1M19A

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19A00
1Q9CA 3KUYA 1KX4B 5GXQA 4JJNC 4Z66D 3AZMC 5AVBD 3UTAA 3LZ0C 3AYWB 3B6FD 5FUGB 5B32B 4J8UD 4JJNA 3AZMA 3AN2D 3W99B 4WZSB 5B31G 1BH8B 5CPKA 3LZ0A 3VH6A 1P3IC 4WU8B 4XZQC 3AZFD 1P3AD 4J8XD 1H3OA 1EQZB 2FJ7C 5B31C 4XZQA 4J8VD 1B6WA 1TZYC 3AZKA 1KX5D 1M1AC 2FJ7A 5B31A 2PYOC 1TZYA 1AOIC 4ZUXD 4G92B 2PYOA 3C1BB 5BO0A 5GSUD 3TU4D 4ZBJC 1KX3B 3X1UD 4Z66C 3LJAB 5AVBC 4LD9D 5B1MD 3X1VB 5DNMD 4DRBA 4J8UC 3AN2C 3B0BA 3AFAD 5CPJD 1ID3B 5CP6D 4J8UA 3AN2A 5B24D 3MGQA 3AZFC 1P3AC 4J8XC 3WA9B 3O62D 1P3PC 3VH6T 3AZFA 1P3AA 1P3BB 5B2JC 4H9SA 4WV4B 4J8VC 3AV2C 1P3KA 1P3PA 5B40D 1KX5C 4KGCD 3REHD 3NQJA 5CPIB 4UUZA 5GT0A 5B2JA 4X23D 3AV2A 1KX5A 1M18D 5KDMB 3UT9D 1ZLAC 4ZUXC 3TU4C 5GSUC 4DRAA 4EO5B 1ZLAA 4ZUXA 3X1UC 5B33D 5GSUA 4LD9C 5B1MC 5JRGA 3WTPE 5DNMC 3V9RA 3X1UA 3AFAC 4LD9A 5CPJC 3AZIC 3AZJB 3UTBD 5CP6C 3B0DC 3AFAA 5CPJA 3MGRD 4E45A 4HGAC 3AZIA 3LZ1B 3RELB 5CP6A 3O62C 3AV1A 1N1JB 4G91B 5B2ID 2YFWA 4KGCC 2NZDD 3REHC 1HQ3A 4X23C 4KGCA 1M18C 3C1CD 3UT9C 3REHA 5G49B 4YS3B 3X1TC 3R45B 4X23A 3B6GD 5BNVA 5GT3B 3UT9A 1S32D 3WAAC 5B33C 3X1TA 3REID 1P34D 3WAAA 3AZLD 4H9OA 3UTBC 3MGRC 4H9QB 3UTBA 4J8WA 5B0YB 5AY8D 5B2IC 3MVDB 2NZDC 1KX4D 3WTPB 4NE6A 5B2IA 3AZHB 3AYWD 3C1CC 3WKJB 5B32D 3W99D 3MNNB 3C1CA 1P3MB 1S32C 5C3IC 3AZEB 4WU8D 2LY8A 1BH9A 4YM6B 1EQZD 4KUDC 1S32A 3REIC 1P34C 4Z5TB 3AZLC 5DNNC 1M19A 4KUDA 5E5AB 3REIA 1P34A 5AV9A 3A6NC 3W97C 2AROC 5B1LB 5DNNA 4H9NA 3REKB 3MGPC 3W98B 5B32G 5AY8C 3A6NA 3W97A 2AROA 2IO5B 4H9RB 3C1BD 3MGPA 1KX4C 3MGSB 1KX3D 5B0ZA 1P3FC 3LJAD 2NQBB 3NQUB 1P3OB 3AYWC 3X1VD 3W99C 1P3FA 5JA4B 1ID3D 5FUGA 3W99A 2HUEC 1BH8A 4WU8C 1P3GC 4R8PC 3WA9D 1EQZC 4E44A 3LELB 4WU8A 3KWQB 4R8PA 1P3BD 1P3GA 3W96B 3X1SB 5F99B 5CPID 4CAYB 1P3IA 1TAFA 5AV5B 4G92C 3C1BC 2L5AA 5BNXA 4H9PB 3VH5A 3KUYB 1M1AA 1KX3C 5GXQB 3LJAC 3C1BA 5BT1D 4KHAB 3B0CT 1AOIA 1U35B 4XUJB 3AZJD 5CPKB 1ID3C 3B6FC 4Z66A 5AVBA 1ULYA 3WA9C 3LZ1D 3RELD 1H3OB 3B6FA 1KU5A 4Z2MG 4CSRA 1P3BC 3WA9A 3AZKB 2FJ7B 5CPIC 1TZYB 4J8XA 3VH6W 3AZGB 4YS3D 1JFIB 5BO0B 4EO5C 4J8VA 5KDMA 5GT3D 1F66B 2HIOB 3VH5T 5BT1C 4ZBJB 4NE3A 3TU4A 5AVCB 3MGQB 5B1MA 3LZ1C 3REJB 3RELC 5DNMA 5B0YD 5B24C 4G91C 3LZ1A 3RELA 1P3KB 3MVDD 1P3PB 3WTPD 5B24A 1N1JA 2YFVA 3NQJB 5GT0B 5B2JB 3AZHD 3AV2B 3AZNB 3O62A 3WKJD 5B40C 4YS3C 3MNND 2BYMA 5GT3C 1P3MD 5B40A 1ZLAB 4YS3A 5AV6B 3R45A 3AZED 1WWSA 5JRGB 4YM6D 1M18A 4Z5TD 5E5AD 5BS7C 5B33A 5B1LD 3AZIB 3REKD 3W98D 5B0YC 5BS7A 3AV1B 4QLCB 3MVDC 2YFWB 3WTPC 3MGSD 2NQBD 1HQ3B 3MGRA 3AZHC 1P3OD 3MVDA 4NFTA 3WKJC 3MNNC 1P3MC 2NZDA 5BNVB 3AZEC 3X1TB 3B6GC 4M6BA 4YM6C 1P3MA 5CHLB 4Z5TC 1P3LB 3LELD 3WAAB 1B67A 4H9OB 3KWQD 3B6GA 3W96D 3X1SD 5E5AC 4Z5TA 5F99D 5AV8B 2CV5B 5B1LC 5AV5D 3W98C 4J8WB 3AZLA 1A7WA 2IO5C 5B1LA 4WNNB 3MGSC 3KUYD 5GXQD 1P3OC 3MGSA 1U35D 4XUJD 5AY8A 3NQUA 4Z2MH 1P3OA 5CPKD 4WU9B 1KX4A 5B32C 3KSYA 3KXBB 3AYWA 5B32A 3LELC 3W96C 3KWQC 3AZKD 2RVQD 3X1SC 1M19B 4KUDB 5F99C 2BYKB 2FJ7D 3LELA 3W96A 3KWQA 5AV9B 5DNNB 1TZYD 1EQZA 5F99A 4AWLB 3AZGD 3A6NB 3W97B 2AROB 1F1EA 3MGPB 3KUYC 1F66D 2F8NB 5B0ZB 2HIOD 4H9PA 1U35C 4XUJC 1P3FB 3UTAB 5CPKC 5AVCD 4KHAA 3X1VC 1U35A 4XUJA 1KX3A 3LJAA 4JJNB 3AZMB 3MGQD 3REJD 3LZ0B 3X1VA 3B0CW 2JSSA 2HUEB 1P3GB 4R8PB 1ID3A 1P3KD 3AZKC 2RVQC 1P3PD 1P3IB 5GT0D 1TAFB 4XZQB 5B2JD 3AV2D 3AZND 3AZGC 5B31B 1P3BA 5BNXB 1F66C 3AZGA 1M1AB 1ZLAD 5AV6D 5CPIA 2HIOC 1JFIA 2PYOB 5JRGD 1HTAA 1F66A 1AOIB 2HIOA 5AVCC 4Z66B 5AVBB 3MGQC 3VH5W 3REJC 5AVCA 3AZID 3AZJC 3B6FB 4J8UB 3AN2B 3AV1D 4QLCD 4CSRB 3REJA 3AZJA 4H9SC 1P3KC 1HQ3D 5GT0C 3AZFB 1P3AB 4J8XB 3AZNC 4UUZB 4J8VB 3AZNA 1BFMA 1KX5B 5AV6C 3X1TD 5JRGC 5G49A 5AV6A 1P3LD 4ZUXB 3WAAD 3TU4B 5GSUB 5GT3A 3V9RB 5AV8D 3X1UB 2CV5D 4LD9B 5B1MB 5DNMB 4J8WD 3AFAB 3AV1C 4QLCC 5CPJB 5CP6B 3B0DB 1HQ3C 4QLCA 2YFVB 5B24B 4H9QA 4HGAB 3O62B 5B0YA 2F8NH 2BYMB 4WU9D 4KGCB 5B40B 3WTPA 3KXBD 3REHB 3AZHA 4X23B 1M18B 3WKJA 3UT9B 1P3LC 3MNNA 1M19D 4KUDD 1P3LA 5AV8C 2CV5C 3AZEA 5B33B 5AV9D 5DNND 4YM6A 4J8WC 2F8NK 5AV8A 2CV5A 3A6ND 3W97D 2AROD 3UTBB 3REKC 3MGPD 2F8ND 5E5AA 5B0ZD 3MGRB 4WNNA 3REKA 3W98A 1P3FD 2NQBC 3UTAD 4H9RA 4WU9C 5B2IB 1R4VA 2NZDB 3KXBC 4JJND 3AZMD 2NQBA 4WU9A 3LZ0D 3C1CB 3KXBA 5JA4A 1P3GD 4R8PD 3B6GB 1M19C 1WWIA 1BH9B 2F8NG 1S32B 5AV9C 5C3IB 1P3ID 4XZQD 4AWLC 2BYKA 3REIB 1P34B 5B31D 3AZLB 3X1SA 4H9NB 5AV5C 1M1AD 5B0ZC 2CWEA 4CAYA 2PYOD 2F8NA 5AV5A 4NE5A 1AOID 5GXQC 5AY8B 3UTAC
