5BNVB

Crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 27
structure length 79
sequence length 79
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnvB00
1P3MD 3LELC 3VH5A 4J8VC 3NQUB 1ZLAA 3REID 4UUZA 3W98A 2L5AA 4X23C 3LZ0B 3REIB 5B2IC 2YFVA 3LJAC 4Z5TA 4AWLC 3MGQA 3V9RB 3X1VA 5AY8A 4QLCA 1KX3C 1P3GC 3KXBC 2F8NK 1P3KC 5B1MA 4H9NA 5G49A 5CPIA 3AZNA 3AZFA 4J8WB 3MGSC 5CPJD 5C3IB 3AYWA 1Q9CA 1KX4B 5B0YA 4CSRB 4R8PB 3UTBA 3X1SC 4YM6C 5CPKB 4KUDA 4EO5C 3AZJB 3REHB 3AV1B 4H9PA 5JRGC 1P34C 4X23A 1AOIB 4H9OB 2BYKB 2FJ7D 3TU4C 1P3OA 5B2IA 5AVCD 4KGCC 5B32G 5AVBD 2FJ7B 1P3AC 3LJAA 4J8UD 1P3ID 3AFAC 3AZKD 1KX3A 2NQBC 3VH5T 5AV9A 1P3IB 1P3GA 4JJNC 5B1LC 5GXQD 4WU8A 3X1TB 1P3KA 1KX5A 1ZLAB 4H9QA 3MNND 5GXQB 5BS7C 3MVDD 3AZED 5DNMC 2YFWB 3X1UA 3AZMC 1M1AD 2F8ND 3REKC 5B33C 1F66A 1ID3C 4Z5TB 1P3FA 4Z66C 1M1AB 3WKJD 3W96D 5AY8B 5AV6A 1P3BD 4YM6A 5CPIB 5G49B 4J8XA 3AZFB 3AN2C 1P34A 5JRGA 5DNNC 1P3PC 1M18B 5JA4B 1TAFA 3WTPD 4KGCA 3W99B 3A6NB 1P3AA 2AROA 3KUYD 4XUJC 5B40C 3LELB 5AV8C 4J8VB 4JJNA 5B24D 3WAAD 3MGRD 3NQJB 1BH8B 4X23B 5DNMA 1M19D 1U35D 3MGPC 3AZMA 5GSUD 5B33A 5AV5D 3LJAB 4YS3D 1HQ3A 5B2JC 1S32C 1KX3B 4YS3B 3AV2C 3KXBB 2HIOD 4HGAC 3W97C 3MGSB 3REJD 2CV5C 3B6GC 3UT9D 3WA9C 4LD9C 5B32D 5F99A 4WU9D 4XUJA 5B40A 1P3LA 3X1SB 4YM6B 1HTAA 3W98C 4EO5B 5CP6A 3AZLA 3O62D 1P34B 1H3OB 4ZUXC 1TAFB 5B31C 3TU4B 1P3MA 1BFMA 3MGPA 1R4VA 5B0ZD 3AZIC 3X1VC 4QLCC 1S32A 5B2JA 3AFAB 2NQBB 5B1MC 3AV2A 3AZNC 3RELC 4JJNB 5B1LB 1EQZD 3W97A 3AYWC 4XZQC 5B0YC 3C1BD 3B6FC 5DNMB 2LY8A 3AZMB 3REKB 3UTBC 5B33B 1ID3B 3C1CA 4Z66B 3KWQC 3LZ0D 4KUDC 3VH6W 5CPJA 4NE3A 1P3OC 3AN2B 1P3PB 5DNNB 4WNNA 5BO0B 4ZUXA 4G91C 5B31A 3LZ1A 3AZIA 3AZGC 5AV9C 4J8WD 5B40B 4XUJB 4WU8C 1KX5C 5GT3C 5AV8B 3R45A 3RELA 5FUGB 1KX4D 4R8PD 3AZKA 3X1UC 4XZQA 5BT1C 3B6FA 2NZDA 1TZYC 1B67A 3MGPB 3AZHC 1F66C 1P3FC 5CPKD 4KHAB 2RVQC 5AV6C 3REHD 3AZJD 1S32B 5B2JB 3AV1D 3KWQA 1AOID 4NFTA 3AV2B 3MVDA 4J8XC 4HGAB 2F8NA 5E5AC 3W97B 3W96A 2CV5B 1P3BA 1JFIA 3B6GB 2AROC 3WA9B 3X1TD 3UTAC 1ZLAD 4LD9B 5BNVA 3AZGA 3VH6A 5GT3A 5KDMA 4UUZB 3W98B 3KUYA 2YFVB 5GT0C 4Z5TD 5B31B 3MGQD 5AY8D 1TZYA 3AZHA 1HQ3C 3WAAA 3MGQB 3X1VB 5CPID 4QLCB 3AZFD 1M18D 5B1MB 4H9NB 3AZNB 3RELB 1M19A 3W99D 1U35A 3AYWD 3A6ND 2F8NH 5E5AA 5AV5A 5B0YD 3AYWB 5B0YB 3LELD 4J8VD 5F99C 2HIOA 3UTAA 3UTBB 1BH9A 1P3LC 2IO5C 4X23D 2PYOC 4KUDB 5CP6C 3AZLC 5B2ID 3UT9A 4H9PB 3LJAD 1P3MC 5B2IB 1P3OB 5GT0A 4WU9A 1KX3D 3REIC 1JFIB 1P3GD 3KXBD 4H9RA 4AWLB 1P3KD 3AZGB 5BNXA 5AV9B 1P3GB 4WU8B 3MGSD 5GT3B 1P3KB 1KX5B 4H9QB 5B0ZA 2BYMA 4CAYA 3X1UB 4ZBJC 3X1SD 4YM6D 1F66B 3C1CC 1P3FB 5AV6B 5CPJC 1P34D 5JRGD 2PYOA 3C1BA 3TU4D 4J8XB 4KGCD 3NQUA 5JRGB 5E5AB 3LZ1C 1P3AD 4KGCB 3AFAD 3REIA 1P3AB 2NQBD 2AROB 4JJND 5B1LD 2FJ7C 5B31G 5AVCC 5AVBC 3V9RA 4J8UC 5DNMD 1P3IC 3AZMD 3REKD 3AZKC 5B33D 4DRBA 1ID3D 2NZDC 4Z66D 5GXQC 1HQ3B 3MNNC 1KX4A 4CSRA 4R8PA 2HUEC 3MVDC 3AZEC 3AN2D 1P3PD 5DNND 1M1AC 5CPKA 3WKJC 3W96C 4G92C 2BYMB 3AZJA 1P3BC 3AV1A 4NE5A 4XUJD 4H9OA 2BYKA 5B40D 5AV8D 2F8NG 5F99B 3B0DC 2FJ7A 1P3LB 5AVCA 3WTPC 2IO5B 5AVBA 2PYOB 5CP6B 3AZLB 4J8UA 1P3IA 3MGPD 3KUYC 3X1TA 4Z2MH 1P3MB 1S32D 5B2JD 3B0CW 5GXQA 5B24C 3WAAC 3AV2D 3MGRC 2YFWA 3MNNA 4DRAA 3AZEA 3W97D 1M19C 1U35C 1M1AA 5GSUC 5AV5C 2CV5D 4YS3C 3B6GD 3WA9D 3WKJA 4LD9D 3C1CD 2HIOC 1M18A 4ZBJB 5JA4A 3W99A 3C1CB 3A6NA 3W98D 3REJC 1B6WA 3WTPA 5CPJB 1ULYA 4ZUXD 3UT9C 3LZ1D 5B31D 5B32C 3LELA 4J8VA 3WTPE 4WNNB 4WV4B 4ZUXB 3LZ1B 4WU9C 3AZID 3X1VD 4QLCD 3NQJA 5B24A 1BH8A 3AZIB 5B1MD 3AZND 3MGRA 3RELD 2NZDD 3O62C 5AVCB 3R45B 5AVBB 2JSSA 4WZSB 5GSUA 4XZQD 5B0ZC 4YS3A 3B6FD 4J8UB 3KXBA 4E44A 3UTBD 3AZKB 4XZQB 1WWSA 3B6FB 2NZDB 1EQZC 3KWQD 3MGSA 4H9SC 4KUDD 3MNNB 3KWQB 3REJA 3C1BC 2HUEB 3MVDB 3AZEB 1P3OD 2F8NB 3X1SA 5B32A 4G91B 3WKJB 1N1JA 4G92B 3LZ0C 3AZGD 1P3BB 3W96B 5AV9D 1H3OA 4WU8D 1KX5D 5GT3D 5BNVB 3TU4A 3O62A 3B0DB 3VH6T 3WTPB 5KDMB 3AFAA 3X1UD 5CHLB 5BT1D 2NQBA 1WWIA 1TZYD 1F66D 3KUYB 5B1LA 3AZHD 4J8WC 1P3FD 1KU5A 2RVQD 5AV6D 1TZYB 1A7WA 1EQZA 3AZHB 5C3IC 5B24B 4H9SA 1KX4C 5BS7A 3WAAB 4Z2MG 4J8XD 4R8PC 3MGRB 3REKA 5E5AD 1ID3A 1M19B 1U35B 4Z66A 5GSUB 5CPKC 5AV5B 3VH5W 4M6BA 3AZJC 2AROD 3REHC 3AV1C 3B0BA 3UTAD 1F1EA 3B0CT 3LZ0A 1AOIC 3AN2A 1P3PA 5DNNA 2HIOB 5BO0A 3UTAB 1BH9B 3REJB 5GT0D 3UT9B 3X1TC 1ZLAC 5B32B 5AV8A 4NE6A 5FUGA 5GT0B 4J8WA 1HQ3D 4WU9B 1N1JB 4H9RB 5BNXB 3O62B 4Z5TC 3KSYA 4KHAA 3MGQC 5AY8C 2CWEA 5B0ZB 5CPIC 4E45A 4CAYB 3REHA 5F99D 3AZFC 1M18C 1P3LD 1AOIA 1EQZB 3W99C 3A6NC 2PYOD 5CP6D 3AZLD 2CV5A 3B6GA 3WA9A 4LD9A 3C1BB
