1M19A

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19A00
3AN2D 5B40C 5CP6A 1KX5B 3LZ1D 1EQZB 4J8XA 3AZKB 1P3FA 3X1SB 2PYOD 3REID 4WU9B 3MGQB 4EO5C 3MGPC 1F66C 3WKJD 3WAAB 5B31B 3AZEC 3B6FC 5GXQB 4XZQA 1P3BC 3UTAD 3B6GD 4Z66A 3TU4B 3C1CA 5F99D 3MVDC 3KUYC 5JRGD 1TZYA 2HIOD 4H9NB 3AZHA 5CP6D 3AZJA 4NE5A 3VH6T 2IO5B 4J8XD 5B2IC 1P3FD 1P3PB 4J8VA 2YFVB 1ZLAA 5B32G 3X1UA 5GT3C 3AV1C 4H9SA 3AZGD 5CPJC 3WTPB 2CV5D 3LJAA 5B2JA 3MGRB 5GT0A 5CPKD 2HUEB 1ID3B 4QLCC 2YFWB 3C1CD 1P3AC 3UTBA 5JA4B 3RELA 3AN2C 1TZYD 3REJB 1KX5A 3LZ1C 5C3IC 3AZJD 3X1SA 2PYOC 3REIC 2F8NK 3REKD 4X23D 4ZUXA 3X1VB 3LELC 4KHAA 4J8VD 3KWQA 4WU9A 3MGQA 1M18B 5GSUD 3W96A 3WAAA 2F8ND 5B0ZD 2BYMB 1HQ3B 5AVCB 5B2JD 5B0YB 1M19D 4CAYB 3LZ0B 1BH9A 5JRGC 2HIOC 4R8PD 1U35B 3AZLC 4H9NA 3AV2A 1KX5D 4DRAA 1EQZD 3WTPE 5BNVA 5CPIA 1P3PA 2RVQC 3X1SD 3AFAB 3B0CW 4WU9D 5AV8A 3MGQD 3AZGC 1M1AA 5AV9A 1P3LB 3WAAD 2CV5C 5B31D 3W99B 5GXQD 3MGRA 5B32B 2FJ7C 4LD9A 5CPKC 1ID3A 5AV6B 3TU4D 1ULYA 3AZIC 5JA4A 4XZQB 3REJA 5BO0A 3VH5A 4Z66B 3REKC 4X23C 3X1VA 1P3PD 4UUZA 1S32A 5AV5A 1P3IB 1M18A 5GSUC 3AZHB 4ZBJB 1M1AD 3WTPD 2NZDA 3REHC 5B0ZC 1P3OA 5B1LA 2BYMA 4JJNC 1ZLAB 3X1UB 3V9RA 5FUGA 3MGRD 1M19C 3X1TC 4CSRB 1ID3D 1P3MA 4G91B 3LJAB 1AOIC 4R8PC 1U35A 5E5AB 1P3KA 5GT0B 3REJD 1EQZC 3AZKC 5BT1C 1KX3C 4H9QB 3UTBB 3X1VD 3RELB 1P34A 1M18D 3MNNA 3AYWB 4YS3C 1P3LA 5AVBC 5B31C 4ZUXB 3O62B 4KHAB 3W99A 5GXQC 3KWQB 5B32A 1HQ3D 5AVCD 4HGAB 5B0YD 3W96B 3A6NA 5AV6A 3LZ0D 3TU4C 4KUDC 3MGSB 5DNMA 4NFTA 5B24B 1U35D 4YM6B 4KGCA 2CWEA 4H9OB 5B1MA 2IO5C 3WA9C 3W97A 3KXBB 1WWSA 1BH9B 3R45B 3AFAD 4J8WA 4Z5TC 1P3IA 3AV2B 5BS7A 3AZFB 4J8UC 4WU8A 5BNVB 2AROC 5AY8C 3WTPC 5CPIB 1P3LD 3W99D 5B32D 5AV8B 4XUJA 2HUEC 4CSRA 1M1AB 5AV9B 5AV6D 5DNMD 1F66B 4XZQD 5E5AA 4LD9B 3AZEB 5B1MD 4Z66D 3W98C 4H9QA 3AZMA 4AWLB 3MVDB 1P3ID 5BO0B 3KUYB 3AZHD 1BH8A 1KX4A 3AYWA 3AZFC 3O62A 4UUZB 1ZLAD 1S32B 1HQ3C 5AV5B 3X1UD 5AVCC 5B33A 2NQBA 5B0YC 4XUJD 5GT3B 3WKJC 2NZDB 3LZ0C 1A7WA 3MGSA 1P3OB 3B0DB 5B1LB 5CPJB 3LJAD 3V9RB 5B24A 5FUGB 3UTAC 1P3GA 4YM6A 5DNNA 5E5AD 3B6GC 5GT0D 4H9OA 5F99C 1P3MB 3KXBA 3R45A 3AFAC 3UT9A 3UTBD 3RELD 1P3KB 3AZNA 1JFIB 5CP6C 5BNXB 3AZFA 1P3AB 4J8XC 5B40A 1P3FC 3AYWD 1Q9CA 4ZUXD 3O62D 1P34B 3KWQD 3LELB 3MNNB 3W96D 3MGSD 1F66A 4XZQC 4E45A 5B24D 3AZEA 3B6FA 4YM6D 3A6NB 4Z66C 1P3BA 3C1CC 4NE6A 3KXBD 5DNMB 1TZYC 4H9RB 3MVDA 4KGCB 3KUYA 3AZHC 3AV2D 3AZJC 3AZFD 5B1MB 3AZLB 4ZBJC 4WV4B 5CPID 3W97B 4J8WB 4J8VC 1ZLAC 1BFMA 3X1UC 4H9SC 3VH6W 5AV8D 4WU8B 5CHLB 5GT3A 5AV9D 1H3OA 3AV1A 4G91C 5CPJA 3LJAC 5B2JC 1F66D 1B6WA 5GT0C 4LD9D 4XUJB 3AZED 2FJ7B 5KDMA 2BYKA 4G92C 3UTBC 3RELC 2LY8A 1JFIA 5BNXA 4QLCA 1P3AA 3AZIB 3MVDD 1KX5C 3KUYD 3AN2A 4E44A 3X1SC 3LZ1A 4ZUXC 3AZMB 4WU9C 3KWQC 2PYOA 1S32D 3REIA 3MGQC 5AV5D 3LELA 1BH8B 1KX4B 3W96C 3VH5T 3NQJB 3WAAC 5GT3D 2NZDD 1P3OD 5B1LD 5CPJD 3C1BB 5B33B 2JSSA 3REHB 2NQBB 4JJNB 1TAFA 3VH6A 1P3MD 3X1TB 4H9PA 4H9RA 1P3GB 5DNNB 3AV2C 4NE3A 1P3KD 1N1JB 5JRGA 1P3AD 2HIOA 1HTAA 3KSYA 3B0CT 1AOIB 3AZLA 5CPIC 1P3PC 3UT9B 1P34D 3AZNB 5AV8C 1KX3B 3B0BA 1M1AC 3LELD 5B40B 5AV9C 3MNND 4Z2MG 3AZGA 1F1EA 3MGRC 4YS3B 2CV5A 5AVBB 4LD9C 1ID3C 3A6ND 2FJ7A 5CPKA 4EO5B 3MGPB 1KU5A 4KUDB 4AWLC 3REJC 3AZIA 3B6FB 4KGCD 1P3BB 3AZLD 3W97D 3X1VC 4J8WD 1S32C 4WZSB 5AV5C 1M18C 3WA9B 2L5AA 4X23A 3REKA 4M6BA 2RVQD 4WU8D 4Z5TB 3NQJA 2NZDC 5GSUA 1P3OC 3B0DC 5B1LC 4J8UB 1B67A 5B2IB 2AROB 5AY8B 3C1BA 2F8NA 3REHA 5B0ZA 4JJNA 4Z2MH 1R4VA 3AV1B 1H3OB 1P3MC 1M19A 5G49A 3X1TA 2FJ7D 1U35C 3NQUA 1P3KC 4WNNA 1N1JA 3AZID 1AOIA 4R8PA 5KDMB 2BYKB 1EQZA 3AZKA 1P34C 3AZMD 3W98B 4QLCB 1KX3A 3AN2B 3MNNC 1KX4D 1P3LC 3LZ1B 5C3IB 2F8NG 3W99C 2PYOB 4YS3A 5B32C 3REIB 5AVBA 3C1BD 5B31A 5B33D 3REHD 2NQBD 5GXQA 4JJND 3VH5W 3A6NC 5AV6C 5DNMC 3X1TD 3MGPA 3WKJB 3TU4A 4KUDA 1P3GD 4KGCC 5DNND 1TAFB 5B1MC 1AOID 3UTAB 3B6GB 3W97C 4H9PB 4J8WC 3UT9D 5F99B 3AZKD 1P3IC 3WA9A 3AZND 5BS7C 5JRGB 2YFVA 2HIOB 5BT1D 1KX3D 4WU8C 4Z5TA 5B40D 5CP6B 4J8UA 4J8XB 5B2IA 2AROA 5AY8A 3WTPA 1P3FB 5B31G 4YS3D 5AVBD 4XUJC 2F8NH 3AZGB 3MGPD 5E5AC 2CV5B 4DRBA 4KUDD 2YFWA 3B6FD 5CPKB 1P3BD 3AZMC 3W98A 3C1CB 3WA9D 1WWIA 1TZYB 1KX4C 3AYWC 4Z5TD 3AZJB 3O62C 4J8UD 5B2ID 2AROD 5AY8D 3C1BC 3REKB 4X23B 4HGAC 5B33C 2NQBC 4J8VB 1HQ3A 5AVCA 5GSUB 3AV1D 5B0YA 3MGSC 4CAYA 3WKJA 3LZ0A 5B24C 2F8NB 5B0ZB 1P3GC 4YM6C 5DNNC 5B2JB 3UTAA 3B6GA 1M19B 5G49B 3KXBC 3UT9C 5F99A 3NQUB 3W98D 4WNNB 3AFAA 4QLCD 4G92B 3AZNC 4R8PB
