5JRGD

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgD00
3REJA 3MGPA 3W99A 3MGPD 5B1MA 3AZFD 5B1MD 1EQZB 2PYOC 1EQZA 3MVDB 3LELB 1EQZD 3TU4C 3MVDA 3LELA 1P3IB 1M18C 3B6GC 1P3IA 4Z5TD 5B33B 5DNMB 3AZEC 1P3ID 2F8NB 4XUJB 3AZLB 2HIOD 4R8PA 5DNMA 4R8PD 2F8NA 4XUJA 3AZLA 2F8ND 4XUJD 3AZLD 3MNNB 1KX4B 5F99C 3UTBC 1AOIB 2NZDC 2RVQD 1KX4A 4J8WB 1KX4D 3KSYA 4J8UC 1P3FB 3WA9B 4J8WA 4X23A 1F1EA 5B31G 4J8WD 4X23D 3AZKB 3KUYB 3AZND 3WA9A 2BYKB 4WU8D 3KXBD 1M1AB 3KUYA 5CP6B 3MGQB 5B32B 1M1AA 5CP6A 3UT9C 3MGQA 5CP6D 1P3MC 5B32A 1N1JB 3REHB 5B32D 3MGSB 2AROB 1N1JA 5AV9B 3MGSA 2AROA 3MGSD 1S32B 3X1VC 1S32A 1P3KB 2CV5B 3C1BC 3AV2B 3B6FC 1P3KA 2CV5A 5GT3C 2PYOD 1P3KD 1WWIA 5AVBC 3A6NB 3AV2A 3X1UA 3X1UD 5CPKC 3VH6T 5GT0C 3A6NA 1P3AA 3A6ND 1KX3A 1P3AD 1M19C 5B40C 1KX3D 4KGCC 3LJAB 4YS3C 3AZED 4H9OB 5B2JB 4H9OA 1KX5A 5B0YB 5B2JA 1KX5D 3B0CW 5CPIB 5FUGB 3UTBD 5AV5B 5CPIA 5FUGA 5CPID 5AV5A 1ID3C 5B0ZC 2HUEB 1BH8B 5KDMB 4E44A 3AZIC 3R45B 5E5AB 1BH8A 5KDMA 3AV1B 1ZLAB 3R45A 3MGPC 3REIB 5E5AA 4J8XB 3UT9D 3W99C 5E5AD 5B1MC 1ZLAA 5DNNA 5JA4B 1ZLAD 5DNND 3AFAB 3AFAA 5G49B 1EQZC 3AFAD 5GSUB 1U35B 5G49A 3VH5W 3LELC 3AZGB 5GSUA 1HQ3B 1U35A 3AZGA 3WAAD 3X1VD 1P3IC 3RELA 1HQ3A 3RELD 2HIOC 2F8NK 4R8PC 1F66B 5DNMC 3AZMB 4XUJC 3AZLC 2BYMB 1F66A 2BYMA 3AZID 2RVQC 2YFVA 4DRBA 1KX4C 4KGCD 1KU5A 5CPJB 3W96B 4J8WC 4X23C 3AZNC 1TZYA 5CPJA 3WA9C 3W96A 1TZYD 5CPJD 3AYWA 3KUYC 3AYWD 4WU9B 3C1CA 1M1AC 4KUDA 5CP6C 5BNXA 3C1CD 4WU9A 4KUDD 4H9NB 3NQJB 4CSRB 5B32C 1P3PB 1ID3D 4KHAB 4H9NA 3NQJA 4CSRA 1P3PA 4KHAA 1P3PD 5B2IA 3MGSC 2AROC 5B2ID 5AV8B 3REJD 4M6BA 1P3BB 5AV8A 3W99D 3AN2B 1S32C 2JSSA 3AN2A 1P3KC 2CV5C 3AN2D 3WTPB 3AV2C 2F8NG 3X1UC 4LD9B 3WTPA 3MVDD 3LELD 3WTPD 3A6NC 4LD9A 3MGRB 1P3AC 1KX3C 3MGRA 3WTPE 3MGRD 3KWQB 5B33A 5B33D 5DNMD 3AZJB 3KWQA 1KX5C 1BH9B 5GXQB 5B2JC 4ZUXB 4Z66B 3AZJA 1BH9A 5GXQA 3MNNA 5B24B 1WWSA 3MNND 5GXQD 4ZUXA 5CPIC 5JRGB 1P3GB 1AOIA 5B24A 1HTAA 5AV5C 1AOID 5B24D 5B32G 1P3FA 1P3FD 3WA9D 2HUEC 3AZKA 3AZKD 2BYKA 3VH6W 3KUYD 4JJNB 3WKJB 1M1AD 5E5AC 1JFIB 4JJNA 3WKJA 4G91C 3MGQD 1ZLAC 5DNNC 3X1SB 3REHA 5BT1D 3REHD 3AFAC 2F8NH 2AROD 5AV9A 5AV9D 3W97B 3WAAC 5GSUC 1U35C 3AZGC 1S32D 3RELC 3W97A 4H9SC 3REKB 2CV5D 3REKA 5AY8B 3AV2D 5B1LB 1F66C 5AY8A 1H3OB 3LJAA 3LJAD 1H3OA 1TZYC 5CPJC 3W96C 5B2JD 3AYWC 5B0YA 5B0YD 3VH5A 3O62B 3C1CC 4KUDC 3B0DB 5AV5D 3O62A 1M18B 4UUZB 4E45A 4AWLB 1P3PC 3B6GB 4H9PB 1M18A 4UUZA 4YM6B 2LY8A 1Q9CA 5B2IC 3B6GA 4H9PA 3REJC 4YM6A 1P34B 5AV8C 3AV1A 4XZQB 1P34A 3AV1D 3REIA 4J8XA 4HGAB 1P34D 3REID 4J8XD 4XZQA 5JA4A 4XZQD 3AN2C 3UTAB 4J8UB 5BS7A 5CHLB 3UTAA 3MVDC 3UTAD 3WTPC 4LD9C 5GSUD 4EO5B 1U35D 3LZ1B 3AZGD 3MGRC 1HQ3D 3LZ1A 5B33C 1P3MB 3KWQC 3AZMA 5C3IB 1F66D 3AZMD 1P3MA 3V9RB 3AZJC 3MNNC 5GXQC 3V9RA 1AOIC 5B24C 4QLCB 1P3FC 3B0CT 1P3LB 4QLCA 3W96D 4QLCD 3AZKC 5AVCB 3LZ0B 1P3LA 4WNNB 5AVCA 3LZ0A 3MGQC 5AVCD 4WU9D 4JJNC 4WNNA 3WKJC 5CPKB 5BT1C 4ZBJB 3REHC 1P3OB 3X1TB 5B40B 5CPKA 1M19B 4YS3B 1P3OA 3X1TA 1P3OD 5AV9C 5BNVB 3X1TD 5AV8D 5BNVA 1P3BA 1P3BD 2FJ7B 3REKC 4J8VB 2FJ7A 5AY8C 3VH6A 4J8VA 4LD9D 4J8VD 3LJAC 4Z2MG 3AZHB 3AZFB 5B1MB 3KWQD 2IO5B 3AZHA 3AZFA 3AZHD 5B0YC 5AV6B 3AZJD 5BO0B 4Z66A 4H9RB 4ZUXD 4Z66D 5AV6A 5AV6D 5BO0A 5JRGA 1P3GA 4H9RA 3O62C 5JRGD 4G92B 1P3GD 4NFTA 3B0DC 4Z5TB 2HIOB 4Z5TA 4AWLC 4R8PB 4YM6C 2HIOA 2L5AA 3AV1C 4JJND 1P34C 3WKJD 3REIC 4J8XC 3W98B 1JFIA 4XZQC 3W98A 1BFMA 4HGAC 3X1SA 3W98D 3X1SD 5BS7C 3UTAC 4DRAA 4X23B 3AZNB 4WU8B 3KXBB 3AZNA 4WU8A 1HQ3C 4CAYB 3W97D 3KXBA 4Z2MH 4EO5C 3LZ1C 2NQBB 1B6WA 4CAYA 3REKD 2CWEA 2NQBA 5B31B 3AZMC 2NQBD 5AY8D 5B1LA 5B31A 5B1LD 5C3IC 5B31D 4QLCC 1ULYA 2PYOB 1P3LC 2PYOA 5AVCC 3LZ0C 4WU9C 3B0BA 3X1UB 3TU4B 4NE6A 3O62D 4WV4B 3TU4A 1P3AB 3TU4D 1KX3B 3AZEB 1M18D 4ZBJC 4H9QB 1P3OC 3X1TC 3B6GD 3AZEA 4NE5A 1B67A 4H9QA 4YM6D 1KX5B 1P3BC 5F99B 3UTBB 2NZDB 1A7WA 5F99A 3UTBA 5F99D 2NZDA 2NZDD 4J8UA 2FJ7C 4J8UD 4J8VC 3UT9B 3LZ1D 4G91B 3UT9A 5DNNB 3AZHC 3AZFC 1P3MD 2YFWB 3NQUB 2IO5C 4ZUXC 4Z66C 2YFWA 5AV6C 3NQUA 5JRGC 1P3GC 3WAAB 3X1VB 4G92C 3RELB 3C1BB 3WAAA 3X1VA 3B6FB 4Z5TC 5GT3B 1P3LD 3C1BA 4H9SA 5AVBB 3B6FA 3C1BD 5GT3A 3LZ0D 3B6FD 5GT3D 5GT0B 5AVBA 5AVBD 2YFVB 5GT0A 3W98C 4KGCB 5CPKD 5GT0D 3X1SC 1M19A 5B40A 4KGCA 1M19D 5B40D 4YS3A 4YS3D 4WZSB 1TZYB 3AYWB 3W97C 4WU8C 4NE3A 3KXBC 3C1CB 4KUDB 5BNXB 3VH5T 1ID3B 2NQBC 1TAFB 5B0ZB 1R4VA 1ID3A 2FJ7D 5B1LC 1TAFA 5B31C 5B0ZA 3AZIB 5B0ZD 5B2IB 3AZIA 3REJB 3MGPB 3W99B