chains in the Genus database with same CATH superfamily
1Q9CA 3KUYA 1KX4B 5GXQA 4JJNC 4Z66D 3AZMC 5AVBD 3UTAA 3LZ0C 3AYWB 3B6FD 5FUGB 5B32B 4J8UD 4JJNA 3AZMA 3AN2D 3W99B 4WZSB 2Y2LA 5B31G 1BH8B 5CPKA 3LZ0A 2Y2OA 3VH6A 1P3IC 4WU8B 4XZQC 3AZFD 1P3AD 4J8XD 1H3OA 1EQZB 2FJ7C 5B31C 4XZQA 4J8VD 1B6WA 1TZYC 3AZKA 1KX5D 1M1AC 2FJ7A 5B31A 3A1KA 2PYOC 1TZYA 1AOIC 3EPKA 4ZUXD 4G92B 2PYOA 3FDDA 3C1BB 5BO0A 5GSUD 3TU4D 4ZBJC 1KX3B 3X1UD 4Z66C 3LJAB 5AVBC 2Y2PA 5B1MD 4LD9D 3X1VB 5DNMD 4DRBA 4J8UC 3AN2C 3B0BA 3AFAD 5CPJD 1ID3B 5CP6D 4UPKA 4J8UA 3AN2A 5B24D 3MGQA 3AZFC 1P3AC 4J8XC 3WA9B 3O62D 1P3PC 3VH6T 3AZFA 1P3AA 1P3BB 5B2JC 4H9SA 4WV4B 4J8VC 3AV2C 1P3KA 1P3PA 5B40D 1KX5C 4DQYB 4KGCD 3REHD 3NQJA 5CPIB 4UUZA 5GT0A 5B2JA 4X23D 3AV2A 1KX5A 1M18D 5KDMB 3UT9D 1ZLAC 4ZUXC 2JE5A 3TU4C 5GSUC 4DRAA 4EO5B 1ZLAA 4ZUXA 3X1UC 5B33D 2BG1A 2XD1A 5GSUA 5B1MC 4LD9C 5JRGA 3WTPE 5DNMC 3V9RA 3X1UA 3AFAC 4LD9A 5CPJC 3AZIC 3AZJB 3UTBD 5CP6C 2VQRA 3B0DC 3H0RC 3AFAA 5CPJA 3MGRD 4E45A 4HGAC 3AZIA 3LZ1B 3RELB 5CP6A 3O62C 3H0MC 3AV1A 1N1JB 4G91B 5B2ID 2YFWA 4KGCC 2NZDD 3REHC 1HQ3A 4X23C 4KGCA 3H0LC 3C1CD 1M18C 3UT9C 3REHA 5G49B 4YS3B 3X1TC 3R45B 4X23A 3B6GD 2F2AC 5BNVA 5GT3B 3UT9A 1S32D 3WAAC 5B33C 3X1TA 3REID 1P34D 3WAAA 3AZLD 4H9OA 2Y2JA 3UTBC 3MGRC 4H9QB 3UTBA 1W2EA 4J8WA 5B0YB 5AY8D 5B2IC 3MVDB 2NZDC 1KX4D 3WTPB 4NE6A 5B2IA 3AZHB 3AYWD 3C1CC 3WKJB 5B32D 3W99D 3MNNB 2Y2IA 3C1CA 1P3MB 1S32C 3P5JB 4WJ3C 5C3IC 3AZEB 4WU8D 2LY8A 2G5IC 1BH9A 4YM6B 1EQZD 2ZM5A 1S32A 4KUDC 3REIC 1P34C 4Z5TB 3AZLC 5DNNC 2FFFB 1M19A 4KUDA 5E5AB 3REIA 1P34A 5AV9A 3A6NC 3W97C 2AROC 5B1LB 5DNNA 4H9NA 3REKB 3MGPC 3W98B 5B32G 5AY8C 3A6NA 3W97A 2AROA 2IO5B 3A1IA 4H9RB 3C1BD 3MGPA 1KX4C 3MGSB 1KX3D 5B0ZA 1P3FC 3LJAD 2NQBB 3NQUB 1P3OB 3AYWC 2G5HC 3X1VD 3W99C 1P3FA 5JA4B 1ID3D 5FUGA 3W99A 2HUEC 1BH8A 4WU8C 1P3GC 4R8PC 3WA9D 1EQZC 4E44A 2XD5A 3LELB 4WU8A 3KWQB 4R8PA 1P3BD 1P3GA 3W96B 3X1SB 5F99B 5CPID 4CAYB 1P3IA 1TAFA 2Y2NA 2RIQA 5AV5B 4G92C 3C1BC 2L5AA 5BNXA 4H9PB 2Y2KA 3VH5A 3KUYB 1M1AA 1KX3C 5GXQB 3LJAC 3C1BA 5BT1D 4KHAB 3B0CT 1AOIA 1U35B 4XUJB 3AZJD 5CPKB 1ID3C 3B6FC 4Z66A 5AVBA 1ULYA 3WA9C 3LZ1D 3RELD 1H3OB 2DF4C 3B6FA 1KU5A 4Z2MG 3EPHA 4CSRA 1P3BC 3WA9A 3AZKB 2FJ7B 5CPIC 1TZYB 4J8XA 3VH6W 3AZGB 4YS3D 1JFIB 5BO0B 4EO5C 4J8VA 5KDMA 5GT3D 1F66B 2HIOB 3VH5T 5BT1C 4ZBJB 4NE3A 3TU4A 5AVCB 3MGQB 2Y2HA 5B1MA 3LZ1C 3REJB 3RELC 5DNMA 5B0YD 5B24C 4G91C 3LZ1A 3RELA 1P3KB 3MVDD 1P3PB 3WTPD 5B24A 1N1JA 2YFVA 3NQJB 5GT0B 5B2JB 3AZHD 3AV2B 3AZNB 3O62A 3WKJD 5B40C 2Y2QA 4YS3C 3MNND 2BYMA 5GT3C 1P3MD 5B40A 1ZLAB 4YS3A 5AV6B 3R45A 3AZED 1WWSA 5JRGB 4YM6D 1M18A 4Z5TD 5E5AD 5BS7C 5B33A 5B1LD 3AZIB 2Y2MA 3REKD 3W98D 5B0YC 5BS7A 3AV1B 4QLCB 3MVDC 2YFWB 3WTPC 3MGSD 2NQBD 3F6TA 1HQ3B 3MGRA 3AZHC 1P3OD 3MVDA 4NFTA 3WKJC 3MNNC 1P3MC 2NZDA 5BNVB 3AZEC 2J8PA 3X1TB 3B6GC 4M6BA 4YM6C 1P3MA 5CHLB 4Z5TC 1P3LB 3LELD 3WAAB 1B67A 4H9OB 3KWQD 3B6GA 3W96D 3AL0C 3X1SD 5E5AC 4Z5TA 5F99D 5AV8B 2CV5B 5B1LC 3EPJA 5AV5D 3W98C 4J8WB 3AZLA 1A7WA 2IO5C 5B1LA 4WNNB 3MGSC 3KUYD 5GXQD 1P3OC 3MGSA 1U35D 4XUJD 5AY8A 3NQUA 4Z2MH 1P3OA 5CPKD 4WU9B 1KX4A 5B32C 3KSYA 3KXBB 3AYWA 5B32A 3LELC 3W96C 3KWQC 3AZKD 2RVQD 3X1SC 1M19B 4KUDB 5F99C 2BYKB 2FJ7D 3LELA 3W96A 3KWQA 5AV9B 5DNNB 1TZYD 1EQZA 5F99A 4AWLB 3AZGD 3A6NB 3W97B 2AROB 1F1EA 3MGPB 3KUYC 1F66D 2F8NB 3KFUG 5B0ZB 2HIOD 4H9PA 1PZRA 2Y2GA 4XUJC 1U35C 1P3FB 3UTAB 5CPKC 5AVCD 4KHAA 3X1VC 1U35A 4XUJA 1KX3A 3LJAA 4JJNB 3AZMB 3MGQD 3REJD 3LZ0B 3X1VA 3B0CW 2JSSA 2HUEB 1P3GB 4R8PB 1ID3A 1P3KD 3AZKC 2RVQC 1P3PD 1P3IB 5GT0D 1TAFB 4XZQB 5B2JD 3AV2D 3AZND 3AZGC 5B31B 1P3BA 5BNXB 1F66C 3AZGA 1M1AB 1ZLAD 5AV6D 5CPIA 2HIOC 1JFIA 2PYOB 5JRGD 1HTAA 1F66A 1AOIB 2HIOA 2W8SA 5AVCC 4Z66B 5AVBB 3MGQC 3IP4C 3VH5W 3REJC 5AVCA 3AZID 3AZJC 3B6FB 4J8UB 3AN2B 3AV1D 4QLCD 4CSRB 3REJA 3AZJA 2JCHA 4H9SC 1P3KC 3EG5B 1HQ3D 2ZY4A 5GT0C 3AZFB 1P3AB 4J8XB 3AZNC 2ZY2A 4UUZB 4J8VB 3AZNA 1BFMA 3EPLA 1KX5B 2ZY5A 5AV6C 3X1TD 5JRGC 5G49A 5AV6A 1P3LD 4ZUXB 3WAAD 3TU4B 5GSUB 5GT3A 3V9RB 5AV8D 3X1UB 2CV5D 4LD9B 5B1MB 5DNMB 2DQNC 4J8WD 3AFAB 3AV1C 4QLCC 5CPJB 5CP6B 3B0DB 1HQ3C 4QLCA 2YFVB 5B24B 4H9QA 4HGAB 3O62B 5B0YA 2F8NH 2BYMB 4WU9D 4KGCB 5B40B 3WTPA 3KXBD 3REHB 3AZHA 4X23B 1M18B 3WKJA 3UT9B 1P3LC 3MNNA 1M19D 4KUDD 1P3LA 5AV8C 2CV5C 3AZEA 5B33B 5AV9D 5DNND 4YM6A 4J8WC 2F8NK 5AV8A 2CV5A 3A6ND 3W97D 2AROD 3UTBB 3REKC 3MGPD 2F8ND 5E5AA 5B0ZD 3MGRB 4WNNA 3REKA 3W98A 1P3FD 2NQBC 3UTAD 4H9RA 1Z2CB 4WU9C 5B2IB 1R4VA 2NZDB 3KXBC 4JJND 3AZMD 2NQBA 4WU9A 3LZ0D 3C1CB 3KXBA 5JA4A 1P3GD 4R8PD 3B6GB 1M19C 1WWIA 1BH9B 2F8NG 1S32B 2ZY3A 5AV9C 5C3IB 1P3ID 4XZQD 4AWLC 2BYKA 3REIB 1P34B 1T3UA 5B31D 3AZLB 3X1SA 4H9NB 5AV5C 1M1AD 5B0ZC 2CWEA 4CAYA 2PYOD 2F8NA 5AV5A 4NE5A 1AOID 5GXQC 5AY8B 3UTAC 2UWXA
