1M19A

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
total genus 33
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19A00
3AZNB 5JRGC 1WWSA 1P3OD 3REIB 5B33A 1S32C 5AV6C 4J8XA 3WAAB 5B33C 5KDMB 3A6ND 1S32A 3O62B 3KXBA 1KX3B 5DNNA 1M1AB 3REKD 4ZUXC 4J8UB 2JSSA 1P3AC 5DNND 5B1MD 3RELC 3B6GD 4NE5A 3X1SB 4QLCD 5B31C 5GXQA 5GT3A 5G49A 5B2JB 1M19A 1KX4A 3AZKD 1P3PB 4UUZB 3REKA 5BS7A 3AZFB 2AROC 1KX5A 3MGRB 4J8VA 1TZYA 4WU8C 3W96D 1P3IB 3AZJA 5B24A 5BO0A 1P3FD 3X1SD 3MGQB 2F8NH 1TAFB 3NQUB 3AZEA 2AROD 3MGQC 4E44A 3AZEC 3A6NB 3C1BD 1P3AB 5AV6A 4JJND 1ZLAB 4YS3A 3AZNA 1JFIB 3AZIB 4J8WB 3B0CT 3X1VD 2FJ7C 4R8PD 3AZIC 3X1VA 1H3OA 1KX3A 1F66D 1P3FB 5CPJB 1P3PD 4ZBJB 5B0YB 1AOIC 5CP6A 1AOIA 3MGRD 3WA9D 4XZQA 3X1SA 1P3AD 2YFVB 5B2ID 5AV9C 3VH6W 3AZID 5B31D 5G49B 5B2JA 4Z66C 3MNNB 3REHB 3AZGC 3W97A 3AV1A 1M18C 1A7WA 3MGPA 5CP6D 5GSUC 1P34D 4AWLB 2AROB 3AZLD 4KGCC 3AYWC 4CSRB 3UTBB 3AYWA 3MGSD 1ZLAC 4H9PA 5BO0B 5BT1C 4Z66D 2HIOC 1F66B 5GT3D 5AY8B 5GSUB 3B6FA 3UTAB 5B1LD 3X1UA 4J8WD 3X1VB 1M1AA 5B31A 3UT9C 1P3FA 5AV9B 4WU9A 3C1CA 4R8PC 3AZFA 5AV5A 4KUDA 3WKJD 3LZ1A 3TU4B 4ZBJC 3AN2B 2LY8A 3REKB 5B24C 3B0BA 5F99A 5CPIA 3W99B 3X1TD 3MGPB 3W98C 3NQUA 5B31G 3LZ0A 5JRGA 2PYOD 3REIC 2HIOB 1M18D 3AZKB 3REIA 4Z2MH 3KXBD 3AZEB 3A6NC 5DNMB 3A6NA 3UTBA 5AVCC 3NQJA 3VH6A 3UTAD 3UTBC 5DNNC 1EQZA 5B32G 4QLCB 5CPJA 1P3IC 4G91C 4XZQD 5AVBA 1P3AA 5AY8A 3RELA 3MGPD 3X1TB 4X23C 1P3KC 1P3MC 1JFIA 4X23B 1P3KB 5AY8D 4DRAA 5GT3B 1P3MB 2RVQD 4Z5TD 3AZFC 5AV5C 4LD9D 5AV8C 4J8XC 3AN2D 5AV8A 3LZ1C 4H9OB 5BNXB 1TZYC 3LELA 3AZHC 2YFWB 3AV1C 1M18A 1P3OC 3AFAD 3WKJC 3KWQD 4CSRA 5B0ZD 2NZDD 3WKJA 3AZED 5AV5D 5B33D 5CPKD 3REKC 1P3BA 1HTAA 3MGSC 5JA4A 4JJNB 1ZLAD 4WU9D 4H9RA 3B6GC 2HIOA 1P3GA 3VH5W 4NFTA 4YM6C 4J8WA 5JRGB 3AZNC 4YM6B 3AZMB 5GSUA 5B0YC 4CAYB 1EQZB 4Z5TB 3AZLB 3LJAD 3REJB 1U35B 3UTAC 3UTBD 5GT0C 3C1CC 1P3LB 4QLCA 5B2IB 4KUDB 3B6FB 3R45A 3MVDD 5B40C 3TU4C 1B67A 5B2JC 3LZ0D 2CV5A 4WNNB 3LZ1B 2IO5B 3X1UC 3C1BC 5F99B 5AV5B 5B1MA 4Z2MG 5CPIC 3C1CD 3V9RA 3LJAB 3B6GB 3B0DC 1HQ3C 2PYOC 4KUDD 1HQ3B 5CHLB 3B0DB 4XUJD 3AV2B 4H9SC 3WKJB 1F66C 3AFAA 3KWQC 4H9RB 4H9SA 1KX3D 1F66A 4J8UD 2L5AA 5F99C 2CWEA 1P3IA 5FUGB 4X23A 1P3KA 1P3MA 2CV5D 5B32A 3MVDA 3MGQA 5KDMA 1P3FC 1R4VA 3W98B 4Z5TA 1BH8B 2NQBC 2NQBA 3WTPB 5AV8D 4H9OA 5BNXA 4EO5C 3TU4A 5AV6B 3REJA 1U35A 1ID3A 3VH5A 1EQZC 3AZIA 3C1BA 5B2IA 5E5AD 5B1MC 2YFWA 1WWIA 1KX4C 3W97D 1KX5B 2NQBD 5GXQC 5CPJD 1M19C 1BFMA 1P3GD 3AV2C 3AZKC 3VH5T 2PYOA 3AZKA 1ID3D 5CP6B 3WA9A 3AZJB 3MGRC 4YM6A 4J8WC 5C3IB 3AZJC 3AZND 4JJNA 1P3OB 3AV1B 4X23D 1P3KD 1P3MD 2HUEC 4XUJC 5AVBC 3X1TA 3AFAB 4G92B 4XUJA 1S32D 5B0YD 4YS3B 5FUGA 1P3BC 2NZDB 4J8XB 3WAAA 4LD9C 4J8UC 4LD9A 5B24D 3AZJD 5AVCA 1P3LC 3R45B 3W98D 3REJC 1U35C 3X1VC 2CV5C 1N1JA 3LELC 5AVBD 1KX5D 2NQBB 2BYMA 1BH9B 3V9RB 1M1AD 3UTAA 1ID3B 3W96A 5B1MB 3C1BB 3W96C 1P3LD 5JA4B 5AV9A 3LJAA 3MGSA 3W97B 4H9NA 4XZQC 4ZUXB 4WU8A 3AZGA 1P3GB 2FJ7B 4Z66A 4AWLC 3MGPC 2YFVA 5GXQD 1M19D 5GSUD 2PYOB 3AN2A 3AYWD 3AN2C 3AZLC 4KGCD 5DNMD 3AZLA 5CPIB 1ZLAA 5BNVA 5BT1D 3AV1D 3RELD 5GT0A 3AZHD 2NZDA 3MVDB 5E5AA 3AFAC 3KWQA 4G92C 2HIOD 5B40D 2HUEB 4XUJB 3MNND 3REHD 2F8NA 4EO5B 3KXBC 4NE6A 1P3BD 3WTPC 4WNNA 1AOID 1P34B 5B0YA 5CPKC 3C1CB 1B6WA 4WU8D 4WV4B 4WU9C 3UT9A 4XZQB 1BH9A 1N1JB 5B31B 4R8PA 3X1SC 3AZHB 4NE3A 1HQ3A 1KX5C 3KUYD 2BYKA 5B40B 1ID3C 3WTPD 2F8NG 4DRBA 5AV8B 3W99A 3WA9B 1ULYA 4KGCB 3W99C 4ZUXD 5CPKB 3MGSB 4JJNC 5B1LB 5GT0D 2FJ7D 4WU8B 3X1TC 4Z66B 3REID 5B2JD 3LZ0C 3MVDC 3AZMD 1P3PC 3WAAD 1BH8A 4LD9B 2NZDC 3MGRA 4YS3C 5AVCB 1P3BB 4KHAA 5CPID 5DNMC 5E5AB 3RELB 5DNMA 3B6FC 5JRGD 3NQJB 5B2IC 5AV9D 4YM6D 1TAFA 5AY8C 3WAAC 1F1EA 1P34C 1S32B 4Z5TC 3AZFD 4J8UA 5CP6C 2RVQC 4YS3D 3KXBB 2BYMB 5BS7C 3LJAC 1P3LA 3W96B 4H9QA 4HGAC 2FJ7A 1KX4B 3B6FD 4H9NB 4ZUXA 4R8PB 4WZSB 3LZ0B 1P3OA 3TU4D 3LELB 4UUZA 3KUYC 4J8VB 5GT3C 1M18B 3KUYA 3AZGB 5B1LA 3X1UD 5B0ZC 3KSYA 5B1LC 5B0ZA 5AVCD 1P3PA 5B24B 5GT0B 3W99D 5B32D 3WA9C 2F8NK 5E5AC 1KU5A 1TZYB 3B0CW 1KX4D 1HQ3D 3W97C 5AVBB 4KHAB 3AV2D 5CPJC 3AZMC 2F8NB 3AZMA 1KX3C 1M1AC 3KWQB 1Q9CA 3AYWB 3O62C 3UT9B 1P34A 3O62A 5B33B 5B32C 4H9PB 4G91B 2CV5B 5B32B 4QLCC 5DNNB 2BYKB 5B40A 5GXQB 1M19B 3AZHA 3WTPA 4H9QB 4E45A 3VH6T 4J8VD 4HGAB 5CPKA 1H3OB 2IO5C 3X1UB 3O62D 1AOIB 1EQZD 4KGCA 3UT9D 4WU9B 4M6BA 3REJD 1U35D 3AV2A 5BNVB 4KUDC 3LELD 1P3ID 2AROA 5C3IC 3WTPE 3B6GA 5B0ZB 3AZGD 1P3GC 3MNNC 3KUYB 4J8VC 3REHC 3MGQD 5AV6D 3MNNA 3REHA 2F8ND 4CAYA 3LZ1D 4J8XD 5F99D 3W98A 1TZYD