chains in the Genus database with same CATH superfamily
3REJA 3MGPA 3W99A 3MGPD 2Y2OA 5B1MA 3AZFD 5B1MD 2Y2JA 1EQZB 2PYOC 2W8SA 1EQZA 3MVDB 3LELB 1EQZD 3TU4C 3MVDA 3LELA 1P3IB 1M18C 3B6GC 1P3IA 4Z5TD 3A1IA 5B33B 5DNMB 3AZEC 1P3ID 2F8NB 4XUJB 3AZLB 2HIOD 4R8PA 5DNMA 4R8PD 2F8NA 4XUJA 3AZLA 2F8ND 3FDDA 4XUJD 3AZLD 3MNNB 2J8PA 1KX4B 5F99C 3UTBC 1AOIB 2NZDC 2RVQD 1KX4A 4J8WB 1KX4D 3KSYA 4J8UC 1P3FB 3WA9B 2Y2IA 4J8WA 4X23A 1F1EA 5B31G 4J8WD 4X23D 3AZKB 3KUYB 3AZND 3WA9A 2BYKB 4WU8D 3KXBD 1M1AB 3KUYA 5CP6B 3MGQB 5B32B 1M1AA 5CP6A 3UT9C 3MGQA 5CP6D 1P3MC 5B32A 1N1JB 3REHB 5B32D 3MGSB 2AROB 1N1JA 2XD1A 5AV9B 3MGSA 2AROA 3MGSD 1S32B 3X1VC 1S32A 1P3KB 2CV5B 3C1BC 3AV2B 3B6FC 1P3KA 2CV5A 5GT3C 2PYOD 1P3KD 1WWIA 5AVBC 3A6NB 3AV2A 3X1UA 3X1UD 5CPKC 3VH6T 5GT0C 3A6NA 1P3AA 3A6ND 1KX3A 1P3AD 1M19C 5B40C 1KX3D 4KGCC 3LJAB 4YS3C 3AZED 4H9OB 5B2JB 2Y2MA 4H9OA 1KX5A 5B0YB 5B2JA 1KX5D 3B0CW 5CPIB 5FUGB 3UTBD 5AV5B 5CPIA 5FUGA 5CPID 5AV5A 1ID3C 5B0ZC 2HUEB 1BH8B 5KDMB 4E44A 3AZIC 3KFUG 3R45B 5E5AB 1BH8A 5KDMA 3AV1B 1ZLAB 3R45A 3MGPC 3REIB 5E5AA 4J8XB 3UT9D 3W99C 5E5AD 5B1MC 1ZLAA 5DNNA 5JA4B 1ZLAD 5DNND 3AFAB 3AFAA 5G49B 1EQZC 3AFAD 5GSUB 3EPLA 1U35B 5G49A 3VH5W 3LELC 3AZGB 5GSUA 1HQ3B 1U35A 3AZGA 2XD5A 3X1VD 3WAAD 1P3IC 3RELA 1HQ3A 3RELD 2HIOC 2F8NK 4R8PC 1F66B 5DNMC 3EPKA 3AZMB 4XUJC 3AZLC 2BYMB 1F66A 2BYMA 3AZID 2RVQC 2YFVA 3F6TA 4DRBA 1KX4C 4KGCD 1KU5A 5CPJB 2JCHA 3W96B 3H0RC 4X23C 4J8WC 3AZNC 1TZYA 5CPJA 3WA9C 3W96A 1TZYD 5CPJD 3AYWA 3KUYC 3AYWD 4WU9B 3C1CA 3IP4C 1M1AC 4KUDA 5CP6C 5BNXA 3C1CD 4WU9A 4KUDD 4H9NB 3NQJB 4CSRB 5B32C 1P3PB 1ID3D 4KHAB 2F2AC 4H9NA 3NQJA 4CSRA 1P3PA 4KHAA 1P3PD 5B2IA 3MGSC 2AROC 5B2ID 5AV8B 2ZY4A 3REJD 4M6BA 1P3BB 5AV8A 3W99D 3AN2B 1S32C 3H0MC 3EPJA 2ZY5A 2JSSA 2Y2PA 3AN2A 1P3KC 2CV5C 3AN2D 3WTPB 3AV2C 2F8NG 3X1UC 4LD9B 3WTPA 3MVDD 3LELD 3WTPD 3A6NC 4LD9A 3MGRB 1P3AC 1KX3C 3MGRA 3WTPE 2JE5A 3MGRD 3KWQB 5B33A 5B33D 5DNMD 3AZJB 3KWQA 1KX5C 1BH9B 5GXQB 5B2JC 4ZUXB 4Z66B 3AZJA 1BH9A 5GXQA 3MNNA 5B24B 1WWSA 3MNND 5GXQD 4ZUXA 5CPIC 5JRGB 1P3GB 1AOIA 5B24A 1HTAA 5AV5C 1AOID 5B24D 5B32G 1P3FA 1P3FD 3WA9D 2HUEC 3AZKA 3AZKD 2BYKA 3VH6W 3KUYD 4JJNB 3WKJB 1M1AD 5E5AC 1JFIB 4JJNA 3WKJA 4G91C 3MGQD 1ZLAC 5DNNC 3X1SB 3REHA 5BT1D 3REHD 2Y2NA 3AFAC 2F8NH 2AROD 5AV9A 5AV9D 3W97B 3WAAC 5GSUC 1U35C 3AZGC 1S32D 3RELC 3W97A 4H9SC 3REKB 2DF4C 2CV5D 3REKA 5AY8B 3AV2D 5B1LB 1F66C 5AY8A 1H3OB 3LJAA 3LJAD 1H3OA 1TZYC 5CPJC 3W96C 5B2JD 3AYWC 5B0YA 5B0YD 3VH5A 3O62B 3C1CC 4KUDC 2DQNC 3B0DB 5AV5D 3O62A 4UPKA 1M18B 4UUZB 4E45A 4AWLB 1P3PC 3B6GB 4H9PB 1M18A 4UUZA 4YM6B 2LY8A 1Q9CA 5B2IC 3B6GA 4H9PA 3REJC 4YM6A 1P34B 2Y2QA 5AV8C 3AV1A 4XZQB 1P34A 3AV1D 3REIA 4J8XA 4HGAB 1P34D 3REID 4J8XD 4XZQA 5JA4A 4XZQD 3AN2C 3UTAB 4J8UB 5BS7A 5CHLB 3UTAA 3MVDC 3UTAD 3WTPC 4LD9C 5GSUD 4EO5B 1U35D 3LZ1B 3AZGD 3MGRC 1HQ3D 2UWXA 3LZ1A 5B33C 2Y2GA 1P3MB 3KWQC 3AZMA 5C3IB 1F66D 2G5IC 3AZMD 1P3MA 3V9RB 3AZJC 3MNNC 5GXQC 3EPHA 3V9RA 1AOIC 5B24C 4QLCB 1P3FC 3B0CT 1P3LB 4QLCA 3W96D 4QLCD 3AZKC 5AVCB 3LZ0B 1P3LA 4WNNB 5AVCA 3LZ0A 3MGQC 5AVCD 4WU9D 2Y2LA 4WNNA 4JJNC 3WKJC 5CPKB 5BT1C 4ZBJB 3REHC 1P3OB 3X1TB 5B40B 5CPKA 1M19B 4YS3B 1P3OA 3X1TA 1P3OD 5AV9C 5BNVB 3X1TD 5AV8D 5BNVA 1P3BA 3A1KA 1P3BD 2FFFB 2FJ7B 3REKC 4J8VB 2FJ7A 5AY8C 3VH6A 4J8VA 4LD9D 4J8VD 3LJAC 4Z2MG 3AZHB 1T3UA 2RIQA 3AZFB 5B1MB 3KWQD 2IO5B 3AZHA 3AZFA 3AZHD 5B0YC 5AV6B 3AZJD 5BO0B 4Z66A 4H9RB 4ZUXD 4Z66D 5AV6A 5AV6D 5BO0A 5JRGA 1P3GA 4H9RA 3O62C 5JRGD 4G92B 1P3GD 4NFTA 3B0DC 4Z5TB 4WJ3C 2HIOB 4Z5TA 4AWLC 4R8PB 4YM6C 2HIOA 2L5AA 3AV1C 4JJND 1P34C 3WKJD 3REIC 4J8XC 3W98B 1JFIA 4XZQC 2BG1A 3W98A 1BFMA 4HGAC 3X1SA 3W98D 3X1SD 5BS7C 3UTAC 4DRAA 4X23B 2Y2KA 3AZNB 4WU8B 1PZRA 3KXBB 3AZNA 3EG5B 4WU8A 1HQ3C 4CAYB 3W97D 3KXBA 4Z2MH 4EO5C 3LZ1C 2NQBB 1B6WA 4CAYA 3H0LC 3REKD 2CWEA 2NQBA 5B31B 3AZMC 2NQBD 5AY8D 5B1LA 5B31A 5B1LD 5C3IC 5B31D 4QLCC 1W2EA 1ULYA 2PYOB 1P3LC 2ZY3A 2PYOA 5AVCC 3LZ0C 4WU9C 2G5HC 3B0BA 3X1UB 3TU4B 4NE6A 3O62D 4WV4B 3TU4A 1P3AB 3TU4D 1KX3B 3AZEB 1M18D 4ZBJC 4H9QB 1P3OC 3X1TC 3B6GD 3AZEA 4NE5A 1B67A 4H9QA 4YM6D 1KX5B 1P3BC 5F99B 3UTBB 2NZDB 1A7WA 5F99A 3UTBA 5F99D 2NZDA 2NZDD 4J8UA 2FJ7C 4J8UD 4J8VC 2ZM5A 3UT9B 3LZ1D 3P5JB 4G91B 3UT9A 5DNNB 3AZHC 3AZFC 1P3MD 2ZY2A 2YFWB 3NQUB 2IO5C 4ZUXC 4Z66C 2YFWA 5AV6C 3NQUA 5JRGC 1P3GC 3WAAB 3X1VB 4G92C 2VQRA 3RELB 3C1BB 3WAAA 3X1VA 3B6FB 4Z5TC 5GT3B 4DQYB 1P3LD 3C1BA 4H9SA 5AVBB 3B6FA 3C1BD 5GT3A 3LZ0D 3B6FD 5GT3D 5GT0B 5AVBA 5AVBD 2YFVB 5GT0A 3W98C 4KGCB 5CPKD 5GT0D 3X1SC 1M19A 5B40A 4KGCA 1M19D 5B40D 4YS3A 4YS3D 4WZSB 1TZYB 3AYWB 3W97C 3AL0C 4WU8C 4NE3A 3KXBC 3C1CB 4KUDB 5BNXB 3VH5T 1ID3B 2NQBC 1TAFB 5B0ZB 2Y2HA 1R4VA 1ID3A 2FJ7D 5B1LC 1TAFA 5B31C 5B0ZA 3AZIB 5B0ZD 5B2IB 1Z2CB 3AZIA 3REJB 3MGPB 3W99B