chains in the Genus database with same CATH topology
1Q9CA 3KUYA 1KX4B 5GXQA 4JJNC 4Z66D 3AZMC 5AVBD 3UTAA 3LZ0C 3AYWB 3B6FD 5FUGB 5B32B 4J8UD 4JJNA 3AZMA 3AN2D 3W99B 4WZSB 2Y2LA 5B31G 1BH8B 5CPKA 3LZ0A 2Y2OA 3VH6A 1P3IC 4WU8B 4XZQC 3AZFD 1P3AD 4J8XD 1H3OA 1EQZB 2FJ7C 5B31C 4XZQA 4J8VD 1B6WA 1TZYC 3AZKA 1KX5D 1M1AC 2FJ7A 5B31A 3A1KA 2PYOC 1TZYA 1AOIC 3EPKA 4ZUXD 4G92B 2PYOA 3FDDA 3C1BB 5BO0A 5GSUD 3TU4D 4ZBJC 1KX3B 3X1UD 4Z66C 3LJAB 5AVBC 2Y2PA 5B1MD 4LD9D 3X1VB 5DNMD 4DRBA 4J8UC 3AN2C 3B0BA 3AFAD 5CPJD 1ID3B 5CP6D 4UPKA 4J8UA 3AN2A 5B24D 3MGQA 3AZFC 1P3AC 4J8XC 3WA9B 3O62D 1P3PC 3VH6T 3AZFA 1P3AA 1P3BB 5B2JC 4H9SA 4WV4B 4J8VC 3AV2C 1P3KA 1P3PA 5B40D 1KX5C 4DQYB 4KGCD 3REHD 3NQJA 5CPIB 4UUZA 5GT0A 5B2JA 4X23D 3AV2A 1KX5A 1M18D 5KDMB 3UT9D 1ZLAC 4ZUXC 2JE5A 3TU4C 5GSUC 4DRAA 4EO5B 1ZLAA 4ZUXA 3X1UC 5B33D 2BG1A 2XD1A 5GSUA 5B1MC 4LD9C 5JRGA 3WTPE 5DNMC 3V9RA 3X1UA 3AFAC 4LD9A 5CPJC 3AZIC 3AZJB 3UTBD 5CP6C 2VQRA 3B0DC 3H0RC 3AFAA 5CPJA 3MGRD 4E45A 4HGAC 3AZIA 3LZ1B 3RELB 5CP6A 3O62C 3H0MC 3AV1A 1N1JB 4G91B 5B2ID 2YFWA 4KGCC 2NZDD 3REHC 1HQ3A 4X23C 4KGCA 3H0LC 3C1CD 1M18C 3UT9C 3REHA 5G49B 4YS3B 3X1TC 3R45B 4X23A 3B6GD 2F2AC 5BNVA 5GT3B 3UT9A 1S32D 3WAAC 5B33C 3X1TA 3REID 1P34D 3WAAA 3AZLD 4H9OA 2Y2JA 3UTBC 3MGRC 4H9QB 3UTBA 1W2EA 4J8WA 5B0YB 5AY8D 5B2IC 3MVDB 2NZDC 1KX4D 3WTPB 4NE6A 5B2IA 3AZHB 3AYWD 3C1CC 3WKJB 5B32D 3W99D 3MNNB 2Y2IA 3C1CA 1P3MB 1S32C 3P5JB 4WJ3C 5C3IC 3AZEB 4WU8D 2LY8A 2G5IC 1BH9A 4YM6B 1EQZD 2ZM5A 1S32A 4KUDC 3REIC 1P34C 4Z5TB 3AZLC 5DNNC 2FFFB 1M19A 4KUDA 5E5AB 3REIA 1P34A 5AV9A 3A6NC 3W97C 2AROC 5B1LB 5DNNA 4H9NA 3REKB 3MGPC 3W98B 5B32G 5AY8C 3A6NA 3W97A 2AROA 2IO5B 3A1IA 4H9RB 3C1BD 3MGPA 1KX4C 3MGSB 1KX3D 5B0ZA 1P3FC 3LJAD 2NQBB 3NQUB 1P3OB 3AYWC 2G5HC 3X1VD 3W99C 1P3FA 5JA4B 1ID3D 5FUGA 3W99A 2HUEC 1BH8A 4WU8C 1P3GC 4R8PC 3WA9D 1EQZC 4E44A 2XD5A 3LELB 4WU8A 3KWQB 4R8PA 1P3BD 1P3GA 3W96B 3X1SB 5F99B 5CPID 4CAYB 1P3IA 1TAFA 2Y2NA 2RIQA 5AV5B 4G92C 3C1BC 2L5AA 5BNXA 4H9PB 2Y2KA 3VH5A 3KUYB 1M1AA 1KX3C 5GXQB 3LJAC 3C1BA 5BT1D 4KHAB 3B0CT 1AOIA 1U35B 4XUJB 3AZJD 5CPKB 1ID3C 3B6FC 4Z66A 5AVBA 1ULYA 3WA9C 3LZ1D 3RELD 1H3OB 2DF4C 3B6FA 1KU5A 4Z2MG 3EPHA 4CSRA 1P3BC 3WA9A 3AZKB 2FJ7B 5CPIC 1TZYB 4J8XA 3VH6W 3AZGB 4YS3D 1JFIB 5BO0B 4EO5C 4J8VA 5KDMA 5GT3D 1F66B 2HIOB 3VH5T 5BT1C 4ZBJB 4NE3A 3TU4A 5AVCB 3MGQB 2Y2HA 5B1MA 3LZ1C 3REJB 3RELC 5DNMA 5B0YD 5B24C 4G91C 3LZ1A 3RELA 1P3KB 3MVDD 1P3PB 3WTPD 5B24A 1N1JA 2YFVA 3NQJB 5GT0B 5B2JB 3AZHD 3AV2B 3AZNB 3O62A 3WKJD 5B40C 2Y2QA 4YS3C 3MNND 2BYMA 5GT3C 1P3MD 5B40A 1ZLAB 4YS3A 5AV6B 3R45A 3AZED 1WWSA 5JRGB 4YM6D 1M18A 4Z5TD 5E5AD 5BS7C 5B33A 5B1LD 3AZIB 2Y2MA 3REKD 3W98D 5B0YC 5BS7A 3AV1B 4QLCB 3MVDC 2YFWB 3WTPC 3MGSD 2NQBD 3F6TA 1HQ3B 3MGRA 3AZHC 1P3OD 3MVDA 4NFTA 3WKJC 3MNNC 1P3MC 2NZDA 5BNVB 3AZEC 2J8PA 3X1TB 3B6GC 4M6BA 4YM6C 1P3MA 5CHLB 4Z5TC 1P3LB 3LELD 3WAAB 1B67A 4H9OB 3KWQD 3B6GA 3W96D 3AL0C 3X1SD 5E5AC 4Z5TA 5F99D 5AV8B 2CV5B 5B1LC 3EPJA 5AV5D 3W98C 4J8WB 3AZLA 1A7WA 2IO5C 5B1LA 4WNNB 3MGSC 3KUYD 5GXQD 1P3OC 3MGSA 1U35D 4XUJD 5AY8A 3NQUA 4Z2MH 1P3OA 5CPKD 4WU9B 1KX4A 5B32C 3KSYA 3KXBB 3AYWA 5B32A 3LELC 3W96C 3KWQC 3AZKD 2RVQD 3X1SC 1M19B 4KUDB 5F99C 2BYKB 2FJ7D 3LELA 3W96A 3KWQA 5AV9B 5DNNB 1TZYD 1EQZA 5F99A 4AWLB 3AZGD 3A6NB 3W97B 2AROB 1F1EA 3MGPB 3KUYC 1F66D 2F8NB 3KFUG 5B0ZB 2HIOD 4H9PA 1PZRA 2Y2GA 4XUJC 1U35C 1P3FB 3UTAB 5CPKC 5AVCD 4KHAA 3X1VC 1U35A 4XUJA 1KX3A 3LJAA 4JJNB 3AZMB 3MGQD 3REJD 3LZ0B 3X1VA 3B0CW 2JSSA 2HUEB 1P3GB 4R8PB 1ID3A 1P3KD 3AZKC 2RVQC 1P3PD 1P3IB 5GT0D 1TAFB 4XZQB 5B2JD 3AV2D 3AZND 3AZGC 5B31B 1P3BA 5BNXB 1F66C 3AZGA 1M1AB 1ZLAD 5AV6D 5CPIA 2HIOC 1JFIA 2PYOB 5JRGD 1HTAA 1F66A 1AOIB 2HIOA 2W8SA 5AVCC 4Z66B 5AVBB 3MGQC 3IP4C 3VH5W 3REJC 5AVCA 3AZID 3AZJC 3B6FB 4J8UB 3AN2B 3AV1D 4QLCD 4CSRB 3REJA 3AZJA 2JCHA 4H9SC 1P3KC 3EG5B 1HQ3D 2ZY4A 5GT0C 