3MGSB

Binding of cesium ions to the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsB00
1P3BC 3AZNA 5B0ZB 3WKJC 1M1AC 3AZKC 4XUJC 2F8NK 2RVQC 1P3KD 4X23D 4Z2MH 5JA4A 3A6NB 3X1TB 3VH5T 4DRAA 5B31D 5AV8A 4AWLC 5B24B 4JJNC 5GT3B 3AZLC 3AZMD 5CP6D 5AV6A 4J8VD 4XZQA 3WTPE 2NZDC 4WNNA 3NQJB 1ID3C 1P3PC 1KX5A 1P3KB 4ZBJB 4X23B 3MVDA 5B31B 5AV6C 3X1SA 4XZQC 3AZED 4J8UC 3AZJB 4H9SA 5B0YB 4WU9D 5DNMA 3W96B 1U35D 4J8VB 3B0CT 3AFAC 1EQZC 1S32A 4KGCD 1KX5C 1HQ3A 1P3IB 5KDMA 3RELC 1P3AA 3MVDC 4KUDD 5GSUD 3X1SC 1M18A 2L5AA 4H9SC 3C1CB 3MGPD 3KUYD 3AZEB 3REID 1F66A 3UT9D 4WU9B 1S32C 1HQ3C 5B33A 1P3AC 4H9RB 5B1MA 3REHA 1M18C 4E44A 1KX3D 3R45B 5DNND 1F66C 5B2JC 1BH9B 4NFTA 3MGPB 3KUYB 5B33C 4H9PB 2YFWA 1P3GD 5B1MC 4QLCA 2YFVA 3REHC 3WAAC 3REKA 3MGRD 3WTPD 3X1VA 5C3IC 2NQBD 2CWEA 1KX3B 3LZ1A 5AVBD 3LELA 2F8ND 5DNNB 4R8PB 3B6GC 5B32G 1P3LD 4QLCC 3W98D 5BNXA 3REKC 3X1VC 1P3GB 5E5AC 4NE5A 5CPKB 1KX4C 5B40C 3B6FC 2HIOB 3KXBB 3NQUA 3LZ0B 3MGRB 2NQBB 5GXQD 5AVBB 3WA9B 1P34B 4LD9A 1P3LB 4J8XA 3W99D 5CPID 3O62B 2AROA 3LJAD 5B1LD 1M19A 5B2IB 2FJ7D 4KHAA 4LD9C 5GXQB 3AZNB 3AZFA 1P3MA 5AV9A 4WU8D 3AZMC 5AV5D 2CV5D 5CP6C 3W99B 5CPJD 4Z5TA 5AV8B 4ZUXD 3LJAB 3AV1D 2PYOD 2FJ7B 3REJA 5AY8D 3MGSB 1P3OA 2IO5C 5BO0A 1P3FD 4KUDA 4CAYB 2BYMA 4Z5TC 3AN2D 3AZEC 1B67A 5AV5B 3MGSD 1R4VA 4J8WD 1U35C 5CPJB 1TAFA 4KGCC 4ZUXB 3AZIA 4WZSB 5DNMB 1P3BA 1P3OC 2PYOB 4KUDC 5GSUC 3WKJA 5AY8B 1M1AA 1Q9CA 3X1UB 1N1JA 1P3FB 3MGQA 3V9RA 3TU4D 4EO5C 4YS3A 3REIC 3UT9C 2F8NH 4J8WB 3AZIC 4JJNA 4HGAC 5B32A 4WV4B 2NZDA 3MGQC 2BYKB 2JSSA 4YS3C 1ID3A 3TU4B 1P3PA 5BS7A 3KSYA 3AZJD 5B0YD 3W96D 5B32C 4J8UA 5JRGD 3W98A 4G91C 3WTPC 1P3ID 5B31G 3AFAA 1EQZA 4CSRA 5BS7C 3RELA 3C1CD 4YM6A 1B6WA 4NE6A 4UUZA 5BT1D 3LZ1B 3LELB 3W98C 3MNND 5AVCA 5JRGB 3KWQB 5BNXB 5FUGB 3C1BD 1H3OB 4YM6C 5F99A 3NQUB 1ZLAD 5AVCC 5B2JA 5CPIC 2CV5A 1AOID 3MNNB 3B0DC 5B1LC 3UTBB 3AZHD 5GT0D 5F99C 1TZYA 5G49A 3C1BB 3WAAA 2AROB 1M19B 4H9NA 4WU8C 3AZGA 4R8PD 4H9OA 2CV5C 4Z66A 3UTAD 3AZFB 1P3MB 1ZLAB 3B6GA 5AV9B 3AV2D 5CPKD 1TZYC 1AOIB 1JFIA 3W97D 3AZHB 5GT0B 2HIOD 3KXBD 3LZ0D 3AYWD 3AV1C 5E5AA 5B0ZA 2HUEC 5B40A 3AZGC 1KX4A 3B6FA 3WA9D 1P3FC 4Z66C 1P34D 3REJB 3X1TA 3AN2C 3A6NA 3AZKD 4XUJD 2RVQD 3MGSC 3UTAB 4G92C 3O62D 5B24A 5GT3A 3AV2B 4H9QB 5B0ZC 2F8NG 3W97B 5B2ID 3AYWB 3AZLD 1TAFB 3NQJA 3AZND 3X1TC 3A6NC 1P3BB 1P3KA 4X23A 3WKJB 5B24C 1WWSA 5GT3C 3AZKB 1M1AB 5BNVB 5B31A 1N1JB 4XUJB 5AV8D 3AZMA 5CP6A 4J8VA 5AV6D 1BH8B 4XZQD 4AWLB 3AZLB 1P3KC 4ZBJC 4X23C 5B31C 2NZDB 1KX5D 3AZJC 5JA4B 5B0YC 3W96C 3MVDD 4J8VC 1ID3B 3X1SD 3AZEA 4WU9A 1U35A 1P3IC 5DNMD 5AV6B 4XZQB 4KGCA 4J8UB 1S32D 3X1UD 4WNNB 1HQ3D 3AFAB 3C1CC 1P3AD 1EQZB 5GSUA 3R45A 1KX5B 1ULYA 1M18D 2LY8A 1BH9A 3RELB 4WU9C 3MVDB 3MGPA 4UUZB 3KUYA 3X1SB 3REIA 3UT9A 1F66D 4H9PA 3B0BA 1S32B 1HQ3B 5KDMB 5B1MD 3REHD 1P3AB 1KX3A 3MGPC 3KUYC 5DNNA 1M18B 4NE3A 1F66B 1A7WA 5B2JB 1P3GA 3VH6W 4QLCD 5B33B 1KX3C 2NQBA 3MGRA 3WTPA 3LZ0A 3REKD 3X1VD 5DNNC 5B1MB 3REHB 4R8PC 5AVBA 3WAAB 2F8NA 3LZ1D 3LELD 5C3IB 4H9NB 1P3GC 1P3LA 5CPKC 1JFIB 2HIOC 3KXBC 3LZ0C 3KWQD 3MGRC 3B6GB 2NQBC 2YFWB 4QLCB 2YFVB 5AVBC 3WA9C 3REKB 3X1VB 1P34C 5E5AB 5GXQA 1KX4B 5B40B 3B6FB 1P3LC 3O62C 4LD9D 1BFMA 4DRBA 3W99A 4J8XD 3UTBD 5CPIA 5B2IC 3LJAA 5GXQC 5B1LA 2AROD 3AZNC 1M19D 2FJ7A 1WWIA 3W99C 4CAYA 4WU8A 3AZFD 1P3MD 4LD9B 5AV9D 5AV8C 5AV5A 3VH6T 3LJAC 4J8XB 5CPJA 4Z5TD 2FJ7C 4ZUXA 3AZMB 5CP6B 3AV1A 2PYOA 4KHAB 5AY8A 3REJD 3X1UA 1P3FA 5AV5C 1P3OD 5CPJC 3AN2A 2IO5B 4ZUXC 3MGSA 4J8WA 5DNMC 4Z5TB 2PYOC 5AY8C 3X1UC 1U35B 3AZID 1P3BD 2BYKA 4KGCB 3WKJD 1M1AD 1P3OB 3TU4A 5BO0B 4J8WC 3MGQD 4KUDB 5GSUB 2BYMB 4YS3D 1F1EA 4EO5B 4JJND 3REIB 3UT9B 3AZIB 5B32D 4HGAB 3TU4C 2NZDD 1ID3D 3MGQB 3V9RB 1P3PD 3AZJA 5B0YA 3W96A 4YS3B 5JRGA 4JJNB 4J8UD 1P3IA 3KWQA 5FUGA 1H3OA 3AFAD 1HTAA 5B32B 1EQZD 4G91B 3LZ1C 3WTPB 3LELC 3C1CA 3RELD 4YM6D 1P3PB 2F8NB 5JRGC 3KWQC 1KU5A 4Z2MG 3MNNA 4H9RA 3UTBA 5AVCD 3W98B 3C1BA 5BT1C 4CSRB 5F99D 4YM6B 3MNNC 4J8XC 1ZLAA 3UTBC 5B2JD 3VH5W 3C1BC 1AOIA 2AROC 5B33D 5AVCB 5GT0A 3AZHA 5CPIB 1M19C 1TZYD 3WAAD 3B0DB 5B1LB 3VH5A 5CHLB 5F99B 3AZFC 1P3MC 4R8PA 1ZLAC 5AV9C 3AZGD 1AOIC 3UTAA 4Z66D 3AZHC 5GT0C 4WU8B 3AV2A 3B6GD 5CPKA 4H9QA 2CV5B 3W97A 4M6BA 2HIOA 3KXBA 3AYWA 5E5AD 1TZYB 3REJC 5G49B 5B0ZD 5B40D 1KX4D 3B6FD 3B0CW 3VH6A 3WA9A 3AV1B 1P34A 3UTAC 2HUEB 4E45A 3AZKA 3X1TD 5BNVA 4H9OB 3A6ND 4XUJA 3AZGB 3AV2C 4Z66B 3O62A 3W97C 3AYWC 3AN2B 5B24D 5GT3D 1BH8A 4G92B 5B2IA 3AZLA