chains in the Genus database with same CATH topology
3REJA 3MGPA 3W99A 3MGPD 2Y2OA 5B1MA 3AZFD 5B1MD 2Y2JA 1EQZB 2PYOC 2W8SA 1EQZA 3MVDB 3LELB 1EQZD 3TU4C 3MVDA 3LELA 1P3IB 1M18C 3B6GC 1P3IA 4Z5TD 3A1IA 5B33B 5DNMB 3AZEC 1P3ID 2F8NB 4XUJB 3AZLB 2HIOD 4R8PA 5DNMA 4R8PD 2F8NA 4XUJA 3AZLA 2F8ND 3FDDA 4XUJD 3AZLD 3MNNB 2J8PA 1KX4B 5F99C 3UTBC 1AOIB 2NZDC 2RVQD 1KX4A 4J8WB 1KX4D 3KSYA 4J8UC 1P3FB 3WA9B 2Y2IA 4J8WA 4X23A 1F1EA 5B31G 4J8WD 4X23D 3AZKB 3KUYB 3AZND 3WA9A 2BYKB 4WU8D 3KXBD 1M1AB 3KUYA 5CP6B 3MGQB 5B32B 1M1AA 5CP6A 3UT9C 3MGQA 5CP6D 1P3MC 5B32A 1N1JB 3REHB 5B32D 3MGSB 2AROB 1N1JA 2XD1A 5AV9B 3MGSA 2AROA 3MGSD 1S32B 3X1VC 1S32A 1P3KB 2CV5B 3C1BC 3AV2B 3B6FC 1P3KA 2CV5A 5GT3C 2PYOD 1P3KD 1WWIA 5AVBC 3A6NB 3AV2A 3X1UA 3X1UD 5CPKC 3VH6T 5GT0C 3A6NA 1P3AA 3A6ND 1KX3A 1P3AD 1M19C 5B40C 1KX3D 4KGCC 3LJAB 4YS3C 3AZED 4H9OB 5B2JB 2Y2MA 4H9OA 1KX5A 5B0YB 5B2JA 1KX5D 3B0CW 5CPIB 5FUGB 3UTBD 5AV5B 5CPIA 5FUGA 5CPID 5AV5A 1ID3C 5B0ZC 2HUEB 1BH8B 5KDMB 4E44A 3AZIC 3KFUG 3R45B 5E5AB 1BH8A 5KDMA 3AV1B 1ZLAB 3R45A 3MGPC 3REIB 5E5AA 4J8XB 3UT9D 3W99C 5E5AD 5B1MC 1ZLAA 5DNNA 5JA4B 1ZLAD 5DNND 3AFAB 3AFAA 5G49B 1EQZC 3AFAD 5GSUB 3EPLA 1U35B 5G49A 3VH5W 3LELC 3AZGB 5GSUA 1HQ3B 1U35A 3AZGA 2XD5A 3X1VD 3WAAD 1P3IC 3RELA 1HQ3A 3RELD 2HIOC 2F8NK 4R8PC 1F66B 5DNMC 3EPKA 3AZMB 4XUJC 3AZLC 2BYMB 1F66A 2BYMA 3AZID 2RVQC 2YFVA 3F6TA 4DRBA 1KX4C 4KGCD 1KU5A 5CPJB 2JCHA 3W96B 3H0RC 4X23C 4J8WC 3AZNC 1TZYA 5CPJA 3WA9C 3W96A 1TZYD 5CPJD 3AYWA 3KUYC 3AYWD 4WU9B 3C1CA 3IP4C 1M1AC 4KUDA 5CP6C 5BNXA 3C1CD 4WU9A 4KUDD 4H9NB 3NQJB 4CSRB 5B32C 1P3PB 1ID3D 4KHAB 2F2AC 4H9NA 3NQJA 4CSRA 1P3PA 4KHAA 1P3PD 5B2IA 3MGSC 2AROC 5B2ID 5AV8B 2ZY4A 3REJD 4M6BA 1P3BB 5AV8A 3W99D 3AN2B 1S32C 3H0MC 3EPJA 2ZY5A 2JSSA 2Y2PA 3AN2A 1P3KC 2CV5C 3AN2D 3WTPB 3AV2C 2F8NG 3X1UC 4LD9B 3WTPA 3MVDD 3LELD 3WTPD 3A6NC 4LD9A 3MGRB 1P3AC 1KX3C 3MGRA 3WTPE 2JE5A 3MGRD 3KWQB 5B33A 5B33D 5DNMD 3AZJB 3KWQA 1KX5C 1BH9B 5GXQB 5B2JC 4ZUXB 4Z66B 3AZJA 1BH9A 5GXQA 3MNNA 5B24B 1WWSA 3MNND 5GXQD 4ZUXA 5CPIC 5JRGB 1P3GB 1AOIA 5B24A 1HTAA 5AV5C 1AOID 5B24D 5B32G 1P3FA 1P3FD 3WA9D 2HUEC 3AZKA 3AZKD 2BYKA 3VH6W 3KUYD 4JJNB 3WKJB 1M1AD 5E5AC 1JFIB 4JJNA 3WKJA 4G91C 3MGQD 1ZLAC 5DNNC 3X1SB 3REHA 5BT1D 3REHD 2Y2NA 3AFAC 2F8NH 2AROD 5AV9A 5AV9D 3W97B 3WAAC 5GSUC 1U35C 3AZGC 1S32D 3RELC 3W97A 4H9SC 3REKB 2DF4C 2CV5D 3REKA 5AY8B 3AV2D 5B1LB 1F66C 5AY8A 1H3OB 3LJAA 3LJAD 1H3OA 1TZYC 5CPJC 3W96C 5B2JD 3AYWC 5B0YA 5B0YD 3VH5A 3O62B 3C1CC 4KUDC 2DQNC 3B0DB 5AV5D 3O62A 4UPKA 1M18B 4UUZB 4E45A 4AWLB 1P3PC 3B6GB 4H9PB 1M18A 4UUZA 4YM6B 2LY8A 1Q9CA 5B2IC 3B6GA 4H9PA 3REJC 4YM6A 1P34B 2Y2QA 5AV8C 3AV1A 4XZQB 1P34A 3AV1D 3REIA 4J8XA 4HGAB 1P34D 3REID 4J8XD 4XZQA 5JA4A 4XZQD 3AN2C 3UTAB 4J8UB 5BS7A 5CHLB 3UTAA 3MVDC 3UTAD 3WTPC 4LD9C 5GSUD 4EO5B 1U35D 3LZ1B 3AZGD 3MGRC 1HQ3D 2UWXA 3LZ1A 5B33C 2Y2GA 1P3MB 3KWQC 3AZMA 5C3IB 1F66D 2G5IC 3AZMD 1P3MA 3V9RB 3AZJC 3MNNC 5GXQC 3EPHA 3V9RA 1AOIC 5B24C 4QLCB 1P3FC 3B0CT 1P3LB 4QLCA 3W96D 4QLCD 3AZKC 5AVCB 3LZ0B 1P3LA 4WNNB 5AVCA 3LZ0A 3MGQC 5AVCD 4WU9D 2Y2LA 4WNNA 4JJNC 3WKJC 5CPKB 5BT1C 4ZBJB 3REHC 1P3OB 3X1TB 5B40B 5CPKA 1M19B 4YS3B 1P3OA 3X1TA 1P3OD 5AV9C 5BNVB 3X1TD 5AV8D 5BNVA 1P3BA 3A1KA 1P3BD 2FFFB 2FJ7B 3REKC 4J8VB 2FJ7A 5AY8C 3VH6A 4J8VA 4LD9D 4J8VD 3LJAC 4Z2MG 3AZHB 1T3UA 2RIQA 3AZFB 5B1MB 3KWQD 2IO5B 3AZHA 3AZFA 3AZHD 5B0YC 5AV6B 3AZJD 5BO0B 4Z66A 4H9RB 4ZUXD 4Z66D 5AV6A 5AV6D 5BO0A 5JRGA 1P3GA 4H9RA 3O62C 5JRGD 4G92B 1P3GD 4NFTA 3B0DC 4Z5TB 4WJ3C 2HIOB 4Z5TA 4AWLC 4R8PB 4YM6C 2HIOA 2L5AA 3AV1C 4JJND 1P34C 3WKJD 3REIC 4J8XC 3W98B 1JFIA 4XZQC 2BG1A 3W98A 1BFMA 4HGAC 3X1SA 3W98D 3X1SD 5BS7C 3UTAC 4DRAA 4X23B 2Y2KA 3AZNB 4WU8B 1PZRA 3KXBB 3AZNA 3EG5B 4WU8A 1HQ3C 4CAYB 3W97D 3KXBA 4Z2MH 4EO5C 3LZ1C 2NQBB 1B6WA 4CAYA 3H0LC 3REKD 2CWEA 2NQBA 5B31B 3AZMC 2NQBD 5AY8D 5B1LA 5B31A 5B1LD 