3AZFB 1P3AB 4J8XB 3AZNC 2ZY2A 4UUZB 4J8VB 3AZNA 1BFMA 3EPLA 1KX5B 2ZY5A 5AV6C 3X1TD 5JRGC 5G49A 5AV6A 1P3LD 4ZUXB 3WAAD 3TU4B 5GSUB 5GT3A 3V9RB 5AV8D 3X1UB 2CV5D 4LD9B 5B1MB 5DNMB 2DQNC 4J8WD 3AFAB 3AV1C 4QLCC 5CPJB 5CP6B 3B0DB 1HQ3C 4QLCA 2YFVB 5B24B 4H9QA 4HGAB 3O62B 5B0YA 2F8NH 2BYMB 4WU9D 4KGCB 5B40B 3WTPA 3KXBD 3REHB 3AZHA 4X23B 1M18B 3WKJA 3UT9B 1P3LC 3MNNA 1M19D 4KUDD 1P3LA 5AV8C 2CV5C 3AZEA 5B33B 5AV9D 5DNND 4YM6A 4J8WC 2F8NK 5AV8A 2CV5A 3A6ND 3W97D 2AROD 3UTBB 3REKC 3MGPD 2F8ND 5E5AA 5B0ZD 3MGRB 4WNNA 3REKA 3W98A 1P3FD 2NQBC 3UTAD 4H9RA 1Z2CB 4WU9C 5B2IB 1R4VA 2NZDB 3KXBC 4JJND 3AZMD 2NQBA 4WU9A 3LZ0D 3C1CB 3KXBA 5JA4A 1P3GD 4R8PD 3B6GB 1M19C 1WWIA 1BH9B 2F8NG 1S32B 2ZY3A 5AV9C 5C3IB 1P3ID 4XZQD 4AWLC 2BYKA 3REIB 1P34B 1T3UA 5B31D 3AZLB 3X1SA 4H9NB 5AV5C 1M1AD 5B0ZC 2CWEA 4CAYA 2PYOD 2F8NA 5AV5A 4NE5A 1AOID 5GXQC 5AY8B 3UTAC 2UWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9C A;  3KUY A;  1KX4 B;  5GXQ A;  4JJN C;  4Z66 D;  3AZM C;  5AVB D;  3UTA A;  3LZ0 C;  3AYW B;  3B6F D;  5FUG B;  5B32 B;  4J8U D;  4JJN A;  3AZM A;  3AN2 D;  3W99 B;  4WZS B;  5B31 G;  1BH8 B;  5CPK A;  3LZ0 A;  3VH6 A;  1P3I C;  4WU8 B;  4XZQ C;  3AZF D;  1P3A D;  4J8X D;  1H3O A;  1EQZ B;  2FJ7 C;  5B31 C;  4XZQ A;  4J8V D;  1B6W A;  1TZY C;  3AZK A;  1KX5 D;  1M1A C;  2FJ7 A;  5B31 A;  2PYO C;  1TZY A;  1AOI C;  4ZUX D;  4G92 B;  2PYO A;  3C1B B;  5BO0 A;  5GSU D;  3TU4 D;  4ZBJ C;  1KX3 B;  3X1U D;  4Z66 C;  3LJA B;  5AVB C;  4LD9 D;  5B1M D;  3X1V B;  5DNM D;  4DRB A;  4J8U C;  3AN2 C;  3B0B A;  3AFA D;  5CPJ D;  1ID3 B;  5CP6 D;  4J8U A;  3AN2 A;  5B24 D;  3MGQ A;  3AZF C;  1P3A C;  4J8X C;  3WA9 B;  3O62 D;  1P3P C;  3VH6 T;  3AZF A;  1P3A A;  1P3B B;  5B2J C;  4H9S A;  4WV4 B;  4J8V C;  3AV2 C;  1P3K A;  1P3P A;  5B40 D;  1KX5 C;  4KGC D;  3REH D;  3NQJ A;  5CPI B;  4UUZ A;  5GT0 A;  5B2J A;  4X23 D;  3AV2 A;  1KX5 A;  1M18 D;  5KDM B;  3UT9 D;  1ZLA C;  4ZUX C;  3TU4 C;  5GSU C;  4DRA A;  4EO5 B;  1ZLA A;  4ZUX A;  3X1U C;  5B33 D;  5GSU A;  4LD9 C;  5B1M C;  5JRG A;  3WTP E;  5DNM C;  3V9R A;  3X1U A;  3AFA C;  4LD9 A;  5CPJ C;  3AZI C;  3AZJ B;  3UTB D;  5CP6 C;  3B0D C;  3AFA A;  5CPJ A;  3MGR D;  4E45 A;  4HGA C;  3AZI A;  3LZ1 B;  3REL B;  5CP6 A;  3O62 C;  3AV1 A;  1N1J B;  4G91 B;  5B2I D;  2YFW A;  4KGC C;  2NZD D;  3REH C;  1HQ3 A;  4X23 C;  4KGC A;  1M18 C;  3C1C D;  3UT9 C;  3REH A;  5G49 B;  4YS3 B;  3X1T C;  3R45 B;  4X23 A;  3B6G D;  5BNV A;  5GT3 B;  3UT9 A;  1S32 D;  3WAA C;  5B33 C;  3X1T A;  3REI D;  1P34 D;  3WAA A;  3AZL D;  4H9O A;  3UTB C;  3MGR C;  4H9Q B;  3UTB A;  4J8W A;  5B0Y B;  5AY8 D;  5B2I C;  3MVD B;  2NZD C;  1KX4 D;  3WTP B;  4NE6 A;  5B2I A;  3AZH B;  3AYW D;  3C1C C;  3WKJ B;  5B32 D;  3W99 D;  3MNN B;  3C1C A;  1P3M B;  1S32 C;  5C3I C;  3AZE B;  4WU8 D;  2LY8 A;  1BH9 A;  4YM6 B;  1EQZ D;  4KUD C;  1S32 A;  3REI C;  1P34 C;  4Z5T B;  3AZL C;  5DNN C;  1M19 A;  4KUD A;  5E5A B;  3REI A;  1P34 A;  5AV9 A;  3A6N C;  3W97 C;  2ARO C;  5B1L B;  5DNN A;  4H9N A;  3REK B;  3MGP C;  3W98 B;  5B32 G;  5AY8 C;  3A6N A;  3W97 A;  2ARO A;  2IO5 B;  4H9R B;  3C1B D;  3MGP A;  1KX4 C;  3MGS B;  1KX3 D;  5B0Z A;  1P3F C;  3LJA D;  2NQB B;  3NQU B;  1P3O B;  3AYW C;  3X1V D;  3W99 C;  1P3F A;  5JA4 B;  1ID3 D;  5FUG A;  3W99 A;  2HUE C;  1BH8 A;  4WU8 C;  1P3G C;  4R8P C;  3WA9 D;  1EQZ C;  4E44 A;  3LEL B;  4WU8 A;  3KWQ B;  4R8P A;  1P3B D;  1P3G A;  3W96 B;  3X1S B;  5F99 B;  5CPI D;  4CAY B;  1P3I A;  1TAF A;  5AV5 B;  4G92 C;  3C1B C;  2L5A A;  5BNX A;  4H9P B;  3VH5 A;  3KUY B;  1M1A A;  1KX3 C;  5GXQ B;  3LJA C;  3C1B A;  5BT1 D;  4KHA B;  3B0C T;  1AOI A;  1U35 B;  4XUJ B;  3AZJ D;  5CPK B;  1ID3 C;  3B6F C;  4Z66 A;  5AVB A;  1ULY A;  3WA9 C;  3LZ1 D;  3REL D;  1H3O B;  3B6F A;  1KU5 A;  4Z2M G;  4CSR A;  1P3B C;  3WA9 A;  3AZK B;  2FJ7 B;  5CPI C;  1TZY B;  4J8X A;  3VH6 W;  3AZG B;  4YS3 D;  1JFI B;  5BO0 B;  4EO5 C;  4J8V A;  5KDM A;  5GT3 D;  1F66 B;  2HIO B;  3VH5 T;  5BT1 C;  4ZBJ B;  4NE3 A;  3TU4 A;  5AVC B;  3MGQ B;  5B1M A;  3LZ1 C;  3REJ B;  3REL C;  5DNM A;  5B0Y D;  5B24 C;  4G91 C;  3LZ1 A;  3REL A;  1P3K B;  3MVD D;  1P3P B;  3WTP D;  5B24 A;  1N1J A;  2YFV A;  3NQJ B;  5GT0 B;  5B2J B;  3AZH D;  3AV2 B;  3AZN B;  3O62 A;  3WKJ D;  5B40 C;  4YS3 