chains in the Genus database with same CATH superfamily
2Y2PA 3AN2D 5B40C 5CP6A 2BG1A 1KX5B 3LZ1D 1EQZB 4J8XA 3AZKB 1P3FA 3X1SB 2PYOD 3REID 2G5HC 4WU9B 3MGQB 2XD1A 4EO5C 3MGPC 1F66C 3WKJD 3WAAB 5B31B 3AZEC 3B6FC 5GXQB 4XZQA 1P3BC 3UTAD 3B6GD 2Y2IA 2JE5A 4Z66A 2Y2JA 3TU4B 3C1CA 2Y2HA 5F99D 3MVDC 3KUYC 5JRGD 1TZYA 2HIOD 3EPJA 4H9NB 3AZHA 5CP6D 3AZJA 4NE5A 3VH6T 2IO5B 4J8XD 5B2IC 1P3FD 1P3PB 4J8VA 2YFVB 1ZLAA 5B32G 3X1UA 5GT3C 3AV1C 4H9SA 3AZGD 5CPJC 3WTPB 2CV5D 3LJAA 5B2JA 3MGRB 5GT0A 5CPKD 2HUEB 1ID3B 4QLCC 2YFWB 3C1CD 1P3AC 3UTBA 5JA4B 3RELA 3AN2C 1TZYD 3IP4C 3REJB 1KX5A 3LZ1C 5C3IC 3AZJD 3X1SA 2PYOC 3REIC 3FDDA 2F8NK 3REKD 4X23D 4ZUXA 3X1VB 3LELC 4KHAA 4J8VD 3KWQA 4WU9A 3MGQA 1M18B 5GSUD 3W96A 3WAAA 2F8ND 5B0ZD 2BYMB 1HQ3B 3A1IA 5AVCB 5B2JD 5B0YB 2F2AC 1M19D 4CAYB 3LZ0B 1BH9A 5JRGC 2HIOC 4R8PD 2Y2LA 3AZLC 1U35B 4H9NA 3AV2A 1KX5D 4DRAA 1EQZD 3WTPE 5BNVA 5CPIA 1P3PA 2RVQC 3X1SD 3AFAB 3B0CW 4WU9D 5AV8A 3MGQD 3AZGC 1M1AA 5AV9A 1P3LB 3WAAD 2CV5C 5B31D 3W99B 5GXQD 3MGRA 5B32B 2FJ7C 4LD9A 5CPKC 1ID3A 2FFFB 5AV6B 3TU4D 1ULYA 3AZIC 5JA4A 4XZQB 3REJA 5BO0A 3VH5A 4Z66B 3F6TA 3REKC 4X23C 3X1VA 1P3PD 4UUZA 1S32A 5AV5A 1P3IB 1M18A 5GSUC 3AZHB 4ZBJB 1M1AD 3WTPD 2NZDA 3REHC 5B0ZC 1P3OA 5B1LA 2BYMA 4JJNC 1ZLAB 3X1UB 3V9RA 5FUGA 2J8PA 3MGRD 1M19C 3X1TC 4CSRB 1ID3D 1P3MA 4G91B 3LJAB 1AOIC 4R8PC 1U35A 5E5AB 1P3KA 5GT0B 3REJD 1EQZC 3AZKC 5BT1C 1KX3C 4H9QB 3UTBB 3X1VD 3RELB 1P34A 1M18D 3MNNA 3AYWB 4YS3C 1P3LA 5AVBC 5B31C 4ZUXB 3O62B 4KHAB 3W99A 5GXQC 3KWQB 5B32A 1HQ3D 5AVCD 4HGAB 5B0YD 3W96B 3A6NA 5AV6A 3LZ0D 3TU4C 4KUDC 3MGSB 5DNMA 4NFTA 5B24B 1U35D 4YM6B 3EPKA 4KGCA 2Y2GA 2CWEA 4H9OB 5B1MA 2IO5C 3WA9C 3W97A 3KXBB 1WWSA 1BH9B 3R45B 3AFAD 4J8WA 4Z5TC 1P3IA 3AV2B 5BS7A 3AZFB 3EG5B 4WU8A 4J8UC 5BNVB 2AROC 5AY8C 3WTPC 5CPIB 1P3LD 2DF4C 3W99D 3KFUG 5B32D 5AV8B 4XUJA 2HUEC 4CSRA 1M1AB 5AV9B 5AV6D 4WJ3C 5DNMD 1F66B 4XZQD 5E5AA 4LD9B 3AZEB 5B1MD 4Z66D 3W98C 1Z2CB 4H9QA 3AZMA 4AWLB 3MVDB 1P3ID 5BO0B 3KUYB 3AZHD 1BH8A 1KX4A 3AYWA 3AZFC 3O62A 4UUZB 2RIQA 1ZLAD 1S32B 1HQ3C 5AV5B 3X1UD 1T3UA 5AVCC 5B33A 2Y2KA 2NQBA 5B0YC 4XUJD 5GT3B 3WKJC 2NZDB 3LZ0C 1A7WA 3MGSA 1P3OB 3B0DB 5B1LB 5CPJB 3LJAD 3V9RB 5B24A 5FUGB 3UTAC 1P3GA 4YM6A 5DNNA 5E5AD 3B6GC 5GT0D 4H9OA 5F99C 1P3MB 3KXBA 3R45A 3AFAC 3UT9A 3UTBD 3RELD 1P3KB 3AZNA 1JFIB 5CP6C 5BNXB 2W8SA 3AZFA 1P3AB 4J8XC 5B40A 1P3FC 3AYWD 1Q9CA 2Y2MA 4ZUXD 3O62D 3A1KA 1P34B 3KWQD 3LELB 3MNNB 3W96D 2ZY4A 3MGSD 1F66A 4XZQC 4E45A 5B24D 3AZEA 3B6FA 4YM6D 3H0RC 3A6NB 4Z66C 1P3BA 3C1CC 4NE6A 3KXBD 5DNMB 1TZYC 4H9RB 3MVDA 4KGCB 3KUYA 3AZHC 3AV2D 3AZJC 3AZFD 5B1MB 3AZLB 4ZBJC 1PZRA 4WV4B 5CPID 2JCHA 3W97B 4J8WB 4J8VC 1ZLAC 1BFMA 3X1UC 4H9SC 3VH6W 5AV8D 4WU8B 5CHLB 5GT3A 5AV9D 1H3OA 3AV1A 4G91C 5CPJA 3LJAC 5B2JC 1F66D 1B6WA 5GT0C 4LD9D 4XUJB 3AZED 3P5JB 2FJ7B 5KDMA 2BYKA 4G92C 3UTBC 3RELC 2LY8A 1JFIA 5BNXA 4QLCA 1P3AA 3AZIB 3MVDD 1KX5C 3KUYD 3AN2A 4UPKA 4E44A 2XD5A 3X1SC 3LZ1A 4ZUXC 3AZMB 4WU9C 3KWQC 2PYOA 1S32D 3REIA 3MGQC 5AV5D 3LELA 1BH8B 1KX4B 3W96C 3VH5T 3NQJB 3WAAC 5GT3D 2NZDD 1P3OD 5B1LD 2ZY2A 5CPJD 3C1BB 5B33B 2JSSA 3REHB 2NQBB 4JJNB 1TAFA 3VH6A 1P3MD 3EPLA 3X1TB 4H9PA 4H9RA 1P3GB 5DNNB 3AV2C 4NE3A 1P3KD 1N1JB 5JRGA 1P3AD 2HIOA 1HTAA 3KSYA 3B0CT 1AOIB 3AZLA 5CPIC 1P3PC 3UT9B 3H0LC 1P34D 3AZNB 5AV8C 1KX3B 2Y2OA 3B0BA 1M1AC 3LELD 5B40B 5AV9C 3MNND 4Z2MG 3AZGA 2DQNC 1F1EA 3MGRC 4YS3B 2CV5A 5AVBB 4LD9C 2UWXA 1ID3C 3A6ND 2FJ7A 5CPKA 4EO5B 3MGPB 1KU5A 4KUDB 4AWLC 3REJC 3AZIA 3B6FB 4KGCD 1P3BB 3AZLD 3W97D 3X1VC 4J8WD 1S32C 4WZSB 5AV5C 1M18C 3WA9B 2L5AA 2ZY3A 4X23A 4M6BA 2RVQD 3REKA 4WU8D 4Z5TB 3NQJA 2NZDC 5GSUA 1P3OC 3B0DC 5B1LC 4J8UB 1B67A 5B2IB 2AROB 5AY8B 3C1BA 2F8NA 3REHA 5B0ZA 4JJNA 4Z2MH 1R4VA 3H0MC 1H3OB 3AV1B 1P3MC 1M19A 5G49A 3X1TA 2FJ7D 1U35C 3NQUA 1P3KC 4WNNA 1N1JA 3AZID 1AOIA 4R8PA 5KDMB 2BYKB 1EQZA 3AZKA 1P34C 3AZMD 3W98B 4QLCB 1KX3A 3AN2B 3MNNC 1KX4D 4DQYB 1P3LC 3LZ1B 5C3IB 2F8NG 3W99C 2PYOB 4YS3A 5B32C 3REIB 5AVBA 3C1BD 5B31A 5B33D 3REHD 2NQBD 5GXQA 4JJND 3VH5W 3A6NC 5AV6C 3EPHA 5DNMC 3X1TD 3MGPA 2ZM5A 3WKJB 3TU4A 4KUDA 1P3GD 4KGCC 5DNND 1TAFB 1W2EA 5B1MC 1AOID 3UTAB 3B6GB 3W97C 4H9PB 4J8WC 3UT9D 5F99B 3AZKD 1P3IC 3WA9A 3AZND 5BS7C 5JRGB 2YFVA 2HIOB 5BT1D 1KX3D 4WU8C 4Z5TA 5B40D 5CP6B 4J8UA 4J8XB 5B2IA 2AROA 5AY8A 3WTPA 1P3FB 5B31G 4YS3D 5AVBD 4XUJC 2F8NH 3AZGB 3MGPD 5E5AC 2CV5B 4DRBA 4KUDD 2YFWA 2G5IC 3B6FD 2Y2QA 5CPKB 1P3BD 2VQRA 3AZMC 3W98A 3C1CB 3WA9D 1WWIA 1TZYB 1KX4C 3AYWC 4Z5TD 3AZJB 3O62C 3AL0C 4J8UD 5B2ID 2AROD 5AY8D 3C1BC 3REKB 4X23B 4HGAC 5B33C 2NQBC 2Y2NA 4J8VB 1HQ3A 5AVCA 5GSUB 3AV1D 5B0YA 2ZY5A 3MGSC 4CAYA 3WKJA 3LZ0A 5B24C 2F8NB 5B0ZB 1P3GC 4YM6C 5DNNC 5B2JB 3UTAA 3B6GA 1M19B 5G49B 3KXBC 3UT9C 5F99A 3NQUB 3W98D 4WNNB 3AFAA 4QLCD 4G92B 3AZNC 4R8PB