5C3IC 5B31D 4QLCC 1W2EA 1ULYA 2PYOB 1P3LC 2ZY3A 2PYOA 5AVCC 3LZ0C 4WU9C 2G5HC 3B0BA 3X1UB 3TU4B 4NE6A 3O62D 4WV4B 3TU4A 1P3AB 3TU4D 1KX3B 3AZEB 1M18D 4ZBJC 4H9QB 1P3OC 3X1TC 3B6GD 3AZEA 4NE5A 1B67A 4H9QA 4YM6D 1KX5B 1P3BC 5F99B 3UTBB 2NZDB 1A7WA 5F99A 3UTBA 5F99D 2NZDA 2NZDD 4J8UA 2FJ7C 4J8UD 4J8VC 2ZM5A 3UT9B 3LZ1D 3P5JB 4G91B 3UT9A 5DNNB 3AZHC 3AZFC 1P3MD 2ZY2A 2YFWB 3NQUB 2IO5C 4ZUXC 4Z66C 2YFWA 5AV6C 3NQUA 5JRGC 1P3GC 3WAAB 3X1VB 4G92C 2VQRA 3RELB 3C1BB 3WAAA 3X1VA 3B6FB 4Z5TC 5GT3B 4DQYB 1P3LD 3C1BA 4H9SA 5AVBB 3B6FA 3C1BD 5GT3A 3LZ0D 3B6FD 5GT3D 5GT0B 5AVBA 5AVBD 2YFVB 5GT0A 3W98C 4KGCB 5CPKD 5GT0D 3X1SC 1M19A 5B40A 4KGCA 1M19D 5B40D 4YS3A 4YS3D 4WZSB 1TZYB 3AYWB 3W97C 3AL0C 4WU8C 4NE3A 3KXBC 3C1CB 4KUDB 5BNXB 3VH5T 1ID3B 2NQBC 1TAFB 5B0ZB 2Y2HA 1R4VA 1ID3A 2FJ7D 5B1LC 1TAFA 5B31C 5B0ZA 3AZIB 5B0ZD 5B2IB 1Z2CB 3AZIA 3REJB 3MGPB 3W99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ A;  3MGP A;  3W99 A;  3MGP D;  5B1M A;  3AZF D;  5B1M D;  1EQZ B;  2PYO C;  1EQZ A;  3MVD B;  3LEL B;  1EQZ D;  3TU4 C;  3MVD A;  3LEL A;  1P3I B;  1M18 C;  3B6G C;  1P3I A;  4Z5T D;  5B33 B;  5DNM B;  3AZE C;  1P3I D;  2F8N B;  4XUJ B;  3AZL B;  2HIO D;  4R8P A;  5DNM A;  4R8P D;  2F8N A;  4XUJ A;  3AZL A;  2F8N D;  4XUJ D;  3AZL D;  3MNN B;  1KX4 B;  5F99 C;  3UTB C;  1AOI B;  2NZD C;  2RVQ D;  1KX4 A;  4J8W B;  1KX4 D;  3KSY A;  4J8U C;  1P3F B;  3WA9 B;  4J8W A;  4X23 A;  1F1E A;  5B31 G;  4J8W D;  4X23 D;  3AZK B;  3KUY B;  3AZN D;  3WA9 A;  2BYK B;  4WU8 D;  3KXB D;  1M1A B;  3KUY A;  5CP6 B;  3MGQ B;  5B32 B;  1M1A A;  5CP6 A;  3UT9 C;  3MGQ A;  5CP6 D;  1P3M C;  5B32 A;  1N1J B;  3REH B;  5B32 D;  3MGS B;  2ARO B;  1N1J A;  5AV9 B;  3MGS A;  2ARO A;  3MGS D;  1S32 B;  3X1V C;  1S32 A;  1P3K B;  2CV5 B;  3C1B C;  3AV2 B;  3B6F C;  1P3K A;  2CV5 A;  5GT3 C;  2PYO D;  1P3K D;  1WWI A;  5AVB C;  3A6N B;  3AV2 A;  3X1U A;  3X1U D;  5CPK C;  3VH6 T;  5GT0 C;  3A6N A;  1P3A A;  3A6N D;  1KX3 A;  1P3A D;  1M19 C;  5B40 C;  1KX3 D;  4KGC C;  3LJA B;  4YS3 C;  3AZE D;  4H9O B;  5B2J B;  4H9O A;  1KX5 A;  5B0Y B;  5B2J A;  1KX5 D;  3B0C W;  5CPI B;  5FUG B;  3UTB D;  5AV5 B;  5CPI A;  5FUG A;  5CPI D;  5AV5 A;  1ID3 C;  5B0Z C;  2HUE B;  1BH8 B;  5KDM B;  4E44 A;  3AZI C;  3R45 B;  5E5A B;  1BH8 A;  5KDM A;  3AV1 B;  1ZLA B;  3R45 A;  3MGP C;  3REI B;  5E5A A;  4J8X B;  3UT9 D;  3W99 C;  5E5A D;  5B1M C;  1ZLA A;  5DNN A;  5JA4 B;  1ZLA D;  5DNN D;  3AFA B;  3AFA A;  5G49 B;  1EQZ C;  3AFA D;  5GSU B;  1U35 B;  5G49 A;  3VH5 W;  3LEL C;  3AZG B;  5GSU A;  1HQ3 B;  1U35 A;  3AZG A;  3WAA D;  3X1V D;  1P3I C;  3REL A;  1HQ3 A;  3REL D;  2HIO C;  2F8N K;  4R8P C;  1F66 B;  5DNM C;  3AZM B;  4XUJ C;  3AZL C;  2BYM B;  1F66 A;  2BYM A;  3AZI D;  2RVQ C;  2YFV A;  4DRB A;  1KX4 C;  4KGC D;  1KU5 A;  5CPJ B;  3W96 B;  4J8W C;  4X23 C;  3AZN C;  1TZY A;  5CPJ A;  3WA9 C;  3W96 A;  1TZY D;  5CPJ D;  3AYW A;  3KUY C;  3AYW D;  4WU9 B;  3C1C A;  1M1A C;  4KUD A;  5CP6 C;  5BNX A;  3C1C D;  4WU9 A;  4KUD D;  4H9N B;  3NQJ B;  4CSR B;  5B32 C;  1P3P B;  1ID3 D;  4KHA B;  4H9N A;  3NQJ A;  4CSR A;  1P3P A;  4KHA A;  1P3P D;  5B2I A;  3MGS C;  2ARO C;  5B2I D;  5AV8 B;  3REJ D;  4M6B A;  1P3B B;  5AV8 A;  3W99 D;  3AN2 B;  1S32 C;  2JSS A;  3AN2 A;  1P3K C;  2CV5 C;  3AN2 D;  3WTP B;  3AV2 C;  2F8N G;  3X1U C;  4LD9 B;  3WTP A;  3MVD D;  3LEL D;  3WTP D;  3A6N C;  4LD9 A;  3MGR B;  1P3A C;  1KX3 C;  3MGR A;  3WTP E;  3MGR D;  3KWQ B;  5B33 A;  5B33 D;  5DNM D;  3AZJ B;  3KWQ A;  1KX5 C;  1BH9 B;  5GXQ B;  5B2J C;  4ZUX B;  4Z66 B;  3AZJ A;  1BH9 A;  5GXQ A;  3MNN A;  5B24 B;  1WWS A;  3MNN D;  5GXQ D;  4ZUX A;  5CPI C;  5JRG B;  1P3G B;  1AOI A;  5B24 A;  1HTA A;  5AV5 C;  1AOI D;  5B24 D;  5B32 G;  1P3F A;  1P3F D;  3WA9 D;  2HUE C;  3AZK A;  3AZK D;  2BYK A;  3VH6 W;  3KUY D;  4JJN B;  3WKJ B;  1M1A D;  5E5A C;  1JFI B;  4JJN A;  3WKJ A;  4G91 C;  3MGQ D;  1ZLA C;  5DNN C;  3X1S B;  3REH A;  5BT1 D;  3REH D;  3AFA C;  2F8N H;  2ARO D;  5AV9 A;  5AV9 D;  3W97 B;  3WAA C;  5GSU C;  1U35 C;  3AZG C;  1S32 D;  3REL C;  3W97 A;  4H9S C;  3REK B;  2CV5 D;  3REK A;  5AY8 B;  3AV2 D;  5B1L B;  1F66 C;  5AY8 A;  1H3O B;  3LJA A;  3LJA D;  1H3O A;  1TZY C;  5CPJ C;  3W96 C;  5B2J D;  3AYW C;  5B0Y A;  5B0Y D;  3VH5 A;  3O62 