chains in the Genus database with same CATH superfamily
1P3BC 3AZNA 5B0ZB 3WKJC 1M1AC 3AZKC 2G5HC 4XUJC 2F8NK 2RVQC 2Y2OA 1P3KD 4X23D 4Z2MH 5JA4A 3A6NB 3X1TB 3VH5T 4DRAA 5B31D 5AV8A 4AWLC 5B24B 4JJNC 5GT3B 3AZLC 3AZMD 5CP6D 5AV6A 4J8VD 4XZQA 3WTPE 2NZDC 4WNNA 3NQJB 1ID3C 1P3PC 1KX5A 1P3KB 4ZBJB 3H0MC 4X23B 3MVDA 5B31B 5AV6C 3X1SA 4XZQC 3AZED 4J8UC 3AZJB 4H9SA 5B0YB 4WU9D 5DNMA 3W96B 1U35D 3H0RC 4J8VB 3B0CT 3AFAC 1EQZC 1S32A 4KGCD 1KX5C 1HQ3A 1P3IB 5KDMA 3RELC 1P3AA 3MVDC 1W2EA 4KUDD 5GSUD 3X1SC 1M18A 2L5AA 4H9SC 3C1CB 2Y2PA 3MGPD 3KUYD 3AZEB 3REID 1F66A 3UT9D 4WU9B 1S32C 1HQ3C 5B33A 1P3AC 4H9RB 5B1MA 3REHA 1M18C 4E44A 1KX3D 3R45B 3EPLA 5DNND 1F66C 5B2JC 1BH9B 4NFTA 3MGPB 3KUYB 5B33C 4H9PB 2YFWA 1P3GD 5B1MC 2G5IC 2YFVA 4QLCA 3REHC 3WAAC 2XD1A 3REKA 3MGRD 3WTPD 3X1VA 5C3IC 2NQBD 2CWEA 1KX3B 3LZ1A 5AVBD 3LELA 2F8ND 3AL0C 5DNNB 4R8PB 3B6GC 5B32G 1P3LD 4QLCC 2ZY5A 3W98D 5BNXA 3REKC 3X1VC 1P3GB 5E5AC 4NE5A 5CPKB 1KX4C 5B40C 3B6FC 2W8SA 2HIOB 3KXBB 3NQUA 3LZ0B 3MGRB 2NQBB 5GXQD 5AVBB 3WA9B 1P34B 4LD9A 3EG5B 1P3LB 4J8XA 3W99D 5CPID 3O62B 2AROA 3LJAD 5B1LD 1M19A 5B2IB 2FJ7D 4KHAA 4LD9C 5GXQB 3AZNB 3AZFA 1P3MA 1Z2CB 5AV9A 4WU8D 3AZMC 5AV5D 2CV5D 5CP6C 3W99B 5CPJD 2Y2IA 4Z5TA 5AV8B 4ZUXD 3LJAB 2FFFB 3AV1D 2PYOD 2FJ7B 3REJA 5AY8D 3MGSB 1P3OA 2IO5C 5BO0A 3EPJA 1P3FD 4KUDA 4CAYB 2BYMA 4Z5TC 3AN2D 3AZEC 1B67A 5AV5B 3MGSD 1R4VA 2ZM5A 4J8WD 1U35C 5CPJB 1TAFA 4KGCC 4ZUXB 3AZIA 4WZSB 5DNMB 1P3BA 1P3OC 2PYOB 4KUDC 5GSUC 3WKJA 5AY8B 1M1AA 1Q9CA 3X1UB 1N1JA 1P3FB 3MGQA 2Y2QA 3V9RA 3TU4D 4EO5C 4YS3A 3REIC 3UT9C 2Y2LA 2F8NH 4J8WB 3AZIC 4JJNA 4HGAC 5B32A 4WV4B 2NZDA 3MGQC 2BYKB 2JSSA 4YS3C 1ID3A 3TU4B 1P3PA 5BS7A 3KSYA 3AZJD 5B0YD 3W96D 5B32C 4J8UA 5JRGD 3W98A 2ZY3A 4G91C 3WTPC 1P3ID 5B31G 3AFAA 1EQZA 4CSRA 5BS7C 3RELA 3C1CD 4YM6A 1B6WA 2Y2HA 4NE6A 4UUZA 5BT1D 3LZ1B 3LELB 3W98C 3MNND 5AVCA 5JRGB 3KWQB 5BNXB 5FUGB 3C1BD 1H3OB 4YM6C 5F99A 3NQUB 2XD5A 1ZLAD 5AVCC 5B2JA 5CPIC 2CV5A 1AOID 3MNNB 3B0DC 5B1LC 3UTBB 2BG1A 5GT0D 3AZHD 2UWXA 5F99C 1TZYA 5G49A 3C1BB 3WAAA 2AROB 1M19B 4H9NA 4WU8C 3AZGA 4R8PD 4H9OA 2CV5C 4Z66A 3UTAD 3AZFB 1P3MB 1ZLAB 3B6GA 5AV9B 3AV2D 5CPKD 1TZYC 1AOIB 1JFIA 3W97D 3AZHB 5GT0B 2HIOD 3KXBD 3LZ0D 3AYWD 3AV1C 5E5AA 5B0ZA 2HUEC 5B40A 3AZGC 1KX4A 3B6FA 3WA9D 1P3FC 4Z66C 1P34D 3REJB 3X1TA 3AN2C 3A6NA 3AZKD 4XUJD 2RVQD 3MGSC 3UTAB 4G92C 3O62D 5B24A 5GT3A 3AV2B 4H9QB 5B0ZC 2F8NG 2F2AC 3W97B 5B2ID 3AYWB 2Y2KA 3AZLD 1TAFB 3NQJA 3AZND 3X1TC 3A6NC 3EPHA 1P3BB 1P3KA 4X23A 3WKJB 5B24C 1WWSA 5GT3C 3AZKB 1M1AB 5BNVB 5B31A 1N1JB 4XUJB 5AV8D 3AZMA 5CP6A 4J8VA 5AV6D 1BH8B 4XZQD 4AWLB 3AZLB 1P3KC 4ZBJC 4X23C 5B31C 2NZDB 1KX5D 3AZJC 5JA4B 5B0YC 3W96C 3MVDD 4J8VC 1ID3B 3X1SD 3AZEA 4WU9A 1U35A 2DQNC 5DNMD 5AV6B 1P3IC 4XZQB 4KGCA 3A1KA 4J8UB 1S32D 3X1UD 4WNNB 1HQ3D 3AFAB 3C1CC 1P3AD 1EQZB 5GSUA 3R45A 1KX5B 1ULYA 1M18D 2LY8A 1BH9A 3RELB 4WU9C 3MVDB 3MGPA 4UUZB 3KUYA 3X1SB 3REIA 3UT9A 1F66D 4H9PA 2JCHA 3B0BA 1S32B 2J8PA 1HQ3B 5KDMB 5B1MD 3REHD 1P3AB 1KX3A 3MGPC 3KUYC 5DNNA 1M18B 4NE3A 4DQYB 1F66B 1A7WA 5B2JB 1P3GA 3VH6W 4QLCD 5B33B 1KX3C 2NQBA 3MGRA 3WTPA 3LZ0A 3REKD 3X1VD 5DNNC 5B1MB 3REHB 4R8PC 5AVBA 2Y2NA 2F8NA 3WAAB 3LZ1D 3LELD 5C3IB 4H9NB 1T3UA 1P3GC 1P3LA 5CPKC 1JFIB 2HIOC 3KXBC 3LZ0C 3KWQD 3MGRC 3B6GB 2NQBC 2YFWB 4QLCB 2YFVB 2ZY4A 3EPKA 5AVBC 3WA9C 3REKB 3X1VB 1P34C 5E5AB 5GXQA 1KX4B 5B40B 3B6FB 1P3LC 3O62C 4LD9D 1BFMA 4DRBA 3W99A 4J8XD 3UTBD 5CPIA 5B2IC 3F6TA 3LJAA 5GXQC 5B1LA 2AROD 3AZNC 1M19D 2FJ7A 4WJ3C 1WWIA 3W99C 4CAYA 4WU8A 3AZFD 1P3MD 4LD9B 5AV9D 5AV8C 5AV5A 3VH6T 3LJAC 4J8XB 5CPJA 4Z5TD 2FJ7C 4ZUXA 3AZMB 5CP6B 3AV1A 2PYOA 4KHAB 2DF4C 5AY8A 3X1UA 3REJD 1P3FA 5AV5C 1P3OD 5CPJC 3AN2A 2IO5B 4ZUXC 3MGSA 4J8WA 5DNMC 4Z5TB 2PYOC 5AY8C 3X1UC 1U35B 3AZID 1P3BD 2BYKA 4KGCB 3WKJD 1M1AD 1P3OB 3TU4A 5BO0B 4J8WC 3MGQD 4KUDB 5GSUB 2JE5A 2BYMB 2Y2GA 4YS3D 1F1EA 4EO5B 4JJND 3REIB 3UT9B 3AZIB 5B32D 4HGAB 3IP4C 4G92B 3TU4C 2NZDD 1ID3D 3MGQB 3V9RB 1P3PD 3KFUG 3AZJA 5B0YA 3W96A 4YS3B 2ZY2A 5JRGA 4JJNB 4J8UD 2RIQA 1P3IA 3KWQA 3H0LC 5FUGA 1H3OA 3AFAD 1HTAA 5B32B 1EQZD 4G91B 3LZ1C 3WTPB 3LELC 3C1CA 3RELD 4YM6D 1P3PB 3A1IA 2F8NB 5JRGC 2VQRA 3KWQC 1KU5A 4Z2MG 3MNNA 4H9RA 3UTBA 5AVCD 3W98B 4UPKA 3C1BA 3P5JB 5BT1C 4CSRB 5F99D 4YM6B 3MNNC 4J8XC 1ZLAA 3UTBC 5B2JD 3VH5W 3C1BC 1AOIA 5B33D 2AROC 5AVCB 5GT0A 3AZHA 5CPIB 1M19C 1TZYD 3WAAD 3B0DB 5B1LB 3VH5A 5CHLB 5F99B 3AZFC 1P3MC 4R8PA 1ZLAC 5AV9C 3AZGD 2Y2MA 1AOIC 3UTAA 4Z66D 3AZHC 5GT0C 4WU8B 3AV2A 3B6GD 5CPKA 4H9QA 2CV5B 3W97A 4M6BA 2HIOA 3KXBA 3AYWA 5E5AD 1TZYB 3REJC 5G49B 5B0ZD 5B40D 1KX4D 3B6FD 3B0CW 3VH6A 3WA9A 1PZRA 3AV1B 1P34A 3UTAC 2HUEB 4E45A 3AZKA 3X1TD 5BNVA 4H9OB 3A6ND 4XUJA 3AZGB 3AV2C 4Z66B 3O62A 3W97C 3AYWC 3AN2B 5B24D 5GT3D 3FDDA 1BH8A 2Y2JA 5B2IA 3AZLA