chains in the Genus database with same CATH topology
2Y2PA 3AN2D 5B40C 5CP6A 2BG1A 1KX5B 3LZ1D 1EQZB 4J8XA 3AZKB 1P3FA 3X1SB 2PYOD 3REID 2G5HC 4WU9B 3MGQB 2XD1A 4EO5C 3MGPC 1F66C 3WKJD 3WAAB 5B31B 3AZEC 3B6FC 5GXQB 4XZQA 1P3BC 3UTAD 3B6GD 2Y2IA 2JE5A 4Z66A 2Y2JA 3TU4B 3C1CA 2Y2HA 5F99D 3MVDC 3KUYC 5JRGD 1TZYA 2HIOD 3EPJA 4H9NB 3AZHA 5CP6D 3AZJA 4NE5A 3VH6T 2IO5B 4J8XD 5B2IC 1P3FD 1P3PB 4J8VA 2YFVB 1ZLAA 5B32G 3X1UA 5GT3C 3AV1C 4H9SA 3AZGD 5CPJC 3WTPB 2CV5D 3LJAA 5B2JA 3MGRB 5GT0A 5CPKD 2HUEB 1ID3B 4QLCC 2YFWB 3C1CD 1P3AC 3UTBA 5JA4B 3RELA 3AN2C 1TZYD 3IP4C 3REJB 1KX5A 3LZ1C 5C3IC 3AZJD 3X1SA 2PYOC 3REIC 3FDDA 2F8NK 3REKD 4X23D 4ZUXA 3X1VB 3LELC 4KHAA 4J8VD 3KWQA 4WU9A 3MGQA 1M18B 5GSUD 3W96A 3WAAA 2F8ND 5B0ZD 2BYMB 1HQ3B 3A1IA 5AVCB 5B2JD 5B0YB 2F2AC 1M19D 4CAYB 3LZ0B 1BH9A 5JRGC 2HIOC 4R8PD 2Y2LA 3AZLC 1U35B 4H9NA 3AV2A 1KX5D 4DRAA 1EQZD 3WTPE 5BNVA 5CPIA 1P3PA 2RVQC 3X1SD 3AFAB 3B0CW 4WU9D 5AV8A 3MGQD 3AZGC 1M1AA 5AV9A 1P3LB 3WAAD 2CV5C 5B31D 3W99B 5GXQD 3MGRA 5B32B 2FJ7C 4LD9A 5CPKC 1ID3A 2FFFB 5AV6B 3TU4D 1ULYA 3AZIC 5JA4A 4XZQB 3REJA 5BO0A 3VH5A 4Z66B 3F6TA 3REKC 4X23C 3X1VA 1P3PD 4UUZA 1S32A 5AV5A 1P3IB 1M18A 5GSUC 3AZHB 4ZBJB 1M1AD 3WTPD 2NZDA 3REHC 5B0ZC 1P3OA 5B1LA 2BYMA 4JJNC 1ZLAB 3X1UB 3V9RA 5FUGA 2J8PA 3MGRD 1M19C 3X1TC 4CSRB 1ID3D 1P3MA 4G91B 3LJAB 1AOIC 4R8PC 1U35A 5E5AB 1P3KA 5GT0B 3REJD 1EQZC 3AZKC 5BT1C 1KX3C 4H9QB 3UTBB 3X1VD 3RELB 1P34A 1M18D 3MNNA 3AYWB 4YS3C 1P3LA 5AVBC 5B31C 4ZUXB 3O62B 4KHAB 3W99A 5GXQC 3KWQB 5B32A 1HQ3D 5AVCD 4HGAB 5B0YD 3W96B 3A6NA 5AV6A 3LZ0D 3TU4C 4KUDC 3MGSB 5DNMA 4NFTA 5B24B 1U35D 4YM6B 3EPKA 4KGCA 2Y2GA 2CWEA 4H9OB 5B1MA 2IO5C 3WA9C 3W97A 3KXBB 1WWSA 1BH9B 3R45B 3AFAD 4J8WA 4Z5TC 1P3IA 3AV2B 5BS7A 3AZFB 3EG5B 4WU8A 4J8UC 5BNVB 2AROC 5AY8C 3WTPC 5CPIB 1P3LD 2DF4C 3W99D 3KFUG 5B32D 5AV8B 4XUJA 2HUEC 4CSRA 1M1AB 5AV9B 5AV6D 4WJ3C 5DNMD 1F66B 4XZQD 5E5AA 4LD9B 3AZEB 5B1MD 4Z66D 3W98C 1Z2CB 4H9QA 3AZMA 4AWLB 3MVDB 1P3ID 5BO0B 3KUYB 3AZHD 1BH8A 1KX4A 3AYWA 3AZFC 3O62A 4UUZB 2RIQA 1ZLAD 1S32B 1HQ3C 5AV5B 3X1UD 1T3UA 5AVCC 5B33A 2Y2KA 2NQBA 5B0YC 4XUJD 5GT3B 3WKJC 2NZDB 3LZ0C 1A7WA 3MGSA 1P3OB 3B0DB 5B1LB 5CPJB 3LJAD 3V9RB 5B24A 5FUGB 3UTAC 1P3GA 4YM6A 5DNNA 5E5AD 3B6GC 5GT0D 4H9OA 5F99C 1P3MB 3KXBA 3R45A 3AFAC 3UT9A 3UTBD 3RELD 1P3KB 3AZNA 1JFIB 5CP6C 5BNXB 2W8SA 3AZFA 1P3AB 4J8XC 5B40A 1P3FC 3AYWD 1Q9CA 2Y2MA 4ZUXD 3O62D 3A1KA 1P34B 3KWQD 3LELB 3MNNB 3W96D 2ZY4A 3MGSD 1F66A 4XZQC 4E45A 5B24D 3AZEA 3B6FA 4YM6D 3H0RC 3A6NB 4Z66C 1P3BA 3C1CC 4NE6A 3KXBD 5DNMB 1TZYC 4H9RB 3MVDA 4KGCB 3KUYA 3AZHC 3AV2D 3AZJC 3AZFD 5B1MB 3AZLB 4ZBJC 1PZRA 4WV4B 5CPID 2JCHA 3W97B 4J8WB 4J8VC 1ZLAC 1BFMA 3X1UC 4H9SC 3VH6W 5AV8D 4WU8B 5CHLB 5GT3A 5AV9D 1H3OA 3AV1A 4G91C 5CPJA 3LJAC 5B2JC 1F66D 1B6WA 5GT0C 4LD9D 4XUJB 3AZED 3P5JB 2FJ7B 5KDMA 2BYKA 4G92C 3UTBC 3RELC 2LY8A 1JFIA 5BNXA 4QLCA 1P3AA 3AZIB 3MVDD 1KX5C 3KUYD 3AN2A 4UPKA 4E44A 2XD5A 3X1SC 3LZ1A 4ZUXC 3AZMB 4WU9C 3KWQC 2PYOA 1S32D 3REIA 3MGQC 5AV5D 3LELA 1BH8B 1KX4B 3W96C 3VH5T 3NQJB 3WAAC 5GT3D 2NZDD 1P3OD 5B1LD 2ZY2A 5CPJD 3C1BB 5B33B 2JSSA 3REHB 2NQBB 4JJNB 1TAFA 3VH6A 1P3MD 3EPLA 3X1TB 4H9PA 4H9RA 1P3GB 5DNNB 3AV2C 4NE3A 1P3KD 1N1JB 5JRGA 1P3AD 2HIOA 1HTAA 3KSYA 3B0CT 1AOIB 3AZLA 5CPIC 1P3PC 3UT9B 3H0LC 1P34D 3AZNB 5AV8C 1KX3B 2Y2OA 3B0BA 1M1AC 3LELD 5B40B 5AV9C 3MNND 4Z2MG 3AZGA 2DQNC 1F1EA 3MGRC 4YS3B 2CV5A 5AVBB 4LD9C 2UWXA 1ID3C 3A6ND 2FJ7A 5CPKA 4EO5B 3MGPB 1KU5A 4KUDB 4AWLC 3REJC 3AZIA 3B6FB 4KGCD 1P3BB 3AZLD 3W97D 3X1VC 4J8WD 1S32C 4WZSB 5AV5C 1M18C 3WA9B 2L5AA 2ZY3A 4X23A 4M6BA 2RVQD 3REKA 4WU8D 4Z5TB 3NQJA 2NZDC 5GSUA 1P3OC 3B0DC 5B1LC 4J8UB 1B67A 5B2IB 2AROB 5AY8B 3C1BA 2F8NA 3REHA 5B0ZA 4JJNA 4Z2MH 1R4VA 3H0MC 1H3OB 3AV1B 1P3MC 1M19A 5G49A 3X1TA 2FJ7D 1U35C 3NQUA 1P3KC 4WNNA 1N1JA 3AZID 1AOIA 4R8PA 5KDMB 2BYKB 1EQZA 3AZKA 1P34C 3AZMD 3W98B 