chains in the Genus database with same CATH superfamily
3AZNB 5JRGC 2Y2MA 1WWSA 1P3OD 3REIB 5B33A 1S32C 5AV6C 4J8XA 3WAAB 5B33C 5KDMB 3A6ND 1S32A 3KFUG 3O62B 3KXBA 1KX3B 5DNNA 1M1AB 3REKD 4ZUXC 4J8UB 2JSSA 1P3AC 1W2EA 5B1MD 5DNND 3RELC 3B6GD 4NE5A 3X1SB 4QLCD 5B31C 5GXQA 5GT3A 5G49A 5B2JB 1M19A 1KX4A 3AZKD 1P3PB 4UUZB 3REKA 5BS7A 3AZFB 2AROC 1KX5A 3MGRB 2Y2KA 1TZYA 4J8VA 4WU8C 3W96D 1P3IB 3AZJA 5B24A 5BO0A 1P3FD 3X1SD 3MGQB 2F8NH 1TAFB 3NQUB 3AZEA 2AROD 3MGQC 4E44A 3AZEC 3A6NB 3C1BD 1P3AB 5AV6A 4JJND 1ZLAB 4YS3A 3AZNA 1JFIB 3AZIB 4J8WB 3B0CT 3X1VD 2FJ7C 4R8PD 3AZIC 3X1VA 4DQYB 1H3OA 1KX3A 1F66D 1P3FB 5CPJB 1P3PD 4ZBJB 5B0YB 1AOIC 2VQRA 5CP6A 1AOIA 3MGRD 3WA9D 4XZQA 3X1SA 1P3AD 2YFVB 5B2ID 5AV9C 3VH6W 3AZID 5B31D 5G49B 5B2JA 4Z66C 3MNNB 3REHB 3AZGC 3W97A 3AV1A 1M18C 1A7WA 3MGPA 5CP6D 3AL0C 5GSUC 1P34D 4AWLB 2AROB 3AZLD 4KGCC 3AYWC 4CSRB 3UTBB 3AYWA 3MGSD 1ZLAC 4H9PA 5BO0B 5BT1C 4Z66D 2HIOC 3A1IA 1F66B 5GT3D 5AY8B 5GSUB 3B6FA 3UTAB 5B1LD 3X1UA 3EPLA 4J8WD 3X1VB 1M1AA 5B31A 3UT9C 3EPKA 1P3FA 5AV9B 4WU9A 3C1CA 4R8PC 3AZFA 2F2AC 5AV5A 4KUDA 3H0MC 3WKJD 3LZ1A 3TU4B 4ZBJC 3P5JB 3AN2B 3EPJA 2LY8A 3REKB 5B24C 3B0BA 5F99A 5CPIA 3W99B 3X1TD 3MGPB 3W98C 2Y2PA 3NQUA 5B31G 3LZ0A 5JRGA 2Y2OA 2PYOD 3REIC 2HIOB 1M18D 3AZKB 3REIA 4Z2MH 3KXBD 3AZEB 3A6NC 5DNMB 3A6NA 3UTBA 5AVCC 3NQJA 3VH6A 3EG5B 3UTAD 3UTBC 5DNNC 1EQZA 5B32G 4QLCB 5CPJA 1P3IC 4G91C 4XZQD 5AVBA 1P3AA 5AY8A 3RELA 3MGPD 3X1TB 4X23C 1P3KC 1P3MC 1JFIA 4X23B 1P3KB 5AY8D 4DRAA 5GT3B 1P3MB 2RVQD 4Z5TD 3AZFC 5AV5C 2DF4C 4LD9D 5AV8C 2Y2HA 4J8XC 2Y2QA 3AN2D 5AV8A 3LZ1C 4H9OB 5BNXB 1TZYC 3LELA 3AZHC 2YFWB 3AV1C 1M18A 1P3OC 3AFAD 3WKJC 3KWQD 4CSRA 5B0ZD 2NZDD 3WKJA 1Z2CB 2DQNC 5B33D 5AV5D 3AZED 5CPKD 3H0LC 3REKC 1P3BA 1HTAA 3MGSC 5JA4A 4JJNB 1ZLAD 4WU9D 4H9RA 2W8SA 3B6GC 2HIOA 1P3GA 3VH5W 4NFTA 1PZRA 4YM6C 5JRGB 4J8WA 3AZNC 4YM6B 3AZMB 5GSUA 3A1KA 2ZY3A 5B0YC 4CAYB 1EQZB 4Z5TB 3AZLB 3LJAD 3REJB 1U35B 3UTAC 3UTBD 5GT0C 3C1CC 1P3LB 4QLCA 5B2IB 4KUDB 3B6FB 2RIQA 3R45A 3MVDD 5B40C 2J8PA 3TU4C 1B67A 5B2JC 3LZ0D 2CV5A 4WNNB 3LZ1B 2IO5B 3X1UC 3C1BC 5F99B 5AV5B 2XD5A 5B1MA 4Z2MG 5CPIC 4UPKA 3C1CD 3FDDA 3V9RA 3LJAB 3B6GB 3B0DC 1HQ3C 2PYOC 4KUDD 1HQ3B 5CHLB 3B0DB 4XUJD 3AV2B 4H9SC 3WKJB 1F66C 3AFAA 3KWQC 4H9RB 4H9SA 1KX3D 1F66A 4J8UD 2L5AA 5F99C 2CWEA 1P3IA 5FUGB 4X23A 1P3KA 1P3MA 2CV5D 5B32A 2ZY4A 3MVDA 5KDMA 3MGQA 1R4VA 1P3FC 4Z5TA 3W98B 1BH8B 2NQBC 3F6TA 2NQBA 3WTPB 3H0RC 5AV8D 4H9OA 5BNXA 4EO5C 3TU4A 5AV6B 3REJA 1U35A 2Y2NA 1ID3A 3VH5A 1EQZC 2JE5A 3AZIA 3C1BA 5B2IA 5E5AD 3EPHA 5B1MC 2YFWA 1WWIA 1KX4C 3W97D 1KX5B 2NQBD 5GXQC 5CPJD 1M19C 1BFMA 1P3GD 3AV2C 3AZKC 3VH5T 2PYOA 3AZKA 1ID3D 5CP6B 2JCHA 3WA9A 3AZJB 3MGRC 4YM6A 4J8WC 2Y2IA 5C3IB 3AZJC 3AZND 4JJNA 1P3OB 3AV1B 4X23D 1P3KD 1P3MD 2HUEC 4XUJC 5AVBC 3X1TA 3AFAB 4G92B 4XUJA 1S32D 5B0YD 4YS3B 5FUGA 1P3BC 2NZDB 4J8XB 3WAAA 4LD9C 4J8UC 4LD9A 5B24D 3AZJD 5AVCA 1T3UA 3R45B 1P3LC 3W98D 3REJC 1U35C 3X1VC 2CV5C 1N1JA 3LELC 5AVBD 1KX5D 2NQBB 2BYMA 1BH9B 3V9RB 1M1AD 2FFFB 3UTAA 1ID3B 4WJ3C 3W96A 5B1MB 3C1BB 3W96C 1P3LD 5JA4B 5AV9A 3LJAA 3MGSA 3W97B 4H9NA 4XZQC 4ZUXB 4WU8A 3AZGA 1P3GB 2FJ7B 4Z66A 4AWLC 3MGPC 2YFVA 5GXQD 1M19D 5GSUD 2PYOB 3AN2A 3AYWD 3AN2C 2G5HC 3AZLC 4KGCD 5DNMD 3AZLA 5CPIB 1ZLAA 5BNVA 5BT1D 3AV1D 3RELD 5GT0A 3AZHD 2Y2GA 2NZDA 3MVDB 5E5AA 3AFAC 3KWQA 4G92C 2HIOD 5B40D 2HUEB 4XUJB 3MNND 3REHD 3IP4C 4EO5B 2F8NA 3KXBC 4NE6A 1P3BD 3WTPC 4WNNA 1AOID 2G5IC 1P34B 5B0YA 5CPKC 3C1CB 1B6WA 4WU8D 4WV4B 4WU9C 3UT9A 4XZQB 1BH9A 1N1JB 5B31B 4R8PA 3X1SC 3AZHB 4NE3A 1HQ3A 1KX5C 3KUYD 2UWXA 2BG1A 2BYKA 5B40B 1ID3C 3WTPD 2F8NG 4DRBA 5AV8B 3W99A 3WA9B 1ULYA 4KGCB 3W99C 4ZUXD 5CPKB 3MGSB 4JJNC 5B1LB 5GT0D 2FJ7D 4WU8B 2Y2JA 3X1TC 4Z66B 3REID 5B2JD 3LZ0C 3MVDC 3AZMD 1P3PC 3WAAD 1BH8A 4LD9B 2NZDC 3MGRA 4YS3C 5AVCB 1P3BB 4KHAA 5CPID 5DNMC 5E5AB 3RELB 5DNMA 3B6FC 5JRGD 3NQJB 5B2IC 5AV9D 4YM6D 1TAFA 5AY8C 3WAAC 1F1EA 1P34C 1S32B 4Z5TC 3AZFD 4J8UA 5CP6C 2RVQC 4YS3D 2Y2LA 3KXBB 2BYMB 5BS7C 3LJAC 1P3LA 3W96B 4H9QA 4HGAC 2FJ7A 1KX4B 3B6FD 4H9NB 4ZUXA 4R8PB 4WZSB 3LZ0B 1P3OA 3TU4D 3LELB 4UUZA 3KUYC 4J8VB 5GT3C 1M18B 3KUYA 3AZGB 5B1LA 3X1UD 5B0ZC 3KSYA 5B1LC 5B0ZA 2ZM5A 5AVCD 1P3PA 5B24B 5GT0B 3W99D 5B32D 3WA9C 2F8NK 5E5AC 1KU5A 1TZYB 3B0CW 1KX4D 1HQ3D 3W97C 5AVBB 4KHAB 3AV2D 5CPJC 3AZMC 2F8NB 3AZMA 1KX3C 1M1AC 3KWQB 1Q9CA 3AYWB 3O62C 3UT9B 1P34A 3O62A 5B33B 5B32C 4H9PB 4G91B 2CV5B 5B32B 4QLCC 5DNNB 2BYKB 5B40A 5GXQB 1M19B 3AZHA 3WTPA 4H9QB 4E45A 3VH6T 4J8VD 4HGAB 5CPKA 1H3OB 2IO5C 3X1UB 3O62D 1AOIB 1EQZD 4KGCA 3UT9D 4WU9B 4M6BA 3REJD 1U35D 2ZY5A 3AV2A 5BNVB 4KUDC 3LELD 1P3ID 2AROA 5C3IC 3WTPE 3B6GA 5B0ZB 3AZGD 1P3GC 3MNNC 3KUYB 4J8VC 3REHC 3MGQD 5AV6D 3MNNA 3REHA 2F8ND 2XD1A 4CAYA 3LZ1D 2ZY2A 4J8XD 5F99D 3W98A 1TZYD