chains in the Genus database with same CATH topology
1P3BC 3AZNA 5B0ZB 3WKJC 1M1AC 3AZKC 2G5HC 4XUJC 2F8NK 2RVQC 2Y2OA 1P3KD 4X23D 4Z2MH 5JA4A 3A6NB 3X1TB 3VH5T 4DRAA 5B31D 5AV8A 4AWLC 5B24B 4JJNC 5GT3B 3AZLC 3AZMD 5CP6D 5AV6A 4J8VD 4XZQA 3WTPE 2NZDC 4WNNA 3NQJB 1ID3C 1P3PC 1KX5A 1P3KB 4ZBJB 3H0MC 4X23B 3MVDA 5B31B 5AV6C 3X1SA 4XZQC 3AZED 4J8UC 3AZJB 4H9SA 5B0YB 4WU9D 5DNMA 3W96B 1U35D 3H0RC 4J8VB 3B0CT 3AFAC 1EQZC 1S32A 4KGCD 1KX5C 1HQ3A 1P3IB 5KDMA 3RELC 1P3AA 3MVDC 1W2EA 4KUDD 5GSUD 3X1SC 1M18A 2L5AA 4H9SC 3C1CB 2Y2PA 3MGPD 3KUYD 3AZEB 3REID 1F66A 3UT9D 4WU9B 1S32C 1HQ3C 5B33A 1P3AC 4H9RB 5B1MA 3REHA 1M18C 4E44A 1KX3D 3R45B 3EPLA 5DNND 1F66C 5B2JC 1BH9B 4NFTA 3MGPB 3KUYB 5B33C 4H9PB 2YFWA 1P3GD 5B1MC 2G5IC 2YFVA 4QLCA 3REHC 3WAAC 2XD1A 3REKA 3MGRD 3WTPD 3X1VA 5C3IC 2NQBD 2CWEA 1KX3B 3LZ1A 5AVBD 3LELA 2F8ND 3AL0C 5DNNB 4R8PB 3B6GC 5B32G 1P3LD 4QLCC 2ZY5A 3W98D 5BNXA 3REKC 3X1VC 1P3GB 5E5AC 4NE5A 5CPKB 1KX4C 5B40C 3B6FC 2W8SA 2HIOB 3KXBB 3NQUA 3LZ0B 3MGRB 2NQBB 5GXQD 5AVBB 3WA9B 1P34B 4LD9A 3EG5B 1P3LB 4J8XA 3W99D 5CPID 3O62B 2AROA 3LJAD 5B1LD 1M19A 5B2IB 2FJ7D 4KHAA 4LD9C 5GXQB 3AZNB 3AZFA 1P3MA 1Z2CB 5AV9A 4WU8D 3AZMC 5AV5D 2CV5D 5CP6C 3W99B 5CPJD 2Y2IA 4Z5TA 5AV8B 4ZUXD 3LJAB 2FFFB 3AV1D 2PYOD 2FJ7B 3REJA 5AY8D 3MGSB 1P3OA 2IO5C 5BO0A 3EPJA 1P3FD 4KUDA 4CAYB 2BYMA 4Z5TC 3AN2D 3AZEC 1B67A 5AV5B 3MGSD 1R4VA 2ZM5A 4J8WD 1U35C 5CPJB 1TAFA 4KGCC 4ZUXB 3AZIA 4WZSB 5DNMB 1P3BA 1P3OC 2PYOB 4KUDC 5GSUC 3WKJA 5AY8B 1M1AA 1Q9CA 3X1UB 1N1JA 1P3FB 3MGQA 2Y2QA 3V9RA 3TU4D 4EO5C 4YS3A 3REIC 3UT9C 2Y2LA 2F8NH 4J8WB 3AZIC 4JJNA 4HGAC 5B32A 4WV4B 2NZDA 3MGQC 2BYKB 2JSSA 4YS3C 1ID3A 3TU4B 1P3PA 5BS7A 3KSYA 3AZJD 5B0YD 3W96D 5B32C 4J8UA 5JRGD 3W98A 2ZY3A 4G91C 3WTPC 1P3ID 5B31G 3AFAA 1EQZA 4CSRA 5BS7C 3RELA 3C1CD 4YM6A 1B6WA 2Y2HA 4NE6A 4UUZA 5BT1D 3LZ1B 3LELB 3W98C 3MNND 5AVCA 5JRGB 3KWQB 5BNXB 5FUGB 3C1BD 1H3OB 4YM6C 5F99A 3NQUB 2XD5A 1ZLAD 5AVCC 5B2JA 5CPIC 2CV5A 1AOID 3MNNB 3B0DC 5B1LC 3UTBB 2BG1A 5GT0D 3AZHD 2UWXA 5F99C 1TZYA 5G49A 3C1BB 3WAAA 2AROB 1M19B 4H9NA 4WU8C 3AZGA 4R8PD 4H9OA 2CV5C 4Z66A 3UTAD 3AZFB 1P3MB 1ZLAB 3B6GA 5AV9B 3AV2D 5CPKD 1TZYC 1AOIB 1JFIA 3W97D 3AZHB 5GT0B 2HIOD 3KXBD 3LZ0D 3AYWD 3AV1C 5E5AA 5B0ZA 2HUEC 5B40A 3AZGC 1KX4A 3B6FA 3WA9D 1P3FC 4Z66C 1P34D 3REJB 3X1TA 3AN2C 3A6NA 3AZKD 4XUJD 2RVQD 3MGSC 3UTAB 4G92C 3O62D 5B24A 5GT3A 3AV2B 4H9QB 5B0ZC 2F8NG 2F2AC 3W97B 5B2ID 3AYWB 2Y2KA 3AZLD 1TAFB 3NQJA 3AZND 3X1TC 3A6NC 3EPHA 1P3BB 1P3KA 4X23A 3WKJB 5B24C 1WWSA 5GT3C 3AZKB 1M1AB 5BNVB 5B31A 1N1JB 4XUJB 5AV8D 3AZMA 5CP6A 4J8VA 5AV6D 1BH8B 4XZQD 4AWLB 3AZLB 1P3KC 4ZBJC 4X23C 5B31C 2NZDB 1KX5D 3AZJC 5JA4B 5B0YC 3W96C 3MVDD 4J8VC 1ID3B 3X1SD 3AZEA 4WU9A 1U35A 2DQNC 5DNMD 5AV6B 1P3IC 4XZQB 4KGCA 3A1KA 4J8UB 1S32D 3X1UD 4WNNB 1HQ3D 3AFAB 3C1CC 1P3AD 1EQZB 5GSUA 3R45A 1KX5B 1ULYA 1M18D 2LY8A 1BH9A 3RELB 4WU9C 3MVDB 3MGPA 4UUZB 3KUYA 3X1SB 3REIA 3UT9A 1F66D 4H9PA 2JCHA 3B0BA 1S32B 2J8PA 1HQ3B 5KDMB 5B1MD 3REHD 1P3AB 1KX3A 3MGPC 3KUYC 5DNNA 1M18B 4NE3A 4DQYB 1F66B 1A7WA 5B2JB 1P3GA 3VH6W 4QLCD 5B33B 1KX3C 2NQBA 3MGRA 3WTPA 3LZ0A 3REKD 3X1VD 5DNNC 5B1MB 3REHB 4R8PC 5AVBA 2Y2NA 2F8NA 3WAAB 3LZ1D 3LELD 5C3IB 4H9NB 1T3UA 1P3GC 1P3LA 5CPKC 1JFIB 2HIOC 3KXBC 3LZ0C 3KWQD 3MGRC 3B6GB 2NQBC 2YFWB 4QLCB 2YFVB 2ZY4A 3EPKA 5AVBC 3WA9C 3REKB 3X1VB 1P34C 5E5AB 5GXQA 1KX4B 5B40B 3B6FB 1P3LC 3O62C 4LD9D 1BFMA 4DRBA 3W99A 4J8XD 3UTBD 5CPIA 5B2IC 3F6TA 3LJAA 5GXQC 5B1LA 2AROD 3AZNC 1M19D 2FJ7A 4WJ3C 1WWIA 3W99C 4CAYA 4WU8A 3AZFD 1P3MD 4LD9B 5AV9D 5AV8C 5AV5A 3VH6T 3LJAC 4J8XB 5CPJA 4Z5TD 2FJ7C 4ZUXA 3AZMB 5CP6B 3AV1A 2PYOA 4KHAB 2DF4C 5AY8A 3X1UA 3REJD 1P3FA 5AV5C 1P3OD 5CPJC 3AN2A 2IO5B 4ZUXC 3MGSA 4J8WA 5DNMC 4Z5TB 2PYOC 5AY8C 3X1UC 1U35B 3AZID 1P3BD 2BYKA 4KGCB 3WKJD 1M1AD 1P3OB 3TU4A 5BO0B 4J8WC 3MGQD 4KUDB 5GSUB 2JE5A 2BYMB 2Y2GA 