chains in the Genus database with same CATH superfamily
1P3MD 3LELC 3VH5A 4J8VC 3FDDA 3NQUB 1ZLAA 3REID 4UUZA 3W98A 2L5AA 4X23C 3LZ0B 3REIB 5B2IC 2YFVA 3LJAC 4Z5TA 4AWLC 3MGQA 3V9RB 3X1VA 5AY8A 4QLCA 1KX3C 1P3GC 3KXBC 2F8NK 1P3KC 5B1MA 4H9NA 5G49A 5CPIA 3AZNA 3AZFA 4J8WB 3MGSC 5CPJD 5C3IB 3AYWA 1Q9CA 1KX4B 5B0YA 4CSRB 4R8PB 3UTBA 3F6TA 3X1SC 4YM6C 5CPKB 4KUDA 4EO5C 3AZJB 3REHB 3P5JB 3AV1B 4H9PA 5JRGC 1P34C 4X23A 1AOIB 4H9OB 2BYKB 2FJ7D 3TU4C 1P3OA 5B2IA 5AVCD 4KGCC 5B32G 5AVBD 2UWXA 2FJ7B 1P3AC 3LJAA 4J8UD 1P3ID 3AFAC 3AZKD 1KX3A 2NQBC 3VH5T 5AV9A 1P3IB 1P3GA 4JJNC 5B1LC 5GXQD 4WU8A 3X1TB 1P3KA 1KX5A 1ZLAB 4H9QA 3MNND 5GXQB 5BS7C 3MVDD 3AZED 5DNMC 2YFWB 3X1UA 3AZMC 1M1AD 2F8ND 3REKC 5B33C 1F66A 1ID3C 4Z5TB 1P3FA 4Z66C 1M1AB 3WKJD 3W96D 5AY8B 5AV6A 1P3BD 4YM6A 5CPIB 5G49B 4J8XA 3AZFB 2XD1A 3AN2C 1P34A 5JRGA 5DNNC 1P3PC 1M18B 5JA4B 1TAFA 3WTPD 4KGCA 3W99B 3A6NB 1P3AA 2AROA 3KUYD 2G5IC 4XUJC 5B40C 2JE5A 3LELB 5AV8C 4J8VB 4JJNA 5B24D 3WAAD 3MGRD 3NQJB 2DF4C 1BH8B 4X23B 5DNMA 1M19D 1U35D 3MGPC 3AZMA 5GSUD 5B33A 5AV5D 3LJAB 4YS3D 4WJ3C 1HQ3A 5B2JC 1S32C 1KX3B 2Y2MA 2ZY4A 3AV2C 4YS3B 3KXBB 2HIOD 2J8PA 4HGAC 3W97C 3MGSB 3REJD 2CV5C 3B6GC 3UT9D 3WA9C 4LD9C 5B32D 5F99A 4WU9D 4XUJA 5B40A 1P3LA 3X1SB 2VQRA 4YM6B 1HTAA 3W98C 4EO5B 5CP6A 3AZLA 3O62D 1P34B 1H3OB 4ZUXC 1TAFB 5B31C 3TU4B 1P3MA 1BFMA 3MGPA 1R4VA 2ZY2A 5B0ZD 3AZIC 3X1VC 4QLCC 3EPKA 5B2JA 3AFAB 1S32A 2NQBB 5B1MC 3AV2A 3AZNC 3RELC 4JJNB 5B1LB 1EQZD 2Y2JA 3EPHA 3W97A 3AYWC 4XZQC 5B0YC 3C1BD 3B6FC 5DNMB 2LY8A 3AZMB 3REKB 3UTBC 5B33B 1ID3B 3C1CA 4Z66B 3KWQC 4UPKA 3LZ0D 4KUDC 3VH6W 5CPJA 4NE3A 1P3OC 3AN2B 3AL0C 1P3PB 5DNNB 4WNNA 5BO0B 4ZUXA 4G91C 5B31A 3LZ1A 3AZIA 3AZGC 5AV9C 4J8WD 5B40B 4XUJB 4WU8C 1KX5C 5GT3C 5AV8B 3R45A 3RELA 5FUGB 1KX4D 4R8PD 3AZKA 3X1UC 4XZQA 5BT1C 3B6FA 2NZDA 1TZYC 1B67A 3MGPB 3AZHC 1F66C 1P3FC 5CPKD 4KHAB 2RVQC 5AV6C 3REHD 3AZJD 1S32B 5B2JB 3AV1D 3KWQA 1AOID 4NFTA 3AV2B 3MVDA 4J8XC 4HGAB 2ZY5A 2F8NA 5E5AC 3W97B 2ZY3A 3W96A 2CV5B 1P3BA 1JFIA 3B6GB 2AROC 3WA9B 3X1TD 3UTAC 2G5HC 1ZLAD 5BNVA 3AZGA 4LD9B 3VH6A 5GT3A 5KDMA 4UUZB 2BG1A 3W98B 3KUYA 2YFVB 5GT0C 4Z5TD 5B31B 3MGQD 5AY8D 1TZYA 2ZM5A 3AZHA 1HQ3C 3WAAA 3MGQB 3X1VB 5CPID 4QLCB 3AZFD 1M18D 2RIQA 5B1MB 4H9NB 3AZNB 3RELB 1M19A 3W99D 1U35A 3AYWD 3A6ND 2F8NH 5E5AA 5AV5A 5B0YD 3AYWB 5B0YB 3LELD 4J8VD 5F99C 2HIOA 3UTAA 3UTBB 1BH9A 1P3LC 2IO5C 4X23D 2PYOC 4KUDB 5CP6C 3AZLC 5B2ID 3UT9A 4H9PB 3H0RC 3LJAD 1P3MC 5B2IB 1P3OB 5GT0A 4WU9A 1KX3D 3REIC 1JFIB 1P3GD 3KXBD 4H9RA 4AWLB 1P3KD 3AZGB 5BNXA 5AV9B 1P3GB 4WU8B 3MGSD 5GT3B 1P3KB 1KX5B 4H9QB 5B0ZA 2BYMA 4CAYA 3IP4C 3X1UB 4ZBJC 3X1SD 4YM6D 1F66B 3C1CC 1P3FB 5AV6B 5CPJC 1P34D 5JRGD 2PYOA 3C1BA 3TU4D 3KFUG 4J8XB 4KGCD 3NQUA 5JRGB 5E5AB 3LZ1C 1P3AD 4KGCB 3AFAD 2Y2PA 3REIA 1P3AB 2NQBD 2AROB 4JJND 5B1LD 2FJ7C 5B31G 5AVCC 5AVBC 3V9RA 4J8UC 5DNMD 1P3IC 3AZMD 3REKD 3AZKC 5B33D 4DRBA 1ID3D 2NZDC 2JCHA 4Z66D 5GXQC 1HQ3B 3MNNC 1KX4A 4CSRA 4R8PA 2HUEC 3MVDC 3AZEC 3AN2D 1P3PD 5DNND 1M1AC 5CPKA 3WKJC 3W96C 4G92C 2BYMB 2Y2KA 3AZJA 1P3BC 3AV1A 2XD5A 4NE5A 4XUJD 4H9OA 2BYKA 5B40D 5AV8D 2F8NG 5F99B 3B0DC 2FJ7A 1P3LB 5AVCA 3WTPC 2IO5B 5AVBA 2W8SA 2PYOB 5CP6B 3AZLB 4J8UA 1P3IA 2Y2GA 3MGPD 3KUYC 1PZRA 3X1TA 4Z2MH 1P3MB 1S32D 5B2JD 3B0CW 5GXQA 5B24C 3WAAC 3AV2D 3MGRC 2FFFB 2YFWA 3MNNA 4DRAA 3AZEA 3W97D 1M19C 1U35C 1M1AA 2Y2LA 5GSUC 3H0MC 5AV5C 2CV5D 4YS3C 3B6GD 3WA9D 2F2AC 3WKJA 4LD9D 3C1CD 2HIOC 1M18A 4ZBJB 5JA4A 2DQNC 3W99A 3C1CB 3A6NA 3W98D 3REJC 1B6WA 3WTPA 5CPJB 1ULYA 4ZUXD 3UT9C 3LZ1D 5B31D 5B32C 1T3UA 3LELA 4J8VA 3WTPE 4DQYB 4WNNB 4WV4B 4ZUXB 3LZ1B 4WU9C 3AZID 3X1VD 4QLCD 3NQJA 2Y2OA 5B24A 1BH8A 3AZIB 5B1MD 3AZND 3MGRA 3RELD 2NZDD 3O62C 3A1KA 3H0LC 5AVCB 3R45B 5AVBB 2JSSA 4WZSB 5GSUA 4XZQD 5B0ZC 4YS3A 3B6FD 4J8UB 3KXBA 4E44A 3UTBD 3AZKB 4XZQB 1WWSA 3B6FB 2NZDB 1EQZC 3KWQD 3MGSA 4H9SC 4KUDD 3MNNB 3KWQB 3REJA 3EPLA 3C1BC 2HUEB 3MVDB 3AZEB 1P3OD 2F8NB 3X1SA 5B32A 2Y2IA 4G91B 3WKJB 1N1JA 4G92B 3LZ0C 3AZGD 1P3BB 3W96B 5AV9D 1H3OA 4WU8D 1KX5D 5GT3D 5BNVB 3TU4A 3O62A 3B0DB 3VH6T 3WTPB 5KDMB 3AFAA 3X1UD 5CHLB 5BT1D 2NQBA 1WWIA 1TZYD 1F66D 3KUYB 5B1LA 3AZHD 4J8WC 1P3FD 1KU5A 2RVQD 5AV6D 1TZYB 1A7WA 3A1IA 3AZHB 5C3IC 5B24B 1EQZA 4H9SA 1KX4C 5BS7A 3WAAB 4Z2MG 4J8XD 4R8PC 3MGRB 3REKA 5E5AD 1ID3A 1M19B 1U35B 1Z2CB 2Y2HA 4Z66A 5GSUB 5CPKC 5AV5B 3VH5W 4M6BA 3AZJC 2AROD 3REHC 3AV1C 3B0BA 3UTAD 1F1EA 3B0CT 3LZ0A 1AOIC 3AN2A 1P3PA 5DNNA 2HIOB 5BO0A 3UTAB 1BH9B 3REJB 5GT0D 3UT9B 3X1TC 1ZLAC 5B32B 3EPJA 5AV8A 4NE6A 5FUGA 3EG5B 5GT0B 4J8WA 1HQ3D 4WU9B 1N1JB 4H9RB 2Y2NA 5BNXB 3O62B 4Z5TC 3KSYA 4KHAA 3MGQC 5AY8C 2CWEA 5B0ZB 5CPIC 4E45A 4CAYB 3REHA 5F99D 3AZFC 1W2EA 1M18C 1P3LD 1AOIA 1EQZB 3W99C 3A6NC 2PYOD 2Y2QA 5CP6D 3AZLD 2CV5A 3B6GA 3WA9A 4LD9A 3C1BB