4QLCB 1KX3A 3AN2B 3MNNC 1KX4D 4DQYB 1P3LC 3LZ1B 5C3IB 2F8NG 3W99C 2PYOB 4YS3A 5B32C 3REIB 5AVBA 3C1BD 5B31A 5B33D 3REHD 2NQBD 5GXQA 4JJND 3VH5W 3A6NC 5AV6C 3EPHA 5DNMC 3X1TD 3MGPA 2ZM5A 3WKJB 3TU4A 4KUDA 1P3GD 4KGCC 5DNND 1TAFB 1W2EA 5B1MC 1AOID 3UTAB 3B6GB 3W97C 4H9PB 4J8WC 3UT9D 5F99B 3AZKD 1P3IC 3WA9A 3AZND 5BS7C 5JRGB 2YFVA 2HIOB 5BT1D 1KX3D 4WU8C 4Z5TA 5B40D 5CP6B 4J8UA 4J8XB 5B2IA 2AROA 5AY8A 3WTPA 1P3FB 5B31G 4YS3D 5AVBD 4XUJC 2F8NH 3AZGB 3MGPD 5E5AC 2CV5B 4DRBA 4KUDD 2YFWA 2G5IC 3B6FD 2Y2QA 5CPKB 1P3BD 2VQRA 3AZMC 3W98A 3C1CB 3WA9D 1WWIA 1TZYB 1KX4C 3AYWC 4Z5TD 3AZJB 3O62C 3AL0C 4J8UD 5B2ID 2AROD 5AY8D 3C1BC 3REKB 4X23B 4HGAC 5B33C 2NQBC 2Y2NA 4J8VB 1HQ3A 5AVCA 5GSUB 3AV1D 5B0YA 2ZY5A 3MGSC 4CAYA 3WKJA 3LZ0A 5B24C 2F8NB 5B0ZB 1P3GC 4YM6C 5DNNC 5B2JB 3UTAA 3B6GA 1M19B 5G49B 3KXBC 3UT9C 5F99A 3NQUB 3W98D 4WNNB 3AFAA 4QLCD 4G92B 3AZNC 4R8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 D;  5B40 C;  5CP6 A;  1KX5 B;  3LZ1 D;  1EQZ B;  4J8X A;  3AZK B;  1P3F A;  3X1S B;  2PYO D;  3REI D;  4WU9 B;  3MGQ B;  4EO5 C;  3MGP C;  1F66 C;  3WKJ D;  3WAA B;  5B31 B;  3AZE C;  3B6F C;  5GXQ B;  4XZQ A;  1P3B C;  3UTA D;  3B6G D;  4Z66 A;  3TU4 B;  3C1C A;  5F99 D;  3MVD C;  3KUY C;  5JRG D;  1TZY A;  2HIO D;  4H9N B;  3AZH A;  5CP6 D;  3AZJ A;  4NE5 A;  3VH6 T;  2IO5 B;  4J8X D;  5B2I C;  1P3F D;  1P3P B;  4J8V A;  2YFV B;  1ZLA A;  5B32 G;  3X1U A;  5GT3 C;  3AV1 C;  4H9S A;  3AZG D;  5CPJ C;  3WTP B;  2CV5 D;  3LJA A;  5B2J A;  3MGR B;  5GT0 A;  5CPK D;  2HUE B;  1ID3 B;  4QLC C;  2YFW B;  3C1C D;  1P3A C;  3UTB A;  5JA4 B;  3REL A;  3AN2 C;  1TZY D;  3REJ B;  1KX5 A;  3LZ1 C;  5C3I C;  3AZJ D;  3X1S A;  2PYO C;  3REI C;  2F8N K;  3REK D;  4X23 D;  4ZUX A;  3X1V B;  3LEL C;  4KHA A;  4J8V D;  3KWQ A;  4WU9 A;  3MGQ A;  1M18 B;  5GSU D;  3W96 A;  3WAA A;  2F8N D;  5B0Z D;  2BYM B;  1HQ3 B;  5AVC B;  5B2J D;  5B0Y B;  1M19 D;  4CAY B;  3LZ0 B;  1BH9 A;  5JRG C;  2HIO C;  4R8P D;  1U35 B;  3AZL C;  4H9N A;  3AV2 A;  1KX5 D;  4DRA A;  1EQZ D;  3WTP E;  5BNV A;  5CPI A;  1P3P A;  2RVQ C;  3X1S D;  3AFA B;  3B0C W;  4WU9 D;  5AV8 A;  3MGQ D;  3AZG C;  1M1A A;  5AV9 A;  1P3L B;  3WAA D;  2CV5 C;  5B31 D;  3W99 B;  5GXQ D;  3MGR A;  5B32 B;  2FJ7 C;  4LD9 A;  5CPK C;  1ID3 A;  5AV6 B;  3TU4 D;  1ULY A;  3AZI C;  5JA4 A;  4XZQ B;  3REJ A;  5BO0 A;  3VH5 A;  4Z66 B;  3REK C;  4X23 C;  3X1V A;  1P3P D;  4UUZ A;  1S32 A;  5AV5 A;  1P3I B;  1M18 A;  5GSU C;  3AZH B;  4ZBJ B;  1M1A D;  3WTP D;  2NZD A;  3REH C;  5B0Z C;  1P3O A;  5B1L A;  2BYM A;  4JJN C;  1ZLA B;  3X1U B;  3V9R A;  5FUG A;  3MGR D;  1M19 C;  3X1T C;  4CSR B;  1ID3 D;  1P3M A;  4G91 B;  3LJA B;  1AOI C;  4R8P C;  1U35 A;  5E5A B;  1P3K A;  5GT0 B;  3REJ D;  1EQZ C;  3AZK C;  5BT1 C;  1KX3 C;  4H9Q B;  3UTB B;  3X1V D;  3REL B;  1P34 A;  1M18 D;  3MNN A;  3AYW B;  4YS3 C;  1P3L A;  5AVB C;  5B31 C;  4ZUX B;  3O62 B;  4KHA B;  3W99 A;  5GXQ C;  3KWQ B;  5B32 A;  1HQ3 D;  5AVC D;  4HGA B;  5B0Y D;  3W96 B;  3A6N A;  5AV6 A;  3LZ0 D;  3TU4 C;  4KUD C;  3MGS B;  5DNM A;  4NFT A;  5B24 B;  1U35 D;  4YM6 B;  4KGC A;  2CWE A;  4H9O B;  5B1M A;  2IO5 C;  3WA9 C;  3W97 A;  3KXB B;  1WWS A;  1BH9 B;  3R45 B;  3AFA D;  4J8W A;  4Z5T C;  1P3I A;  3AV2 B;  5BS7 A;  3AZF B;  4J8U C;  4WU8 A;  5BNV B;  2ARO C;  5AY8 C;  3WTP C;  5CPI B;  1P3L D;  3W99 D;  5B32 D;  5AV8 B;  4XUJ A;  2HUE C;  4CSR A;  1M1A B;  5AV9 B;  5AV6 D;  5DNM D;  1F66 B;  4XZQ D;  5E5A A;  4LD9 B;  3AZE B;  5B1M D;  4Z66 D;  3W98 C;  4H9Q A;  3AZM A;  4AWL B;  3MVD B;  1P3I D;  5BO0 B;  3KUY B;  3AZH D;  1BH8 A;  1KX4 A;  3AYW A;  3AZF C;  3O62 A;  4UUZ B;  1ZLA D;  1S32 B;  1HQ3 C;  5AV5 B;  3X1U D;  5AVC C;  5B33 A;  2NQB A;  5B0Y C;  4XUJ D;  5GT3 B;  3WKJ C;  2NZD B;  3LZ0 C;  1A7W A;  3MGS A;  1P3O B;  3B0D B;  5B1L B;  5CPJ B;  3LJA D;  3V9R B;  5B24 A;  5FUG B;  3UTA C;  1P3G A;  4YM6 A;  5DNN A;  5E5A D;  3B6G C;  5GT0 D;  4H9O A;  5F99 C;  1P3M B;  3KXB A;  3R45 A;  3AFA C;  3UT9 A;  3UTB D;  3REL D;  1P3K B;  3AZN A;  1JFI B;  5CP6 C;  5BNX B;  3AZF A;  1P3A B;  4J8X C;  5B40 A;  1P3F C;  3AYW D;  1Q9C A;  4ZUX D;  3O62 D;  1P34 B;  3KWQ D;  3LEL B;  3MNN B;  3W96 D;  3MGS D;  1F66 A;  4XZQ C;  4E45 A;  5B24 D;  3AZE A;  3B6F A;  4YM6 D;  3A6N B;  4Z66 C;  1P3B A;  3C1C