4YS3D 1F1EA 4EO5B 4JJND 3REIB 3UT9B 3AZIB 5B32D 4HGAB 3IP4C 4G92B 3TU4C 2NZDD 1ID3D 3MGQB 3V9RB 1P3PD 3KFUG 3AZJA 5B0YA 3W96A 4YS3B 2ZY2A 5JRGA 4JJNB 4J8UD 2RIQA 1P3IA 3KWQA 3H0LC 5FUGA 1H3OA 3AFAD 1HTAA 5B32B 1EQZD 4G91B 3LZ1C 3WTPB 3LELC 3C1CA 3RELD 4YM6D 1P3PB 3A1IA 2F8NB 5JRGC 2VQRA 3KWQC 1KU5A 4Z2MG 3MNNA 4H9RA 3UTBA 5AVCD 3W98B 4UPKA 3C1BA 3P5JB 5BT1C 4CSRB 5F99D 4YM6B 3MNNC 4J8XC 1ZLAA 3UTBC 5B2JD 3VH5W 3C1BC 1AOIA 5B33D 2AROC 5AVCB 5GT0A 3AZHA 5CPIB 1M19C 1TZYD 3WAAD 3B0DB 5B1LB 3VH5A 5CHLB 5F99B 3AZFC 1P3MC 4R8PA 1ZLAC 5AV9C 3AZGD 2Y2MA 1AOIC 3UTAA 4Z66D 3AZHC 5GT0C 4WU8B 3AV2A 3B6GD 5CPKA 4H9QA 2CV5B 3W97A 4M6BA 2HIOA 3KXBA 3AYWA 5E5AD 1TZYB 3REJC 5G49B 5B0ZD 5B40D 1KX4D 3B6FD 3B0CW 3VH6A 3WA9A 1PZRA 3AV1B 1P34A 3UTAC 2HUEB 4E45A 3AZKA 3X1TD 5BNVA 4H9OB 3A6ND 4XUJA 3AZGB 3AV2C 4Z66B 3O62A 3W97C 3AYWC 3AN2B 5B24D 5GT3D 3FDDA 1BH8A 2Y2JA 5B2IA 3AZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B C;  3AZN A;  5B0Z B;  3WKJ C;  1M1A C;  3AZK C;  4XUJ C;  2F8N K;  2RVQ C;  1P3K D;  4X23 D;  4Z2M H;  5JA4 A;  3A6N B;  3X1T B;  3VH5 T;  4DRA A;  5B31 D;  5AV8 A;  4AWL C;  5B24 B;  4JJN C;  5GT3 B;  3AZL C;  3AZM D;  5CP6 D;  5AV6 A;  4J8V D;  4XZQ A;  3WTP E;  2NZD C;  4WNN A;  3NQJ B;  1ID3 C;  1P3P C;  1KX5 A;  1P3K B;  4ZBJ B;  4X23 B;  3MVD A;  5B31 B;  5AV6 C;  3X1S A;  4XZQ C;  3AZE D;  4J8U C;  3AZJ B;  4H9S A;  5B0Y B;  4WU9 D;  5DNM A;  3W96 B;  1U35 D;  4J8V B;  3B0C T;  3AFA C;  1EQZ C;  1S32 A;  4KGC D;  1KX5 C;  1HQ3 A;  1P3I B;  5KDM A;  3REL C;  1P3A A;  3MVD C;  4KUD D;  5GSU D;  3X1S C;  1M18 A;  2L5A A;  4H9S C;  3C1C B;  3MGP D;  3KUY D;  3AZE B;  3REI D;  1F66 A;  3UT9 D;  4WU9 B;  1S32 C;  1HQ3 C;  5B33 A;  1P3A C;  4H9R B;  5B1M A;  3REH A;  1M18 C;  4E44 A;  1KX3 D;  3R45 B;  5DNN D;  1F66 C;  5B2J C;  1BH9 B;  4NFT A;  3MGP B;  3KUY B;  5B33 C;  4H9P B;  2YFW A;  1P3G D;  5B1M C;  4QLC A;  2YFV A;  3REH C;  3WAA C;  3REK A;  3MGR D;  3WTP D;  3X1V A;  5C3I C;  2NQB D;  2CWE A;  1KX3 B;  3LZ1 A;  5AVB D;  3LEL A;  2F8N D;  5DNN B;  4R8P B;  3B6G C;  5B32 G;  1P3L D;  4QLC C;  3W98 D;  5BNX A;  3REK C;  3X1V C;  1P3G B;  5E5A C;  4NE5 A;  5CPK B;  1KX4 C;  5B40 C;  3B6F C;  2HIO B;  3KXB B;  3NQU A;  3LZ0 B;  3MGR B;  2NQB B;  5GXQ D;  5AVB B;  3WA9 B;  1P34 B;  4LD9 A;  1P3L B;  4J8X A;  3W99 D;  5CPI D;  3O62 B;  2ARO A;  3LJA D;  5B1L D;  1M19 A;  5B2I B;  2FJ7 D;  4KHA A;  4LD9 C;  5GXQ B;  3AZN B;  3AZF A;  1P3M A;  5AV9 A;  4WU8 D;  3AZM C;  5AV5 D;  2CV5 D;  5CP6 C;  3W99 B;  5CPJ D;  4Z5T A;  5AV8 B;  4ZUX D;  3LJA B;  3AV1 D;  2PYO D;  2FJ7 B;  3REJ A;  5AY8 D;  3MGS B;  1P3O A;  2IO5 C;  5BO0 A;  1P3F D;  4KUD A;  4CAY B;  2BYM A;  4Z5T C;  3AN2 D;  3AZE C;  1B67 A;  5AV5 B;  3MGS D;  1R4V A;  4J8W D;  1U35 C;  5CPJ B;  1TAF A;  4KGC C;  4ZUX B;  3AZI A;  4WZS B;  5DNM B;  1P3B A;  1P3O C;  2PYO B;  4KUD C;  5GSU C;  3WKJ A;  5AY8 B;  1M1A A;  1Q9C A;  3X1U B;  1N1J A;  1P3F B;  3MGQ A;  3V9R A;  3TU4 D;  4EO5 C;  4YS3 A;  3REI C;  3UT9 C;  2F8N H;  4J8W B;  3AZI C;  4JJN A;  4HGA C;  5B32 A;  4WV4 B;  2NZD A;  3MGQ C;  2BYK B;  2JSS A;  4YS3 C;  1ID3 A;  3TU4 B;  1P3P A;  5BS7 A;  3KSY A;  3AZJ D;  5B0Y D;  3W96 D;  5B32 C;  4J8U A;  5JRG D;  3W98 A;  4G91 C;  3WTP C;  1P3I D;  5B31 G;  3AFA A;  1EQZ A;  4CSR A;  5BS7 C;  3REL A;  3C1C D;  4YM6 A;  1B6W A;  4NE6 A;  4UUZ A;  5BT1 D;  3LZ1 B;  3LEL B;  3W98 C;  3MNN D;  5AVC A;  5JRG B;  3KWQ B;  5BNX B;  5FUG B;  3C1B D;  1H3O B;  4YM6 C;  5F99 A;  3NQU B;  1ZLA D;  5AVC C;  5B2J A;  5CPI C;  2CV5 A;  1AOI D;  3MNN B;  3B0D C;  5B1L C;  3UTB B;  3AZH D;  5GT0 D;  5F99 C;  1TZY A;  5G49 A;  3C1B B;  3WAA A;  2ARO B;  1M19 B;  4H9N A;  4WU8 C;  3AZG A;  4R8P D;  4H9O A;  2CV5 C;  4Z66 A;  3UTA D;  3AZF B;  1P3M B;  1ZLA B;  3B6G A;  5AV9 B;  3AV2 D;  5CPK D;  1TZY C;  1AOI B;  1JFI A;  3W97 D;  3AZH B;  5GT0 B;  2HIO D;  3KXB D;  3LZ0 D;  3AYW D;  3AV1 C;  5E5A A;  5B0Z A;  2HUE C;  5B40 A;  3AZG C;  1KX4 A;  3B6F A;  3WA9 D;  1P3F C;  4Z66 C;  1P34 D;  3REJ B;  3X1T A;  3AN2 C;  3A6N A;  3AZK D;  4XUJ D;  2RVQ D;  3MGS C;  3UTA B;  4G92 C;  3O62 D;  5B24 A;  5GT3 A;  3AV2 B;  4H9Q B;  5B0Z C;  2F8N G;  3W97 B;  5B2I D;  3AYW B;  3AZL D;  1TAF B;  3NQJ A;  3AZN D;  3X1T C;  3A6N C;  1P3B B;  1P3K A;  