chains in the Genus database with same CATH topology
1P3MD 3LELC 3VH5A 4J8VC 3FDDA 3NQUB 1ZLAA 3REID 4UUZA 3W98A 2L5AA 4X23C 3LZ0B 3REIB 5B2IC 2YFVA 3LJAC 4Z5TA 4AWLC 3MGQA 3V9RB 3X1VA 5AY8A 4QLCA 1KX3C 1P3GC 3KXBC 2F8NK 1P3KC 5B1MA 4H9NA 5G49A 5CPIA 3AZNA 3AZFA 4J8WB 3MGSC 5CPJD 5C3IB 3AYWA 1Q9CA 1KX4B 5B0YA 4CSRB 4R8PB 3UTBA 3F6TA 3X1SC 4YM6C 5CPKB 4KUDA 4EO5C 3AZJB 3REHB 3P5JB 3AV1B 4H9PA 5JRGC 1P34C 4X23A 1AOIB 4H9OB 2BYKB 2FJ7D 3TU4C 1P3OA 5B2IA 5AVCD 4KGCC 5B32G 5AVBD 2UWXA 2FJ7B 1P3AC 3LJAA 4J8UD 1P3ID 3AFAC 3AZKD 1KX3A 2NQBC 3VH5T 5AV9A 1P3IB 1P3GA 4JJNC 5B1LC 5GXQD 4WU8A 3X1TB 1P3KA 1KX5A 1ZLAB 4H9QA 3MNND 5GXQB 5BS7C 3MVDD 3AZED 5DNMC 2YFWB 3X1UA 3AZMC 1M1AD 2F8ND 3REKC 5B33C 1F66A 1ID3C 4Z5TB 1P3FA 4Z66C 1M1AB 3WKJD 3W96D 5AY8B 5AV6A 1P3BD 4YM6A 5CPIB 5G49B 4J8XA 3AZFB 2XD1A 3AN2C 1P34A 5JRGA 5DNNC 1P3PC 1M18B 5JA4B 1TAFA 3WTPD 4KGCA 3W99B 3A6NB 1P3AA 2AROA 3KUYD 2G5IC 4XUJC 5B40C 2JE5A 3LELB 5AV8C 4J8VB 4JJNA 5B24D 3WAAD 3MGRD 3NQJB 2DF4C 1BH8B 4X23B 5DNMA 1M19D 1U35D 3MGPC 3AZMA 5GSUD 5B33A 5AV5D 3LJAB 4YS3D 4WJ3C 1HQ3A 5B2JC 1S32C 1KX3B 2Y2MA 2ZY4A 3AV2C 4YS3B 3KXBB 2HIOD 2J8PA 4HGAC 3W97C 3MGSB 3REJD 2CV5C 3B6GC 3UT9D 3WA9C 4LD9C 5B32D 5F99A 4WU9D 4XUJA 5B40A 1P3LA 3X1SB 2VQRA 4YM6B 1HTAA 3W98C 4EO5B 5CP6A 3AZLA 3O62D 1P34B 1H3OB 4ZUXC 1TAFB 5B31C 3TU4B 1P3MA 1BFMA 3MGPA 1R4VA 2ZY2A 5B0ZD 3AZIC 3X1VC 4QLCC 3EPKA 5B2JA 3AFAB 1S32A 2NQBB 5B1MC 3AV2A 3AZNC 3RELC 4JJNB 5B1LB 1EQZD 2Y2JA 3EPHA 3W97A 3AYWC 4XZQC 5B0YC 3C1BD 3B6FC 5DNMB 2LY8A 3AZMB 3REKB 3UTBC 5B33B 1ID3B 3C1CA 4Z66B 3KWQC 4UPKA 3LZ0D 4KUDC 3VH6W 5CPJA 4NE3A 1P3OC 3AN2B 3AL0C 1P3PB 5DNNB 4WNNA 5BO0B 4ZUXA 4G91C 5B31A 3LZ1A 3AZIA 3AZGC 5AV9C 4J8WD 5B40B 4XUJB 4WU8C 1KX5C 5GT3C 5AV8B 3R45A 3RELA 5FUGB 1KX4D 4R8PD 3AZKA 3X1UC 4XZQA 5BT1C 3B6FA 2NZDA 1TZYC 1B67A 3MGPB 3AZHC 1F66C 1P3FC 5CPKD 4KHAB 2RVQC 5AV6C 3REHD 3AZJD 1S32B 5B2JB 3AV1D 3KWQA 1AOID 4NFTA 3AV2B 3MVDA 4J8XC 4HGAB 2ZY5A 2F8NA 5E5AC 3W97B 2ZY3A 3W96A 2CV5B 1P3BA 1JFIA 3B6GB 2AROC 3WA9B 3X1TD 3UTAC 2G5HC 1ZLAD 5BNVA 3AZGA 4LD9B 3VH6A 5GT3A 5KDMA 4UUZB 2BG1A 3W98B 3KUYA 2YFVB 5GT0C 4Z5TD 5B31B 3MGQD 5AY8D 1TZYA 2ZM5A 3AZHA 1HQ3C 3WAAA 3MGQB 3X1VB 5CPID 4QLCB 3AZFD 1M18D 2RIQA 5B1MB 4H9NB 3AZNB 3RELB 1M19A 3W99D 1U35A 3AYWD 3A6ND 2F8NH 5E5AA 5AV5A 5B0YD 3AYWB 5B0YB 3LELD 4J8VD 5F99C 2HIOA 3UTAA 3UTBB 1BH9A 1P3LC 2IO5C 4X23D 2PYOC 4KUDB 5CP6C 3AZLC 5B2ID 3UT9A 4H9PB 3H0RC 3LJAD 1P3MC 5B2IB 1P3OB 5GT0A 4WU9A 1KX3D 3REIC 1JFIB 1P3GD 3KXBD 4H9RA 4AWLB 1P3KD 3AZGB 5BNXA 5AV9B 1P3GB 4WU8B 3MGSD 5GT3B 1P3KB 1KX5B 4H9QB 5B0ZA 2BYMA 4CAYA 3IP4C 3X1UB 4ZBJC 3X1SD 4YM6D 1F66B 3C1CC 1P3FB 5AV6B 5CPJC 1P34D 5JRGD 2PYOA 3C1BA 3TU4D 3KFUG 4J8XB 4KGCD 3NQUA 5JRGB 5E5AB 3LZ1C 1P3AD 4KGCB 3AFAD 2Y2PA 3REIA 1P3AB 2NQBD 2AROB 4JJND 5B1LD 2FJ7C 5B31G 5AVCC 5AVBC 3V9RA 4J8UC 5DNMD 1P3IC 3AZMD 3REKD 3AZKC 5B33D 4DRBA 1ID3D 2NZDC 2JCHA 4Z66D 5GXQC 1HQ3B 3MNNC 1KX4A 4CSRA 4R8PA 2HUEC 3MVDC 3AZEC 3AN2D 1P3PD 5DNND 1M1AC 5CPKA 3WKJC 3W96C 4G92C 2BYMB 2Y2KA 3AZJA 1P3BC 3AV1A 2XD5A 4NE5A 4XUJD 4H9OA 2BYKA 5B40D 5AV8D 2F8NG 5F99B 3B0DC 2FJ7A 1P3LB 5AVCA 3WTPC 2IO5B 5AVBA 2W8SA 2PYOB 5CP6B 3AZLB 4J8UA 1P3IA 2Y2GA 3MGPD 3KUYC 1PZRA 3X1TA 4Z2MH 1P3MB 1S32D 5B2JD 3B0CW 5GXQA 5B24C 3WAAC 3AV2D 3MGRC 2FFFB 2YFWA 3MNNA 4DRAA 3AZEA 3W97D 1M19C 1U35C 1M1AA 2Y2LA 5GSUC 3H0MC 5AV5C 2CV5D 4YS3C 3B6GD 3WA9D 2F2AC 3WKJA 4LD9D 3C1CD 2HIOC 1M18A 4ZBJB 5JA4A 2DQNC 3W99A 3C1CB 3A6NA 3W98D 3REJC 1B6WA 3WTPA 5CPJB 1ULYA 4ZUXD 3UT9C 3LZ1D 5B31D 5B32C 1T3UA 3LELA 4J8VA 3WTPE 4DQYB 4WNNB 4WV4B 4ZUXB 3LZ1B 4WU9C 3AZID 3X1VD 4QLCD 3NQJA 2Y2OA 5B24A 1BH8A 3AZIB 5B1MD 3AZND 3MGRA 3RELD 2NZDD 3O62C 3A1KA 3H0LC 5AVCB 3R45B 5AVBB 2JSSA 4WZSB 5GSUA 4XZQD 5B0ZC 4YS3A 3B6FD 4J8UB 3KXBA 4E44A 3UTBD 