C;  4NE6 A;  3KXB D;  5DNM B;  1TZY C;  4H9R B;  3MVD A;  4KGC B;  3KUY A;  3AZH C;  3AV2 D;  3AZJ C;  3AZF D;  5B1M B;  3AZL B;  4ZBJ C;  4WV4 B;  5CPI D;  3W97 B;  4J8W B;  4J8V C;  1ZLA C;  1BFM A;  3X1U C;  4H9S C;  3VH6 W;  5AV8 D;  4WU8 B;  5CHL B;  5GT3 A;  5AV9 D;  1H3O A;  3AV1 A;  4G91 C;  5CPJ A;  3LJA C;  5B2J C;  1F66 D;  1B6W A;  5GT0 C;  4LD9 D;  4XUJ B;  3AZE D;  2FJ7 B;  5KDM A;  2BYK A;  4G92 C;  3UTB C;  3REL C;  2LY8 A;  1JFI A;  5BNX A;  4QLC A;  1P3A A;  3AZI B;  3MVD D;  1KX5 C;  3KUY D;  3AN2 A;  4E44 A;  3X1S C;  3LZ1 A;  4ZUX C;  3AZM B;  4WU9 C;  3KWQ C;  2PYO A;  1S32 D;  3REI A;  3MGQ C;  5AV5 D;  3LEL A;  1BH8 B;  1KX4 B;  3W96 C;  3VH5 T;  3NQJ B;  3WAA C;  5GT3 D;  2NZD D;  1P3O D;  5B1L D;  5CPJ D;  3C1B B;  5B33 B;  2JSS A;  3REH B;  2NQB B;  4JJN B;  1TAF A;  3VH6 A;  1P3M D;  3X1T B;  4H9P A;  4H9R A;  1P3G B;  5DNN B;  3AV2 C;  4NE3 A;  1P3K D;  1N1J B;  5JRG A;  1P3A D;  2HIO A;  1HTA A;  3KSY A;  3B0C T;  1AOI B;  3AZL A;  5CPI C;  1P3P C;  3UT9 B;  1P34 D;  3AZN B;  5AV8 C;  1KX3 B;  3B0B A;  1M1A C;  3LEL D;  5B40 B;  5AV9 C;  3MNN D;  4Z2M G;  3AZG A;  1F1E A;  3MGR C;  4YS3 B;  2CV5 A;  5AVB B;  4LD9 C;  1ID3 C;  3A6N D;  2FJ7 A;  5CPK A;  4EO5 B;  3MGP B;  1KU5 A;  4KUD B;  4AWL C;  3REJ C;  3AZI A;  3B6F B;  4KGC D;  1P3B B;  3AZL D;  3W97 D;  3X1V C;  4J8W D;  1S32 C;  4WZS B;  5AV5 C;  1M18 C;  3WA9 B;  2L5A A;  4X23 A;  3REK A;  4M6B A;  2RVQ D;  4WU8 D;  4Z5T B;  3NQJ A;  2NZD C;  5GSU A;  1P3O C;  3B0D C;  5B1L C;  4J8U B;  1B67 A;  5B2I B;  2ARO B;  5AY8 B;  3C1B A;  2F8N A;  3REH A;  5B0Z A;  4JJN A;  4Z2M H;  1R4V A;  3AV1 B;  1H3O B;  1P3M C;  1M19 A;  5G49 A;  3X1T A;  2FJ7 D;  1U35 C;  3NQU A;  1P3K C;  4WNN A;  1N1J A;  3AZI D;  1AOI A;  4R8P A;  5KDM B;  2BYK B;  1EQZ A;  3AZK A;  1P34 C;  3AZM D;  3W98 B;  4QLC B;  1KX3 A;  3AN2 B;  3MNN C;  1KX4 D;  1P3L C;  3LZ1 B;  5C3I B;  2F8N G;  3W99 C;  2PYO B;  4YS3 A;  5B32 C;  3REI B;  5AVB A;  3C1B D;  5B31 A;  5B33 D;  3REH D;  2NQB D;  5GXQ A;  4JJN D;  3VH5 W;  3A6N C;  5AV6 C;  5DNM C;  3X1T D;  3MGP A;  3WKJ B;  3TU4 A;  4KUD A;  1P3G D;  4KGC C;  5DNN D;  1TAF B;  5B1M C;  1AOI D;  3UTA B;  3B6G B;  3W97 C;  4H9P B;  4J8W C;  3UT9 D;  5F99 B;  3AZK D;  1P3I C;  3WA9 A;  3AZN D;  5BS7 C;  5JRG B;  2YFV A;  2HIO B;  5BT1 D;  1KX3 D;  4WU8 C;  4Z5T A;  5B40 D;  5CP6 B;  4J8U A;  4J8X B;  5B2I A;  2ARO A;  5AY8 A;  3WTP A;  1P3F B;  5B31 G;  4YS3 D;  5AVB D;  4XUJ C;  2F8N H;  3AZG B;  3MGP D;  5E5A C;  2CV5 B;  4DRB A;  4KUD D;  2YFW A;  3B6F D;  5CPK B;  1P3B D;  3AZM C;  3W98 A;  3C1C B;  3WA9 D;  1WWI A;  1TZY B;  1KX4 C;  3AYW C;  4Z5T D;  3AZJ B;  3O62 C;  4J8U D;  5B2I D;  2ARO D;  5AY8 D;  3C1B C;  3REK B;  4X23 B;  4HGA C;  5B33 C;  2NQB C;  4J8V B;  1HQ3 A;  5AVC A;  5GSU B;  3AV1 D;  5B0Y A;  3MGS C;  4CAY A;  3WKJ A;  3LZ0 A;  5B24 C;  2F8N B;  5B0Z B;  1P3G C;  4YM6 C;  5DNN C;  5B2J B;  3UTA A;  3B6G A;  1M19 B;  5G49 B;  3KXB C;  3UT9 C;  5F99 A;  3NQU B;  3W98 D;  4WNN B;  3AFA A;  4QLC D;  4G92 B;  3AZN C;  4R8P B; 
#chains in the Genus database with same CATH topology
 2Y2P A;  3AN2 D;  5B40 C;  5CP6 A;  2BG1 A;  1KX5 B;  3LZ1 D;  1EQZ B;  4J8X A;  3AZK B;  1P3F A;  3X1S B;  2PYO D;  3REI D;  2G5H C;  4WU9 B;  3MGQ B;  2XD1 A;  4EO5 C;  3MGP C;  1F66 C;  3WKJ D;  3WAA B;  5B31 B;  3AZE C;  3B6F C;  5GXQ B;  4XZQ A;  1P3B C;  3UTA D;  3B6G D;  2Y2I A;  2JE5 A;  4Z66 A;  2Y2J A;  3TU4 B;  3C1C A;  2Y2H A;  5F99 D;  3MVD C;  3KUY C;  5JRG D;  1TZY A;  2HIO D;  3EPJ A;  4H9N B;  3AZH A;  5CP6 D;  3AZJ A;  4NE5 A;  3VH6 T;  2IO5 B;  4J8X D;  5B2I C;  1P3F D;  1P3P B;  4J8V A;  2YFV B;  1ZLA A;  5B32 G;  3X1U A;  5GT3 C;  3AV1 C;  4H9S A;  3AZG D;  5CPJ C;  3WTP B;  2CV5 D;  3LJA A;  5B2J A;  3MGR B;  5GT0 A;  5CPK D;  2HUE B;  1ID3 B;  4QLC C;  2YFW B;  3C1C D;  1P3A C;  3UTB A;  5JA4 B;  3REL A;  3AN2 C;  1TZY D;  3IP4 C;  3REJ B;  1KX5 A;  3LZ1 C;  5C3I C;  3AZJ D;  3X1S A;  2PYO C;  3REI C;  3FDD A;  2F8N K;  3REK D;  4X23 D;  4ZUX A;  3X1V B;  3LEL C;  4KHA A;  4J8V D;  3KWQ A;  4WU9 A;  3MGQ A;  1M18 B;  5GSU D;  3W96 A;  3WAA A;  2F8N D;  5B0Z D;  2BYM B;  1HQ3 B;  3A1I A;  5AVC B;  5B2J D;  5B0Y B;  2F2A C;  1M19 D;  4CAY B;  3LZ0 B;  1BH9 A;  5JRG C;  2HIO C;  