4X23 A;  3WKJ B;  5B24 C;  1WWS A;  5GT3 C;  3AZK B;  1M1A B;  5BNV B;  5B31 A;  1N1J B;  4XUJ B;  5AV8 D;  3AZM A;  5CP6 A;  4J8V A;  5AV6 D;  1BH8 B;  4XZQ D;  4AWL B;  3AZL B;  1P3K C;  4ZBJ C;  4X23 C;  5B31 C;  2NZD B;  1KX5 D;  3AZJ C;  5JA4 B;  5B0Y C;  3W96 C;  3MVD D;  4J8V C;  1ID3 B;  3X1S D;  3AZE A;  4WU9 A;  1U35 A;  1P3I C;  5DNM D;  5AV6 B;  4XZQ B;  4KGC A;  4J8U B;  1S32 D;  3X1U D;  4WNN B;  1HQ3 D;  3AFA B;  3C1C C;  1P3A D;  1EQZ B;  5GSU A;  3R45 A;  1KX5 B;  1ULY A;  1M18 D;  2LY8 A;  1BH9 A;  3REL B;  4WU9 C;  3MVD B;  3MGP A;  4UUZ B;  3KUY A;  3X1S B;  3REI A;  3UT9 A;  1F66 D;  4H9P A;  3B0B A;  1S32 B;  1HQ3 B;  5KDM B;  5B1M D;  3REH D;  1P3A B;  1KX3 A;  3MGP C;  3KUY C;  5DNN A;  1M18 B;  4NE3 A;  1F66 B;  1A7W A;  5B2J B;  1P3G A;  3VH6 W;  4QLC D;  5B33 B;  1KX3 C;  2NQB A;  3MGR A;  3WTP A;  3LZ0 A;  3REK D;  3X1V D;  5DNN C;  5B1M B;  3REH B;  4R8P C;  5AVB A;  3WAA B;  2F8N A;  3LZ1 D;  3LEL D;  5C3I B;  4H9N B;  1P3G C;  1P3L A;  5CPK C;  1JFI B;  2HIO C;  3KXB C;  3LZ0 C;  3KWQ D;  3MGR C;  3B6G B;  2NQB C;  2YFW B;  4QLC B;  2YFV B;  5AVB C;  3WA9 C;  3REK B;  3X1V B;  1P34 C;  5E5A B;  5GXQ A;  1KX4 B;  5B40 B;  3B6F B;  1P3L C;  3O62 C;  4LD9 D;  1BFM A;  4DRB A;  3W99 A;  4J8X D;  3UTB D;  5CPI A;  5B2I C;  3LJA A;  5GXQ C;  5B1L A;  2ARO D;  3AZN C;  1M19 D;  2FJ7 A;  1WWI A;  3W99 C;  4CAY A;  4WU8 A;  3AZF D;  1P3M D;  4LD9 B;  5AV9 D;  5AV8 C;  5AV5 A;  3VH6 T;  3LJA C;  4J8X B;  5CPJ A;  4Z5T D;  2FJ7 C;  4ZUX A;  3AZM B;  5CP6 B;  3AV1 A;  2PYO A;  4KHA B;  5AY8 A;  3REJ D;  3X1U A;  1P3F A;  5AV5 C;  1P3O D;  5CPJ C;  3AN2 A;  2IO5 B;  4ZUX C;  3MGS A;  4J8W A;  5DNM C;  4Z5T B;  2PYO C;  5AY8 C;  3X1U C;  1U35 B;  3AZI D;  1P3B D;  2BYK A;  4KGC B;  3WKJ D;  1M1A D;  1P3O B;  3TU4 A;  5BO0 B;  4J8W C;  3MGQ D;  4KUD B;  5GSU B;  2BYM B;  4YS3 D;  1F1E A;  4EO5 B;  4JJN D;  3REI B;  3UT9 B;  3AZI B;  5B32 D;  4HGA B;  3TU4 C;  2NZD D;  1ID3 D;  3MGQ B;  3V9R B;  1P3P D;  3AZJ A;  5B0Y A;  3W96 A;  4YS3 B;  5JRG A;  4JJN B;  4J8U D;  1P3I A;  3KWQ A;  5FUG A;  1H3O A;  3AFA D;  1HTA A;  5B32 B;  1EQZ D;  4G91 B;  3LZ1 C;  3WTP B;  3LEL C;  3C1C A;  3REL D;  4YM6 D;  1P3P B;  2F8N B;  5JRG C;  3KWQ C;  1KU5 A;  4Z2M G;  3MNN A;  4H9R A;  3UTB A;  5AVC D;  3W98 B;  3C1B A;  5BT1 C;  4CSR B;  5F99 D;  4YM6 B;  3MNN C;  4J8X C;  1ZLA A;  3UTB C;  5B2J D;  3VH5 W;  3C1B C;  1AOI A;  2ARO C;  5B33 D;  5AVC B;  5GT0 A;  3AZH A;  5CPI B;  1M19 C;  1TZY D;  3WAA D;  3B0D B;  5B1L B;  3VH5 A;  5CHL B;  5F99 B;  3AZF C;  1P3M C;  4R8P A;  1ZLA C;  5AV9 C;  3AZG D;  1AOI C;  3UTA A;  4Z66 D;  3AZH C;  5GT0 C;  4WU8 B;  3AV2 A;  3B6G D;  5CPK A;  4H9Q A;  2CV5 B;  3W97 A;  4M6B A;  2HIO A;  3KXB A;  3AYW A;  5E5A D;  1TZY B;  3REJ C;  5G49 B;  5B0Z D;  5B40 D;  1KX4 D;  3B6F D;  3B0C W;  3VH6 A;  3WA9 A;  3AV1 B;  1P34 A;  3UTA C;  2HUE B;  4E45 A;  3AZK A;  3X1T D;  5BNV A;  4H9O B;  3A6N D;  4XUJ A;  3AZG B;  3AV2 C;  4Z66 B;  3O62 A;  3W97 C;  3AYW C;  3AN2 B;  5B24 D;  5GT3 D;  1BH8 A;  4G92 B;  5B2I A;  3AZL A; 
#chains in the Genus database with same CATH topology
 1P3B C;  3AZN A;  5B0Z B;  3WKJ C;  1M1A C;  3AZK C;  2G5H C;  4XUJ C;  2F8N K;  2RVQ C;  2Y2O A;  1P3K D;  4X23 D;  4Z2M H;  5JA4 A;  3A6N B;  3X1T B;  3VH5 T;  4DRA A;  5B31 D;  5AV8 A;  4AWL C;  5B24 B;  4JJN C;  5GT3 B;  3AZL C;  3AZM D;  5CP6 D;  5AV6 A;  4J8V D;  4XZQ A;  3WTP E;  2NZD C;  4WNN A;  3NQJ B;  1ID3 C;  1P3P C;  1KX5 A;  1P3K B;  4ZBJ B;  3H0M C;  4X23 B;  3MVD A;  5B31 B;  5AV6 C;  3X1S A;  4XZQ C;  3AZE D;  4J8U C;  3AZJ B;  4H9S A;  5B0Y B;  4WU9 D;  5DNM A;  3W96 B;  1U35 D;  3H0R C;  4J8V B;  3B0C T;  3AFA C;  1EQZ C;  1S32 A;  4KGC D;  1KX5 C;  1HQ3 A;  1P3I B;  5KDM A;  3REL C;  1P3A A;  3MVD C;  1W2E A;  4KUD D;  5GSU D;  3X1S C;  1M18 A;  2L5A A;  4H9S C;  3C1C B;  2Y2P A;  3MGP D;  3KUY D;  3AZE B;  3REI D;  1F66 A;  3UT9 D;  4WU9 B;  1S32 C;  1HQ3 C;  5B33 A;  1P3A C;  4H9R B;  5B1M A;  3REH A;  1M18 C;  4E44 A;  1KX3 D;  3R45 B;  3EPL A;  5DNN D;  1F66 C;  5B2J C;  1BH9 B;  4NFT A;  3MGP B;  3KUY B;  5B33 C;  4H9P B;  2YFW A;  1P3G D;  5B1M C;  2G5I C;  2YFV A;  4QLC A;  3REH C;  3WAA C;  2XD1 A;  3REK A;  3MGR D;  3WTP D;  3X1V A;  5C3I C;  2NQB D;  2CWE