chains in the Genus database with same CATH topology
3AZNB 5JRGC 2Y2MA 1WWSA 1P3OD 3REIB 5B33A 1S32C 5AV6C 4J8XA 3WAAB 5B33C 5KDMB 3A6ND 1S32A 3KFUG 3O62B 3KXBA 1KX3B 5DNNA 1M1AB 3REKD 4ZUXC 4J8UB 2JSSA 1P3AC 1W2EA 5B1MD 5DNND 3RELC 3B6GD 4NE5A 3X1SB 4QLCD 5B31C 5GXQA 5GT3A 5G49A 5B2JB 1M19A 1KX4A 3AZKD 1P3PB 4UUZB 3REKA 5BS7A 3AZFB 2AROC 1KX5A 3MGRB 2Y2KA 1TZYA 4J8VA 4WU8C 3W96D 1P3IB 3AZJA 5B24A 5BO0A 1P3FD 3X1SD 3MGQB 2F8NH 1TAFB 3NQUB 3AZEA 2AROD 3MGQC 4E44A 3AZEC 3A6NB 3C1BD 1P3AB 5AV6A 4JJND 1ZLAB 4YS3A 3AZNA 1JFIB 3AZIB 4J8WB 3B0CT 3X1VD 2FJ7C 4R8PD 3AZIC 3X1VA 4DQYB 1H3OA 1KX3A 1F66D 1P3FB 5CPJB 1P3PD 4ZBJB 5B0YB 1AOIC 2VQRA 5CP6A 1AOIA 3MGRD 3WA9D 4XZQA 3X1SA 1P3AD 2YFVB 5B2ID 5AV9C 3VH6W 3AZID 5B31D 5G49B 5B2JA 4Z66C 3MNNB 3REHB 3AZGC 3W97A 3AV1A 1M18C 1A7WA 3MGPA 5CP6D 3AL0C 5GSUC 1P34D 4AWLB 2AROB 3AZLD 4KGCC 3AYWC 4CSRB 3UTBB 3AYWA 3MGSD 1ZLAC 4H9PA 5BO0B 5BT1C 4Z66D 2HIOC 3A1IA 1F66B 5GT3D 5AY8B 5GSUB 3B6FA 3UTAB 5B1LD 3X1UA 3EPLA 4J8WD 3X1VB 1M1AA 5B31A 3UT9C 3EPKA 1P3FA 5AV9B 4WU9A 3C1CA 4R8PC 3AZFA 2F2AC 5AV5A 4KUDA 3H0MC 3WKJD 3LZ1A 3TU4B 4ZBJC 3P5JB 3AN2B 3EPJA 2LY8A 3REKB 5B24C 3B0BA 5F99A 5CPIA 3W99B 3X1TD 3MGPB 3W98C 2Y2PA 3NQUA 5B31G 3LZ0A 5JRGA 2Y2OA 2PYOD 3REIC 2HIOB 1M18D 3AZKB 3REIA 4Z2MH 3KXBD 3AZEB 3A6NC 5DNMB 3A6NA 3UTBA 5AVCC 3NQJA 3VH6A 3EG5B 3UTAD 3UTBC 5DNNC 1EQZA 5B32G 4QLCB 5CPJA 1P3IC 4G91C 4XZQD 5AVBA 1P3AA 5AY8A 3RELA 3MGPD 3X1TB 4X23C 1P3KC 1P3MC 1JFIA 4X23B 1P3KB 5AY8D 4DRAA 5GT3B 1P3MB 2RVQD 4Z5TD 3AZFC 5AV5C 2DF4C 4LD9D 5AV8C 2Y2HA 4J8XC 2Y2QA 3AN2D 5AV8A 3LZ1C 4H9OB 5BNXB 1TZYC 3LELA 3AZHC 2YFWB 3AV1C 1M18A 1P3OC 3AFAD 3WKJC 3KWQD 4CSRA 5B0ZD 2NZDD 3WKJA 1Z2CB 2DQNC 5B33D 5AV5D 3AZED 5CPKD 3H0LC 3REKC 1P3BA 1HTAA 3MGSC 5JA4A 4JJNB 1ZLAD 4WU9D 4H9RA 2W8SA 3B6GC 2HIOA 1P3GA 3VH5W 4NFTA 1PZRA 4YM6C 5JRGB 4J8WA 3AZNC 4YM6B 3AZMB 5GSUA 3A1KA 2ZY3A 5B0YC 4CAYB 1EQZB 4Z5TB 3AZLB 3LJAD 3REJB 1U35B 3UTAC 3UTBD 5GT0C 3C1CC 1P3LB 4QLCA 5B2IB 4KUDB 3B6FB 2RIQA 3R45A 3MVDD 5B40C 2J8PA 3TU4C 1B67A 5B2JC 3LZ0D 2CV5A 4WNNB 3LZ1B 2IO5B 3X1UC 3C1BC 5F99B 5AV5B 2XD5A 5B1MA 4Z2MG 5CPIC 4UPKA 3C1CD 3FDDA 3V9RA 3LJAB 3B6GB 3B0DC 1HQ3C 2PYOC 4KUDD 1HQ3B 5CHLB 3B0DB 4XUJD 3AV2B 4H9SC 3WKJB 1F66C 3AFAA 3KWQC 4H9RB 4H9SA 1KX3D 1F66A 4J8UD 2L5AA 5F99C 2CWEA 1P3IA 5FUGB 4X23A 1P3KA 1P3MA 2CV5D 5B32A 2ZY4A 3MVDA 5KDMA 3MGQA 1R4VA 1P3FC 4Z5TA 3W98B 1BH8B 2NQBC 3F6TA 2NQBA 3WTPB 3H0RC 5AV8D 4H9OA 5BNXA 4EO5C 3TU4A 5AV6B 3REJA 1U35A 2Y2NA 1ID3A 3VH5A 1EQZC 2JE5A 3AZIA 3C1BA 5B2IA 5E5AD 3EPHA 5B1MC 2YFWA 1WWIA 1KX4C 3W97D 1KX5B 2NQBD 5GXQC 5CPJD 1M19C 1BFMA 1P3GD 3AV2C 3AZKC 3VH5T 2PYOA 3AZKA 1ID3D 5CP6B 2JCHA 3WA9A 3AZJB 3MGRC 4YM6A 4J8WC 2Y2IA 5C3IB 3AZJC 3AZND 4JJNA 1P3OB 3AV1B 4X23D 1P3KD 1P3MD 2HUEC 4XUJC 5AVBC 3X1TA 3AFAB 4G92B 4XUJA 1S32D 5B0YD 4YS3B 5FUGA 1P3BC 2NZDB 4J8XB 3WAAA 4LD9C 4J8UC 4LD9A 5B24D 3AZJD 5AVCA 1T3UA 3R45B 1P3LC 3W98D 3REJC 1U35C 3X1VC 2CV5C 1N1JA 3LELC 5AVBD 1KX5D 2NQBB 2BYMA 1BH9B 3V9RB 1M1AD 2FFFB 3UTAA 1ID3B 4WJ3C 3W96A 5B1MB 3C1BB 3W96C 1P3LD 5JA4B 5AV9A 3LJAA 3MGSA 3W97B 4H9NA 4XZQC 4ZUXB 4WU8A 3AZGA 1P3GB 2FJ7B 4Z66A 4AWLC 3MGPC 2YFVA 5GXQD 1M19D 5GSUD 2PYOB 3AN2A 3AYWD 3AN2C 2G5HC 3AZLC 4KGCD 5DNMD 3AZLA 5CPIB 1ZLAA 5BNVA 5BT1D 3AV1D 3RELD 5GT0A 3AZHD 2Y2GA 2NZDA 3MVDB 5E5AA 3AFAC 3KWQA 4G92C 2HIOD 5B40D 2HUEB 4XUJB 3MNND 3REHD 3IP4C 4EO5B 2F8NA 3KXBC 4NE6A 1P3BD 3WTPC 4WNNA 1AOID 2G5IC 1P34B 5B0YA 5CPKC 3C1CB 1B6WA 4WU8D 4WV4B 4WU9C 3UT9A 4XZQB 1BH9A 1N1JB 5B31B 4R8PA 3X1SC 3AZHB 4NE3A 1HQ3A 1KX5C 3KUYD 2UWXA 2BG1A 2BYKA 5B40B 1ID3C 3WTPD 2F8NG 4DRBA 5AV8B 3W99A 3WA9B 1ULYA 4KGCB 3W99C 4ZUXD 5CPKB 3MGSB 4JJNC 5B1LB 5GT0D 2FJ7D 4WU8B 2Y2JA 3X1TC 4Z66B 3REID 5B2JD 3LZ0C 3MVDC 3AZMD 1P3PC 3WAAD 1BH8A 4LD9B 2NZDC 3MGRA 4YS3C 5AVCB 1P3BB 4KHAA 