3AZKB 4XZQB 1WWSA 3B6FB 2NZDB 1EQZC 3KWQD 3MGSA 4H9SC 4KUDD 3MNNB 3KWQB 3REJA 3EPLA 3C1BC 2HUEB 3MVDB 3AZEB 1P3OD 2F8NB 3X1SA 5B32A 2Y2IA 4G91B 3WKJB 1N1JA 4G92B 3LZ0C 3AZGD 1P3BB 3W96B 5AV9D 1H3OA 4WU8D 1KX5D 5GT3D 5BNVB 3TU4A 3O62A 3B0DB 3VH6T 3WTPB 5KDMB 3AFAA 3X1UD 5CHLB 5BT1D 2NQBA 1WWIA 1TZYD 1F66D 3KUYB 5B1LA 3AZHD 4J8WC 1P3FD 1KU5A 2RVQD 5AV6D 1TZYB 1A7WA 3A1IA 3AZHB 5C3IC 5B24B 1EQZA 4H9SA 1KX4C 5BS7A 3WAAB 4Z2MG 4J8XD 4R8PC 3MGRB 3REKA 5E5AD 1ID3A 1M19B 1U35B 1Z2CB 2Y2HA 4Z66A 5GSUB 5CPKC 5AV5B 3VH5W 4M6BA 3AZJC 2AROD 3REHC 3AV1C 3B0BA 3UTAD 1F1EA 3B0CT 3LZ0A 1AOIC 3AN2A 1P3PA 5DNNA 2HIOB 5BO0A 3UTAB 1BH9B 3REJB 5GT0D 3UT9B 3X1TC 1ZLAC 5B32B 3EPJA 5AV8A 4NE6A 5FUGA 3EG5B 5GT0B 4J8WA 1HQ3D 4WU9B 1N1JB 4H9RB 2Y2NA 5BNXB 3O62B 4Z5TC 3KSYA 4KHAA 3MGQC 5AY8C 2CWEA 5B0ZB 5CPIC 4E45A 4CAYB 3REHA 5F99D 3AZFC 1W2EA 1M18C 1P3LD 1AOIA 1EQZB 3W99C 3A6NC 2PYOD 2Y2QA 5CP6D 3AZLD 2CV5A 3B6GA 3WA9A 4LD9A 3C1BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M D;  3LEL C;  3VH5 A;  4J8V C;  3NQU B;  1ZLA A;  3REI D;  4UUZ A;  3W98 A;  2L5A A;  4X23 C;  3LZ0 B;  3REI B;  5B2I C;  2YFV A;  3LJA C;  4Z5T A;  4AWL C;  3MGQ A;  3V9R B;  3X1V A;  5AY8 A;  4QLC A;  1KX3 C;  1P3G C;  3KXB C;  2F8N K;  1P3K C;  5B1M A;  4H9N A;  5G49 A;  5CPI A;  3AZN A;  3AZF A;  4J8W B;  3MGS C;  5CPJ D;  5C3I B;  3AYW A;  1Q9C A;  1KX4 B;  5B0Y A;  4CSR B;  4R8P B;  3UTB A;  3X1S C;  4YM6 C;  5CPK B;  4KUD A;  4EO5 C;  3AZJ B;  3REH B;  3AV1 B;  4H9P A;  5JRG C;  1P34 C;  4X23 A;  1AOI B;  4H9O B;  2BYK B;  2FJ7 D;  3TU4 C;  1P3O A;  5B2I A;  5AVC D;  4KGC C;  5B32 G;  5AVB D;  2FJ7 B;  1P3A C;  3LJA A;  4J8U D;  1P3I D;  3AFA C;  3AZK D;  1KX3 A;  2NQB C;  3VH5 T;  5AV9 A;  1P3I B;  1P3G A;  4JJN C;  5B1L C;  5GXQ D;  4WU8 A;  3X1T B;  1P3K A;  1KX5 A;  1ZLA B;  4H9Q A;  3MNN D;  5GXQ B;  5BS7 C;  3MVD D;  3AZE D;  5DNM C;  2YFW B;  3X1U A;  3AZM C;  1M1A D;  2F8N D;  3REK C;  5B33 C;  1F66 A;  1ID3 C;  4Z5T B;  1P3F A;  4Z66 C;  1M1A B;  3WKJ D;  3W96 D;  5AY8 B;  5AV6 A;  1P3B D;  4YM6 A;  5CPI B;  5G49 B;  4J8X A;  3AZF B;  3AN2 C;  1P34 A;  5JRG A;  5DNN C;  1P3P C;  1M18 B;  5JA4 B;  1TAF A;  3WTP D;  4KGC A;  3W99 B;  3A6N B;  1P3A A;  2ARO A;  3KUY D;  4XUJ C;  5B40 C;  3LEL B;  5AV8 C;  4J8V B;  4JJN A;  5B24 D;  3WAA D;  3MGR D;  3NQJ B;  1BH8 B;  4X23 B;  5DNM A;  1M19 D;  1U35 D;  3MGP C;  3AZM A;  5GSU D;  5B33 A;  5AV5 D;  3LJA B;  4YS3 D;  1HQ3 A;  5B2J C;  1S32 C;  1KX3 B;  4YS3 B;  3AV2 C;  3KXB B;  2HIO D;  4HGA C;  3W97 C;  3MGS B;  3REJ D;  2CV5 C;  3B6G C;  3UT9 D;  3WA9 C;  4LD9 C;  5B32 D;  5F99 A;  4WU9 D;  4XUJ A;  5B40 A;  1P3L A;  3X1S B;  4YM6 B;  1HTA A;  3W98 C;  4EO5 B;  5CP6 A;  3AZL A;  3O62 D;  1P34 B;  1H3O B;  4ZUX C;  1TAF B;  5B31 C;  3TU4 B;  1P3M A;  1BFM A;  3MGP A;  1R4V A;  5B0Z D;  3AZI C;  3X1V C;  4QLC C;  1S32 A;  5B2J A;  3AFA B;  2NQB B;  5B1M C;  3AV2 A;  3AZN C;  3REL C;  4JJN B;  5B1L B;  1EQZ D;  3W97 A;  3AYW C;  4XZQ C;  5B0Y C;  3C1B D;  3B6F C;  5DNM B;  2LY8 A;  3AZM B;  3REK B;  3UTB C;  5B33 B;  1ID3 B;  3C1C A;  4Z66 B;  3KWQ C;  3LZ0 D;  4KUD C;  3VH6 W;  5CPJ A;  4NE3 A;  1P3O C;  3AN2 B;  1P3P B;  5DNN B;  4WNN A;  5BO0 B;  4ZUX A;  4G91 C;  5B31 A;  3LZ1 A;  3AZI A;  3AZG C;  5AV9 C;  4J8W D;  5B40 B;  4XUJ B;  4WU8 C;  1KX5 C;  5GT3 C;  5AV8 B;  3R45 A;  3REL A;  5FUG B;  1KX4 D;  4R8P D;  3AZK A;  3X1U C;  4XZQ A;  5BT1 C;  3B6F A;  2NZD A;  1TZY C;  1B67 A;  3MGP B;  3AZH C;  1F66 C;  1P3F C;  5CPK D;  4KHA B;  2RVQ C;  5AV6 C;  3REH D;  3AZJ D;  1S32 B;  5B2J B;  3AV1 D;  3KWQ A;  1AOI D;  4NFT A;  3AV2 B;  3MVD A;  4J8X C;  4HGA B;  2F8N A;  5E5A C;  3W97 B;  3W96 A;  2CV5 B;  1P3B A;  1JFI A;  3B6G B;  2ARO C;  3WA9 B;  3X1T D;  3UTA C;  1ZLA D;  4LD9 B;  5BNV A;  3AZG A;  3VH6 A;  5GT3 A;  5KDM A;  4UUZ B;  3W98 B;  3KUY A;  2YFV B;  5GT0 C;  4Z5T D;  5B31 B;  3MGQ D;  5AY8 D;  1TZY A;  3AZH A;  1HQ3 C;  3WAA A;  3MGQ B;  3X1V B;  5CPI D;  4QLC B;  3AZF D;  1M18 D;  5B1M B;  4H9N B;  3AZN B;  3REL B;  1M19 A;  3W99 D;  1U35 A;  3AYW D;  3A6N D;  2F8N H;  5E5A A;  5AV5 A;  5B0Y D;  3AYW B;  5B0Y B;  3LEL D;  4J8V D;  5F99 C;  2HIO A;  3UTA A;  3UTB B;  1BH9 A;  1P3L C;  2IO5 C;  4X23 D;  2PYO C;  4KUD B;  5CP6 C;  3AZL C;  5B2I D;  3UT9 A;  4H9P B;  3LJA D;  