B;  3C1C C;  4KUD C;  3B0D B;  5AV5 D;  3O62 A;  1M18 B;  4UUZ B;  4E45 A;  4AWL B;  1P3P C;  3B6G B;  4H9P B;  1M18 A;  4UUZ A;  4YM6 B;  2LY8 A;  1Q9C A;  5B2I C;  3B6G A;  4H9P A;  3REJ C;  4YM6 A;  1P34 B;  5AV8 C;  3AV1 A;  4XZQ B;  1P34 A;  3AV1 D;  3REI A;  4J8X A;  4HGA B;  1P34 D;  3REI D;  4J8X D;  4XZQ A;  5JA4 A;  4XZQ D;  3AN2 C;  3UTA B;  4J8U B;  5BS7 A;  5CHL B;  3UTA A;  3MVD C;  3UTA D;  3WTP C;  4LD9 C;  5GSU D;  4EO5 B;  1U35 D;  3LZ1 B;  3AZG D;  3MGR C;  1HQ3 D;  3LZ1 A;  5B33 C;  1P3M B;  3KWQ C;  3AZM A;  5C3I B;  1F66 D;  3AZM D;  1P3M A;  3V9R B;  3AZJ C;  3MNN C;  5GXQ C;  3V9R A;  1AOI C;  5B24 C;  4QLC B;  1P3F C;  3B0C T;  1P3L B;  4QLC A;  3W96 D;  4QLC D;  3AZK C;  5AVC B;  3LZ0 B;  1P3L A;  4WNN B;  5AVC A;  3LZ0 A;  3MGQ C;  5AVC D;  4WU9 D;  4JJN C;  4WNN A;  3WKJ C;  5CPK B;  5BT1 C;  4ZBJ B;  3REH C;  1P3O B;  3X1T B;  5B40 B;  5CPK A;  1M19 B;  4YS3 B;  1P3O A;  3X1T A;  1P3O D;  5AV9 C;  5BNV B;  3X1T D;  5AV8 D;  5BNV A;  1P3B A;  1P3B D;  2FJ7 B;  3REK C;  4J8V B;  2FJ7 A;  5AY8 C;  3VH6 A;  4J8V A;  4LD9 D;  4J8V D;  3LJA C;  4Z2M G;  3AZH B;  3AZF B;  5B1M B;  3KWQ D;  2IO5 B;  3AZH A;  3AZF A;  3AZH D;  5B0Y C;  5AV6 B;  3AZJ D;  5BO0 B;  4Z66 A;  4H9R B;  4ZUX D;  4Z66 D;  5AV6 A;  5AV6 D;  5BO0 A;  5JRG A;  1P3G A;  4H9R A;  3O62 C;  5JRG D;  4G92 B;  1P3G D;  4NFT A;  3B0D C;  4Z5T B;  2HIO B;  4Z5T A;  4AWL C;  4R8P B;  4YM6 C;  2HIO A;  2L5A A;  3AV1 C;  4JJN D;  1P34 C;  3WKJ D;  3REI C;  4J8X C;  3W98 B;  1JFI A;  4XZQ C;  3W98 A;  1BFM A;  4HGA C;  3X1S A;  3W98 D;  3X1S D;  5BS7 C;  3UTA C;  4DRA A;  4X23 B;  3AZN B;  4WU8 B;  3KXB B;  3AZN A;  4WU8 A;  1HQ3 C;  4CAY B;  3W97 D;  3KXB A;  4Z2M H;  4EO5 C;  3LZ1 C;  2NQB B;  1B6W A;  4CAY A;  3REK D;  2CWE A;  2NQB A;  5B31 B;  3AZM C;  2NQB D;  5AY8 D;  5B1L A;  5B31 A;  5B1L D;  5C3I C;  5B31 D;  4QLC C;  1ULY A;  2PYO B;  1P3L C;  2PYO A;  5AVC C;  3LZ0 C;  4WU9 C;  3B0B A;  3X1U B;  3TU4 B;  4NE6 A;  3O62 D;  4WV4 B;  3TU4 A;  1P3A B;  3TU4 D;  1KX3 B;  3AZE B;  1M18 D;  4ZBJ C;  4H9Q B;  1P3O C;  3X1T C;  3B6G D;  3AZE A;  4NE5 A;  1B67 A;  4H9Q A;  4YM6 D;  1KX5 B;  1P3B C;  5F99 B;  3UTB B;  2NZD B;  1A7W A;  5F99 A;  3UTB A;  5F99 D;  2NZD A;  2NZD D;  4J8U A;  2FJ7 C;  4J8U D;  4J8V C;  3UT9 B;  3LZ1 D;  4G91 B;  3UT9 A;  5DNN B;  3AZH C;  3AZF C;  1P3M D;  2YFW B;  3NQU B;  2IO5 C;  4ZUX C;  4Z66 C;  2YFW A;  5AV6 C;  3NQU A;  5JRG C;  1P3G C;  3WAA B;  3X1V B;  4G92 C;  3REL B;  3C1B B;  3WAA A;  3X1V A;  3B6F B;  4Z5T C;  5GT3 B;  1P3L D;  3C1B A;  4H9S A;  5AVB B;  3B6F A;  3C1B D;  5GT3 A;  3LZ0 D;  3B6F D;  5GT3 D;  5GT0 B;  5AVB A;  5AVB D;  2YFV B;  5GT0 A;  3W98 C;  4KGC B;  5CPK D;  5GT0 D;  3X1S C;  1M19 A;  5B40 A;  4KGC A;  1M19 D;  5B40 D;  4YS3 A;  4YS3 D;  4WZS B;  1TZY B;  3AYW B;  3W97 C;  4WU8 C;  4NE3 A;  3KXB C;  3C1C B;  4KUD B;  5BNX B;  3VH5 T;  1ID3 B;  2NQB C;  1TAF B;  5B0Z B;  1R4V A;  1ID3 A;  2FJ7 D;  5B1L C;  1TAF A;  5B31 C;  5B0Z A;  3AZI B;  5B0Z D;  5B2I B;  3AZI A;  3REJ B;  3MGP B;  3W99 B; 
#chains in the Genus database with same CATH topology
 3REJ A;  3MGP A;  3W99 A;  3MGP D;  2Y2O A;  5B1M A;  3AZF D;  5B1M D;  2Y2J A;  1EQZ B;  2PYO C;  2W8S A;  1EQZ A;  3MVD B;  3LEL B;  1EQZ D;  3TU4 C;  3MVD A;  3LEL A;  1P3I B;  1M18 C;  3B6G C;  1P3I A;  4Z5T D;  3A1I A;  5B33 B;  5DNM B;  3AZE C;  1P3I D;  2F8N B;  4XUJ B;  3AZL B;  2HIO D;  4R8P A;  5DNM A;  4R8P D;  2F8N A;  4XUJ A;  3AZL A;  2F8N D;  3FDD A;  4XUJ D;  3AZL D;  3MNN B;  2J8P A;  1KX4 B;  5F99 C;  3UTB C;  1AOI B;  2NZD C;  2RVQ D;  1KX4 A;  4J8W B;  1KX4 D;  3KSY A;  4J8U C;  1P3F B;  3WA9 B;  2Y2I A;  4J8W A;  4X23 A;  1F1E A;  5B31 G;  4J8W D;  4X23 D;  3AZK B;  3KUY B;  3AZN D;  3WA9 A;  2BYK B;  4WU8 D;  3KXB D;  1M1A B;  3KUY A;  5CP6 B;  3MGQ B;  5B32 B;  1M1A A;  5CP6 A;  3UT9 C;  3MGQ A;  5CP6 D;  1P3M C;  5B32 A;  1N1J B;  3REH B;  5B32 D;  3MGS B;  2ARO B;  1N1J A;  2XD1 A;  5AV9 B;  3MGS A;  2ARO A;  3MGS D;  1S32 B;  3X1V C;  1S32 A;  1P3K B;  2CV5 B;  3C1B C;  3AV2 B;  3B6F C;  1P3K A;  2CV5 A;  5GT3 C;  2PYO D;  1P3K D;  1WWI A;  5AVB C;  3A6N B;  3AV2 A;  3X1U A;  3X1U D;  5CPK C;  3VH6 T;  5GT0 C;  3A6N A;  1P3A A;  3A6N D;  1KX3 A;  1P3A D;  1M19 C;  5B40 C;  