5CPID 5DNMC 5E5AB 3RELB 5DNMA 3B6FC 5JRGD 3NQJB 5B2IC 5AV9D 4YM6D 1TAFA 5AY8C 3WAAC 1F1EA 1P34C 1S32B 4Z5TC 3AZFD 4J8UA 5CP6C 2RVQC 4YS3D 2Y2LA 3KXBB 2BYMB 5BS7C 3LJAC 1P3LA 3W96B 4H9QA 4HGAC 2FJ7A 1KX4B 3B6FD 4H9NB 4ZUXA 4R8PB 4WZSB 3LZ0B 1P3OA 3TU4D 3LELB 4UUZA 3KUYC 4J8VB 5GT3C 1M18B 3KUYA 3AZGB 5B1LA 3X1UD 5B0ZC 3KSYA 5B1LC 5B0ZA 2ZM5A 5AVCD 1P3PA 5B24B 5GT0B 3W99D 5B32D 3WA9C 2F8NK 5E5AC 1KU5A 1TZYB 3B0CW 1KX4D 1HQ3D 3W97C 5AVBB 4KHAB 3AV2D 5CPJC 3AZMC 2F8NB 3AZMA 1KX3C 1M1AC 3KWQB 1Q9CA 3AYWB 3O62C 3UT9B 1P34A 3O62A 5B33B 5B32C 4H9PB 4G91B 2CV5B 5B32B 4QLCC 5DNNB 2BYKB 5B40A 5GXQB 1M19B 3AZHA 3WTPA 4H9QB 4E45A 3VH6T 4J8VD 4HGAB 5CPKA 1H3OB 2IO5C 3X1UB 3O62D 1AOIB 1EQZD 4KGCA 3UT9D 4WU9B 4M6BA 3REJD 1U35D 2ZY5A 3AV2A 5BNVB 4KUDC 3LELD 1P3ID 2AROA 5C3IC 3WTPE 3B6GA 5B0ZB 3AZGD 1P3GC 3MNNC 3KUYB 4J8VC 3REHC 3MGQD 5AV6D 3MNNA 3REHA 2F8ND 2XD1A 4CAYA 3LZ1D 2ZY2A 4J8XD 5F99D 3W98A 1TZYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  5JRG C;  1WWS A;  1P3O D;  3REI B;  5B33 A;  1S32 C;  5AV6 C;  4J8X A;  3WAA B;  5B33 C;  5KDM B;  3A6N D;  1S32 A;  3O62 B;  3KXB A;  1KX3 B;  5DNN A;  1M1A B;  3REK D;  4ZUX C;  4J8U B;  2JSS A;  1P3A C;  5DNN D;  5B1M D;  3REL C;  3B6G D;  4NE5 A;  3X1S B;  4QLC D;  5B31 C;  5GXQ A;  5GT3 A;  5G49 A;  5B2J B;  1M19 A;  1KX4 A;  3AZK D;  1P3P B;  4UUZ B;  3REK A;  5BS7 A;  3AZF B;  2ARO C;  1KX5 A;  3MGR B;  4J8V A;  1TZY A;  4WU8 C;  3W96 D;  1P3I B;  3AZJ A;  5B24 A;  5BO0 A;  1P3F D;  3X1S D;  3MGQ B;  2F8N H;  1TAF B;  3NQU B;  3AZE A;  2ARO D;  3MGQ C;  4E44 A;  3AZE C;  3A6N B;  3C1B D;  1P3A B;  5AV6 A;  4JJN D;  1ZLA B;  4YS3 A;  3AZN A;  1JFI B;  3AZI B;  4J8W B;  3B0C T;  3X1V D;  2FJ7 C;  4R8P D;  3AZI C;  3X1V A;  1H3O A;  1KX3 A;  1F66 D;  1P3F B;  5CPJ B;  1P3P D;  4ZBJ B;  5B0Y B;  1AOI C;  5CP6 A;  1AOI A;  3MGR D;  3WA9 D;  4XZQ A;  3X1S A;  1P3A D;  2YFV B;  5B2I D;  5AV9 C;  3VH6 W;  3AZI D;  5B31 D;  5G49 B;  5B2J A;  4Z66 C;  3MNN B;  3REH B;  3AZG C;  3W97 A;  3AV1 A;  1M18 C;  1A7W A;  3MGP A;  5CP6 D;  5GSU C;  1P34 D;  4AWL B;  2ARO B;  3AZL D;  4KGC C;  3AYW C;  4CSR B;  3UTB B;  3AYW A;  3MGS D;  1ZLA C;  4H9P A;  5BO0 B;  5BT1 C;  4Z66 D;  2HIO C;  1F66 B;  5GT3 D;  5AY8 B;  5GSU B;  3B6F A;  3UTA B;  5B1L D;  3X1U A;  4J8W D;  3X1V B;  1M1A A;  5B31 A;  3UT9 C;  1P3F A;  5AV9 B;  4WU9 A;  3C1C A;  4R8P C;  3AZF A;  5AV5 A;  4KUD A;  3WKJ D;  3LZ1 A;  3TU4 B;  4ZBJ C;  3AN2 B;  2LY8 A;  3REK B;  5B24 C;  3B0B A;  5F99 A;  5CPI A;  3W99 B;  3X1T D;  3MGP B;  3W98 C;  3NQU A;  5B31 G;  3LZ0 A;  5JRG A;  2PYO D;  3REI C;  2HIO B;  1M18 D;  3AZK B;  3REI A;  4Z2M H;  3KXB D;  3AZE B;  3A6N C;  5DNM B;  3A6N A;  3UTB A;  5AVC C;  3NQJ A;  3VH6 A;  3UTA D;  3UTB C;  5DNN C;  1EQZ A;  5B32 G;  4QLC B;  5CPJ A;  1P3I C;  4G91 C;  4XZQ D;  5AVB A;  1P3A A;  5AY8 A;  3REL A;  3MGP D;  3X1T B;  4X23 C;  1P3K C;  1P3M C;  1JFI A;  4X23 B;  1P3K B;  5AY8 D;  4DRA A;  5GT3 B;  1P3M B;  2RVQ D;  4Z5T D;  3AZF C;  5AV5 C;  4LD9 D;  5AV8 C;  4J8X C;  3AN2 D;  5AV8 A;  3LZ1 C;  4H9O B;  5BNX B;  1TZY C;  3LEL A;  3AZH C;  2YFW B;  3AV1 C;  1M18 A;  1P3O C;  3AFA D;  3WKJ C;  3KWQ D;  4CSR A;  5B0Z D;  2NZD D;  3WKJ A;  3AZE D;  5AV5 D;  5B33 D;  5CPK D;  3REK C;  1P3B A;  1HTA A;  3MGS C;  5JA4 A;  4JJN B;  1ZLA D;  4WU9 D;  4H9R A;  3B6G C;  2HIO A;  1P3G A;  3VH5 W;  4NFT A;  4YM6 C;  4J8W A;  5JRG B;  3AZN C;  4YM6 B;  3AZM B;  5GSU A;  5B0Y C;  4CAY B;  1EQZ B;  4Z5T B;  3AZL B;  3LJA D;  3REJ B;  1U35 B;  3UTA C;  3UTB D;  5GT0 C;  3C1C C;  1P3L B;  4QLC A;  5B2I B;  4KUD B;  3B6F B;  3R45 A;  3MVD D;  5B40 C;  3TU4 C;  1B67 A;  5B2J C;  3LZ0 D;  2CV5 A;  4WNN B;  3LZ1 B;  2IO5 B;  3X1U C;  3C1B C;  5F99 B;  5AV5 B;  5B1M A;  4Z2M G;  5CPI C;  3C1C D;  3V9R A;  3LJA B;  3B6G B;  3B0D C;  1HQ3 C;  2PYO C;  4KUD D;  1HQ3 B;  5CHL B;  3B0D B;  4XUJ D;  3AV2 B;  4H9S C;  3WKJ B;  1F66 C;  3AFA A;  3KWQ C;  4H9R B;  4H9S A;  1KX3 D;  1F66 A;  4J8U D;  2L5A A;  5F99 C;  2CWE A;  1P3I A;  5FUG B;  4X23 A;  1P3K A;  1P3M A;  2CV5 D;  5B32 A;  3MVD A;  3MGQ A;  5KDM A;  1P3F C;  1R4V A;  3W98 B;  4Z5T A;  1BH8 B;  2NQB C;  2NQB A;  3WTP B;  5AV8 D;  4H9O A;  5BNX A;  4EO5 C;  3TU4 A;  5AV6 B;  3REJ A;  1U35 A;  1ID3 A;  3VH5 A;  1EQZ C;  3AZI A;  3C1B