A;  1KX3 B;  3LZ1 A;  5AVB D;  3LEL A;  2F8N D;  3AL0 C;  5DNN B;  4R8P B;  3B6G C;  5B32 G;  1P3L D;  4QLC C;  2ZY5 A;  3W98 D;  5BNX A;  3REK C;  3X1V C;  1P3G B;  5E5A C;  4NE5 A;  5CPK B;  1KX4 C;  5B40 C;  3B6F C;  2W8S A;  2HIO B;  3KXB B;  3NQU A;  3LZ0 B;  3MGR B;  2NQB B;  5GXQ D;  5AVB B;  3WA9 B;  1P34 B;  4LD9 A;  3EG5 B;  1P3L B;  4J8X A;  3W99 D;  5CPI D;  3O62 B;  2ARO A;  3LJA D;  5B1L D;  1M19 A;  5B2I B;  2FJ7 D;  4KHA A;  4LD9 C;  5GXQ B;  3AZN B;  3AZF A;  1P3M A;  1Z2C B;  5AV9 A;  4WU8 D;  3AZM C;  5AV5 D;  2CV5 D;  5CP6 C;  3W99 B;  5CPJ D;  2Y2I A;  4Z5T A;  5AV8 B;  4ZUX D;  3LJA B;  2FFF B;  3AV1 D;  2PYO D;  2FJ7 B;  3REJ A;  5AY8 D;  3MGS B;  1P3O A;  2IO5 C;  5BO0 A;  3EPJ A;  1P3F D;  4KUD A;  4CAY B;  2BYM A;  4Z5T C;  3AN2 D;  3AZE C;  1B67 A;  5AV5 B;  3MGS D;  1R4V A;  2ZM5 A;  4J8W D;  1U35 C;  5CPJ B;  1TAF A;  4KGC C;  4ZUX B;  3AZI A;  4WZS B;  5DNM B;  1P3B A;  1P3O C;  2PYO B;  4KUD C;  5GSU C;  3WKJ A;  5AY8 B;  1M1A A;  1Q9C A;  3X1U B;  1N1J A;  1P3F B;  3MGQ A;  2Y2Q A;  3V9R A;  3TU4 D;  4EO5 C;  4YS3 A;  3REI C;  3UT9 C;  2Y2L A;  2F8N H;  4J8W B;  3AZI C;  4JJN A;  4HGA C;  5B32 A;  4WV4 B;  2NZD A;  3MGQ C;  2BYK B;  2JSS A;  4YS3 C;  1ID3 A;  3TU4 B;  1P3P A;  5BS7 A;  3KSY A;  3AZJ D;  5B0Y D;  3W96 D;  5B32 C;  4J8U A;  5JRG D;  3W98 A;  2ZY3 A;  4G91 C;  3WTP C;  1P3I D;  5B31 G;  3AFA A;  1EQZ A;  4CSR A;  5BS7 C;  3REL A;  3C1C D;  4YM6 A;  1B6W A;  2Y2H A;  4NE6 A;  4UUZ A;  5BT1 D;  3LZ1 B;  3LEL B;  3W98 C;  3MNN D;  5AVC A;  5JRG B;  3KWQ B;  5BNX B;  5FUG B;  3C1B D;  1H3O B;  4YM6 C;  5F99 A;  3NQU B;  2XD5 A;  1ZLA D;  5AVC C;  5B2J A;  5CPI C;  2CV5 A;  1AOI D;  3MNN B;  3B0D C;  5B1L C;  3UTB B;  2BG1 A;  5GT0 D;  3AZH D;  2UWX A;  5F99 C;  1TZY A;  5G49 A;  3C1B B;  3WAA A;  2ARO B;  1M19 B;  4H9N A;  4WU8 C;  3AZG A;  4R8P D;  4H9O A;  2CV5 C;  4Z66 A;  3UTA D;  3AZF B;  1P3M B;  1ZLA B;  3B6G A;  5AV9 B;  3AV2 D;  5CPK D;  1TZY C;  1AOI B;  1JFI A;  3W97 D;  3AZH B;  5GT0 B;  2HIO D;  3KXB D;  3LZ0 D;  3AYW D;  3AV1 C;  5E5A A;  5B0Z A;  2HUE C;  5B40 A;  3AZG C;  1KX4 A;  3B6F A;  3WA9 D;  1P3F C;  4Z66 C;  1P34 D;  3REJ B;  3X1T A;  3AN2 C;  3A6N A;  3AZK D;  4XUJ D;  2RVQ D;  3MGS C;  3UTA B;  4G92 C;  3O62 D;  5B24 A;  5GT3 A;  3AV2 B;  4H9Q B;  5B0Z C;  2F8N G;  2F2A C;  3W97 B;  5B2I D;  3AYW B;  2Y2K A;  3AZL D;  1TAF B;  3NQJ A;  3AZN D;  3X1T C;  3A6N C;  3EPH A;  1P3B B;  1P3K A;  4X23 A;  3WKJ B;  5B24 C;  1WWS A;  5GT3 C;  3AZK B;  1M1A B;  5BNV B;  5B31 A;  1N1J B;  4XUJ B;  5AV8 D;  3AZM A;  5CP6 A;  4J8V A;  5AV6 D;  1BH8 B;  4XZQ D;  4AWL B;  3AZL B;  1P3K C;  4ZBJ C;  4X23 C;  5B31 C;  2NZD B;  1KX5 D;  3AZJ C;  5JA4 B;  5B0Y C;  3W96 C;  3MVD D;  4J8V C;  1ID3 B;  3X1S D;  3AZE A;  4WU9 A;  1U35 A;  2DQN C;  5DNM D;  5AV6 B;  1P3I C;  4XZQ B;  4KGC A;  3A1K A;  4J8U B;  1S32 D;  3X1U D;  4WNN B;  1HQ3 D;  3AFA B;  3C1C C;  1P3A D;  1EQZ B;  5GSU A;  3R45 A;  1KX5 B;  1ULY A;  1M18 D;  2LY8 A;  1BH9 A;  3REL B;  4WU9 C;  3MVD B;  3MGP A;  4UUZ B;  3KUY A;  3X1S B;  3REI A;  3UT9 A;  1F66 D;  4H9P A;  2JCH A;  3B0B A;  1S32 B;  2J8P A;  1HQ3 B;  5KDM B;  5B1M D;  3REH D;  1P3A B;  1KX3 A;  3MGP C;  3KUY C;  5DNN A;  1M18 B;  4NE3 A;  4DQY B;  1F66 B;  1A7W A;  5B2J B;  1P3G A;  3VH6 W;  4QLC D;  5B33 B;  1KX3 C;  2NQB A;  3MGR A;  3WTP A;  3LZ0 A;  3REK D;  3X1V D;  5DNN C;  5B1M B;  3REH B;  4R8P C;  5AVB A;  2Y2N A;  2F8N A;  3WAA B;  3LZ1 D;  3LEL D;  5C3I B;  4H9N B;  1T3U A;  1P3G C;  1P3L A;  5CPK C;  1JFI B;  2HIO C;  3KXB C;  3LZ0 C;  3KWQ D;  3MGR C;  3B6G B;  2NQB C;  2YFW B;  4QLC B;  2YFV B;  2ZY4 A;  3EPK A;  5AVB C;  3WA9 C;  3REK B;  3X1V B;  1P34 C;  5E5A B;  5GXQ A;  1KX4 B;  5B40 B;  3B6F B;  1P3L C;  3O62 C;  4LD9 D;  1BFM A;  4DRB A;  3W99 A;  4J8X D;  3UTB D;  5CPI A;  5B2I C;  3F6T A;  3LJA A;  5GXQ C;  5B1L A;  2ARO D;  3AZN C;  1M19 D;  2FJ7 A;  4WJ3 C;  1WWI A;  3W99 C;  4CAY A;  4WU8 A;  3AZF D;  1P3M D;  4LD9 B;  5AV9 D;  5AV8 C;  5AV5 A;  3VH6 T;  3LJA C;  4J8X B;  5CPJ A;  4Z5T D;  2FJ7 C;  4ZUX A;  3AZM B;  5CP6 B;  3AV1 A;  2PYO A;  4KHA B;  2DF4 C;  5AY8 A;  3X1U A;  3REJ D;  1P3F A;  5AV5 C;  1P3O D;  5CPJ C;  3AN2 A;  2IO5 B;  4ZUX C;  3MGS A;  4J8W A;  5DNM C;  4Z5T B;  2PYO