1P3M C;  5B2I B;  1P3O B;  5GT0 A;  4WU9 A;  1KX3 D;  3REI C;  1JFI B;  1P3G D;  3KXB D;  4H9R A;  4AWL B;  1P3K D;  3AZG B;  5BNX A;  5AV9 B;  1P3G B;  4WU8 B;  3MGS D;  5GT3 B;  1P3K B;  1KX5 B;  4H9Q B;  5B0Z A;  2BYM A;  4CAY A;  3X1U B;  4ZBJ C;  3X1S D;  4YM6 D;  1F66 B;  3C1C C;  1P3F B;  5AV6 B;  5CPJ C;  1P34 D;  5JRG D;  2PYO A;  3C1B A;  3TU4 D;  4J8X B;  4KGC D;  3NQU A;  5JRG B;  5E5A B;  3LZ1 C;  1P3A D;  4KGC B;  3AFA D;  3REI A;  1P3A B;  2NQB D;  2ARO B;  4JJN D;  5B1L D;  2FJ7 C;  5B31 G;  5AVC C;  5AVB C;  3V9R A;  4J8U C;  5DNM D;  1P3I C;  3AZM D;  3REK D;  3AZK C;  5B33 D;  4DRB A;  1ID3 D;  2NZD C;  4Z66 D;  5GXQ C;  1HQ3 B;  3MNN C;  1KX4 A;  4CSR A;  4R8P A;  2HUE C;  3MVD C;  3AZE C;  3AN2 D;  1P3P D;  5DNN D;  1M1A C;  5CPK A;  3WKJ C;  3W96 C;  4G92 C;  2BYM B;  3AZJ A;  1P3B C;  3AV1 A;  4NE5 A;  4XUJ D;  4H9O A;  2BYK A;  5B40 D;  5AV8 D;  2F8N G;  5F99 B;  3B0D C;  2FJ7 A;  1P3L B;  5AVC A;  3WTP C;  2IO5 B;  5AVB A;  2PYO B;  5CP6 B;  3AZL B;  4J8U A;  1P3I A;  3MGP D;  3KUY C;  3X1T A;  4Z2M H;  1P3M B;  1S32 D;  5B2J D;  3B0C W;  5GXQ A;  5B24 C;  3WAA C;  3AV2 D;  3MGR C;  2YFW A;  3MNN A;  4DRA A;  3AZE A;  3W97 D;  1M19 C;  1U35 C;  1M1A A;  5GSU C;  5AV5 C;  2CV5 D;  4YS3 C;  3B6G D;  3WA9 D;  3WKJ A;  4LD9 D;  3C1C D;  2HIO C;  1M18 A;  4ZBJ B;  5JA4 A;  3W99 A;  3C1C B;  3A6N A;  3W98 D;  3REJ C;  1B6W A;  3WTP A;  5CPJ B;  1ULY A;  4ZUX D;  3UT9 C;  3LZ1 D;  5B31 D;  5B32 C;  3LEL A;  4J8V A;  3WTP E;  4WNN B;  4WV4 B;  4ZUX B;  3LZ1 B;  4WU9 C;  3AZI D;  3X1V D;  4QLC D;  3NQJ A;  5B24 A;  1BH8 A;  3AZI B;  5B1M D;  3AZN D;  3MGR A;  3REL D;  2NZD D;  3O62 C;  5AVC B;  3R45 B;  5AVB B;  2JSS A;  4WZS B;  5GSU A;  4XZQ D;  5B0Z C;  4YS3 A;  3B6F D;  4J8U B;  3KXB A;  4E44 A;  3UTB D;  3AZK B;  4XZQ B;  1WWS A;  3B6F B;  2NZD B;  1EQZ C;  3KWQ D;  3MGS A;  4H9S C;  4KUD D;  3MNN B;  3KWQ B;  3REJ A;  3C1B C;  2HUE B;  3MVD B;  3AZE B;  1P3O D;  2F8N B;  3X1S A;  5B32 A;  4G91 B;  3WKJ B;  1N1J A;  4G92 B;  3LZ0 C;  3AZG D;  1P3B B;  3W96 B;  5AV9 D;  1H3O A;  4WU8 D;  1KX5 D;  5GT3 D;  5BNV B;  3TU4 A;  3O62 A;  3B0D B;  3VH6 T;  3WTP B;  5KDM B;  3AFA A;  3X1U D;  5CHL B;  5BT1 D;  2NQB A;  1WWI A;  1TZY D;  1F66 D;  3KUY B;  5B1L A;  3AZH D;  4J8W C;  1P3F D;  1KU5 A;  2RVQ D;  5AV6 D;  1TZY B;  1A7W A;  1EQZ A;  3AZH B;  5C3I C;  5B24 B;  4H9S A;  1KX4 C;  5BS7 A;  3WAA B;  4Z2M G;  4J8X D;  4R8P C;  3MGR B;  3REK A;  5E5A D;  1ID3 A;  1M19 B;  1U35 B;  4Z66 A;  5GSU B;  5CPK C;  5AV5 B;  3VH5 W;  4M6B A;  3AZJ C;  2ARO D;  3REH C;  3AV1 C;  3B0B A;  3UTA D;  1F1E A;  3B0C T;  3LZ0 A;  1AOI C;  3AN2 A;  1P3P A;  5DNN A;  2HIO B;  5BO0 A;  3UTA B;  1BH9 B;  3REJ B;  5GT0 D;  3UT9 B;  3X1T C;  1ZLA C;  5B32 B;  5AV8 A;  4NE6 A;  5FUG A;  5GT0 B;  4J8W A;  1HQ3 D;  4WU9 B;  1N1J B;  4H9R B;  5BNX B;  3O62 B;  4Z5T C;  3KSY A;  4KHA A;  3MGQ C;  5AY8 C;  2CWE A;  5B0Z B;  5CPI C;  4E45 A;  4CAY B;  3REH A;  5F99 D;  3AZF C;  1M18 C;  1P3L D;  1AOI A;  1EQZ B;  3W99 C;  3A6N C;  2PYO D;  5CP6 D;  3AZL D;  2CV5 A;  3B6G A;  3WA9 A;  4LD9 A;  3C1B B; 
#chains in the Genus database with same CATH topology
 1P3M D;  3LEL C;  3VH5 A;  4J8V C;  3FDD A;  3NQU B;  1ZLA A;  3REI D;  4UUZ A;  3W98 A;  2L5A A;  4X23 C;  3LZ0 B;  3REI B;  5B2I C;  2YFV A;  3LJA C;  4Z5T A;  4AWL C;  3MGQ A;  3V9R B;  3X1V A;  5AY8 A;  4QLC A;  1KX3 C;  1P3G C;  3KXB C;  2F8N K;  1P3K C;  5B1M A;  4H9N A;  5G49 A;  5CPI A;  3AZN A;  3AZF A;  4J8W B;  3MGS C;  5CPJ D;  5C3I B;  3AYW A;  1Q9C A;  1KX4 B;  5B0Y A;  4CSR B;  4R8P B;  3UTB A;  3F6T A;  3X1S C;  4YM6 C;  5CPK B;  4KUD A;  4EO5 C;  3AZJ B;  3REH B;  3P5J B;  3AV1 B;  4H9P A;  5JRG C;  1P34 C;  4X23 A;  1AOI B;  4H9O B;  2BYK B;  2FJ7 D;  3TU4 C;  1P3O A;  5B2I A;  5AVC D;  4KGC C;  5B32 G;  5AVB D;  2UWX A;  2FJ7 B;  1P3A C;  3LJA A;  4J8U D;  1P3I D;  3AFA C;  3AZK D;  1KX3 A;  2NQB C;  3VH5 T;  5AV9 A;  1P3I B;  1P3G A;  4JJN C;  5B1L C;  5GXQ D;  4WU8 A;  3X1T B;  1P3K A;  1KX5 A;  1ZLA B;  4H9Q A;  3MNN D;  5GXQ B;  5BS7 C;  3MVD D;  3AZE D;  5DNM C;  2YFW B;  3X1U A;  3AZM C;  1M1A D;  2F8N D;  3REK C;  5B33 C;  1F66 A;  1ID3 C;  4Z5T B;  1P3F A;  4Z66 C;  1M1A B;  3WKJ D;  3W96 D;  5AY8 B;  5AV6 A;  1P3B D;  4YM6 A;  5CPI B;  