;  2G5I C;  3AV2 B;  4KUD B;  1HTA A;  3AZK C;  3WA9 C;  4M6B A;  3B0C T;  5E5A C;  3AZF C;  3X1S A;  3O62 C;  3EPK A;  1U35 B;  4QLC B;  2IO5 C;  5B33 A;  5AVC B;  4WU9 D;  5CPJ D;  5F99 C;  1KX4 C;  5KDM A;  2VQR A;  1ZLA D;  4XUJ B;  3AFA D;  3R45 B;  5AV5 B;  3MGP D;  4YS3 C;  1EQZ B;  2HUE C;  3LZ1 C;  5B2I C;  2FJ7 B;  3LJA D;  3AV2 A;  1M1A D;  4KUD A;  1KX5 C;  2Y2J A;  1KX3 A;  2CV5 C;  5C3I C;  3LZ0 C;  5B32 D;  5CPI A;  1U35 A;  4QLC A;  5AVC A;  3IP4 C;  3MGQ D;  3LEL C;  4WU8 D;  5GT0 B;  4ZBJ C;  4WU9 B;  1T3U A;  5CPJ B;  1ULY A;  3R45 A;  3AFA B;  5AV5 A;  3MGP B;  3X1V B;  3EPH A;  1WWS A;  4H9S A;  4UUZ A;  3KUY D;  2FJ7 A;  1M1A B;  4UPK A;  3W99 C;  4J8W A;  5AVB C;  4J8X C;  5B32 B;  3A6N C;  3X1S C;  1P3F D;  3AZL A;  2JE5 A;  3KWQ D;  4R8P D;  5GT0 A;  4WU8 B;  3MGQ B;  5B33 C;  5B32 G;  3AZN D;  4WU9 A;  3KXB D;  1M18 C;  3A1K A;  3X1V A;  3REK C;  1M1A A;  4H9Q B;  3MGR C;  2LY8 A;  5FUG A;  5B32 A;  4E45 A;  3W96 C;  5CPI C;  3X1U C;  1P3F B;  1P3L A;  4R8P B;  3MGS C;  3WKJ D;  3AZH D;  3AZN B;  3MNN C;  3KXB B;  2RVQ D;  5DNM A;  5E5A D;  3B0D C;  3UT9 C;  4G92 B;  3B6G B;  5GT3 A;  5JRG B;  5F99 D;  2W8S A;  3AZE C;  1KX4 D;  2Y2M A;  1P3B A;  5B0Z A;  4XZQ B;  4J8W C;  5CPK A;  2Y2H A;  1HQ3 C;  1P3F A;  3C1B C;  3AN2 D;  5B2I D;  4YM6 A;  4J8V D;  5B2J D;  3AZN A;  3WKJ B;  3KXB A;  4Z66 D;  1P3K B;  2CV5 D;  5E5A B;  4WV4 B;  5AV6 A;  3VH6 A;  3B6G A;  5B1L A;  5JRG A;  2HIO D;  3LEL D;  3NQU B;  4ZUX B;  5F99 B;  4XZQ A;  1KX4 B;  2Y2I A;  3EPL A;  5G49 B;  3REH D;  3TU4 C;  4H9P B;  1BH8 A;  3W97 C;  5B0Y B;  2JCH A;  2HUE B;  5BS7 A;  3WTP B;  5B2I B;  3AN2 B;  5B31 G;  4J8V B;  5B2J B;  1F66 D;  1P3K A;  5AVB D;  4Z66 B;  1AOI C;  2CV5 B;  2J8P A;  5C3I B;  3B6F D;  3AZM C;  1P3A C;  3REL B;  4J8U C;  2PYO C;  3NQU A;  4ZUX A;  2HIO B;  3LEL B;  1P3I D;  4CAY B;  5GXQ D;  5G49 A;  5B31 A;  2YFW B;  3REJ A;  3AV1 A;  3W98 C;  3REH B;  3WAA D;  1P3B C;  2FFF B;  3REK D;  5CHL B;  5B0Y A;  1M19 C;  3REI D;  3AN2 A;  3WTP A;  4J8V A;  3UTA D;  5B2J A;  5AV9 A;  1F66 B;  5B24 A;  4Z5T A;  5AVB B;  3H0R C;  3X1T B;  5DNN A;  2YFV B;  3B6F B;  4NE3 A;  3W96 D;  3X1U D;  3REL A;  1P3O A;  5AY8 B;  2HIO A;  3UTB B;  4CAY A;  1P3G A;  1P3I B;  2UWX A;  3MNN D;  3AZJ D;  2YFW A;  5GXQ B;  4LD9 C;  3AYW A;  3WAA B;  1P3P C;  3REK B;  3REI B;  3UT9 D;  