C;  5AY8 C;  3X1U C;  1U35 B;  3AZI D;  1P3B D;  2BYK A;  4KGC B;  3WKJ D;  1M1A D;  1P3O B;  3TU4 A;  5BO0 B;  4J8W C;  3MGQ D;  4KUD B;  5GSU B;  2JE5 A;  2BYM B;  2Y2G A;  4YS3 D;  1F1E A;  4EO5 B;  4JJN D;  3REI B;  3UT9 B;  3AZI B;  5B32 D;  4HGA B;  3IP4 C;  4G92 B;  3TU4 C;  2NZD D;  1ID3 D;  3MGQ B;  3V9R B;  1P3P D;  3KFU G;  3AZJ A;  5B0Y A;  3W96 A;  4YS3 B;  2ZY2 A;  5JRG A;  4JJN B;  4J8U D;  2RIQ A;  1P3I A;  3KWQ A;  3H0L C;  5FUG A;  1H3O A;  3AFA D;  1HTA A;  5B32 B;  1EQZ D;  4G91 B;  3LZ1 C;  3WTP B;  3LEL C;  3C1C A;  3REL D;  4YM6 D;  1P3P B;  3A1I A;  2F8N B;  5JRG C;  2VQR A;  3KWQ C;  1KU5 A;  4Z2M G;  3MNN A;  4H9R A;  3UTB A;  5AVC D;  3W98 B;  4UPK A;  3C1B A;  3P5J B;  5BT1 C;  4CSR B;  5F99 D;  4YM6 B;  3MNN C;  4J8X C;  1ZLA A;  3UTB C;  5B2J D;  3VH5 W;  3C1B C;  1AOI A;  5B33 D;  2ARO C;  5AVC B;  5GT0 A;  3AZH A;  5CPI B;  1M19 C;  1TZY D;  3WAA D;  3B0D B;  5B1L B;  3VH5 A;  5CHL B;  5F99 B;  3AZF C;  1P3M C;  4R8P A;  1ZLA C;  5AV9 C;  3AZG D;  2Y2M A;  1AOI C;  3UTA A;  4Z66 D;  3AZH C;  5GT0 C;  4WU8 B;  3AV2 A;  3B6G D;  5CPK A;  4H9Q A;  2CV5 B;  3W97 A;  4M6B A;  2HIO A;  3KXB A;  3AYW A;  5E5A D;  1TZY B;  3REJ C;  5G49 B;  5B0Z D;  5B40 D;  1KX4 D;  3B6F D;  3B0C W;  3VH6 A;  3WA9 A;  1PZR A;  3AV1 B;  1P34 A;  3UTA C;  2HUE B;  4E45 A;  3AZK A;  3X1T D;  5BNV A;  4H9O B;  3A6N D;  4XUJ A;  3AZG B;  3AV2 C;  4Z66 B;  3O62 A;  3W97 C;  3AYW C;  3AN2 B;  5B24 D;  5GT3 D;  3FDD A;  1BH8 A;  2Y2J A;  5B2I A;  3AZL A; 
#chains in the Genus database with same CATH homology
 1P3B C;  3AZN A;  5B0Z B;  3WKJ C;  1M1A C;  3AZK C;  2G5H C;  4XUJ C;  2F8N K;  2RVQ C;  2Y2O A;  1P3K D;  4X23 D;  4Z2M H;  5JA4 A;  3A6N B;  3X1T B;  3VH5 T;  4DRA A;  5B31 D;  5AV8 A;  4AWL C;  5B24 B;  4JJN C;  5GT3 B;  3AZL C;  3AZM D;  5CP6 D;  5AV6 A;  4J8V D;  4XZQ A;  3WTP E;  2NZD C;  4WNN A;  3NQJ B;  1ID3 C;  1P3P C;  1KX5 A;  1P3K B;  4ZBJ B;  3H0M C;  4X23 B;  3MVD A;  5B31 B;  5AV6 C;  3X1S A;  4XZQ C;  3AZE D;  4J8U C;  3AZJ B;  4H9S A;  5B0Y B;  4WU9 D;  5DNM A;  3W96 B;  1U35 D;  3H0R C;  4J8V B;  3B0C T;  3AFA C;  1EQZ C;  1S32 A;  4KGC D;  1KX5 C;  1HQ3 A;  1P3I B;  5KDM A;  3REL C;  1P3A A;  3MVD C;  1W2E A;  4KUD D;  5GSU D;  3X1S C;  1M18 A;  2L5A A;  4H9S C;  3C1C B;  2Y2P A;  3MGP D;  3KUY D;  3AZE B;  3REI D;  1F66 A;  3UT9 D;  4WU9 B;  1S32 C;  1HQ3 C;  5B33 A;  1P3A C;  4H9R B;  5B1M A;  3REH A;  1M18 C;  4E44 A;  1KX3 D;  3R45 B;  3EPL A;  5DNN D;  1F66 C;  5B2J C;  1BH9 B;  4NFT A;  3MGP B;  3KUY B;  5B33 C;  4H9P B;  2YFW A;  1P3G D;  5B1M C;  2G5I C;  2YFV A;  4QLC A;  3REH C;  3WAA C;  2XD1 A;  3REK A;  3MGR D;  3WTP D;  3X1V A;  5C3I C;  2NQB D;  2CWE A;  1KX3 B;  3LZ1 A;  5AVB D;  3LEL A;  2F8N D;  3AL0 C;  5DNN B;  4R8P B;  3B6G C;  5B32 G;  1P3L D;  4QLC C;  2ZY5 A;  3W98 D;  5BNX A;  3REK C;  3X1V C;  1P3G B;  5E5A C;  4NE5 A;  5CPK B;  1KX4 C;  5B40 C;  3B6F C;  2W8S A;  2HIO B;  3KXB B;  3NQU A;  3LZ0 B;  3MGR B;  2NQB B;  5GXQ D;  5AVB B;  3WA9 B;  1P34 B;  4LD9 A;  3EG5 B;  1P3L B;  4J8X A;  3W99 D;  5CPI D;  3O62 B;  2ARO A;  3LJA D;  5B1L D;  1M19 A;  5B2I B;  2FJ7 D;  4KHA A;  4LD9 C;  5GXQ B;  3AZN B;  3AZF A;  1P3M A;  1Z2C B;  5AV9 A;  4WU8 D;  3AZM C;  5AV5 D;  2CV5 D;  5CP6 C;  3W99 B;  5CPJ D;  2Y2I A;  4Z5T A;  5AV8 B;  4ZUX D;  3LJA B;  2FFF B;  3AV1 D;  2PYO D;  2FJ7 B;  3REJ A;  5AY8 D;  3MGS B;  1P3O A;  2IO5 C;  5BO0 A;  3EPJ A;  1P3F D;  4KUD A;  4CAY B;  2BYM A;  4Z5T C;  3AN2 D;  3AZE C;  1B67 A;  5AV5 B;  3MGS D;  1R4V A;  2ZM5 A;  4J8W D;  1U35 C;  5CPJ B;  1TAF A;  4KGC C;  4ZUX B;  3AZI A;  4WZS B;  5DNM B;  1P3B A;  1P3O C;  2PYO B;  4KUD C;  5GSU C;  3WKJ A;  5AY8 B;  1M1A A;  1Q9C A;  3X1U B;  1N1J A;  1P3F B;  3MGQ A;  2Y2Q A;  3V9R A;  3TU4 D;  4EO5 C;  4YS3 A;  3REI C;  3UT9 C;  2Y2L A;  2F8N H;  4J8W B;  3AZI C;  4JJN A;  4HGA C;  5B32 A;  4WV4 B;  2NZD A;  3MGQ C;  2BYK B;  2JSS A;  4YS3 C;  1ID3 A;  3TU4 B;  1P3P A;  5BS7 A;  3KSY A;  3AZJ D;  5B0Y D;  3W96 D;  5B32 C;  4J8U A;  5JRG D;  3W98 A;  2ZY3 A;  4G91 C;  3WTP C;  1P3I D;  5B31 G;  3AFA A;  1EQZ A;  4CSR A;  5BS7 C;  3REL A;  3C1C D;  4YM6 A;  1B6W A;  2Y2H A;  4NE6 A;  4UUZ A;  5BT1 D;  3LZ1 B;  3LEL B;  3W98 C;  3MNN D;  5AVC A;  5JRG B;  3KWQ B;  5BNX