4R8P D;  2Y2L A;  3AZL C;  1U35 B;  4H9N A;  3AV2 A;  1KX5 D;  4DRA A;  1EQZ D;  3WTP E;  5BNV A;  5CPI A;  1P3P A;  2RVQ C;  3X1S D;  3AFA B;  3B0C W;  4WU9 D;  5AV8 A;  3MGQ D;  3AZG C;  1M1A A;  5AV9 A;  1P3L B;  3WAA D;  2CV5 C;  5B31 D;  3W99 B;  5GXQ D;  3MGR A;  5B32 B;  2FJ7 C;  4LD9 A;  5CPK C;  1ID3 A;  2FFF B;  5AV6 B;  3TU4 D;  1ULY A;  3AZI C;  5JA4 A;  4XZQ B;  3REJ A;  5BO0 A;  3VH5 A;  4Z66 B;  3F6T A;  3REK C;  4X23 C;  3X1V A;  1P3P D;  4UUZ A;  1S32 A;  5AV5 A;  1P3I B;  1M18 A;  5GSU C;  3AZH B;  4ZBJ B;  1M1A D;  3WTP D;  2NZD A;  3REH C;  5B0Z C;  1P3O A;  5B1L A;  2BYM A;  4JJN C;  1ZLA B;  3X1U B;  3V9R A;  5FUG A;  2J8P A;  3MGR D;  1M19 C;  3X1T C;  4CSR B;  1ID3 D;  1P3M A;  4G91 B;  3LJA B;  1AOI C;  4R8P C;  1U35 A;  5E5A B;  1P3K A;  5GT0 B;  3REJ D;  1EQZ C;  3AZK C;  5BT1 C;  1KX3 C;  4H9Q B;  3UTB B;  3X1V D;  3REL B;  1P34 A;  1M18 D;  3MNN A;  3AYW B;  4YS3 C;  1P3L A;  5AVB C;  5B31 C;  4ZUX B;  3O62 B;  4KHA B;  3W99 A;  5GXQ C;  3KWQ B;  5B32 A;  1HQ3 D;  5AVC D;  4HGA B;  5B0Y D;  3W96 B;  3A6N A;  5AV6 A;  3LZ0 D;  3TU4 C;  4KUD C;  3MGS B;  5DNM A;  4NFT A;  5B24 B;  1U35 D;  4YM6 B;  3EPK A;  4KGC A;  2Y2G A;  2CWE A;  4H9O B;  5B1M A;  2IO5 C;  3WA9 C;  3W97 A;  3KXB B;  1WWS A;  1BH9 B;  3R45 B;  3AFA D;  4J8W A;  4Z5T C;  1P3I A;  3AV2 B;  5BS7 A;  3AZF B;  3EG5 B;  4WU8 A;  4J8U C;  5BNV B;  2ARO C;  5AY8 C;  3WTP C;  5CPI B;  1P3L D;  2DF4 C;  3W99 D;  3KFU G;  5B32 D;  5AV8 B;  4XUJ A;  2HUE C;  4CSR A;  1M1A B;  5AV9 B;  5AV6 D;  4WJ3 C;  5DNM D;  1F66 B;  4XZQ D;  5E5A A;  4LD9 B;  3AZE B;  5B1M D;  4Z66 D;  3W98 C;  1Z2C B;  4H9Q A;  3AZM A;  4AWL B;  3MVD B;  1P3I D;  5BO0 B;  3KUY B;  3AZH D;  1BH8 A;  1KX4 A;  3AYW A;  3AZF C;  3O62 A;  4UUZ B;  2RIQ A;  1ZLA D;  1S32 B;  1HQ3 C;  5AV5 B;  3X1U D;  1T3U A;  5AVC C;  5B33 A;  2Y2K A;  2NQB A;  5B0Y C;  4XUJ D;  5GT3 B;  3WKJ C;  2NZD B;  3LZ0 C;  1A7W A;  3MGS A;  1P3O B;  3B0D B;  5B1L B;  5CPJ B;  3LJA D;  3V9R B;  5B24 A;  5FUG B;  3UTA C;  1P3G A;  4YM6 A;  5DNN A;  5E5A D;  3B6G C;  5GT0 D;  4H9O A;  5F99 C;  1P3M B;  3KXB A;  3R45 A;  3AFA C;  3UT9 A;  3UTB D;  3REL D;  1P3K B;  3AZN A;  1JFI B;  5CP6 C;  5BNX B;  2W8S A;  3AZF A;  1P3A B;  4J8X C;  5B40 A;  1P3F C;  3AYW D;  1Q9C A;  2Y2M A;  4ZUX D;  3O62 D;  3A1K A;  1P34 B;  3KWQ D;  3LEL B;  3MNN B;  3W96 D;  2ZY4 A;  3MGS D;  1F66 A;  4XZQ C;  4E45 A;  5B24 D;  3AZE A;  3B6F A;  4YM6 D;  3H0R C;  3A6N B;  4Z66 C;  1P3B A;  3C1C C;  4NE6 A;  3KXB D;  5DNM B;  1TZY C;  4H9R B;  3MVD A;  4KGC B;  3KUY A;  3AZH C;  3AV2 D;  3AZJ C;  3AZF D;  5B1M B;  3AZL B;  4ZBJ C;  1PZR A;  4WV4 B;  5CPI D;  2JCH A;  3W97 B;  4J8W B;  4J8V C;  1ZLA C;  1BFM A;  3X1U C;  4H9S C;  3VH6 W;  5AV8 D;  4WU8 B;  5CHL B;  5GT3 A;  5AV9 D;  1H3O A;  3AV1 A;  4G91 C;  5CPJ A;  3LJA C;  5B2J C;  1F66 D;  1B6W A;  5GT0 C;  4LD9 D;  4XUJ B;  3AZE D;  3P5J B;  2FJ7 B;  5KDM A;  2BYK A;  4G92 C;  3UTB C;  3REL C;  2LY8 A;  1JFI A;  5BNX A;  4QLC A;  1P3A A;  3AZI B;  3MVD D;  1KX5 C;  3KUY D;  3AN2 A;  4UPK A;  4E44 A;  2XD5 A;  3X1S C;  3LZ1 A;  4ZUX C;  3AZM B;  4WU9 C;  3KWQ C;  2PYO A;  1S32 D;  3REI A;  3MGQ C;  5AV5 D;  3LEL A;  1BH8 B;  1KX4 B;  3W96 C;  3VH5 T;  3NQJ B;  3WAA C;  5GT3 D;  2NZD D;  1P3O D;  5B1L D;  2ZY2 A;  5CPJ D;  3C1B B;  5B33 B;  2JSS A;  3REH B;  2NQB B;  4JJN B;  1TAF A;  3VH6 A;  1P3M D;  3EPL A;  3X1T B;  4H9P A;  4H9R A;  1P3G B;  5DNN B;  3AV2 C;  4NE3 A;  1P3K D;  1N1J B;  5JRG A;  1P3A D;  2HIO A;  1HTA A;  3KSY A;  3B0C T;  1AOI B;  3AZL A;  5CPI C;  1P3P C;  3UT9 B;  3H0L C;  1P34 D;  3AZN B;  5AV8 C;  1KX3 B;  2Y2O A;  3B0B A;  1M1A C;  3LEL D;  5B40 B;  5AV9 C;  3MNN D;  4Z2M G;  3AZG A;  2DQN C;  1F1E A;  3MGR C;  4YS3 B;  2CV5 A;  5AVB B;  4LD9 C;  2UWX A;  1ID3 C;  3A6N D;  2FJ7 A;  5CPK A;  4EO5 B;  3MGP B;  1KU5 A;  4KUD B;  4AWL C;  3REJ C;  3AZI A;  3B6F B;  4KGC D;  1P3B B;  3AZL D;  3W97 D;  3X1V C;  4J8W D;  1S32 C;  4WZS B;  5AV5 C;  1M18 C;  3WA9 B;  2L5A A;  2ZY3 A;  4X23 A;  4M6B A;  2RVQ D;  3REK A;  4WU8 D;  4Z5T B;  3NQJ A;  2NZD C;  5GSU A;  1P3O C;  3B0D C;  5B1L C;  4J8U B;  1B67 A;  5B2I B;  2ARO B;  5AY8 B;  3C1B A;  2F8N A;  3REH A;  5B0Z A;  4JJN A;  4Z2M H;  1R4V A;  3H0M C;  1H3O B;  3AV1 