A;  5B2I A;  5E5A D;  5B1M C;  2YFW A;  1WWI A;  1KX4 C;  3W97 D;  1KX5 B;  2NQB D;  5GXQ C;  5CPJ D;  1M19 C;  1BFM A;  1P3G D;  3AV2 C;  3AZK C;  3VH5 T;  2PYO A;  3AZK A;  1ID3 D;  5CP6 B;  3WA9 A;  3AZJ B;  3MGR C;  4YM6 A;  4J8W C;  5C3I B;  3AZJ C;  3AZN D;  4JJN A;  1P3O B;  3AV1 B;  4X23 D;  1P3K D;  1P3M D;  2HUE C;  4XUJ C;  5AVB C;  3X1T A;  3AFA B;  4G92 B;  4XUJ A;  1S32 D;  5B0Y D;  4YS3 B;  5FUG A;  1P3B C;  2NZD B;  4J8X B;  3WAA A;  4LD9 C;  4J8U C;  4LD9 A;  5B24 D;  3AZJ D;  5AVC A;  1P3L C;  3R45 B;  3W98 D;  3REJ C;  1U35 C;  3X1V C;  2CV5 C;  1N1J A;  3LEL C;  5AVB D;  1KX5 D;  2NQB B;  2BYM A;  1BH9 B;  3V9R B;  1M1A D;  3UTA A;  1ID3 B;  3W96 A;  5B1M B;  3C1B B;  3W96 C;  1P3L D;  5JA4 B;  5AV9 A;  3LJA A;  3MGS A;  3W97 B;  4H9N A;  4XZQ C;  4ZUX B;  4WU8 A;  3AZG A;  1P3G B;  2FJ7 B;  4Z66 A;  4AWL C;  3MGP C;  2YFV A;  5GXQ D;  1M19 D;  5GSU D;  2PYO B;  3AN2 A;  3AYW D;  3AN2 C;  3AZL C;  4KGC D;  5DNM D;  3AZL A;  5CPI B;  1ZLA A;  5BNV A;  5BT1 D;  3AV1 D;  3REL D;  5GT0 A;  3AZH D;  2NZD A;  3MVD B;  5E5A A;  3AFA C;  3KWQ A;  4G92 C;  2HIO D;  5B40 D;  2HUE B;  4XUJ B;  3MNN D;  3REH D;  2F8N A;  4EO5 B;  3KXB C;  4NE6 A;  1P3B D;  3WTP C;  4WNN A;  1AOI D;  1P34 B;  5B0Y A;  5CPK C;  3C1C B;  1B6W A;  4WU8 D;  4WV4 B;  4WU9 C;  3UT9 A;  4XZQ B;  1BH9 A;  1N1J B;  5B31 B;  4R8P A;  3X1S C;  3AZH B;  4NE3 A;  1HQ3 A;  1KX5 C;  3KUY D;  2BYK A;  5B40 B;  1ID3 C;  3WTP D;  2F8N G;  4DRB A;  5AV8 B;  3W99 A;  3WA9 B;  1ULY A;  4KGC B;  3W99 C;  4ZUX D;  5CPK B;  3MGS B;  4JJN C;  5B1L B;  5GT0 D;  2FJ7 D;  4WU8 B;  3X1T C;  4Z66 B;  3REI D;  5B2J D;  3LZ0 C;  3MVD C;  3AZM D;  1P3P C;  3WAA D;  1BH8 A;  4LD9 B;  2NZD C;  3MGR A;  4YS3 C;  5AVC B;  1P3B B;  4KHA A;  5CPI D;  5DNM C;  5E5A B;  3REL B;  5DNM A;  3B6F C;  5JRG D;  3NQJ B;  5B2I C;  5AV9 D;  4YM6 D;  1TAF A;  5AY8 C;  3WAA C;  1F1E A;  1P34 C;  1S32 B;  4Z5T C;  3AZF D;  4J8U A;  5CP6 C;  2RVQ C;  4YS3 D;  3KXB B;  2BYM B;  5BS7 C;  3LJA C;  1P3L A;  3W96 B;  4H9Q A;  4HGA C;  2FJ7 A;  1KX4 B;  3B6F D;  4H9N B;  4ZUX A;  4R8P B;  4WZS B;  3LZ0 B;  1P3O A;  3TU4 D;  3LEL B;  4UUZ A;  3KUY C;  4J8V B;  5GT3 C;  1M18 B;  3KUY A;  3AZG B;  5B1L A;  3X1U D;  5B0Z C;  3KSY A;  5B1L C;  5B0Z A;  5AVC D;  1P3P A;  5B24 B;  5GT0 B;  3W99 D;  5B32 D;  3WA9 C;  2F8N K;  5E5A C;  1KU5 A;  1TZY B;  3B0C W;  1KX4 D;  1HQ3 D;  3W97 C;  5AVB B;  4KHA B;  3AV2 D;  5CPJ C;  3AZM C;  2F8N B;  3AZM A;  1KX3 C;  1M1A C;  3KWQ B;  1Q9C A;  3AYW B;  3O62 C;  3UT9 B;  1P34 A;  3O62 A;  5B33 B;  5B32 C;  4H9P B;  4G91 B;  2CV5 B;  5B32 B;  4QLC C;  5DNN B;  2BYK B;  5B40 A;  5GXQ B;  1M19 B;  3AZH A;  3WTP A;  4H9Q B;  4E45 A;  3VH6 T;  4J8V D;  4HGA B;  5CPK A;  1H3O B;  2IO5 C;  3X1U B;  3O62 D;  1AOI B;  1EQZ D;  4KGC A;  3UT9 D;  4WU9 B;  4M6B A;  3REJ D;  1U35 D;  3AV2 A;  5BNV B;  4KUD C;  3LEL D;  1P3I D;  2ARO A;  5C3I C;  3WTP E;  3B6G A;  5B0Z B;  3AZG D;  1P3G C;  3MNN C;  3KUY B;  4J8V C;  3REH C;  3MGQ D;  5AV6 D;  3MNN A;  3REH A;  2F8N D;  4CAY A;  3LZ1 D;  4J8X D;  5F99 D;  3W98 A;  1TZY D; 
#chains in the Genus database with same CATH topology
 3AZN B;  5JRG C;  2Y2M A;  1WWS A;  1P3O D;  3REI B;  5B33 A;  1S32 C;  5AV6 C;  4J8X A;  3WAA B;  5B33 C;  5KDM B;  3A6N D;  1S32 A;  3KFU G;  3O62 B;  3KXB A;  1KX3 B;  5DNN A;  1M1A B;  3REK D;  4ZUX C;  4J8U B;  2JSS A;  1P3A C;  1W2E A;  5B1M D;  5DNN D;  3REL C;  3B6G D;  4NE5 A;  3X1S B;  4QLC D;  5B31 C;  5GXQ A;  5GT3 A;  5G49 A;  5B2J B;  1M19 A;  1KX4 A;  3AZK D;  1P3P B;  4UUZ B;  3REK A;  5BS7 A;  3AZF B;  2ARO C;  1KX5 A;  3MGR B;  2Y2K A;  1TZY A;  4J8V A;  4WU8 C;  3W96 D;  1P3I B;  3AZJ A;  5B24 A;  5BO0 A;  1P3F D;  3X1S D;  3MGQ B;  2F8N H;  1TAF B;  3NQU B;  3AZE A;  2ARO D;  3MGQ C;  4E44 A;  3AZE C;  3A6N B;  3C1B D;  1P3A B;  5AV6 A;  4JJN D;  1ZLA B;  4YS3 A;  3AZN A;  1JFI B;  3AZI B;  4J8W B;  3B0C T;  3X1V D;  2FJ7 C;  4R8P D;  3AZI C;  3X1V A;  4DQY B;  1H3O A;  1KX3 A;  1F66 D;  1P3F B;  5CPJ B;  1P3P D;  4ZBJ B;  5B0Y B;  1AOI C;  2VQR A;  5CP6 A;  1AOI A;  3MGR D;  3WA9 D;  4XZQ A;  3X1S A;  1P3A D;  2YFV B;  5B2I D;  5AV9 C;  3VH6 W;  3AZI D;  5B31 D;  5G49 B;  5B2J A;  4Z66 C;  3MNN B;  3REH B;  3AZG C;  3W97 A;  3AV1 A;  1M18 C;  1A7W A;  