1KX3 D;  4KGC C;  3LJA B;  4YS3 C;  3AZE D;  4H9O B;  5B2J B;  2Y2M A;  4H9O A;  1KX5 A;  5B0Y B;  5B2J A;  1KX5 D;  3B0C W;  5CPI B;  5FUG B;  3UTB D;  5AV5 B;  5CPI A;  5FUG A;  5CPI D;  5AV5 A;  1ID3 C;  5B0Z C;  2HUE B;  1BH8 B;  5KDM B;  4E44 A;  3AZI C;  3KFU G;  3R45 B;  5E5A B;  1BH8 A;  5KDM A;  3AV1 B;  1ZLA B;  3R45 A;  3MGP C;  3REI B;  5E5A A;  4J8X B;  3UT9 D;  3W99 C;  5E5A D;  5B1M C;  1ZLA A;  5DNN A;  5JA4 B;  1ZLA D;  5DNN D;  3AFA B;  3AFA A;  5G49 B;  1EQZ C;  3AFA D;  5GSU B;  3EPL A;  1U35 B;  5G49 A;  3VH5 W;  3LEL C;  3AZG B;  5GSU A;  1HQ3 B;  1U35 A;  3AZG A;  2XD5 A;  3X1V D;  3WAA D;  1P3I C;  3REL A;  1HQ3 A;  3REL D;  2HIO C;  2F8N K;  4R8P C;  1F66 B;  5DNM C;  3EPK A;  3AZM B;  4XUJ C;  3AZL C;  2BYM B;  1F66 A;  2BYM A;  3AZI D;  2RVQ C;  2YFV A;  3F6T A;  4DRB A;  1KX4 C;  4KGC D;  1KU5 A;  5CPJ B;  2JCH A;  3W96 B;  3H0R C;  4X23 C;  4J8W C;  3AZN C;  1TZY A;  5CPJ A;  3WA9 C;  3W96 A;  1TZY D;  5CPJ D;  3AYW A;  3KUY C;  3AYW D;  4WU9 B;  3C1C A;  3IP4 C;  1M1A C;  4KUD A;  5CP6 C;  5BNX A;  3C1C D;  4WU9 A;  4KUD D;  4H9N B;  3NQJ B;  4CSR B;  5B32 C;  1P3P B;  1ID3 D;  4KHA B;  2F2A C;  4H9N A;  3NQJ A;  4CSR A;  1P3P A;  4KHA A;  1P3P D;  5B2I A;  3MGS C;  2ARO C;  5B2I D;  5AV8 B;  2ZY4 A;  3REJ D;  4M6B A;  1P3B B;  5AV8 A;  3W99 D;  3AN2 B;  1S32 C;  3H0M C;  3EPJ A;  2ZY5 A;  2JSS A;  2Y2P A;  3AN2 A;  1P3K C;  2CV5 C;  3AN2 D;  3WTP B;  3AV2 C;  2F8N G;  3X1U C;  4LD9 B;  3WTP A;  3MVD D;  3LEL D;  3WTP D;  3A6N C;  4LD9 A;  3MGR B;  1P3A C;  1KX3 C;  3MGR A;  3WTP E;  2JE5 A;  3MGR D;  3KWQ B;  5B33 A;  5B33 D;  5DNM D;  3AZJ B;  3KWQ A;  1KX5 C;  1BH9 B;  5GXQ B;  5B2J C;  4ZUX B;  4Z66 B;  3AZJ A;  1BH9 A;  5GXQ A;  3MNN A;  5B24 B;  1WWS A;  3MNN D;  5GXQ D;  4ZUX A;  5CPI C;  5JRG B;  1P3G B;  1AOI A;  5B24 A;  1HTA A;  5AV5 C;  1AOI D;  5B24 D;  5B32 G;  1P3F A;  1P3F D;  3WA9 D;  2HUE C;  3AZK A;  3AZK D;  2BYK A;  3VH6 W;  3KUY D;  4JJN B;  3WKJ B;  1M1A D;  5E5A C;  1JFI B;  4JJN A;  3WKJ A;  4G91 C;  3MGQ D;  1ZLA C;  5DNN C;  3X1S B;  3REH A;  5BT1 D;  3REH D;  2Y2N A;  3AFA C;  2F8N H;  2ARO D;  5AV9 A;  5AV9 D;  3W97 B;  3WAA C;  5GSU C;  1U35 C;  3AZG C;  1S32 D;  3REL C;  3W97 A;  4H9S C;  3REK B;  2DF4 C;  2CV5 D;  3REK A;  5AY8 B;  3AV2 D;  5B1L B;  1F66 C;  5AY8 A;  1H3O B;  3LJA A;  3LJA D;  1H3O A;  1TZY C;  5CPJ C;  3W96 C;  5B2J D;  3AYW C;  5B0Y A;  5B0Y D;  3VH5 A;  3O62 B;  3C1C C;  4KUD C;  2DQN C;  3B0D B;  5AV5 D;  3O62 A;  4UPK A;  1M18 B;  4UUZ B;  4E45 A;  4AWL B;  1P3P C;  3B6G B;  4H9P B;  1M18 A;  4UUZ A;  4YM6 B;  2LY8 A;  1Q9C A;  5B2I C;  3B6G A;  4H9P A;  3REJ C;  4YM6 A;  1P34 B;  2Y2Q A;  5AV8 C;  3AV1 A;  4XZQ B;  1P34 A;  3AV1 D;  3REI A;  4J8X A;  4HGA B;  1P34 D;  3REI D;  4J8X D;  4XZQ A;  5JA4 A;  4XZQ D;  3AN2 C;  3UTA B;  4J8U B;  5BS7 A;  5CHL B;  3UTA A;  3MVD C;  3UTA D;  3WTP C;  4LD9 C;  5GSU D;  4EO5 B;  1U35 D;  3LZ1 B;  3AZG D;  3MGR C;  1HQ3 D;  2UWX A;  3LZ1 A;  5B33 C;  2Y2G A;  1P3M B;  3KWQ C;  3AZM A;  5C3I B;  1F66 D;  2G5I C;  3AZM D;  1P3M A;  3V9R B;  3AZJ C;  3MNN C;  5GXQ C;  3EPH A;  3V9R A;  1AOI C;  5B24 C;  4QLC B;  1P3F C;  3B0C T;  1P3L B;  4QLC A;  3W96 D;  4QLC D;  3AZK C;  5AVC B;  3LZ0 B;  1P3L A;  4WNN B;  5AVC A;  3LZ0 A;  3MGQ C;  5AVC D;  4WU9 D;  2Y2L A;  4WNN A;  4JJN C;  3WKJ C;  5CPK B;  5BT1 C;  4ZBJ B;  3REH C;  1P3O B;  3X1T B;  5B40 B;  5CPK A;  1M19 B;  4YS3 B;  1P3O A;  3X1T A;  1P3O D;  5AV9 C;  5BNV B;  3X1T D;  5AV8 D;  5BNV A;  1P3B A;  3A1K A;  1P3B D;  2FFF B;  2FJ7 B;  3REK C;  4J8V B;  2FJ7 A;  5AY8 C;  3VH6 A;  4J8V A;  4LD9 D;  4J8V D;  3LJA C;  4Z2M G;  3AZH B;  1T3U A;  2RIQ A;  3AZF B;  5B1M B;  3KWQ D;  2IO5 B;  3AZH A;  3AZF A;  3AZH D;  5B0Y C;  5AV6 B;  3AZJ D;  5BO0 B;  4Z66 A;  4H9R B;  4ZUX D;  4Z66 D;  5AV6 A;  5AV6 D;  5BO0 A;  5JRG A;  1P3G A;  4H9R A;  3O62 C;  5JRG D;  4G92 B;  1P3G D;  4NFT A;  3B0D C;  4Z5T B;  4WJ3 C;  2HIO B;  4Z5T A;  4AWL C;  4R8P B;  4YM6 C;  2HIO A;  2L5A A;  3AV1 C;  4JJN D;  1P34 C;  3WKJ D;  3REI C;  4J8X C;  3W98 B;  1JFI A;  4XZQ C;  2BG1 A;  3W98 A;  1BFM A;  4HGA C;  3X1S A;  3W98 D;  3X1S D;  5BS7 C;  3UTA C;  4DRA A;  4X23 B;  2Y2K A;  3AZN B;  4WU8 B;  1PZR A;  3KXB B;  3AZN A;  3EG5 B;  4WU8 