B;  1P3M C;  1M19 A;  5G49 A;  3X1T A;  2FJ7 D;  1U35 C;  3NQU A;  1P3K C;  4WNN A;  1N1J A;  3AZI D;  1AOI A;  4R8P A;  5KDM B;  2BYK B;  1EQZ A;  3AZK A;  1P34 C;  3AZM D;  3W98 B;  4QLC B;  1KX3 A;  3AN2 B;  3MNN C;  1KX4 D;  4DQY B;  1P3L C;  3LZ1 B;  5C3I B;  2F8N G;  3W99 C;  2PYO B;  4YS3 A;  5B32 C;  3REI B;  5AVB A;  3C1B D;  5B31 A;  5B33 D;  3REH D;  2NQB D;  5GXQ A;  4JJN D;  3VH5 W;  3A6N C;  5AV6 C;  3EPH A;  5DNM C;  3X1T D;  3MGP A;  2ZM5 A;  3WKJ B;  3TU4 A;  4KUD A;  1P3G D;  4KGC C;  5DNN D;  1TAF B;  1W2E A;  5B1M C;  1AOI D;  3UTA B;  3B6G B;  3W97 C;  4H9P B;  4J8W C;  3UT9 D;  5F99 B;  3AZK D;  1P3I C;  3WA9 A;  3AZN D;  5BS7 C;  5JRG B;  2YFV A;  2HIO B;  5BT1 D;  1KX3 D;  4WU8 C;  4Z5T A;  5B40 D;  5CP6 B;  4J8U A;  4J8X B;  5B2I A;  2ARO A;  5AY8 A;  3WTP A;  1P3F B;  5B31 G;  4YS3 D;  5AVB D;  4XUJ C;  2F8N H;  3AZG B;  3MGP D;  5E5A C;  2CV5 B;  4DRB A;  4KUD D;  2YFW A;  2G5I C;  3B6F D;  2Y2Q A;  5CPK B;  1P3B D;  2VQR A;  3AZM C;  3W98 A;  3C1C B;  3WA9 D;  1WWI A;  1TZY B;  1KX4 C;  3AYW C;  4Z5T D;  3AZJ B;  3O62 C;  3AL0 C;  4J8U D;  5B2I D;  2ARO D;  5AY8 D;  3C1B C;  3REK B;  4X23 B;  4HGA C;  5B33 C;  2NQB C;  2Y2N A;  4J8V B;  1HQ3 A;  5AVC A;  5GSU B;  3AV1 D;  5B0Y A;  2ZY5 A;  3MGS C;  4CAY A;  3WKJ A;  3LZ0 A;  5B24 C;  2F8N B;  5B0Z B;  1P3G C;  4YM6 C;  5DNN C;  5B2J B;  3UTA A;  3B6G A;  1M19 B;  5G49 B;  3KXB C;  3UT9 C;  5F99 A;  3NQU B;  3W98 D;  4WNN B;  3AFA A;  4QLC D;  4G92 B;  3AZN C;  4R8P B; 
#chains in the Genus database with same CATH homology
 2Y2P A;  3AN2 D;  5B40 C;  5CP6 A;  2BG1 A;  1KX5 B;  3LZ1 D;  1EQZ B;  4J8X A;  3AZK B;  1P3F A;  3X1S B;  2PYO D;  3REI D;  2G5H C;  4WU9 B;  3MGQ B;  2XD1 A;  4EO5 C;  3MGP C;  1F66 C;  3WKJ D;  3WAA B;  5B31 B;  3AZE C;  3B6F C;  5GXQ B;  4XZQ A;  1P3B C;  3UTA D;  3B6G D;  2Y2I A;  2JE5 A;  4Z66 A;  2Y2J A;  3TU4 B;  3C1C A;  2Y2H A;  5F99 D;  3MVD C;  3KUY C;  5JRG D;  1TZY A;  2HIO D;  3EPJ A;  4H9N B;  3AZH A;  5CP6 D;  3AZJ A;  4NE5 A;  3VH6 T;  2IO5 B;  4J8X D;  5B2I C;  1P3F D;  1P3P B;  4J8V A;  2YFV B;  1ZLA A;  5B32 G;  3X1U A;  5GT3 C;  3AV1 C;  4H9S A;  3AZG D;  5CPJ C;  3WTP B;  2CV5 D;  3LJA A;  5B2J A;  3MGR B;  5GT0 A;  5CPK D;  2HUE B;  1ID3 B;  4QLC C;  2YFW B;  3C1C D;  1P3A C;  3UTB A;  5JA4 B;  3REL A;  3AN2 C;  1TZY D;  3IP4 C;  3REJ B;  1KX5 A;  3LZ1 C;  5C3I C;  3AZJ D;  3X1S A;  2PYO C;  3REI C;  3FDD A;  2F8N K;  3REK D;  4X23 D;  4ZUX A;  3X1V B;  3LEL C;  4KHA A;  4J8V D;  3KWQ A;  4WU9 A;  3MGQ A;  1M18 B;  5GSU D;  3W96 A;  3WAA A;  2F8N D;  5B0Z D;  2BYM B;  1HQ3 B;  3A1I A;  5AVC B;  5B2J D;  5B0Y B;  2F2A C;  1M19 D;  4CAY B;  3LZ0 B;  1BH9 A;  5JRG C;  2HIO C;  4R8P D;  2Y2L A;  3AZL C;  1U35 B;  4H9N A;  3AV2 A;  1KX5 D;  4DRA A;  1EQZ D;  3WTP E;  5BNV A;  5CPI A;  1P3P A;  2RVQ C;  3X1S D;  3AFA B;  3B0C W;  4WU9 D;  5AV8 A;  3MGQ D;  3AZG C;  1M1A A;  5AV9 A;  1P3L B;  3WAA D;  2CV5 C;  5B31 D;  3W99 B;  5GXQ D;  3MGR A;  5B32 B;  2FJ7 C;  4LD9 A;  5CPK C;  1ID3 A;  2FFF B;  5AV6 B;  3TU4 D;  1ULY A;  3AZI C;  5JA4 A;  4XZQ B;  3REJ A;  5BO0 A;  3VH5 A;  4Z66 B;  3F6T A;  3REK C;  4X23 C;  3X1V A;  1P3P D;  4UUZ A;  1S32 A;  5AV5 A;  1P3I B;  1M18 A;  5GSU C;  3AZH B;  4ZBJ B;  1M1A D;  3WTP D;  2NZD A;  3REH C;  5B0Z C;  1P3O A;  5B1L A;  2BYM A;  4JJN C;  1ZLA B;  3X1U B;  3V9R A;  5FUG A;  2J8P A;  3MGR D;  1M19 C;  3X1T C;  4CSR B;  1ID3 D;  1P3M A;  4G91 B;  3LJA B;  1AOI C;  4R8P C;  1U35 A;  5E5A B;  1P3K A;  5GT0 B;  3REJ D;  1EQZ C;  3AZK C;  5BT1 C;  1KX3 C;  4H9Q B;  3UTB B;  3X1V D;  3REL B;  1P34 A;  1M18 D;  3MNN A;  3AYW B;  4YS3 C;  1P3L A;  5AVB C;  5B31 C;  4ZUX B;  3O62 B;  4KHA B;  3W99 A;  5GXQ C;  3KWQ B;  5B32 A;  1HQ3 D;  5AVC D;  4HGA B;  5B0Y D;  3W96 B;  3A6N A;  5AV6 A;  3LZ0 D;  3TU4 C;  4KUD C;  3MGS B;  5DNM A;  4NFT A;  5B24 B;  1U35 D;  4YM6 B;  3EPK A;  4KGC A;  2Y2G A;  2CWE A;  4H9O B;  5B1M A;  2IO5 C;  3WA9 C;  3W97 A;  3KXB B;  1WWS A;  1BH9 B;  3R45 B;  3AFA D;  4J8W A;  4Z5T C;  1P3I A;  3AV2 B;  5BS7 A;  3AZF B;  3EG5 B;  4WU8 A;  4J8U C;  5BNV B;  2ARO C;  5AY8 C;  3WTP C;  5CPI B;  1P3L D;  2DF4 C;  3W99 D;  3KFU G;  5B32 D;  5AV8 B;  4XUJ A;  2HUE C;  4CSR A;  1M1A B;  5AV9 B;  5AV6 D;  4WJ3 C;  5DNM D;  