3MGP A;  5CP6 D;  3AL0 C;  5GSU C;  1P34 D;  4AWL B;  2ARO B;  3AZL D;  4KGC C;  3AYW C;  4CSR B;  3UTB B;  3AYW A;  3MGS D;  1ZLA C;  4H9P A;  5BO0 B;  5BT1 C;  4Z66 D;  2HIO C;  3A1I A;  1F66 B;  5GT3 D;  5AY8 B;  5GSU B;  3B6F A;  3UTA B;  5B1L D;  3X1U A;  3EPL A;  4J8W D;  3X1V B;  1M1A A;  5B31 A;  3UT9 C;  3EPK A;  1P3F A;  5AV9 B;  4WU9 A;  3C1C A;  4R8P C;  3AZF A;  2F2A C;  5AV5 A;  4KUD A;  3H0M C;  3WKJ D;  3LZ1 A;  3TU4 B;  4ZBJ C;  3P5J B;  3AN2 B;  3EPJ A;  2LY8 A;  3REK B;  5B24 C;  3B0B A;  5F99 A;  5CPI A;  3W99 B;  3X1T D;  3MGP B;  3W98 C;  2Y2P A;  3NQU A;  5B31 G;  3LZ0 A;  5JRG A;  2Y2O A;  2PYO D;  3REI C;  2HIO B;  1M18 D;  3AZK B;  3REI A;  4Z2M H;  3KXB D;  3AZE B;  3A6N C;  5DNM B;  3A6N A;  3UTB A;  5AVC C;  3NQJ A;  3VH6 A;  3EG5 B;  3UTA D;  3UTB C;  5DNN C;  1EQZ A;  5B32 G;  4QLC B;  5CPJ A;  1P3I C;  4G91 C;  4XZQ D;  5AVB A;  1P3A A;  5AY8 A;  3REL A;  3MGP D;  3X1T B;  4X23 C;  1P3K C;  1P3M C;  1JFI A;  4X23 B;  1P3K B;  5AY8 D;  4DRA A;  5GT3 B;  1P3M B;  2RVQ D;  4Z5T D;  3AZF C;  5AV5 C;  2DF4 C;  4LD9 D;  5AV8 C;  2Y2H A;  4J8X C;  2Y2Q A;  3AN2 D;  5AV8 A;  3LZ1 C;  4H9O B;  5BNX B;  1TZY C;  3LEL A;  3AZH C;  2YFW B;  3AV1 C;  1M18 A;  1P3O C;  3AFA D;  3WKJ C;  3KWQ D;  4CSR A;  5B0Z D;  2NZD D;  3WKJ A;  1Z2C B;  2DQN C;  5B33 D;  5AV5 D;  3AZE D;  5CPK D;  3H0L C;  3REK C;  1P3B A;  1HTA A;  3MGS C;  5JA4 A;  4JJN B;  1ZLA D;  4WU9 D;  4H9R A;  2W8S A;  3B6G C;  2HIO A;  1P3G A;  3VH5 W;  4NFT A;  1PZR A;  4YM6 C;  5JRG B;  4J8W A;  3AZN C;  4YM6 B;  3AZM B;  5GSU A;  3A1K A;  2ZY3 A;  5B0Y C;  4CAY B;  1EQZ B;  4Z5T B;  3AZL B;  3LJA D;  3REJ B;  1U35 B;  3UTA C;  3UTB D;  5GT0 C;  3C1C C;  1P3L B;  4QLC A;  5B2I B;  4KUD B;  3B6F B;  2RIQ A;  3R45 A;  3MVD D;  5B40 C;  2J8P A;  3TU4 C;  1B67 A;  5B2J C;  3LZ0 D;  2CV5 A;  4WNN B;  3LZ1 B;  2IO5 B;  3X1U C;  3C1B C;  5F99 B;  5AV5 B;  2XD5 A;  5B1M A;  4Z2M G;  5CPI C;  4UPK A;  3C1C D;  3FDD A;  3V9R A;  3LJA B;  3B6G B;  3B0D C;  1HQ3 C;  2PYO C;  4KUD D;  1HQ3 B;  5CHL B;  3B0D B;  4XUJ D;  3AV2 B;  4H9S C;  3WKJ B;  1F66 C;  3AFA A;  3KWQ C;  4H9R B;  4H9S A;  1KX3 D;  1F66 A;  4J8U D;  2L5A A;  5F99 C;  2CWE A;  1P3I A;  5FUG B;  4X23 A;  1P3K A;  1P3M A;  2CV5 D;  5B32 A;  2ZY4 A;  3MVD A;  5KDM A;  3MGQ A;  1R4V A;  1P3F C;  4Z5T A;  3W98 B;  1BH8 B;  2NQB C;  3F6T A;  2NQB A;  3WTP B;  3H0R C;  5AV8 D;  4H9O A;  5BNX A;  4EO5 C;  3TU4 A;  5AV6 B;  3REJ A;  1U35 A;  2Y2N A;  1ID3 A;  3VH5 A;  1EQZ C;  2JE5 A;  3AZI A;  3C1B A;  5B2I A;  5E5A D;  3EPH A;  5B1M C;  2YFW A;  1WWI A;  1KX4 C;  3W97 D;  1KX5 B;  2NQB D;  5GXQ C;  5CPJ D;  1M19 C;  1BFM A;  1P3G D;  3AV2 C;  3AZK C;  3VH5 T;  2PYO A;  3AZK A;  1ID3 D;  5CP6 B;  2JCH A;  3WA9 A;  3AZJ B;  3MGR C;  4YM6 A;  4J8W C;  2Y2I A;  5C3I B;  3AZJ C;  3AZN D;  4JJN A;  1P3O B;  3AV1 B;  4X23 D;  1P3K D;  1P3M D;  2HUE C;  4XUJ C;  5AVB C;  3X1T A;  3AFA B;  4G92 B;  4XUJ A;  1S32 D;  5B0Y D;  4YS3 B;  5FUG A;  1P3B C;  2NZD B;  4J8X B;  3WAA A;  4LD9 C;  4J8U C;  4LD9 A;  5B24 D;  3AZJ D;  5AVC A;  1T3U A;  3R45 B;  1P3L C;  3W98 D;  3REJ C;  1U35 C;  3X1V C;  2CV5 C;  1N1J A;  3LEL C;  5AVB D;  1KX5 D;  2NQB B;  2BYM A;  1BH9 B;  3V9R B;  1M1A D;  2FFF B;  3UTA A;  1ID3 B;  4WJ3 C;  3W96 A;  5B1M B;  3C1B B;  3W96 C;  1P3L D;  5JA4 B;  5AV9 A;  3LJA A;  3MGS A;  3W97 B;  4H9N A;  4XZQ C;  4ZUX B;  4WU8 A;  3AZG A;  1P3G B;  2FJ7 B;  4Z66 A;  4AWL C;  3MGP C;  2YFV A;  5GXQ D;  1M19 D;  5GSU D;  2PYO B;  3AN2 A;  3AYW D;  3AN2 C;  2G5H C;  3AZL C;  4KGC D;  5DNM D;  3AZL A;  5CPI B;  1ZLA A;  5BNV A;  5BT1 D;  3AV1 D;  3REL D;  5GT0 A;  3AZH D;  2Y2G A;  2NZD A;  3MVD B;  5E5A A;  3AFA C;  3KWQ A;  4G92 C;  2HIO D;  5B40 D;  2HUE B;  4XUJ B;  3MNN D;  3REH D;  3IP4 C;  4EO5 B;  2F8N A;  3KXB C;  4NE6 A;  1P3B D;  3WTP C;  4WNN A;  1AOI D;  2G5I C;  1P34 B;  5B0Y A;  5CPK C;  3C1C B;  1B6W A;  4WU8 D;  4WV4 B;  4WU9 C;  3UT9 A;  4XZQ B;  1BH9 A;  1N1J B;  5B31 B;  4R8P A;  3X1S C;  3AZH B;  4NE3 A;  1HQ3 A;  1KX5 C;  3KUY D;  2UWX A;  2BG1 A;  2BYK A;  5B40 B;  1ID3 C;  3WTP D;  2F8N G;  4DRB A;  5AV8 B;  3W99 A;  3WA9 B;  1ULY A;  4KGC B;  3W99 C;  4ZUX D;  5CPK B;  3MGS B;  4JJN C;  5B1L B;  5GT0 D;  2FJ7 D;  4WU8 B;  2Y2J A;  3X1T C;  4Z66 