A;  1HQ3 C;  4CAY B;  3W97 D;  3KXB A;  4Z2M H;  4EO5 C;  3LZ1 C;  2NQB B;  1B6W A;  4CAY A;  3H0L C;  3REK D;  2CWE A;  2NQB A;  5B31 B;  3AZM C;  2NQB D;  5AY8 D;  5B1L A;  5B31 A;  5B1L D;  5C3I C;  5B31 D;  4QLC C;  1W2E A;  1ULY A;  2PYO B;  1P3L C;  2ZY3 A;  2PYO A;  5AVC C;  3LZ0 C;  4WU9 C;  2G5H C;  3B0B A;  3X1U B;  3TU4 B;  4NE6 A;  3O62 D;  4WV4 B;  3TU4 A;  1P3A B;  3TU4 D;  1KX3 B;  3AZE B;  1M18 D;  4ZBJ C;  4H9Q B;  1P3O C;  3X1T C;  3B6G D;  3AZE A;  4NE5 A;  1B67 A;  4H9Q A;  4YM6 D;  1KX5 B;  1P3B C;  5F99 B;  3UTB B;  2NZD B;  1A7W A;  5F99 A;  3UTB A;  5F99 D;  2NZD A;  2NZD D;  4J8U A;  2FJ7 C;  4J8U D;  4J8V C;  2ZM5 A;  3UT9 B;  3LZ1 D;  3P5J B;  4G91 B;  3UT9 A;  5DNN B;  3AZH C;  3AZF C;  1P3M D;  2ZY2 A;  2YFW B;  3NQU B;  2IO5 C;  4ZUX C;  4Z66 C;  2YFW A;  5AV6 C;  3NQU A;  5JRG C;  1P3G C;  3WAA B;  3X1V B;  4G92 C;  2VQR A;  3REL B;  3C1B B;  3WAA A;  3X1V A;  3B6F B;  4Z5T C;  5GT3 B;  4DQY B;  1P3L D;  3C1B A;  4H9S A;  5AVB B;  3B6F A;  3C1B D;  5GT3 A;  3LZ0 D;  3B6F D;  5GT3 D;  5GT0 B;  5AVB A;  5AVB D;  2YFV B;  5GT0 A;  3W98 C;  4KGC B;  5CPK D;  5GT0 D;  3X1S C;  1M19 A;  5B40 A;  4KGC A;  1M19 D;  5B40 D;  4YS3 A;  4YS3 D;  4WZS B;  1TZY B;  3AYW B;  3W97 C;  3AL0 C;  4WU8 C;  4NE3 A;  3KXB C;  3C1C B;  4KUD B;  5BNX B;  3VH5 T;  1ID3 B;  2NQB C;  1TAF B;  5B0Z B;  2Y2H A;  1R4V A;  1ID3 A;  2FJ7 D;  5B1L C;  1TAF A;  5B31 C;  5B0Z A;  3AZI B;  5B0Z D;  5B2I B;  1Z2C B;  3AZI A;  3REJ B;  3MGP B;  3W99 B; 
#chains in the Genus database with same CATH homology
 3REJ A;  3MGP A;  3W99 A;  3MGP D;  2Y2O A;  5B1M A;  3AZF D;  5B1M D;  2Y2J A;  1EQZ B;  2PYO C;  2W8S A;  1EQZ A;  3MVD B;  3LEL B;  1EQZ D;  3TU4 C;  3MVD A;  3LEL A;  1P3I B;  1M18 C;  3B6G C;  1P3I A;  4Z5T D;  3A1I A;  5B33 B;  5DNM B;  3AZE C;  1P3I D;  2F8N B;  4XUJ B;  3AZL B;  2HIO D;  4R8P A;  5DNM A;  4R8P D;  2F8N A;  4XUJ A;  3AZL A;  2F8N D;  3FDD A;  4XUJ D;  3AZL D;  3MNN B;  2J8P A;  1KX4 B;  5F99 C;  3UTB C;  1AOI B;  2NZD C;  2RVQ D;  1KX4 A;  4J8W B;  1KX4 D;  3KSY A;  4J8U C;  1P3F B;  3WA9 B;  2Y2I A;  4J8W A;  4X23 A;  1F1E A;  5B31 G;  4J8W D;  4X23 D;  3AZK B;  3KUY B;  3AZN D;  3WA9 A;  2BYK B;  4WU8 D;  3KXB D;  1M1A B;  3KUY A;  5CP6 B;  3MGQ B;  5B32 B;  1M1A A;  5CP6 A;  3UT9 C;  3MGQ A;  5CP6 D;  1P3M C;  5B32 A;  1N1J B;  3REH B;  5B32 D;  3MGS B;  2ARO B;  1N1J A;  2XD1 A;  5AV9 B;  3MGS A;  2ARO A;  3MGS D;  1S32 B;  3X1V C;  1S32 A;  1P3K B;  2CV5 B;  3C1B C;  3AV2 B;  3B6F C;  1P3K A;  2CV5 A;  5GT3 C;  2PYO D;  1P3K D;  1WWI A;  5AVB C;  3A6N B;  3AV2 A;  3X1U A;  3X1U D;  5CPK C;  3VH6 T;  5GT0 C;  3A6N A;  1P3A A;  3A6N D;  1KX3 A;  1P3A D;  1M19 C;  5B40 C;  1KX3 D;  4KGC C;  3LJA B;  4YS3 C;  3AZE D;  4H9O B;  5B2J B;  2Y2M A;  4H9O A;  1KX5 A;  5B0Y B;  5B2J A;  1KX5 D;  3B0C W;  5CPI B;  5FUG B;  3UTB D;  5AV5 B;  5CPI A;  5FUG A;  5CPI D;  5AV5 A;  1ID3 C;  5B0Z C;  2HUE B;  1BH8 B;  5KDM B;  4E44 A;  3AZI C;  3KFU G;  3R45 B;  5E5A B;  1BH8 A;  5KDM A;  3AV1 B;  1ZLA B;  3R45 A;  3MGP C;  3REI B;  5E5A A;  4J8X B;  3UT9 D;  3W99 C;  5E5A D;  5B1M C;  1ZLA A;  5DNN A;  5JA4 B;  1ZLA D;  5DNN D;  3AFA B;  3AFA A;  5G49 B;  1EQZ C;  3AFA D;  5GSU B;  3EPL A;  1U35 B;  5G49 A;  3VH5 W;  3LEL C;  3AZG B;  5GSU A;  1HQ3 B;  1U35 A;  3AZG A;  2XD5 A;  3X1V D;  3WAA D;  1P3I C;  3REL A;  1HQ3 A;  3REL D;  2HIO C;  2F8N K;  4R8P C;  1F66 B;  5DNM C;  3EPK A;  3AZM B;  4XUJ C;  3AZL C;  2BYM B;  1F66 A;  2BYM A;  3AZI D;  2RVQ C;  2YFV A;  3F6T A;  4DRB A;  1KX4 C;  4KGC D;  1KU5 A;  5CPJ B;  2JCH A;  3W96 B;  3H0R C;  4X23 C;  4J8W C;  3AZN C;  1TZY A;  5CPJ A;  3WA9 C;  3W96 A;  1TZY D;  5CPJ D;  3AYW A;  3KUY C;  3AYW D;  4WU9 B;  3C1C A;  3IP4 C;  1M1A C;  4KUD A;  5CP6 C;  5BNX A;  3C1C D;  4WU9 A;  4KUD D;  4H9N B;  3NQJ B;  4CSR B;  5B32 C;  1P3P B;  1ID3 D;  4KHA B;  2F2A C;  4H9N A;  3NQJ A;  4CSR A;  1P3P A;  4KHA A;  1P3P D;  5B2I A;  3MGS C;  2ARO C;  5B2I D;  5AV8 B;  2ZY4 A;  3REJ D;  4M6B A;  1P3B B;  5AV8 A;  3W99 D;  3AN2 B;  1S32 C;  3H0M C;  3EPJ A;  2ZY5 A;  2JSS A;  2Y2P A;  3AN2 A;  1P3K C;  2CV5 C;  3AN2 D;  3WTP B;  3AV2 C;  2F8N G;  3X1U C;  4LD9 B;  3WTP A;  3MVD D;  3LEL D;  3WTP D;  3A6N C;  4LD9 A;  3MGR B;  1P3A C;  1KX3 C;  