1F66 B;  4XZQ D;  5E5A A;  4LD9 B;  3AZE B;  5B1M D;  4Z66 D;  3W98 C;  1Z2C B;  4H9Q A;  3AZM A;  4AWL B;  3MVD B;  1P3I D;  5BO0 B;  3KUY B;  3AZH D;  1BH8 A;  1KX4 A;  3AYW A;  3AZF C;  3O62 A;  4UUZ B;  2RIQ A;  1ZLA D;  1S32 B;  1HQ3 C;  5AV5 B;  3X1U D;  1T3U A;  5AVC C;  5B33 A;  2Y2K A;  2NQB A;  5B0Y C;  4XUJ D;  5GT3 B;  3WKJ C;  2NZD B;  3LZ0 C;  1A7W A;  3MGS A;  1P3O B;  3B0D B;  5B1L B;  5CPJ B;  3LJA D;  3V9R B;  5B24 A;  5FUG B;  3UTA C;  1P3G A;  4YM6 A;  5DNN A;  5E5A D;  3B6G C;  5GT0 D;  4H9O A;  5F99 C;  1P3M B;  3KXB A;  3R45 A;  3AFA C;  3UT9 A;  3UTB D;  3REL D;  1P3K B;  3AZN A;  1JFI B;  5CP6 C;  5BNX B;  2W8S A;  3AZF A;  1P3A B;  4J8X C;  5B40 A;  1P3F C;  3AYW D;  1Q9C A;  2Y2M A;  4ZUX D;  3O62 D;  3A1K A;  1P34 B;  3KWQ D;  3LEL B;  3MNN B;  3W96 D;  2ZY4 A;  3MGS D;  1F66 A;  4XZQ C;  4E45 A;  5B24 D;  3AZE A;  3B6F A;  4YM6 D;  3H0R C;  3A6N B;  4Z66 C;  1P3B A;  3C1C C;  4NE6 A;  3KXB D;  5DNM B;  1TZY C;  4H9R B;  3MVD A;  4KGC B;  3KUY A;  3AZH C;  3AV2 D;  3AZJ C;  3AZF D;  5B1M B;  3AZL B;  4ZBJ C;  1PZR A;  4WV4 B;  5CPI D;  2JCH A;  3W97 B;  4J8W B;  4J8V C;  1ZLA C;  1BFM A;  3X1U C;  4H9S C;  3VH6 W;  5AV8 D;  4WU8 B;  5CHL B;  5GT3 A;  5AV9 D;  1H3O A;  3AV1 A;  4G91 C;  5CPJ A;  3LJA C;  5B2J C;  1F66 D;  1B6W A;  5GT0 C;  4LD9 D;  4XUJ B;  3AZE D;  3P5J B;  2FJ7 B;  5KDM A;  2BYK A;  4G92 C;  3UTB C;  3REL C;  2LY8 A;  1JFI A;  5BNX A;  4QLC A;  1P3A A;  3AZI B;  3MVD D;  1KX5 C;  3KUY D;  3AN2 A;  4UPK A;  4E44 A;  2XD5 A;  3X1S C;  3LZ1 A;  4ZUX C;  3AZM B;  4WU9 C;  3KWQ C;  2PYO A;  1S32 D;  3REI A;  3MGQ C;  5AV5 D;  3LEL A;  1BH8 B;  1KX4 B;  3W96 C;  3VH5 T;  3NQJ B;  3WAA C;  5GT3 D;  2NZD D;  1P3O D;  5B1L D;  2ZY2 A;  5CPJ D;  3C1B B;  5B33 B;  2JSS A;  3REH B;  2NQB B;  4JJN B;  1TAF A;  3VH6 A;  1P3M D;  3EPL A;  3X1T B;  4H9P A;  4H9R A;  1P3G B;  5DNN B;  3AV2 C;  4NE3 A;  1P3K D;  1N1J B;  5JRG A;  1P3A D;  2HIO A;  1HTA A;  3KSY A;  3B0C T;  1AOI B;  3AZL A;  5CPI C;  1P3P C;  3UT9 B;  3H0L C;  1P34 D;  3AZN B;  5AV8 C;  1KX3 B;  2Y2O A;  3B0B A;  1M1A C;  3LEL D;  5B40 B;  5AV9 C;  3MNN D;  4Z2M G;  3AZG A;  2DQN C;  1F1E A;  3MGR C;  4YS3 B;  2CV5 A;  5AVB B;  4LD9 C;  2UWX A;  1ID3 C;  3A6N D;  2FJ7 A;  5CPK A;  4EO5 B;  3MGP B;  1KU5 A;  4KUD B;  4AWL C;  3REJ C;  3AZI A;  3B6F B;  4KGC D;  1P3B B;  3AZL D;  3W97 D;  3X1V C;  4J8W D;  1S32 C;  4WZS B;  5AV5 C;  1M18 C;  3WA9 B;  2L5A A;  2ZY3 A;  4X23 A;  4M6B A;  2RVQ D;  3REK A;  4WU8 D;  4Z5T B;  3NQJ A;  2NZD C;  5GSU A;  1P3O C;  3B0D C;  5B1L C;  4J8U B;  1B67 A;  5B2I B;  2ARO B;  5AY8 B;  3C1B A;  2F8N A;  3REH A;  5B0Z A;  4JJN A;  4Z2M H;  1R4V A;  3H0M C;  1H3O B;  3AV1 B;  1P3M C;  1M19 A;  5G49 A;  3X1T A;  2FJ7 D;  1U35 C;  3NQU A;  1P3K C;  4WNN A;  1N1J A;  3AZI D;  1AOI A;  4R8P A;  5KDM B;  2BYK B;  1EQZ A;  3AZK A;  1P34 C;  3AZM D;  3W98 B;  4QLC B;  1KX3 A;  3AN2 B;  3MNN C;  1KX4 D;  4DQY B;  1P3L C;  3LZ1 B;  5C3I B;  2F8N G;  3W99 C;  2PYO B;  4YS3 A;  5B32 C;  3REI B;  5AVB A;  3C1B D;  5B31 A;  5B33 D;  3REH D;  2NQB D;  5GXQ A;  4JJN D;  3VH5 W;  3A6N C;  5AV6 C;  3EPH A;  5DNM C;  3X1T D;  3MGP A;  2ZM5 A;  3WKJ B;  3TU4 A;  4KUD A;  1P3G D;  4KGC C;  5DNN D;  1TAF B;  1W2E A;  5B1M C;  1AOI D;  3UTA B;  3B6G B;  3W97 C;  4H9P B;  4J8W C;  3UT9 D;  5F99 B;  3AZK D;  1P3I C;  3WA9 A;  3AZN D;  5BS7 C;  5JRG B;  2YFV A;  2HIO B;  5BT1 D;  1KX3 D;  4WU8 C;  4Z5T A;  5B40 D;  5CP6 B;  4J8U A;  4J8X B;  5B2I A;  2ARO A;  5AY8 A;  3WTP A;  1P3F B;  5B31 G;  4YS3 D;  5AVB D;  4XUJ C;  2F8N H;  3AZG B;  3MGP D;  5E5A C;  2CV5 B;  4DRB A;  4KUD D;  2YFW A;  2G5I C;  3B6F D;  2Y2Q A;  5CPK B;  1P3B D;  2VQR A;  3AZM C;  3W98 A;  3C1C B;  3WA9 D;  1WWI A;  1TZY B;  1KX4 C;  3AYW C;  4Z5T D;  3AZJ B;  3O62 C;  3AL0 C;  4J8U D;  5B2I D;  2ARO D;  5AY8 D;  3C1B C;  3REK B;  4X23 B;  4HGA C;  5B33 C;  2NQB C;  2Y2N A;  4J8V B;  1HQ3 A;  5AVC A;  5GSU B;  3AV1 D;  5B0Y A;  2ZY5 A;  3MGS C;  4CAY A;  3WKJ A;  3LZ0 A;  5B24 C;  2F8N B;  5B0Z B;  1P3G C;  4YM6 C;  5DNN C;  5B2J B;  3UTA A;  3B6G A;  1M19 B;  5G49 B;  3KXB C;  3UT9 C;  5F99 A;  3NQU B;  3W98 D;  4WNN B;  3AFA A;  4QLC D;  4G92 B;  3AZN C;  4R8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...