B;  5FUG B;  3C1B D;  1H3O B;  4YM6 C;  5F99 A;  3NQU B;  2XD5 A;  1ZLA D;  5AVC C;  5B2J A;  5CPI C;  2CV5 A;  1AOI D;  3MNN B;  3B0D C;  5B1L C;  3UTB B;  2BG1 A;  5GT0 D;  3AZH D;  2UWX A;  5F99 C;  1TZY A;  5G49 A;  3C1B B;  3WAA A;  2ARO B;  1M19 B;  4H9N A;  4WU8 C;  3AZG A;  4R8P D;  4H9O A;  2CV5 C;  4Z66 A;  3UTA D;  3AZF B;  1P3M B;  1ZLA B;  3B6G A;  5AV9 B;  3AV2 D;  5CPK D;  1TZY C;  1AOI B;  1JFI A;  3W97 D;  3AZH B;  5GT0 B;  2HIO D;  3KXB D;  3LZ0 D;  3AYW D;  3AV1 C;  5E5A A;  5B0Z A;  2HUE C;  5B40 A;  3AZG C;  1KX4 A;  3B6F A;  3WA9 D;  1P3F C;  4Z66 C;  1P34 D;  3REJ B;  3X1T A;  3AN2 C;  3A6N A;  3AZK D;  4XUJ D;  2RVQ D;  3MGS C;  3UTA B;  4G92 C;  3O62 D;  5B24 A;  5GT3 A;  3AV2 B;  4H9Q B;  5B0Z C;  2F8N G;  2F2A C;  3W97 B;  5B2I D;  3AYW B;  2Y2K A;  3AZL D;  1TAF B;  3NQJ A;  3AZN D;  3X1T C;  3A6N C;  3EPH A;  1P3B B;  1P3K A;  4X23 A;  3WKJ B;  5B24 C;  1WWS A;  5GT3 C;  3AZK B;  1M1A B;  5BNV B;  5B31 A;  1N1J B;  4XUJ B;  5AV8 D;  3AZM A;  5CP6 A;  4J8V A;  5AV6 D;  1BH8 B;  4XZQ D;  4AWL B;  3AZL B;  1P3K C;  4ZBJ C;  4X23 C;  5B31 C;  2NZD B;  1KX5 D;  3AZJ C;  5JA4 B;  5B0Y C;  3W96 C;  3MVD D;  4J8V C;  1ID3 B;  3X1S D;  3AZE A;  4WU9 A;  1U35 A;  2DQN C;  5DNM D;  5AV6 B;  1P3I C;  4XZQ B;  4KGC A;  3A1K A;  4J8U B;  1S32 D;  3X1U D;  4WNN B;  1HQ3 D;  3AFA B;  3C1C C;  1P3A D;  1EQZ B;  5GSU A;  3R45 A;  1KX5 B;  1ULY A;  1M18 D;  2LY8 A;  1BH9 A;  3REL B;  4WU9 C;  3MVD B;  3MGP A;  4UUZ B;  3KUY A;  3X1S B;  3REI A;  3UT9 A;  1F66 D;  4H9P A;  2JCH A;  3B0B A;  1S32 B;  2J8P A;  1HQ3 B;  5KDM B;  5B1M D;  3REH D;  1P3A B;  1KX3 A;  3MGP C;  3KUY C;  5DNN A;  1M18 B;  4NE3 A;  4DQY B;  1F66 B;  1A7W A;  5B2J B;  1P3G A;  3VH6 W;  4QLC D;  5B33 B;  1KX3 C;  2NQB A;  3MGR A;  3WTP A;  3LZ0 A;  3REK D;  3X1V D;  5DNN C;  5B1M B;  3REH B;  4R8P C;  5AVB A;  2Y2N A;  2F8N A;  3WAA B;  3LZ1 D;  3LEL D;  5C3I B;  4H9N B;  1T3U A;  1P3G C;  1P3L A;  5CPK C;  1JFI B;  2HIO C;  3KXB C;  3LZ0 C;  3KWQ D;  3MGR C;  3B6G B;  2NQB C;  2YFW B;  4QLC B;  2YFV B;  2ZY4 A;  3EPK A;  5AVB C;  3WA9 C;  3REK B;  3X1V B;  1P34 C;  5E5A B;  5GXQ A;  1KX4 B;  5B40 B;  3B6F B;  1P3L C;  3O62 C;  4LD9 D;  1BFM A;  4DRB A;  3W99 A;  4J8X D;  3UTB D;  5CPI A;  5B2I C;  3F6T A;  3LJA A;  5GXQ C;  5B1L A;  2ARO D;  3AZN C;  1M19 D;  2FJ7 A;  4WJ3 C;  1WWI A;  3W99 C;  4CAY A;  4WU8 A;  3AZF D;  1P3M D;  4LD9 B;  5AV9 D;  5AV8 C;  5AV5 A;  3VH6 T;  3LJA C;  4J8X B;  5CPJ A;  4Z5T D;  2FJ7 C;  4ZUX A;  3AZM B;  5CP6 B;  3AV1 A;  2PYO A;  4KHA B;  2DF4 C;  5AY8 A;  3X1U A;  3REJ D;  1P3F A;  5AV5 C;  1P3O D;  5CPJ C;  3AN2 A;  2IO5 B;  4ZUX C;  3MGS A;  4J8W A;  5DNM C;  4Z5T B;  2PYO C;  5AY8 C;  3X1U C;  1U35 B;  3AZI D;  1P3B D;  2BYK A;  4KGC B;  3WKJ D;  1M1A D;  1P3O B;  3TU4 A;  5BO0 B;  4J8W C;  3MGQ D;  4KUD B;  5GSU B;  2JE5 A;  2BYM B;  2Y2G A;  4YS3 D;  1F1E A;  4EO5 B;  4JJN D;  3REI B;  3UT9 B;  3AZI B;  5B32 D;  4HGA B;  3IP4 C;  4G92 B;  3TU4 C;  2NZD D;  1ID3 D;  3MGQ B;  3V9R B;  1P3P D;  3KFU G;  3AZJ A;  5B0Y A;  3W96 A;  4YS3 B;  2ZY2 A;  5JRG A;  4JJN B;  4J8U D;  2RIQ A;  1P3I A;  3KWQ A;  3H0L C;  5FUG A;  1H3O A;  3AFA D;  1HTA A;  5B32 B;  1EQZ D;  4G91 B;  3LZ1 C;  3WTP B;  3LEL C;  3C1C A;  3REL D;  4YM6 D;  1P3P B;  3A1I A;  2F8N B;  5JRG C;  2VQR A;  3KWQ C;  1KU5 A;  4Z2M G;  3MNN A;  4H9R A;  3UTB A;  5AVC D;  3W98 B;  4UPK A;  3C1B A;  3P5J B;  5BT1 C;  4CSR B;  5F99 D;  4YM6 B;  3MNN C;  4J8X C;  1ZLA A;  3UTB C;  5B2J D;  3VH5 W;  3C1B C;  1AOI A;  5B33 D;  2ARO C;  5AVC B;  5GT0 A;  3AZH A;  5CPI B;  1M19 C;  1TZY D;  3WAA D;  3B0D B;  5B1L B;  3VH5 A;  5CHL B;  5F99 B;  3AZF C;  1P3M C;  4R8P A;  1ZLA C;  5AV9 C;  3AZG D;  2Y2M A;  1AOI C;  3UTA A;  4Z66 D;  3AZH C;  5GT0 C;  4WU8 B;  3AV2 A;  3B6G D;  5CPK A;  4H9Q A;  2CV5 B;  3W97 A;  4M6B A;  2HIO A;  3KXB A;  3AYW A;  5E5A D;  1TZY B;  3REJ C;  5G49 B;  5B0Z D;  5B40 D;  1KX4 D;  3B6F D;  3B0C W;  3VH6 A;  3WA9 A;  1PZR A;  3AV1 B;  1P34 A;  3UTA C;  2HUE B;  4E45 A;  3AZK A;  3X1T D;  5BNV A;  4H9O B;  3A6N D;  4XUJ A;  3AZG B;  3AV2 C;  4Z66 B;  3O62 A;  3W97 C;  3AYW C;  3AN2 B;  5B24 D;  5GT3 D;  3FDD A;  1BH8 A;  2Y2J A;  5B2I A;  3AZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...