C;  3MNN D;  2BYM A;  5GT3 C;  1P3M D;  5B40 A;  1ZLA B;  4YS3 A;  5AV6 B;  3R45 A;  3AZE D;  1WWS A;  5JRG B;  4YM6 D;  1M18 A;  4Z5T D;  5E5A D;  5BS7 C;  5B33 A;  5B1L D;  3AZI B;  3REK D;  3W98 D;  5B0Y C;  5BS7 A;  3AV1 B;  4QLC B;  3MVD C;  2YFW B;  3WTP C;  3MGS D;  2NQB D;  1HQ3 B;  3MGR A;  3AZH C;  1P3O D;  3MVD A;  4NFT A;  3WKJ C;  3MNN C;  1P3M C;  2NZD A;  5BNV B;  3AZE C;  3X1T B;  3B6G C;  4M6B A;  4YM6 C;  1P3M A;  5CHL B;  4Z5T C;  1P3L B;  3LEL D;  3WAA B;  1B67 A;  4H9O B;  3KWQ D;  3B6G A;  3W96 D;  3X1S D;  5E5A C;  4Z5T A;  5F99 D;  5AV8 B;  2CV5 B;  5B1L C;  5AV5 D;  3W98 C;  4J8W B;  3AZL A;  1A7W A;  2IO5 C;  5B1L A;  4WNN B;  3MGS C;  3KUY D;  5GXQ D;  1P3O C;  3MGS A;  1U35 D;  4XUJ D;  5AY8 A;  3NQU A;  4Z2M H;  1P3O A;  5CPK D;  4WU9 B;  1KX4 A;  5B32 C;  3KSY A;  3KXB B;  3AYW A;  5B32 A;  3LEL C;  3W96 C;  3KWQ C;  3AZK D;  2RVQ D;  3X1S C;  1M19 B;  4KUD B;  5F99 C;  2BYK B;  2FJ7 D;  3LEL A;  3W96 A;  3KWQ A;  5AV9 B;  5DNN B;  1TZY D;  1EQZ A;  5F99 A;  4AWL B;  3AZG D;  3A6N B;  3W97 B;  2ARO B;  1F1E A;  3MGP B;  3KUY C;  1F66 D;  2F8N B;  5B0Z B;  2HIO D;  4H9P A;  1U35 C;  4XUJ C;  1P3F B;  3UTA B;  5CPK C;  5AVC D;  4KHA A;  3X1V C;  1U35 A;  4XUJ A;  1KX3 A;  3LJA A;  4JJN B;  3AZM B;  3MGQ D;  3REJ D;  3LZ0 B;  3X1V A;  3B0C W;  2JSS A;  2HUE B;  1P3G B;  4R8P B;  1ID3 A;  1P3K D;  3AZK C;  2RVQ C;  1P3P D;  1P3I B;  5GT0 D;  1TAF B;  4XZQ B;  5B2J D;  3AV2 D;  3AZN D;  3AZG C;  5B31 B;  1P3B A;  5BNX B;  1F66 C;  3AZG A;  1M1A B;  1ZLA D;  5AV6 D;  5CPI A;  2HIO C;  1JFI A;  2PYO B;  5JRG D;  1HTA A;  1F66 A;  1AOI B;  2HIO A;  5AVC C;  4Z66 B;  5AVB B;  3MGQ C;  3VH5 W;  3REJ C;  5AVC A;  3AZI D;  3AZJ C;  3B6F B;  4J8U B;  3AN2 B;  3AV1 D;  4QLC D;  4CSR B;  3REJ A;  3AZJ A;  4H9S C;  1P3K C;  1HQ3 D;  5GT0 C;  3AZF B;  1P3A B;  4J8X B;  3AZN C;  4UUZ B;  4J8V B;  3AZN A;  1BFM A;  1KX5 B;  5AV6 C;  3X1T D;  5JRG C;  5G49 A;  5AV6 A;  1P3L D;  4ZUX B;  3WAA D;  3TU4 B;  5GSU B;  5GT3 A;  3V9R B;  5AV8 D;  3X1U B;  2CV5 D;  4LD9 B;  5B1M B;  5DNM B;  4J8W D;  3AFA B;  3AV1 C;  4QLC C;  5CPJ B;  5CP6 B;  3B0D B;  1HQ3 C;  4QLC A;  2YFV B;  5B24 B;  4H9Q A;  4HGA B;  3O62 B;  5B0Y A;  2F8N H;  2BYM B;  4WU9 D;  4KGC B;  5B40 B;  3WTP A;  3KXB D;  3REH B;  3AZH A;  4X23 B;  1M18 B;  3WKJ A;  3UT9 B;  1P3L C;  3MNN A;  1M19 D;  4KUD D;  1P3L A;  5AV8 C;  2CV5 C;  3AZE A;  5B33 B;  5AV9 D;  5DNN D;  4YM6 A;  4J8W C;  2F8N K;  5AV8 A;  2CV5 A;  3A6N D;  3W97 D;  2ARO D;  3UTB B;  3REK C;  3MGP D;  2F8N D;  5E5A A;  5B0Z D;  3MGR B;  4WNN A;  3REK A;  3W98 A;  1P3F D;  2NQB C;  3UTA D;  4H9R A;  4WU9 C;  5B2I B;  1R4V A;  2NZD B;  3KXB C;  4JJN D;  3AZM D;  2NQB A;  4WU9 A;  3LZ0 D;  3C1C B;  3KXB A;  5JA4 A;  1P3G D;  4R8P D;  3B6G B;  1M19 C;  1WWI A;  1BH9 B;  2F8N G;  1S32 B;  5AV9 C;  5C3I B;  1P3I D;  4XZQ D;  4AWL C;  2BYK A;  3REI B;  1P34 B;  5B31 D;  3AZL B;  3X1S A;  4H9N B;  5AV5 C;  1M1A D;  5B0Z C;  2CWE A;  4CAY A;  2PYO D;  2F8N A;  5AV5 A;  4NE5 A;  1AOI D;  5GXQ C;  5AY8 B;  3UTA C; 
#chains in the Genus database with same CATH topology
 1Q9C A;  3KUY A;  1KX4 B;  5GXQ A;  4JJN C;  4Z66 D;  3AZM C;  5AVB D;  3UTA A;  3LZ0 C;  3AYW B;  3B6F D;  5FUG B;  5B32 B;  4J8U D;  4JJN A;  3AZM A;  3AN2 D;  3W99 B;  4WZS B;  2Y2L A;  5B31 G;  1BH8 B;  5CPK A;  3LZ0 A;  2Y2O A;  3VH6 A;  1P3I C;  4WU8 B;  4XZQ C;  3AZF D;  1P3A D;  4J8X D;  1H3O A;  1EQZ B;  2FJ7 C;  5B31 C;  4XZQ A;  4J8V D;  1B6W A;  1TZY C;  3AZK A;  1KX5 D;  1M1A C;  2FJ7 A;  5B31 A;  3A1K A;  2PYO C;  1TZY A;  1AOI C;  3EPK A;  4ZUX D;  4G92 B;  2PYO A;  3FDD A;  3C1B B;  5BO0 A;  5GSU D;  3TU4 D;  4ZBJ C;  1KX3 B;  3X1U D;  4Z66 C;  3LJA B;  5AVB C;  2Y2P A;  5B1M D;  4LD9 D;  3X1V B;  5DNM D;  4DRB A;  4J8U C;  3AN2 C;  3B0B A;  3AFA D;  5CPJ D;  1ID3 B;  5CP6 D;  4UPK A;  4J8U A;  3AN2 A;  5B24 D;  3MGQ A;  3AZF C;  1P3A C;  4J8X C;  3WA9 B;  3O62 D;  1P3P C;  3VH6 T;  3AZF A;  1P3A A;  1P3B B;  5B2J C;  4H9S A;  4WV4 B;  4J8V C;  3AV2 C;  1P3K A;  1P3P A;  5B40 D;  1KX5 C;  4DQY B;  4KGC D;  3REH D;  3NQJ A;  5CPI B;  4UUZ A;  5GT0 A;  5B2J A;  4X23 D;  3AV2 A;  1KX5 A;  1M18 D;  5KDM B;  3UT9 D;  1ZLA C;  4ZUX C;  2JE5 A;  3TU4 C;  5GSU C;  4DRA A;  4EO5 B;  1ZLA A;  