B;  3REI D;  5B2J D;  3LZ0 C;  3MVD C;  3AZM D;  1P3P C;  3WAA D;  1BH8 A;  4LD9 B;  2NZD C;  3MGR A;  4YS3 C;  5AVC B;  1P3B B;  4KHA A;  5CPI D;  5DNM C;  5E5A B;  3REL B;  5DNM A;  3B6F C;  5JRG D;  3NQJ B;  5B2I C;  5AV9 D;  4YM6 D;  1TAF A;  5AY8 C;  3WAA C;  1F1E A;  1P34 C;  1S32 B;  4Z5T C;  3AZF D;  4J8U A;  5CP6 C;  2RVQ C;  4YS3 D;  2Y2L A;  3KXB B;  2BYM B;  5BS7 C;  3LJA C;  1P3L A;  3W96 B;  4H9Q A;  4HGA C;  2FJ7 A;  1KX4 B;  3B6F D;  4H9N B;  4ZUX A;  4R8P B;  4WZS B;  3LZ0 B;  1P3O A;  3TU4 D;  3LEL B;  4UUZ A;  3KUY C;  4J8V B;  5GT3 C;  1M18 B;  3KUY A;  3AZG B;  5B1L A;  3X1U D;  5B0Z C;  3KSY A;  5B1L C;  5B0Z A;  2ZM5 A;  5AVC D;  1P3P A;  5B24 B;  5GT0 B;  3W99 D;  5B32 D;  3WA9 C;  2F8N K;  5E5A C;  1KU5 A;  1TZY B;  3B0C W;  1KX4 D;  1HQ3 D;  3W97 C;  5AVB B;  4KHA B;  3AV2 D;  5CPJ C;  3AZM C;  2F8N B;  3AZM A;  1KX3 C;  1M1A C;  3KWQ B;  1Q9C A;  3AYW B;  3O62 C;  3UT9 B;  1P34 A;  3O62 A;  5B33 B;  5B32 C;  4H9P B;  4G91 B;  2CV5 B;  5B32 B;  4QLC C;  5DNN B;  2BYK B;  5B40 A;  5GXQ B;  1M19 B;  3AZH A;  3WTP A;  4H9Q B;  4E45 A;  3VH6 T;  4J8V D;  4HGA B;  5CPK A;  1H3O B;  2IO5 C;  3X1U B;  3O62 D;  1AOI B;  1EQZ D;  4KGC A;  3UT9 D;  4WU9 B;  4M6B A;  3REJ D;  1U35 D;  2ZY5 A;  3AV2 A;  5BNV B;  4KUD C;  3LEL D;  1P3I D;  2ARO A;  5C3I C;  3WTP E;  3B6G A;  5B0Z B;  3AZG D;  1P3G C;  3MNN C;  3KUY B;  4J8V C;  3REH C;  3MGQ D;  5AV6 D;  3MNN A;  3REH A;  2F8N D;  2XD1 A;  4CAY A;  3LZ1 D;  2ZY2 A;  4J8X D;  5F99 D;  3W98 A;  1TZY D; 
#chains in the Genus database with same CATH homology
 3AZN B;  5JRG C;  2Y2M A;  1WWS A;  1P3O D;  3REI B;  5B33 A;  1S32 C;  5AV6 C;  4J8X A;  3WAA B;  5B33 C;  5KDM B;  3A6N D;  1S32 A;  3KFU G;  3O62 B;  3KXB A;  1KX3 B;  5DNN A;  1M1A B;  3REK D;  4ZUX C;  4J8U B;  2JSS A;  1P3A C;  1W2E A;  5B1M D;  5DNN D;  3REL C;  3B6G D;  4NE5 A;  3X1S B;  4QLC D;  5B31 C;  5GXQ A;  5GT3 A;  5G49 A;  5B2J B;  1M19 A;  1KX4 A;  3AZK D;  1P3P B;  4UUZ B;  3REK A;  5BS7 A;  3AZF B;  2ARO C;  1KX5 A;  3MGR B;  2Y2K A;  1TZY A;  4J8V A;  4WU8 C;  3W96 D;  1P3I B;  3AZJ A;  5B24 A;  5BO0 A;  1P3F D;  3X1S D;  3MGQ B;  2F8N H;  1TAF B;  3NQU B;  3AZE A;  2ARO D;  3MGQ C;  4E44 A;  3AZE C;  3A6N B;  3C1B D;  1P3A B;  5AV6 A;  4JJN D;  1ZLA B;  4YS3 A;  3AZN A;  1JFI B;  3AZI B;  4J8W B;  3B0C T;  3X1V D;  2FJ7 C;  4R8P D;  3AZI C;  3X1V A;  4DQY B;  1H3O A;  1KX3 A;  1F66 D;  1P3F B;  5CPJ B;  1P3P D;  4ZBJ B;  5B0Y B;  1AOI C;  2VQR A;  5CP6 A;  1AOI A;  3MGR D;  3WA9 D;  4XZQ A;  3X1S A;  1P3A D;  2YFV B;  5B2I D;  5AV9 C;  3VH6 W;  3AZI D;  5B31 D;  5G49 B;  5B2J A;  4Z66 C;  3MNN B;  3REH B;  3AZG C;  3W97 A;  3AV1 A;  1M18 C;  1A7W A;  3MGP A;  5CP6 D;  3AL0 C;  5GSU C;  1P34 D;  4AWL B;  2ARO B;  3AZL D;  4KGC C;  3AYW C;  4CSR B;  3UTB B;  3AYW A;  3MGS D;  1ZLA C;  4H9P A;  5BO0 B;  5BT1 C;  4Z66 D;  2HIO C;  3A1I A;  1F66 B;  5GT3 D;  5AY8 B;  5GSU B;  3B6F A;  3UTA B;  5B1L D;  3X1U A;  3EPL A;  4J8W D;  3X1V B;  1M1A A;  5B31 A;  3UT9 C;  3EPK A;  1P3F A;  5AV9 B;  4WU9 A;  3C1C A;  4R8P C;  3AZF A;  2F2A C;  5AV5 A;  4KUD A;  3H0M C;  3WKJ D;  3LZ1 A;  3TU4 B;  4ZBJ C;  3P5J B;  3AN2 B;  3EPJ A;  2LY8 A;  3REK B;  5B24 C;  3B0B A;  5F99 A;  5CPI A;  3W99 B;  3X1T D;  3MGP B;  3W98 C;  2Y2P A;  3NQU A;  5B31 G;  3LZ0 A;  5JRG A;  2Y2O A;  2PYO D;  3REI C;  2HIO B;  1M18 D;  3AZK B;  3REI A;  4Z2M H;  3KXB D;  3AZE B;  3A6N C;  5DNM B;  3A6N A;  3UTB A;  5AVC C;  3NQJ A;  3VH6 A;  3EG5 B;  3UTA D;  3UTB C;  5DNN C;  1EQZ A;  5B32 G;  4QLC B;  5CPJ A;  1P3I C;  4G91 C;  4XZQ D;  5AVB A;  1P3A A;  5AY8 A;  3REL A;  3MGP D;  3X1T B;  4X23 C;  1P3K C;  1P3M C;  1JFI A;  4X23 B;  1P3K B;  5AY8 D;  4DRA A;  5GT3 B;  1P3M B;  2RVQ D;  4Z5T D;  3AZF C;  5AV5 C;  2DF4 C;  4LD9 D;  5AV8 C;  2Y2H A;  4J8X C;  2Y2Q A;  3AN2 D;  5AV8 A;  3LZ1 C;  4H9O B;  5BNX B;  1TZY C;  3LEL A;  3AZH C;  2YFW B;  3AV1 C;  1M18 A;  1P3O C;  3AFA D;  3WKJ C;  3KWQ D;  4CSR A;  5B0Z D;  2NZD D;  3WKJ A;  1Z2C B;  2DQN C;  5B33 D;  5AV5 D;  3AZE D;  5CPK D;  3H0L C;  3REK C;  1P3B A;  1HTA A;  3MGS C;  5JA4 A;  4JJN B;  1ZLA D;  4WU9 D;  4H9R A;  2W8S A;  3B6G C;  2HIO A;  1P3G A;  3VH5 W;  4NFT A;  1PZR A;  4YM6 C;  5JRG B;  4J8W A;  3AZN C;  4YM6 B;  3AZM B;  5GSU A;  3A1K A;  2ZY3 A;  5B0Y C;  4CAY B;  1EQZ B;  4Z5T B;  3AZL B;  3LJA D;  3REJ B;  1U35 B;  3UTA C;  3UTB D;  5GT0 C;  3C1C C;  1P3L B;  4QLC A;  5B2I B;  4KUD B;  3B6F B;  2RIQ A;  3R45 A;  3MVD D;  5B40 C;  2J8P A;  3TU4 C;  1B67 A;  5B2J C;  3LZ0 D;  2CV5 A;  4WNN B;  3LZ1 B;  2IO5 B;  3X1U C;  3C1B C;  5F99 B;  5AV5 B;  2XD5 A;  5B1M A;  4Z2M G;  5CPI C;  4UPK A;  3C1C D;  3FDD A;  3V9R A;  3LJA B;  3B6G B;  3B0D C;  1HQ3 C;  2PYO C;  4KUD D;  1HQ3 B;  5CHL B;  3B0D B;  4XUJ D;  3AV2 B;  4H9S C;  3WKJ B;  1F66 C;  3AFA A;  3KWQ C;  4H9R B;  4H9S A;  1KX3 D;  1F66 A;  4J8U D;  2L5A A;  5F99 C;  2CWE A;  1P3I A;  5FUG B;  4X23 A;  1P3K A;  1P3M A;  2CV5 D;  5B32 A;  2ZY4 A;  3MVD A;  5KDM A;  3MGQ A;  1R4V A;  1P3F C;  4Z5T A;  3W98 B;  1BH8 B;  2NQB C;  3F6T A;  2NQB A;  3WTP B;  3H0R C;  5AV8 D;  4H9O A;  5BNX A;  4EO5 C;  3TU4 A;  5AV6 B;  3REJ A;  1U35 A;  2Y2N A;  1ID3 A;  3VH5 A;  1EQZ C;  2JE5 A;  3AZI A;  3C1B A;  5B2I A;  5E5A D;  3EPH A;  5B1M C;  2YFW A;  1WWI A;  1KX4 C;  3W97 D;  1KX5 B;  2NQB D;  5GXQ C;  5CPJ D;  1M19 C;  1BFM A;  1P3G D;  3AV2 C;  3AZK C;  3VH5 T;  2PYO A;  3AZK A;  1ID3 D;  5CP6 B;  2JCH A;  3WA9 A;  3AZJ B;  3MGR C;  4YM6 A;  4J8W C;  2Y2I A;  5C3I B;  3AZJ C;  3AZN D;  4JJN A;  1P3O B;  3AV1 B;  4X23 D;  1P3K D;  1P3M D;  2HUE C;  4XUJ C;  5AVB C;  3X1T A;  3AFA B;  4G92 B;  4XUJ A;  1S32 D;  5B0Y D;  4YS3 B;  5FUG A;  1P3B C;  2NZD B;  4J8X B;  3WAA A;  4LD9 C;  4J8U C;  4LD9 A;  5B24 D;  3AZJ D;  5AVC A;  1T3U A;  3R45 B;  1P3L C;  3W98 D;  3REJ C;  1U35 C;  3X1V C;  2CV5 C;  1N1J A;  3LEL C;  5AVB D;  1KX5 D;  2NQB B;  2BYM A;  1BH9 B;  3V9R B;  1M1A D;  2FFF B;  3UTA A;  1ID3 B;  4WJ3 C;  3W96 A;  5B1M B;  3C1B B;  3W96 C;  1P3L D;  5JA4 B;  5AV9 A;  3LJA A;  3MGS A;  3W97 B;  4H9N A;  4XZQ C;  4ZUX B;  4WU8 A;  3AZG A;  1P3G B;  2FJ7 B;  4Z66 A;  4AWL C;  3MGP C;  2YFV A;  5GXQ D;  1M19 D;  5GSU D;  2PYO B;  3AN2 A;  3AYW D;  3AN2 C;  2G5H C;  3AZL C;  4KGC D;  5DNM D;  3AZL A;  5CPI B;  1ZLA A;  5BNV A;  5BT1 D;  3AV1 D;  3REL D;  5GT0 A;  3AZH D;  2Y2G A;  2NZD A;  3MVD B;  5E5A A;  3AFA C;  3KWQ A;  4G92 C;  2HIO D;  5B40 D;  2HUE B;  4XUJ B;  3MNN D;  3REH D;  3IP4 C;  4EO5 B;  2F8N A;  3KXB C;  4NE6 A;  1P3B D;  3WTP C;  4WNN A;  1AOI D;  2G5I C;  1P34 B;  5B0Y A;  5CPK C;  3C1C B;  1B6W A;  4WU8 D;  4WV4 B;  4WU9 C;  3UT9 A;  4XZQ B;  1BH9 A;  1N1J B;  5B31 B;  4R8P A;  3X1S C;  3AZH B;  4NE3 A;  1HQ3 A;  1KX5 C;  3KUY D;  2UWX A;  2BG1 A;  2BYK A;  5B40 B;  1ID3 C;  3WTP D;  2F8N G;  4DRB A;  5AV8 B;  3W99 A;  3WA9 B;  1ULY A;  4KGC B;  3W99 C;  4ZUX D;  5CPK B;  3MGS B;  4JJN C;  5B1L B;  5GT0 D;  2FJ7 D;  4WU8 B;  2Y2J A;  3X1T C;  4Z66 B;  3REI D;  5B2J D;  3LZ0 C;  3MVD C;  3AZM D;  1P3P C;  3WAA D;  1BH8 A;  4LD9 B;  2NZD C;  3MGR A;  4YS3 C;  5AVC B;  1P3B B;  4KHA A;  5CPI D;  5DNM C;  5E5A B;  3REL B;  5DNM A;  3B6F C;  5JRG D;  3NQJ B;  5B2I C;  5AV9 D;  4YM6 D;  1TAF A;  5AY8 C;  3WAA C;  1F1E A;  1P34 C;  1S32 B;  4Z5T C;  3AZF D;  4J8U A;  5CP6 C;  2RVQ C;  4YS3 D;  2Y2L A;  3KXB B;  2BYM B;  5BS7 C;  3LJA C;  1P3L A;  3W96 B;  4H9Q A;  4HGA C;  2FJ7 A;  1KX4 B;  3B6F D;  4H9N B;  4ZUX A;  4R8P B;  4WZS B;  3LZ0 B;  1P3O A;  3TU4 D;  3LEL B;  4UUZ A;  3KUY C;  4J8V B;  5GT3 C;  1M18 B;  3KUY A;  3AZG B;  5B1L A;  3X1U D;  5B0Z C;  3KSY A;  5B1L C;  5B0Z A;  2ZM5 A;  5AVC D;  1P3P A;  5B24 B;  5GT0 B;  3W99 D;  5B32 D;  3WA9 C;  2F8N K;  5E5A C;  1KU5 A;  1TZY B;  3B0C W;  1KX4 D;  1HQ3 D;  3W97 C;  5AVB B;  4KHA B;  3AV2 D;  5CPJ C;  3AZM C;  2F8N B;  3AZM A;  1KX3 C;  1M1A C;  3KWQ B;  1Q9C A;  3AYW B;  3O62 C;  3UT9 B;  1P34 A;  3O62 A;  5B33 B;  5B32 C;  4H9P B;  4G91 B;  2CV5 B;  5B32 B;  4QLC C;  5DNN B;  2BYK B;  5B40 A;  5GXQ B;  1M19 B;  3AZH A;  3WTP A;  4H9Q B;  4E45 A;  3VH6 T;  4J8V D;  4HGA B;  5CPK A;  1H3O B;  2IO5 C;  3X1U B;  3O62 D;  1AOI B;  1EQZ D;  4KGC A;  3UT9 D;  4WU9 B;  4M6B A;  3REJ D;  1U35 D;  2ZY5 A;  3AV2 A;  5BNV B;  4KUD C;  3LEL D;  1P3I D;  2ARO A;  5C3I C;  3WTP E;  3B6G A;  5B0Z B;  3AZG D;  1P3G C;  3MNN C;  3KUY B;  4J8V C;  3REH C;  3MGQ D;  5AV6 D;  3MNN A;  3REH A;  2F8N D;  2XD1 A;  4CAY A;  3LZ1 D;  2ZY2 A;  4J8X D;  5F99 D;  3W98 A;  1TZY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...