4X23 D;  2ARO A;  3UTA B;  5GSU D;  1F66 A;  2F8N B;  3X1T A;  2Y2O A;  1S32 C;  1ID3 C;  3B6F A;  2F8N G;  1HQ3 D;  5AY8 A;  4HGA B;  3W96 B;  3UTB A;  2L5A A;  4G91 C;  1H3O B;  2Y2P A;  1P3I A;  4JJN C;  2NZD C;  3EG5 B;  3MNN B;  3AZJ B;  3AZG C;  4XUJ A;  1ZLA B;  5AV8 C;  3WAA A;  3C1C C;  3REI A;  4NE5 A;  1EQZ A;  2F2A C;  4CSR B;  4X23 B;  3AZI D;  1P34 C;  2F8N A;  2NQB D;  1TZY C;  3LJA B;  1P3M D;  5GSU B;  3MVD C;  4H9R B;  5B24 C;  3W97 D;  2XD5 A;  3B0B A;  1P3O C;  5CPJ A;  3B0C W;  3WTP E;  1P3G C;  1ZLA A;  1AOI D;  4DRB A;  3AFA A;  2DQN C;  1BH9 B;  1Q9C A;  3MGP A;  5B40 D;  2RIQ A;  1B6W A;  1F1E A;  4CSR A;  4X23 A;  3KUY B;  5CP6 D;  3LJA A;  4NFT A;  4J8U D;  4DRA A;  5GSU A;  3AZI B;  2PYO D;  2NQB B;  1P3M B;  4KGC D;  3AV2 C;  2JSS A;  4KUD C;  3VH5 W;  1KX3 C;  1U35 C;  2BYM B;  2ZY2 A;  5B1M D;  4QLC C;  4WU8 A;  3KWQ B;  2Y2L A;  5AVC C;  3MGQ A;  4AWL B;  3AZK D;  3EPJ A;  3WA9 D;  1BH9 A;  3AZF D;  2ZY3 A;  3O62 D;  4XUJ C;  5B40 B;  5AV5 C;  3KUY A;  4H9Q A;  3AZI A;  2NQB A;  5CP6 B;  4H9S C;  4J8U B;  1P3M A;  1EQZ C;  5BT1 C;  2FJ7 C;  1JFI B;  3FDD A;  4KGC B;  1B67 A;  2BYM A;  4YS3 D;  3KWQ A;  4R8P A;  3LZ1 D;  5B1M B;  3AZL C;  2DF4 C;  2Y2G A;  1KX5 D;  3AZH B;  5GT0 C;  2ZM5 A;  4WU9 C;  5CPJ C;  3AZK B;  3WA9 B;  1ID3 D;  3LZ0 D;  3AZF B;  3O62 B;  3X1V C;  2G5H C;  5CP6 A;  2IO5 B;  1JFI A;  2NZD D;  4KGC A;  4Z2M G;  1M1A C;  3AZG D;  3C1C D;  5B32 C;  4YS3 B;  5B1M A;  3LZ1 B;  1P34 D;  3AL0 C;  3WKJ A;  1P3L C;  1TZY D;  3AZH A;  1KX5 B;  3W99 D;  3WA9 A;  4H9O B;  5E5A A;  4J8X D;  1TAF B;  3O62 A;  3AZF A;  1ID3 B;  3LZ0 B;  5DNM C;  3A6N D;  3X1S D;  1A7W A;  4WJ3 C;  4WZS B;  5B33 D;  5F99 A;  3VH6 W;  1KX4 A;  4ZBJ B;  1M18 D;  5GT3 C;  3AZG B;  4H9P A;  5B0Z C;  5CPK C;  4YS3 A;  3LZ1 A;  5B2I A;  1P3F C;  1WWI A;  1P34 B;  1KX5 A;  1TZY B;  3MGR D;  4NE6 A;  4YM6 C;  4Z66 A;  4H9O A;  3W99 B;  4KUD D;  5BNV B;  3AZN C;  2CV5 A;  3KXB C;  3LZ0 A;  4J8X B;  1KX3 D;  3A1I A;  3A6N B;  5AV6 C;  3X1S B;  5CPI D;  3LEL A;  4G92 C;  3MGS D;  3B6G C;  5B33 B;  3KSY A;  5B1L C;  5JRG C;  1M18 B;  3REH A;  4EO5 C;  4XZQ C;  5KDM B;  4DQY B;  5BT1 D;  3W99 A;  5BS7 C;  5BNV A;  5AVB A;  3MGR B;  3WKJ C;  3AZE D;  4J8X A;  1P3K C;  2YFV A;  4J8W D;  2RVQ C;  3A6N A;  1KX3 B;  3H0M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...