4ZUX A;  3X1U C;  5B33 D;  2BG1 A;  2XD1 A;  5GSU A;  5B1M C;  4LD9 C;  5JRG A;  3WTP E;  5DNM C;  3V9R A;  3X1U A;  3AFA C;  4LD9 A;  5CPJ C;  3AZI C;  3AZJ B;  3UTB D;  5CP6 C;  2VQR A;  3B0D C;  3H0R C;  3AFA A;  5CPJ A;  3MGR D;  4E45 A;  4HGA C;  3AZI A;  3LZ1 B;  3REL B;  5CP6 A;  3O62 C;  3H0M C;  3AV1 A;  1N1J B;  4G91 B;  5B2I D;  2YFW A;  4KGC C;  2NZD D;  3REH C;  1HQ3 A;  4X23 C;  4KGC A;  3H0L C;  3C1C D;  1M18 C;  3UT9 C;  3REH A;  5G49 B;  4YS3 B;  3X1T C;  3R45 B;  4X23 A;  3B6G D;  2F2A C;  5BNV A;  5GT3 B;  3UT9 A;  1S32 D;  3WAA C;  5B33 C;  3X1T A;  3REI D;  1P34 D;  3WAA A;  3AZL D;  4H9O A;  2Y2J A;  3UTB C;  3MGR C;  4H9Q B;  3UTB A;  1W2E A;  4J8W A;  5B0Y B;  5AY8 D;  5B2I C;  3MVD B;  2NZD C;  1KX4 D;  3WTP B;  4NE6 A;  5B2I A;  3AZH B;  3AYW D;  3C1C C;  3WKJ B;  5B32 D;  3W99 D;  3MNN B;  2Y2I A;  3C1C A;  1P3M B;  1S32 C;  3P5J B;  4WJ3 C;  5C3I C;  3AZE B;  4WU8 D;  2LY8 A;  2G5I C;  1BH9 A;  4YM6 B;  1EQZ D;  2ZM5 A;  1S32 A;  4KUD C;  3REI C;  1P34 C;  4Z5T B;  3AZL C;  5DNN C;  2FFF B;  1M19 A;  4KUD A;  5E5A B;  3REI A;  1P34 A;  5AV9 A;  3A6N C;  3W97 C;  2ARO C;  5B1L B;  5DNN A;  4H9N A;  3REK B;  3MGP C;  3W98 B;  5B32 G;  5AY8 C;  3A6N A;  3W97 A;  2ARO A;  2IO5 B;  3A1I A;  4H9R B;  3C1B D;  3MGP A;  1KX4 C;  3MGS B;  1KX3 D;  5B0Z A;  1P3F C;  3LJA D;  2NQB B;  3NQU B;  1P3O B;  3AYW C;  2G5H C;  3X1V D;  3W99 C;  1P3F A;  5JA4 B;  1ID3 D;  5FUG A;  3W99 A;  2HUE C;  1BH8 A;  4WU8 C;  1P3G C;  4R8P C;  3WA9 D;  1EQZ C;  4E44 A;  2XD5 A;  3LEL B;  4WU8 A;  3KWQ B;  4R8P A;  1P3B D;  1P3G A;  3W96 B;  3X1S B;  5F99 B;  5CPI D;  4CAY B;  1P3I A;  1TAF A;  2Y2N A;  2RIQ A;  5AV5 B;  4G92 C;  3C1B C;  2L5A A;  5BNX A;  4H9P B;  2Y2K A;  3VH5 A;  3KUY B;  1M1A A;  1KX3 C;  5GXQ B;  3LJA C;  3C1B A;  5BT1 D;  4KHA B;  3B0C T;  1AOI A;  1U35 B;  4XUJ B;  3AZJ D;  5CPK B;  1ID3 C;  3B6F C;  4Z66 A;  5AVB A;  1ULY A;  3WA9 C;  3LZ1 D;  3REL D;  1H3O B;  2DF4 C;  3B6F A;  1KU5 A;  4Z2M G;  3EPH A;  4CSR A;  1P3B C;  3WA9 A;  3AZK B;  2FJ7 B;  5CPI C;  1TZY B;  4J8X A;  3VH6 W;  3AZG B;  4YS3 D;  1JFI B;  5BO0 B;  4EO5 C;  4J8V A;  5KDM A;  5GT3 D;  1F66 B;  2HIO B;  3VH5 T;  5BT1 C;  4ZBJ B;  4NE3 A;  3TU4 A;  5AVC B;  3MGQ B;  2Y2H A;  5B1M A;  3LZ1 C;  3REJ B;  3REL C;  5DNM A;  5B0Y D;  5B24 C;  4G91 C;  3LZ1 A;  3REL A;  1P3K B;  3MVD D;  1P3P B;  3WTP D;  5B24 A;  1N1J A;  2YFV A;  3NQJ B;  5GT0 B;  5B2J B;  3AZH D;  3AV2 B;  3AZN B;  3O62 A;  3WKJ D;  5B40 C;  2Y2Q A;  4YS3 C;  3MNN D;  2BYM A;  5GT3 C;  1P3M D;  5B40 A;  1ZLA B;  4YS3 A;  5AV6 B;  3R45 A;  3AZE D;  1WWS A;  5JRG B;  4YM6 D;  1M18 A;  4Z5T D;  5E5A D;  5BS7 C;  5B33 A;  5B1L D;  3AZI B;  2Y2M A;  3REK D;  3W98 D;  5B0Y C;  5BS7 A;  3AV1 B;  4QLC B;  3MVD C;  2YFW B;  3WTP C;  3MGS D;  2NQB D;  3F6T A;  1HQ3 B;  3MGR A;  3AZH C;  1P3O D;  3MVD A;  4NFT A;  3WKJ C;  3MNN C;  1P3M C;  2NZD A;  5BNV B;  3AZE C;  2J8P A;  3X1T B;  3B6G C;  4M6B A;  4YM6 C;  1P3M A;  5CHL B;  4Z5T C;  1P3L B;  3LEL D;  3WAA B;  1B67 A;  4H9O B;  3KWQ D;  3B6G A;  3W96 D;  3AL0 C;  3X1S D;  5E5A C;  4Z5T A;  5F99 D;  5AV8 B;  2CV5 B;  5B1L C;  3EPJ A;  5AV5 D;  3W98 C;  4J8W B;  3AZL A;  1A7W A;  2IO5 C;  5B1L A;  4WNN B;  3MGS C;  3KUY D;  5GXQ D;  1P3O C;  3MGS A;  1U35 D;  4XUJ D;  5AY8 A;  3NQU A;  4Z2M H;  1P3O A;  5CPK D;  4WU9 B;  1KX4 A;  5B32 C;  3KSY A;  3KXB B;  3AYW A;  5B32 A;  3LEL C;  3W96 C;  3KWQ C;  3AZK D;  2RVQ D;  3X1S C;  1M19 B;  4KUD B;  5F99 C;  2BYK B;  2FJ7 D;  3LEL A;  3W96 A;  3KWQ A;  5AV9 B;  5DNN B;  1TZY D;  1EQZ A;  5F99 A;  4AWL B;  3AZG D;  3A6N B;  3W97 B;  2ARO B;  1F1E A;  3MGP B;  3KUY C;  1F66 D;  2F8N B;  3KFU G;  5B0Z B;  2HIO D;  4H9P A;  1PZR A;  2Y2G A;  4XUJ C;  1U35 C;  1P3F B;  3UTA B;  5CPK C;  5AVC D;  4KHA A;  3X1V C;  1U35 A;  4XUJ A;  1KX3 A;  3LJA A;  4JJN B;  3AZM B;  3MGQ D;  3REJ D;  3LZ0 B;  3X1V A;  3B0C W;  2JSS A;  2HUE B;  1P3G B;  4R8P B;  1ID3 A;  1P3K D;  3AZK C;  2RVQ C;  1P3P D;  1P3I B;  5GT0 D;  1TAF B;  4XZQ B;  5B2J D;  3AV2 D;  3AZN D;  3AZG C;  5B31 B;  1P3B A;  5BNX B;  1F66 C;  3AZG A;  1M1A B;  1ZLA D;  5AV6 D;  5CPI A;  2HIO C;  1JFI A;  2PYO B;  5JRG D;  1HTA A;  1F66 A;  1AOI B;  2HIO A;  2W8S A;  5AVC C;  4Z66 B;  5AVB B;  3MGQ C;  3IP4 C;  3VH5 W;  3REJ C;  5AVC A;  3AZI D;  3AZJ C;  3B6F B;  4J8U B;  3AN2 B;  3AV1 D;  4QLC D;  4CSR B;  3REJ A;  3AZJ A;  2JCH A;  4H9S C;  1P3K C;  3EG5 B;  1HQ3 D;  2ZY4 A;  5GT0 C;  3AZF B;  1P3A B;  4J8X B;  3AZN C;  2ZY2 A;  4UUZ B;  4J8V B;  3AZN A;  1BFM A;  3EPL A;  1KX5 B;  2ZY5 A;  5AV6 C;  3X1T D;  5JRG C;  5G49 A;  5AV6 A;  1P3L D;  4ZUX B;  3WAA D;  3TU4 B;  5GSU B;  5GT3 A;  3V9R B;  5AV8 D;  3X1U B;  2CV5 D;  4LD9 B;  5B1M B;  5DNM B;  2DQN C;  4J8W D;  3AFA B;  3AV1 C;  4QLC C;  5CPJ B;  5CP6 B;  3B0D B;  1HQ3 C;  4QLC A;  2YFV B;  5B24 B;  4H9Q A;  4HGA B;  3O62 B;  5B0Y A;  2F8N H;  2BYM B;  4WU9 D;  4KGC B;  5B40 B;  3WTP A;  3KXB D;  3REH B;  3AZH A;  4X23 B;  1M18 B;  3WKJ A;  3UT9 B;  1P3L C;  3MNN A;  1M19 D;  4KUD D;  1P3L A;  5AV8 C;  2CV5 C;  3AZE A;  5B33 B;  5AV9 D;  5DNN D;  4YM6 A;  4J8W C;  2F8N K;  5AV8 A;  2CV5 A;  3A6N D;  3W97 D;  2ARO D;  3UTB B;  3REK C;  3MGP D;  2F8N D;  5E5A A;  5B0Z D;  3MGR B;  4WNN A;  3REK A;  3W98 A;  1P3F D;  2NQB C;  3UTA D;  4H9R A;  1Z2C B;  4WU9 C;  5B2I B;  1R4V A;  2NZD B;  3KXB C;  4JJN D;  3AZM D;  2NQB A;  4WU9 A;  3LZ0 D;  3C1C B;  3KXB A;  5JA4 A;  1P3G D;  4R8P D;  3B6G B;  1M19 C;  1WWI A;  1BH9 B;  2F8N G;  1S32 B;  2ZY3 A;  5AV9 C;  5C3I B;  1P3I D;  4XZQ D;  4AWL C;  2BYK A;  3REI B;  1P34 B;  1T3U A;  5B31 D;  3AZL B;  3X1S A;  4H9N B;  5AV5 C;  1M1A D;  5B0Z C;  2CWE A;  4CAY A;  2PYO D;  2F8N A;  5AV5 A;  4NE5 A;  1AOI D;  5GXQ C;  5AY8 B;  3UTA C;  2UWX A; 
#chains in the Genus database with same CATH homology
 1Q9C A;  3KUY A;  1KX4 B;  5GXQ A;  4JJN C;  4Z66 D;  3AZM C;  5AVB D;  3UTA A;  3LZ0 C;  3AYW B;  3B6F D;  5FUG B;  5B32 B;  4J8U D;  4JJN A;  3AZM A;  3AN2 D;  3W99 B;  4WZS B;  2Y2L A;  5B31 G;  1BH8 B;  5CPK A;  3LZ0 A;  2Y2O A;  3VH6 A;  1P3I C;  4WU8 B;  4XZQ C;  3AZF D;  1P3A D;  4J8X D;  1H3O A;  1EQZ B;  2FJ7 C;  5B31 C;  4XZQ A;  4J8V D;  1B6W A;  1TZY C;  3AZK A;  1KX5 D;  1M1A C;  2FJ7 A;  5B31 A;  3A1K A;  2PYO C;  1TZY A;  1AOI C;  3EPK A;  4ZUX D;  4G92 B;  2PYO A;  3FDD A;  3C1B B;  5BO0 A;  5GSU D;  3TU4 D;  4ZBJ C;  1KX3 B;  3X1U D;  4Z66 C;  3LJA B;  5AVB C;  2Y2P A;  5B1M D;  4LD9 D;  3X1V B;  5DNM D;  4DRB A;  4J8U C;  3AN2 C;  3B0B A;  3AFA D;  5CPJ D;  1ID3 B;  5CP6 D;  4UPK A;  4J8U A;  3AN2 A;  5B24 D;  3MGQ A;  3AZF C;  1P3A C;  4J8X C;  3WA9 B;  3O62 D;  1P3P C;  3VH6 T;  3AZF A;  1P3A A;  1P3B B;  5B2J C;  4H9S A;  4WV4 B;  4J8V C;  3AV2 C;  1P3K A;  1P3P A;  5B40 D;  1KX5 C;  4DQY B;  4KGC D;  3REH D;  3NQJ A;  5CPI B;  4UUZ A;  5GT0 A;  5B2J A;  4X23 D;  3AV2 A;  1KX5 A;  1M18 D;  5KDM B;  3UT9 D;  1ZLA C;  4ZUX C;  2JE5 A;  3TU4 C;  5GSU C;  4DRA A;  4EO5 B;  1ZLA A;  4ZUX A;  3X1U C;  5B33 D;  2BG1 A;  2XD1 A;  5GSU A;  5B1M C;  4LD9 C;  5JRG A;  3WTP E;  5DNM C;  3V9R A;  3X1U A;  3AFA C;  4LD9 A;  5CPJ C;  3AZI C;  3AZJ B;  3UTB D;  5CP6 C;  2VQR A;  3B0D C;  3H0R C;  3AFA A;  5CPJ A;  3MGR D;  4E45 A;  4HGA C;  3AZI A;  3LZ1 B;  3REL B;  5CP6 A;  3O62 C;  3H0M C;  3AV1 A;  1N1J B;  4G91 B;  5B2I D;  2YFW A;  4KGC C;  2NZD D;  3REH C;  1HQ3 A;  4X23 C;  4KGC A;  3H0L C;  3C1C D;  1M18 C;  3UT9 C;  3REH A;  5G49 B;  4YS3 B;  3X1T C;  3R45 B;  4X23 A;  3B6G D;  2F2A C;  5BNV A;  5GT3 B;  3UT9 A;  1S32 D;  3WAA C;  5B33 C;  3X1T A;  3REI D;  1P34 D;  3WAA A;  3AZL D;  4H9O A;  2Y2J A;  3UTB C;  3MGR C;  4H9Q B;  3UTB A;  1W2E A;  4J8W A;  5B0Y B;  5AY8 D;  5B2I C;  3MVD B;  2NZD C;  1KX4 D;  3WTP B;  4NE6 A;  5B2I A;  3AZH B;  3AYW D;  3C1C C;  3WKJ B;  5B32 D;  3W99 D;  3MNN B;  2Y2I A;  3C1C A;  1P3M B;  1S32 C;  3P5J B;  4WJ3 C;  5C3I C;  3AZE B;  4WU8 D;  2LY8 A;  2G5I C;  1BH9 A;  4YM6 B;  1EQZ D;  2ZM5 A;  1S32 A;  4KUD C;  3REI C;  1P34 C;  4Z5T B;  3AZL C;  5DNN C;  2FFF B;  1M19 A;  4KUD A;  5E5A B;  3REI A;  1P34 A;  5AV9 A;  3A6N C;  3W97 C;  2ARO C;  5B1L B;  5DNN A;  4H9N A;  3REK B;  3MGP C;  3W98 B;  5B32 G;  5AY8 C;  3A6N A;  3W97 A;  2ARO A;  2IO5 B;  3A1I A;  4H9R B;  3C1B D;  3MGP A;  1KX4 C;  3MGS B;  1KX3 D;  5B0Z A;  1P3F C;  3LJA D;  2NQB B;  3NQU B;  1P3O B;  3AYW C;  2G5H C;  3X1V D;  3W99 C;  1P3F A;  5JA4 B;  1ID3 D;  5FUG A;  3W99 A;  2HUE C;  1BH8 A;  4WU8 C;  1P3G C;  4R8P C;  3WA9 D;  1EQZ C;  4E44 A;  2XD5 A;  3LEL B;  4WU8 A;  