3MGR A;  3WTP E;  2JE5 A;  3MGR D;  3KWQ B;  5B33 A;  5B33 D;  5DNM D;  3AZJ B;  3KWQ A;  1KX5 C;  1BH9 B;  5GXQ B;  5B2J C;  4ZUX B;  4Z66 B;  3AZJ A;  1BH9 A;  5GXQ A;  3MNN A;  5B24 B;  1WWS A;  3MNN D;  5GXQ D;  4ZUX A;  5CPI C;  5JRG B;  1P3G B;  1AOI A;  5B24 A;  1HTA A;  5AV5 C;  1AOI D;  5B24 D;  5B32 G;  1P3F A;  1P3F D;  3WA9 D;  2HUE C;  3AZK A;  3AZK D;  2BYK A;  3VH6 W;  3KUY D;  4JJN B;  3WKJ B;  1M1A D;  5E5A C;  1JFI B;  4JJN A;  3WKJ A;  4G91 C;  3MGQ D;  1ZLA C;  5DNN C;  3X1S B;  3REH A;  5BT1 D;  3REH D;  2Y2N A;  3AFA C;  2F8N H;  2ARO D;  5AV9 A;  5AV9 D;  3W97 B;  3WAA C;  5GSU C;  1U35 C;  3AZG C;  1S32 D;  3REL C;  3W97 A;  4H9S C;  3REK B;  2DF4 C;  2CV5 D;  3REK A;  5AY8 B;  3AV2 D;  5B1L B;  1F66 C;  5AY8 A;  1H3O B;  3LJA A;  3LJA D;  1H3O A;  1TZY C;  5CPJ C;  3W96 C;  5B2J D;  3AYW C;  5B0Y A;  5B0Y D;  3VH5 A;  3O62 B;  3C1C C;  4KUD C;  2DQN C;  3B0D B;  5AV5 D;  3O62 A;  4UPK A;  1M18 B;  4UUZ B;  4E45 A;  4AWL B;  1P3P C;  3B6G B;  4H9P B;  1M18 A;  4UUZ A;  4YM6 B;  2LY8 A;  1Q9C A;  5B2I C;  3B6G A;  4H9P A;  3REJ C;  4YM6 A;  1P34 B;  2Y2Q A;  5AV8 C;  3AV1 A;  4XZQ B;  1P34 A;  3AV1 D;  3REI A;  4J8X A;  4HGA B;  1P34 D;  3REI D;  4J8X D;  4XZQ A;  5JA4 A;  4XZQ D;  3AN2 C;  3UTA B;  4J8U B;  5BS7 A;  5CHL B;  3UTA A;  3MVD C;  3UTA D;  3WTP C;  4LD9 C;  5GSU D;  4EO5 B;  1U35 D;  3LZ1 B;  3AZG D;  3MGR C;  1HQ3 D;  2UWX A;  3LZ1 A;  5B33 C;  2Y2G A;  1P3M B;  3KWQ C;  3AZM A;  5C3I B;  1F66 D;  2G5I C;  3AZM D;  1P3M A;  3V9R B;  3AZJ C;  3MNN C;  5GXQ C;  3EPH A;  3V9R A;  1AOI C;  5B24 C;  4QLC B;  1P3F C;  3B0C T;  1P3L B;  4QLC A;  3W96 D;  4QLC D;  3AZK C;  5AVC B;  3LZ0 B;  1P3L A;  4WNN B;  5AVC A;  3LZ0 A;  3MGQ C;  5AVC D;  4WU9 D;  2Y2L A;  4WNN A;  4JJN C;  3WKJ C;  5CPK B;  5BT1 C;  4ZBJ B;  3REH C;  1P3O B;  3X1T B;  5B40 B;  5CPK A;  1M19 B;  4YS3 B;  1P3O A;  3X1T A;  1P3O D;  5AV9 C;  5BNV B;  3X1T D;  5AV8 D;  5BNV A;  1P3B A;  3A1K A;  1P3B D;  2FFF B;  2FJ7 B;  3REK C;  4J8V B;  2FJ7 A;  5AY8 C;  3VH6 A;  4J8V A;  4LD9 D;  4J8V D;  3LJA C;  4Z2M G;  3AZH B;  1T3U A;  2RIQ A;  3AZF B;  5B1M B;  3KWQ D;  2IO5 B;  3AZH A;  3AZF A;  3AZH D;  5B0Y C;  5AV6 B;  3AZJ D;  5BO0 B;  4Z66 A;  4H9R B;  4ZUX D;  4Z66 D;  5AV6 A;  5AV6 D;  5BO0 A;  5JRG A;  1P3G A;  4H9R A;  3O62 C;  5JRG D;  4G92 B;  1P3G D;  4NFT A;  3B0D C;  4Z5T B;  4WJ3 C;  2HIO B;  4Z5T A;  4AWL C;  4R8P B;  4YM6 C;  2HIO A;  2L5A A;  3AV1 C;  4JJN D;  1P34 C;  3WKJ D;  3REI C;  4J8X C;  3W98 B;  1JFI A;  4XZQ C;  2BG1 A;  3W98 A;  1BFM A;  4HGA C;  3X1S A;  3W98 D;  3X1S D;  5BS7 C;  3UTA C;  4DRA A;  4X23 B;  2Y2K A;  3AZN B;  4WU8 B;  1PZR A;  3KXB B;  3AZN A;  3EG5 B;  4WU8 A;  1HQ3 C;  4CAY B;  3W97 D;  3KXB A;  4Z2M H;  4EO5 C;  3LZ1 C;  2NQB B;  1B6W A;  4CAY A;  3H0L C;  3REK D;  2CWE A;  2NQB A;  5B31 B;  3AZM C;  2NQB D;  5AY8 D;  5B1L A;  5B31 A;  5B1L D;  5C3I C;  5B31 D;  4QLC C;  1W2E A;  1ULY A;  2PYO B;  1P3L C;  2ZY3 A;  2PYO A;  5AVC C;  3LZ0 C;  4WU9 C;  2G5H C;  3B0B A;  3X1U B;  3TU4 B;  4NE6 A;  3O62 D;  4WV4 B;  3TU4 A;  1P3A B;  3TU4 D;  1KX3 B;  3AZE B;  1M18 D;  4ZBJ C;  4H9Q B;  1P3O C;  3X1T C;  3B6G D;  3AZE A;  4NE5 A;  1B67 A;  4H9Q A;  4YM6 D;  1KX5 B;  1P3B C;  5F99 B;  3UTB B;  2NZD B;  1A7W A;  5F99 A;  3UTB A;  5F99 D;  2NZD A;  2NZD D;  4J8U A;  2FJ7 C;  4J8U D;  4J8V C;  2ZM5 A;  3UT9 B;  3LZ1 D;  3P5J B;  4G91 B;  3UT9 A;  5DNN B;  3AZH C;  3AZF C;  1P3M D;  2ZY2 A;  2YFW B;  3NQU B;  2IO5 C;  4ZUX C;  4Z66 C;  2YFW A;  5AV6 C;  3NQU A;  5JRG C;  1P3G C;  3WAA B;  3X1V B;  4G92 C;  2VQR A;  3REL B;  3C1B B;  3WAA A;  3X1V A;  3B6F B;  4Z5T C;  5GT3 B;  4DQY B;  1P3L D;  3C1B A;  4H9S A;  5AVB B;  3B6F A;  3C1B D;  5GT3 A;  3LZ0 D;  3B6F D;  5GT3 D;  5GT0 B;  5AVB A;  5AVB D;  2YFV B;  5GT0 A;  3W98 C;  4KGC B;  5CPK D;  5GT0 D;  3X1S C;  1M19 A;  5B40 A;  4KGC A;  1M19 D;  5B40 D;  4YS3 A;  4YS3 D;  4WZS B;  1TZY B;  3AYW B;  3W97 C;  3AL0 C;  4WU8 C;  4NE3 A;  3KXB C;  3C1C B;  4KUD B;  5BNX B;  3VH5 T;  1ID3 B;  2NQB C;  1TAF B;  5B0Z B;  2Y2H A;  1R4V A;  1ID3 A;  2FJ7 D;  5B1L C;  1TAF A;  5B31 C;  5B0Z A;  3AZI B;  5B0Z D;  5B2I B;  1Z2C B;  3AZI A;  3REJ B;  3MGP B;  3W99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...