5G49 B;  4J8X A;  3AZF B;  2XD1 A;  3AN2 C;  1P34 A;  5JRG A;  5DNN C;  1P3P C;  1M18 B;  5JA4 B;  1TAF A;  3WTP D;  4KGC A;  3W99 B;  3A6N B;  1P3A A;  2ARO A;  3KUY D;  2G5I C;  4XUJ C;  5B40 C;  2JE5 A;  3LEL B;  5AV8 C;  4J8V B;  4JJN A;  5B24 D;  3WAA D;  3MGR D;  3NQJ B;  2DF4 C;  1BH8 B;  4X23 B;  5DNM A;  1M19 D;  1U35 D;  3MGP C;  3AZM A;  5GSU D;  5B33 A;  5AV5 D;  3LJA B;  4YS3 D;  4WJ3 C;  1HQ3 A;  5B2J C;  1S32 C;  1KX3 B;  2Y2M A;  2ZY4 A;  3AV2 C;  4YS3 B;  3KXB B;  2HIO D;  2J8P A;  4HGA C;  3W97 C;  3MGS B;  3REJ D;  2CV5 C;  3B6G C;  3UT9 D;  3WA9 C;  4LD9 C;  5B32 D;  5F99 A;  4WU9 D;  4XUJ A;  5B40 A;  1P3L A;  3X1S B;  2VQR A;  4YM6 B;  1HTA A;  3W98 C;  4EO5 B;  5CP6 A;  3AZL A;  3O62 D;  1P34 B;  1H3O B;  4ZUX C;  1TAF B;  5B31 C;  3TU4 B;  1P3M A;  1BFM A;  3MGP A;  1R4V A;  2ZY2 A;  5B0Z D;  3AZI C;  3X1V C;  4QLC C;  3EPK A;  5B2J A;  3AFA B;  1S32 A;  2NQB B;  5B1M C;  3AV2 A;  3AZN C;  3REL C;  4JJN B;  5B1L B;  1EQZ D;  2Y2J A;  3EPH A;  3W97 A;  3AYW C;  4XZQ C;  5B0Y C;  3C1B D;  3B6F C;  5DNM B;  2LY8 A;  3AZM B;  3REK B;  3UTB C;  5B33 B;  1ID3 B;  3C1C A;  4Z66 B;  3KWQ C;  4UPK A;  3LZ0 D;  4KUD C;  3VH6 W;  5CPJ A;  4NE3 A;  1P3O C;  3AN2 B;  3AL0 C;  1P3P B;  5DNN B;  4WNN A;  5BO0 B;  4ZUX A;  4G91 C;  5B31 A;  3LZ1 A;  3AZI A;  3AZG C;  5AV9 C;  4J8W D;  5B40 B;  4XUJ B;  4WU8 C;  1KX5 C;  5GT3 C;  5AV8 B;  3R45 A;  3REL A;  5FUG B;  1KX4 D;  4R8P D;  3AZK A;  3X1U C;  4XZQ A;  5BT1 C;  3B6F A;  2NZD A;  1TZY C;  1B67 A;  3MGP B;  3AZH C;  1F66 C;  1P3F C;  5CPK D;  4KHA B;  2RVQ C;  5AV6 C;  3REH D;  3AZJ D;  1S32 B;  5B2J B;  3AV1 D;  3KWQ A;  1AOI D;  4NFT A;  3AV2 B;  3MVD A;  4J8X C;  4HGA B;  2ZY5 A;  2F8N A;  5E5A C;  3W97 B;  2ZY3 A;  3W96 A;  2CV5 B;  1P3B A;  1JFI A;  3B6G B;  2ARO C;  3WA9 B;  3X1T D;  3UTA C;  2G5H C;  1ZLA D;  5BNV A;  3AZG A;  4LD9 B;  3VH6 A;  5GT3 A;  5KDM A;  4UUZ B;  2BG1 A;  3W98 B;  3KUY A;  2YFV B;  5GT0 C;  4Z5T D;  5B31 B;  3MGQ D;  5AY8 D;  1TZY A;  2ZM5 A;  3AZH A;  1HQ3 C;  3WAA A;  3MGQ B;  3X1V B;  5CPI D;  4QLC B;  3AZF D;  1M18 D;  2RIQ A;  5B1M B;  4H9N B;  3AZN B;  3REL B;  1M19 A;  3W99 D;  1U35 A;  3AYW D;  3A6N D;  2F8N H;  5E5A A;  5AV5 A;  5B0Y D;  3AYW B;  5B0Y B;  3LEL D;  4J8V D;  5F99 C;  2HIO A;  3UTA A;  3UTB B;  1BH9 A;  1P3L C;  2IO5 C;  4X23 D;  2PYO C;  4KUD B;  5CP6 C;  3AZL C;  5B2I D;  3UT9 A;  4H9P B;  3H0R C;  3LJA D;  1P3M C;  5B2I B;  1P3O B;  5GT0 A;  4WU9 A;  1KX3 D;  3REI C;  1JFI B;  1P3G D;  3KXB D;  4H9R A;  4AWL B;  1P3K D;  3AZG B;  5BNX A;  5AV9 B;  1P3G B;  4WU8 B;  3MGS D;  5GT3 B;  1P3K B;  1KX5 B;  4H9Q B;  5B0Z A;  2BYM A;  4CAY A;  3IP4 C;  3X1U B;  4ZBJ C;  3X1S D;  4YM6 D;  1F66 B;  3C1C C;  1P3F B;  5AV6 B;  5CPJ C;  1P34 D;  5JRG D;  2PYO A;  3C1B A;  3TU4 D;  3KFU G;  4J8X B;  4KGC D;  3NQU A;  5JRG B;  5E5A B;  3LZ1 C;  1P3A D;  4KGC B;  3AFA D;  2Y2P A;  3REI A;  1P3A B;  2NQB D;  2ARO B;  4JJN D;  5B1L D;  2FJ7 C;  5B31 G;  5AVC C;  5AVB C;  3V9R A;  4J8U C;  5DNM D;  1P3I C;  3AZM D;  3REK D;  3AZK C;  5B33 D;  4DRB A;  1ID3 D;  2NZD C;  2JCH A;  4Z66 D;  5GXQ C;  1HQ3 B;  3MNN C;  1KX4 A;  4CSR A;  4R8P A;  2HUE C;  3MVD C;  3AZE C;  3AN2 D;  1P3P D;  5DNN D;  1M1A C;  5CPK A;  3WKJ C;  3W96 C;  4G92 C;  2BYM B;  2Y2K A;  3AZJ A;  1P3B C;  3AV1 A;  2XD5 A;  4NE5 A;  4XUJ D;  4H9O A;  2BYK A;  5B40 D;  5AV8 D;  2F8N G;  5F99 B;  3B0D C;  2FJ7 A;  1P3L B;  5AVC A;  3WTP C;  2IO5 B;  5AVB A;  2W8S A;  2PYO B;  5CP6 B;  3AZL B;  4J8U A;  1P3I A;  2Y2G A;  3MGP D;  3KUY C;  1PZR A;  3X1T A;  4Z2M H;  1P3M B;  1S32 D;  5B2J D;  3B0C W;  5GXQ A;  5B24 C;  3WAA C;  3AV2 D;  3MGR C;  2FFF B;  2YFW A;  3MNN A;  4DRA A;  3AZE A;  3W97 D;  1M19 C;  1U35 C;  1M1A A;  2Y2L A;  5GSU C;  3H0M C;  5AV5 C;  2CV5 D;  4YS3 C;  3B6G D;  3WA9 D;  2F2A C;  3WKJ A;  4LD9 D;  3C1C D;  2HIO C;  1M18 A;  4ZBJ B;  5JA4 A;  2DQN C;  3W99 A;  3C1C B;  3A6N A;  3W98 D;  3REJ C;  1B6W A;  3WTP A;  5CPJ B;  1ULY A;  4ZUX D;  3UT9 C;  3LZ1 D;  5B31 D;  5B32 C;  1T3U A;  3LEL A;  4J8V A;  3WTP E;  4DQY B;  4WNN B;  4WV4 B;  4ZUX B;  3LZ1 B;  4WU9 C;  3AZI D;  3X1V D;  4QLC D;  3NQJ A;  2Y2O A;  5B24 A;  1BH8 A;  3AZI B;  5B1M D;  3AZN D;  3MGR A;  3REL D;  2NZD D;  3O62 C;  3A1K A;  3H0L C;  5AVC B;  