3KWQ B;  4R8P A;  1P3B D;  1P3G A;  3W96 B;  3X1S B;  5F99 B;  5CPI D;  4CAY B;  1P3I A;  1TAF A;  2Y2N A;  2RIQ A;  5AV5 B;  4G92 C;  3C1B C;  2L5A A;  5BNX A;  4H9P B;  2Y2K A;  3VH5 A;  3KUY B;  1M1A A;  1KX3 C;  5GXQ B;  3LJA C;  3C1B A;  5BT1 D;  4KHA B;  3B0C T;  1AOI A;  1U35 B;  4XUJ B;  3AZJ D;  5CPK B;  1ID3 C;  3B6F C;  4Z66 A;  5AVB A;  1ULY A;  3WA9 C;  3LZ1 D;  3REL D;  1H3O B;  2DF4 C;  3B6F A;  1KU5 A;  4Z2M G;  3EPH A;  4CSR A;  1P3B C;  3WA9 A;  3AZK B;  2FJ7 B;  5CPI C;  1TZY B;  4J8X A;  3VH6 W;  3AZG B;  4YS3 D;  1JFI B;  5BO0 B;  4EO5 C;  4J8V A;  5KDM A;  5GT3 D;  1F66 B;  2HIO B;  3VH5 T;  5BT1 C;  4ZBJ B;  4NE3 A;  3TU4 A;  5AVC B;  3MGQ B;  2Y2H A;  5B1M A;  3LZ1 C;  3REJ B;  3REL C;  5DNM A;  5B0Y D;  5B24 C;  4G91 C;  3LZ1 A;  3REL A;  1P3K B;  3MVD D;  1P3P B;  3WTP D;  5B24 A;  1N1J A;  2YFV A;  3NQJ B;  5GT0 B;  5B2J B;  3AZH D;  3AV2 B;  3AZN B;  3O62 A;  3WKJ D;  5B40 C;  2Y2Q A;  4YS3 C;  3MNN D;  2BYM A;  5GT3 C;  1P3M D;  5B40 A;  1ZLA B;  4YS3 A;  5AV6 B;  3R45 A;  3AZE D;  1WWS A;  5JRG B;  4YM6 D;  1M18 A;  4Z5T D;  5E5A D;  5BS7 C;  5B33 A;  5B1L D;  3AZI B;  2Y2M A;  3REK D;  3W98 D;  5B0Y C;  5BS7 A;  3AV1 B;  4QLC B;  3MVD C;  2YFW B;  3WTP C;  3MGS D;  2NQB D;  3F6T A;  1HQ3 B;  3MGR A;  3AZH C;  1P3O D;  3MVD A;  4NFT A;  3WKJ C;  3MNN C;  1P3M C;  2NZD A;  5BNV B;  3AZE C;  2J8P A;  3X1T B;  3B6G C;  4M6B A;  4YM6 C;  1P3M A;  5CHL B;  4Z5T C;  1P3L B;  3LEL D;  3WAA B;  1B67 A;  4H9O B;  3KWQ D;  3B6G A;  3W96 D;  3AL0 C;  3X1S D;  5E5A C;  4Z5T A;  5F99 D;  5AV8 B;  2CV5 B;  5B1L C;  3EPJ A;  5AV5 D;  3W98 C;  4J8W B;  3AZL A;  1A7W A;  2IO5 C;  5B1L A;  4WNN B;  3MGS C;  3KUY D;  5GXQ D;  1P3O C;  3MGS A;  1U35 D;  4XUJ D;  5AY8 A;  3NQU A;  4Z2M H;  1P3O A;  5CPK D;  4WU9 B;  1KX4 A;  5B32 C;  3KSY A;  3KXB B;  3AYW A;  5B32 A;  3LEL C;  3W96 C;  3KWQ C;  3AZK D;  2RVQ D;  3X1S C;  1M19 B;  4KUD B;  5F99 C;  2BYK B;  2FJ7 D;  3LEL A;  3W96 A;  3KWQ A;  5AV9 B;  5DNN B;  1TZY D;  1EQZ A;  5F99 A;  4AWL B;  3AZG D;  3A6N B;  3W97 B;  2ARO B;  1F1E A;  3MGP B;  3KUY C;  1F66 D;  2F8N B;  3KFU G;  5B0Z B;  2HIO D;  4H9P A;  1PZR A;  2Y2G A;  4XUJ C;  1U35 C;  1P3F B;  3UTA B;  5CPK C;  5AVC D;  4KHA A;  3X1V C;  1U35 A;  4XUJ A;  1KX3 A;  3LJA A;  4JJN B;  3AZM B;  3MGQ D;  3REJ D;  3LZ0 B;  3X1V A;  3B0C W;  2JSS A;  2HUE B;  1P3G B;  4R8P B;  1ID3 A;  1P3K D;  3AZK C;  2RVQ C;  1P3P D;  1P3I B;  5GT0 D;  1TAF B;  4XZQ B;  5B2J D;  3AV2 D;  3AZN D;  3AZG C;  5B31 B;  1P3B A;  5BNX B;  1F66 C;  3AZG A;  1M1A B;  1ZLA D;  5AV6 D;  5CPI A;  2HIO C;  1JFI A;  2PYO B;  5JRG D;  1HTA A;  1F66 A;  1AOI B;  2HIO A;  2W8S A;  5AVC C;  4Z66 B;  5AVB B;  3MGQ C;  3IP4 C;  3VH5 W;  3REJ C;  5AVC A;  3AZI D;  3AZJ C;  3B6F B;  4J8U B;  3AN2 B;  3AV1 D;  4QLC D;  4CSR B;  3REJ A;  3AZJ A;  2JCH A;  4H9S C;  1P3K C;  3EG5 B;  1HQ3 D;  2ZY4 A;  5GT0 C;  3AZF B;  1P3A B;  4J8X B;  3AZN C;  2ZY2 A;  4UUZ B;  4J8V B;  3AZN A;  1BFM A;  3EPL A;  1KX5 B;  2ZY5 A;  5AV6 C;  3X1T D;  5JRG C;  5G49 A;  5AV6 A;  1P3L D;  4ZUX B;  3WAA D;  3TU4 B;  5GSU B;  5GT3 A;  3V9R B;  5AV8 D;  3X1U B;  2CV5 D;  4LD9 B;  5B1M B;  5DNM B;  2DQN C;  4J8W D;  3AFA B;  3AV1 C;  4QLC C;  5CPJ B;  5CP6 B;  3B0D B;  1HQ3 C;  4QLC A;  2YFV B;  5B24 B;  4H9Q A;  4HGA B;  3O62 B;  5B0Y A;  2F8N H;  2BYM B;  4WU9 D;  4KGC B;  5B40 B;  3WTP A;  3KXB D;  3REH B;  3AZH A;  4X23 B;  1M18 B;  3WKJ A;  3UT9 B;  1P3L C;  3MNN A;  1M19 D;  4KUD D;  1P3L A;  5AV8 C;  2CV5 C;  3AZE A;  5B33 B;  5AV9 D;  5DNN D;  4YM6 A;  4J8W C;  2F8N K;  5AV8 A;  2CV5 A;  3A6N D;  3W97 D;  2ARO D;  3UTB B;  3REK C;  3MGP D;  2F8N D;  5E5A A;  5B0Z D;  3MGR B;  4WNN A;  3REK A;  3W98 A;  1P3F D;  2NQB C;  3UTA D;  4H9R A;  1Z2C B;  4WU9 C;  5B2I B;  1R4V A;  2NZD B;  3KXB C;  4JJN D;  3AZM D;  2NQB A;  4WU9 A;  3LZ0 D;  3C1C B;  3KXB A;  5JA4 A;  1P3G D;  4R8P D;  3B6G B;  1M19 C;  1WWI A;  1BH9 B;  2F8N G;  1S32 B;  2ZY3 A;  5AV9 C;  5C3I B;  1P3I D;  4XZQ D;  4AWL C;  2BYK A;  3REI B;  1P34 B;  1T3U A;  5B31 D;  3AZL B;  3X1S A;  4H9N B;  5AV5 C;  1M1A D;  5B0Z C;  2CWE A;  4CAY A;  2PYO D;  2F8N A;  5AV5 A;  4NE5 A;  1AOI D;  5GXQ C;  5AY8 B;  3UTA C;  2UWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...