3R45 B;  5AVB B;  2JSS A;  4WZS B;  5GSU A;  4XZQ D;  5B0Z C;  4YS3 A;  3B6F D;  4J8U B;  3KXB A;  4E44 A;  3UTB D;  3AZK B;  4XZQ B;  1WWS A;  3B6F B;  2NZD B;  1EQZ C;  3KWQ D;  3MGS A;  4H9S C;  4KUD D;  3MNN B;  3KWQ B;  3REJ A;  3EPL A;  3C1B C;  2HUE B;  3MVD B;  3AZE B;  1P3O D;  2F8N B;  3X1S A;  5B32 A;  2Y2I A;  4G91 B;  3WKJ B;  1N1J A;  4G92 B;  3LZ0 C;  3AZG D;  1P3B B;  3W96 B;  5AV9 D;  1H3O A;  4WU8 D;  1KX5 D;  5GT3 D;  5BNV B;  3TU4 A;  3O62 A;  3B0D B;  3VH6 T;  3WTP B;  5KDM B;  3AFA A;  3X1U D;  5CHL B;  5BT1 D;  2NQB A;  1WWI A;  1TZY D;  1F66 D;  3KUY B;  5B1L A;  3AZH D;  4J8W C;  1P3F D;  1KU5 A;  2RVQ D;  5AV6 D;  1TZY B;  1A7W A;  3A1I A;  3AZH B;  5C3I C;  5B24 B;  1EQZ A;  4H9S A;  1KX4 C;  5BS7 A;  3WAA B;  4Z2M G;  4J8X D;  4R8P C;  3MGR B;  3REK A;  5E5A D;  1ID3 A;  1M19 B;  1U35 B;  1Z2C B;  2Y2H A;  4Z66 A;  5GSU B;  5CPK C;  5AV5 B;  3VH5 W;  4M6B A;  3AZJ C;  2ARO D;  3REH C;  3AV1 C;  3B0B A;  3UTA D;  1F1E A;  3B0C T;  3LZ0 A;  1AOI C;  3AN2 A;  1P3P A;  5DNN A;  2HIO B;  5BO0 A;  3UTA B;  1BH9 B;  3REJ B;  5GT0 D;  3UT9 B;  3X1T C;  1ZLA C;  5B32 B;  3EPJ A;  5AV8 A;  4NE6 A;  5FUG A;  3EG5 B;  5GT0 B;  4J8W A;  1HQ3 D;  4WU9 B;  1N1J B;  4H9R B;  2Y2N A;  5BNX B;  3O62 B;  4Z5T C;  3KSY A;  4KHA A;  3MGQ C;  5AY8 C;  2CWE A;  5B0Z B;  5CPI C;  4E45 A;  4CAY B;  3REH A;  5F99 D;  3AZF C;  1W2E A;  1M18 C;  1P3L D;  1AOI A;  1EQZ B;  3W99 C;  3A6N C;  2PYO D;  2Y2Q A;  5CP6 D;  3AZL D;  2CV5 A;  3B6G A;  3WA9 A;  4LD9 A;  3C1B B; 
#chains in the Genus database with same CATH homology
 1P3M D;  3LEL C;  3VH5 A;  4J8V C;  3FDD A;  3NQU B;  1ZLA A;  3REI D;  4UUZ A;  3W98 A;  2L5A A;  4X23 C;  3LZ0 B;  3REI B;  5B2I C;  2YFV A;  3LJA C;  4Z5T A;  4AWL C;  3MGQ A;  3V9R B;  3X1V A;  5AY8 A;  4QLC A;  1KX3 C;  1P3G C;  3KXB C;  2F8N K;  1P3K C;  5B1M A;  4H9N A;  5G49 A;  5CPI A;  3AZN A;  3AZF A;  4J8W B;  3MGS C;  5CPJ D;  5C3I B;  3AYW A;  1Q9C A;  1KX4 B;  5B0Y A;  4CSR B;  4R8P B;  3UTB A;  3F6T A;  3X1S C;  4YM6 C;  5CPK B;  4KUD A;  4EO5 C;  3AZJ B;  3REH B;  3P5J B;  3AV1 B;  4H9P A;  5JRG C;  1P34 C;  4X23 A;  1AOI B;  4H9O B;  2BYK B;  2FJ7 D;  3TU4 C;  1P3O A;  5B2I A;  5AVC D;  4KGC C;  5B32 G;  5AVB D;  2UWX A;  2FJ7 B;  1P3A C;  3LJA A;  4J8U D;  1P3I D;  3AFA C;  3AZK D;  1KX3 A;  2NQB C;  3VH5 T;  5AV9 A;  1P3I B;  1P3G A;  4JJN C;  5B1L C;  5GXQ D;  4WU8 A;  3X1T B;  1P3K A;  1KX5 A;  1ZLA B;  4H9Q A;  3MNN D;  5GXQ B;  5BS7 C;  3MVD D;  3AZE D;  5DNM C;  2YFW B;  3X1U A;  3AZM C;  1M1A D;  2F8N D;  3REK C;  5B33 C;  1F66 A;  1ID3 C;  4Z5T B;  1P3F A;  4Z66 C;  1M1A B;  3WKJ D;  3W96 D;  5AY8 B;  5AV6 A;  1P3B D;  4YM6 A;  5CPI B;  5G49 B;  4J8X A;  3AZF B;  2XD1 A;  3AN2 C;  1P34 A;  5JRG A;  5DNN C;  1P3P C;  1M18 B;  5JA4 B;  1TAF A;  3WTP D;  4KGC A;  3W99 B;  3A6N B;  1P3A A;  2ARO A;  3KUY D;  2G5I C;  4XUJ C;  5B40 C;  2JE5 A;  3LEL B;  5AV8 C;  4J8V B;  4JJN A;  5B24 D;  3WAA D;  3MGR D;  3NQJ B;  2DF4 C;  1BH8 B;  4X23 B;  5DNM A;  1M19 D;  1U35 D;  3MGP C;  3AZM A;  5GSU D;  5B33 A;  5AV5 D;  3LJA B;  4YS3 D;  4WJ3 C;  1HQ3 A;  5B2J C;  1S32 C;  1KX3 B;  2Y2M A;  2ZY4 A;  3AV2 C;  4YS3 B;  3KXB B;  2HIO D;  2J8P A;  4HGA C;  3W97 C;  3MGS B;  3REJ D;  2CV5 C;  3B6G C;  3UT9 D;  3WA9 C;  4LD9 C;  5B32 D;  5F99 A;  4WU9 D;  4XUJ A;  5B40 A;  1P3L A;  3X1S B;  2VQR A;  4YM6 B;  1HTA A;  3W98 C;  4EO5 B;  5CP6 A;  3AZL A;  3O62 D;  1P34 B;  1H3O B;  4ZUX C;  1TAF B;  5B31 C;  3TU4 B;  1P3M A;  1BFM A;  3MGP A;  1R4V A;  2ZY2 A;  5B0Z D;  3AZI C;  3X1V C;  4QLC C;  3EPK A;  5B2J A;  3AFA B;  1S32 A;  2NQB B;  5B1M C;  3AV2 A;  3AZN C;  3REL C;  4JJN B;  5B1L B;  1EQZ D;  2Y2J A;  3EPH A;  3W97 A;  3AYW C;  4XZQ C;  5B0Y C;  3C1B D;  3B6F C;  5DNM B;  2LY8 A;  3AZM B;  3REK B;  3UTB C;  5B33 B;  1ID3 B;  3C1C A;  4Z66 B;  3KWQ C;  4UPK A;  3LZ0 D;  4KUD C;  3VH6 W;  5CPJ A;  4NE3 A;  1P3O C;  3AN2 B;  3AL0 C;  1P3P B;  5DNN B;  4WNN A;  5BO0 B;  4ZUX A;  4G91 C;  5B31 A;  3LZ1 A;  3AZI A;  3AZG C;  5AV9 C;  4J8W D;  5B40 B;  4XUJ B;  4WU8 C;  1KX5 C;  5GT3 C;  5AV8 B;  3R45 A;  3REL A;  5FUG B;  1KX4 D;  4R8P D;  3AZK A;  3X1U C;  4XZQ A;  5BT1 C;  3B6F A;  2NZD A;  1TZY C;  1B67 A;  3MGP B;  3AZH C;  1F66 C;  1P3F C;  5CPK D;  4KHA B;  2RVQ C;  5AV6 C;  3REH D;  3AZJ D;  1S32 B;  5B2J B;  3AV1 D;  3KWQ A;  1AOI D;  4NFT A;  3AV2 B;  3MVD A;  4J8X C;  4HGA B;  2ZY5 A;  2F8N A;  5E5A C;  3W97 B;  2ZY3 A;  3W96 A;  2CV5 B;  1P3B A;  1JFI A;  3B6G B;  2ARO C;  3WA9 B;  3X1T D;  3UTA C;  2G5H C;  1ZLA D;  5BNV A;  3AZG A;  4LD9 B;  3VH6 A;  5GT3 A;  5KDM A;  4UUZ B;  2BG1 A;  3W98 B;  3KUY A;  2YFV B;  5GT0 C;  4Z5T D;  5B31 B;  3MGQ D;  5AY8 D;  1TZY A;  2ZM5 A;  3AZH A;  1HQ3 C;  3WAA A;  3MGQ B;  3X1V B;  5CPI D;  4QLC B;  3AZF D;  1M18 D;  2RIQ A;  5B1M B;  4H9N B;  3AZN B;  3REL B;  1M19 A;  3W99 D;  1U35 A;  3AYW D;  3A6N D;  2F8N H;  5E5A A;  5AV5 A;  5B0Y D;  3AYW B;  5B0Y B;  3LEL D;  4J8V D;  5F99 C;  2HIO A;  3UTA A;  3UTB B;  1BH9 A;  1P3L C;  2IO5 C;  4X23 D;  2PYO C;  4KUD B;  5CP6 C;  3AZL C;  5B2I D;  3UT9 A;  4H9P B;  3H0R C;  3LJA D;  1P3M C;  5B2I B;  1P3O B;  5GT0 A;  4WU9 A;  1KX3 D;  3REI C;  1JFI B;  1P3G D;  3KXB D;  4H9R A;  4AWL B;  1P3K D;  3AZG B;  5BNX A;  5AV9 B;  1P3G B;  4WU8 B;  3MGS D;  5GT3 B;  1P3K B;  1KX5 B;  4H9Q B;  5B0Z A;  2BYM A;  4CAY A;  3IP4 C;  3X1U B;  4ZBJ C;  3X1S D;  4YM6 D;  1F66 B;  3C1C C;  1P3F B;  5AV6 B;  5CPJ C;  1P34 D;  5JRG D;  2PYO A;  3C1B A;  3TU4 D;  3KFU G;  4J8X B;  4KGC D;  3NQU A;  5JRG B;  5E5A B;  3LZ1 C;  1P3A D;  4KGC B;  3AFA D;  2Y2P A;  3REI A;  1P3A B;  2NQB D;  2ARO B;  4JJN D;  5B1L D;  2FJ7 C;  5B31 G;  5AVC C;  5AVB C;  3V9R A;  4J8U C;  5DNM D;  1P3I C;  3AZM D;  3REK D;  3AZK C;  5B33 D;  4DRB A;  1ID3 D;  2NZD C;  2JCH A;  4Z66 D;  5GXQ C;  1HQ3 B;  3MNN C;  1KX4 A;  4CSR A;  4R8P A;  2HUE C;  3MVD C;  3AZE C;  3AN2 D;  1P3P D;  5DNN D;  1M1A C;  5CPK A;  3WKJ C;  3W96 C;  4G92 C;  2BYM B;  2Y2K A;  3AZJ A;  1P3B C;  3AV1 A;  2XD5 A;  4NE5 A;  4XUJ D;  4H9O A;  2BYK A;  5B40 D;  5AV8 D;  2F8N G;  5F99 B;  3B0D C;  2FJ7 A;  1P3L B;  5AVC A;  3WTP C;  2IO5 B;  5AVB A;  2W8S A;  2PYO B;  5CP6 B;  3AZL B;  4J8U A;  1P3I A;  2Y2G A;  3MGP D;  3KUY C;  1PZR A;  3X1T A;  4Z2M H;  1P3M B;  1S32 D;  5B2J D;  3B0C W;  5GXQ A;  5B24 C;  3WAA C;  3AV2 D;  3MGR C;  2FFF B;  2YFW A;  3MNN A;  4DRA A;  3AZE A;  3W97 D;  1M19 C;  1U35 C;  1M1A A;  2Y2L A;  5GSU C;  3H0M C;  5AV5 C;  2CV5 D;  4YS3 C;  3B6G D;  3WA9 D;  2F2A C;  3WKJ A;  4LD9 D;  3C1C D;  2HIO C;  1M18 A;  4ZBJ B;  5JA4 A;  2DQN C;  3W99 A;  3C1C B;  3A6N A;  3W98 D;  3REJ C;  1B6W A;  3WTP A;  5CPJ B;  1ULY A;  4ZUX D;  3UT9 C;  3LZ1 D;  5B31 D;  5B32 C;  1T3U A;  3LEL A;  4J8V A;  3WTP E;  4DQY B;  4WNN B;  4WV4 B;  4ZUX B;  3LZ1 B;  4WU9 C;  3AZI D;  3X1V D;  4QLC D;  3NQJ A;  2Y2O A;  5B24 A;  1BH8 A;  3AZI B;  5B1M D;  3AZN D;  3MGR A;  3REL D;  2NZD D;  3O62 C;  3A1K A;  3H0L C;  5AVC B;  3R45 B;  5AVB B;  2JSS A;  4WZS B;  5GSU A;  4XZQ D;  5B0Z C;  4YS3 A;  3B6F D;  4J8U B;  3KXB A;  4E44 A;  3UTB D;  3AZK B;  4XZQ B;  1WWS A;  3B6F B;  2NZD B;  1EQZ C;  3KWQ D;  3MGS A;  4H9S C;  4KUD D;  3MNN B;  3KWQ B;  3REJ A;  3EPL A;  3C1B C;  2HUE B;  3MVD B;  3AZE B;  1P3O D;  2F8N B;  3X1S A;  5B32 A;  2Y2I A;  4G91 B;  3WKJ B;  1N1J A;  4G92 B;  3LZ0 C;  3AZG D;  1P3B B;  3W96 B;  5AV9 D;  1H3O A;  4WU8 D;  1KX5 D;  5GT3 D;  5BNV B;  3TU4 A;  3O62 A;  3B0D B;  3VH6 T;  3WTP B;  5KDM B;  3AFA A;  3X1U D;  5CHL B;  5BT1 D;  2NQB A;  1WWI A;  1TZY D;  1F66 D;  3KUY B;  5B1L A;  3AZH D;  4J8W C;  1P3F D;  1KU5 A;  2RVQ D;  5AV6 D;  1TZY B;  1A7W A;  3A1I A;  3AZH B;  5C3I C;  5B24 B;  1EQZ A;  4H9S A;  1KX4 C;  5BS7 A;  3WAA B;  4Z2M G;  4J8X D;  4R8P C;  3MGR B;  3REK A;  5E5A D;  1ID3 A;  1M19 B;  1U35 B;  1Z2C B;  2Y2H A;  4Z66 A;  5GSU B;  5CPK C;  5AV5 B;  3VH5 W;  4M6B A;  3AZJ C;  2ARO D;  3REH C;  3AV1 C;  3B0B A;  3UTA D;  1F1E A;  3B0C T;  3LZ0 A;  1AOI C;  3AN2 A;  1P3P A;  5DNN A;  2HIO B;  5BO0 A;  3UTA B;  1BH9 B;  3REJ B;  5GT0 D;  3UT9 B;  3X1T C;  1ZLA C;  5B32 B;  3EPJ A;  5AV8 A;  4NE6 A;  5FUG A;  3EG5 B;  5GT0 B;  4J8W A;  1HQ3 D;  4WU9 B;  1N1J B;  4H9R B;  2Y2N A;  5BNX B;  3O62 B;  4Z5T C;  3KSY A;  4KHA A;  3MGQ C;  5AY8 C;  2CWE A;  5B0Z B;  5CPI C;  4E45 A;  4CAY B;  3REH A;  5F99 D;  3AZF C;  1W2E A;  1M18 C;  1P3L D;  1AOI A;  1EQZ B;  3W99 C;  3A6N C;  2PYO D;  2Y2Q A;  5CP6 D;  3AZL D;  2CV5 A;  3B6G A;  3WA9 A;  4LD9 A;  3C1B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...