2IO5C

Crystal structure of the cia- histone h3-h4 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/structural protein
molecule keywords ASF1A protein
publication title Structure and function of the histone chaperone CIA/ASF1 complexed with histones H3 and H4.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2io5C00
1P3IA 3REJA 4H9SA 3LELA 3WAAC 3AV2A 5F99D 3WA9D 4UUZB 4JJND 5B2ID 3MGPB 4ZUXA 1M18D 4QLCC 3LZ1B 3C1BB 3WTPA 3X1TD 5AV8C 3AYWC 1M1AB 2FJ7D 1P34D 5KDMA 5B40D 2BYKB 2PYOB 5B1LC 3AN2C 4J8XA 5CPKB 3AZLD 4H9OA 3MGRA 3AV1B 1ZLAA 3AFAB 1HQ3A 3REKB 5GT3B 1P3OD 1M19C 3AZHD 5B0ZB 5B24C 3AZEB 3W97A 4KGCC 3MGSD 1S32C 3AZJD 1KX5D 1EQZD 1KX3D 3AZNA 3AZKB 3MGPC 5BS7A 4J8WD 2IO5B 3LJAD 5GXQA 3LZ1C 3KUYD 3C1BC 5B1MD 3O62A 5CPJB 1BH8A 4YM6B 3W99A 1M1AC 3A6ND 1AOIB 3B6FA 5AV5D 4Z66A 1P3KD 2NZDA 2PYOC 1WWSA 5CPKC 1P3LB 3AV1C 4G91B 5B0YD 4XUJD 3MVDD 5GT3C 3AFAC 3REKC 1P3AA 1P3FD 3RELB 5DNMD 4X23A 1P3GA 5B0ZC 4G92B 3AZEC 1H3OB 4NE6A 5JRGD 1P3BD 5CP6D 3LZ0A 3X1SD 4LD9D 4J8UD 5F99B 3KWQA 3NQUB 3WA9B 5B2IB 3AZKC 2IO5C 4KHAA 4J8VA 2HIOA 5B31D 3X1VA 5CPJC 3B0CW 3AZMD 5AV9A 4YM6C 2FJ7B 1AOIC 5B40B 1JFIA 4R8PD 2NQBB 4WU8D 3AZLB 1P3LC 1ULYA 4G91C 5B32A 1P3OB 3RELC 2BYMA 3C1CD 3AZHB 3KXBD 4G92C 5CPIA 3WAAA 2AROB 3W96D 1KX5B 1EQZB 4QLCA 5F99C 1KX3B 3WA9C 3R45B 5B2IC 3AYWA 4J8WB 5BNVA 1KX4D 1M18C 4DRAA 2YFWA 3LJAB 3KUYB 2HUEB 5B1LA 5B1MB 5AVCD 1P3MD 2FJ7C 4NE3A 5AV5B 5B40C 3NQJA 1P3KB 4CAYA 1U35A 1ID3D 3AZGD 2NQBC 3X1UD 1HTAA 5JA4B 3AZLC 1P3ID 2LY8A 3REJD 5B0YB 1P3OC 3MVDB 3LELD 3AV2D 1P3FB 4WNNB 3REHD 5GSUA 4ZUXD 5DNMB 3AZHC 1F66A 2AROC 5FUGA 4UUZA 5JRGB 1N1JA 3WTPD 3MGPA 1P3BB 1KX5C 1EQZC 5CP6B 3WKJB 5AV6D 3X1SB 4LD9B 1KX3C 3C1BA 3AZIB 3UT9D 2YFVA 4J8WC 4J8XD 3MGRD 1ZLAD 2BYKA 5B31B 3LJAC 3KUYC 2HUEC 1WWIA 1HQ3D 5B1MC 5BT1C 3AZMB 3VH5T 3AFAA 5GT3A 5AV5C 5G49B 1P3KC 3W97D 4Z2MH 4R8PB 5BNXB 4WU8B 5B0ZA 5GT0B 5B0YC 3MVDC 4H9RB 3UTAA 1P3FC 1BH9B 3AZND 3VH5A 3WTPE 3C1CB 5DNMC 4KUDA 5DNNB 1F1EA 5GXQD 5JRGC 3W96B 3AZKA 3O62D 1P3BC 5CP6C 3WKJC 3X1SC 4LD9C 3B6FD 5BO0A 4H9QB 4Z66D 3MNND 3AZIC 2F8NA 3V9RB 4CSRB 4YM6A 1KX4B 1AOIA 5B31C 1P3AD 1B6WA 3AZMC 1P3PA 1TAFA 3VH6T 5AVCB 4X23D 3AZFD 1ID3B 5AY8D 3RELA 4R8PC 5E5AA 3AZGB 4WU8C 4M6BA 3LZ0D 2CV5A 1P3IB 3REJB 5GT0C 3AV2B 4XZQA 1H3OA 3VH6A 3KWQD 3C1CC 3REIA 3REHB 4ZUXB 5DNNC 2F8NK 1TZYB 2HIOD 3WA9A 5B31G 3WTPB 3W96C 3X1VD 5AV6B 5AV9D 5KDMB 3UT9B 4Z5TA 1KX4C 4J8XB 4H9OB 3MGRB 5B32D 1HQ3B 2NQBA 5B33D 5AVCC 4JJNB 5CPID 1ID3C 3W97B 3AZGC 4YS3A 1M18B 1P3IC 3REJC 2AROA 4H9SC 3AV2C 3X1TB 4H9PA 3REHC 1P34B 4ZUXC 3MGQA 2CWEA 4EO5B 1KX3A 1TZYC 3WTPC 3R45A 5B1LD 5AVBA 4H9NA 3B6GD 1BH8B 5AV6C 3MNNB 4Z66B 5C3IB 3UT9C 3UTBA 1U35D 4WU9D 3MGSB 4J8XC 3W98D 3MGRC 3AZJB 1HQ3C 1P3AB 5GSUD 3AZFB 1F66D 5AV8A 4JJNC 3W97C 5AY8B 1P3FA 3TU4D 3LZ0B 5B2JD 3AN2A 3X1TC 5JRGA 2RVQD 5CP6A 3WKJA 3A6NB 1P34C 5BS7C 4EO5C 4KHAB 2HIOB 4E45A 3AZIA 1M19A 1A7WA 5B24A 4KGCA 4XUJB 5AV9B 1S32A 4Z2MG 3MNNC 5C3IC 4Z66C 3MGSC 4E44A 5B32B 3AZJC 1P3AC 3UTAD 3B0BA 5BNXA 4ZBJB 4J8UB 5B33B 3LZ1A 3AZFC 5GT0A 4KUDD 5CPIB 5AY8C 1BH9A 1M1AA 3LZ0C 5DNNA 2PYOA 5CPKA 2F8ND 3AV1A 3A6NC 3REKA 2F8NH 5BNVB 4H9QA 2HIOC 2YFWB 4CSRA 3B6GB 3AZEA 1P3PD 4XUJC 5AV9C 3NQJB 4CAYB 1U35B 4WU9B 5E5AD 3KXBB 2JSSA 3W98B 2CV5D 5B32C 1ID3A 3AZGA 4XZQD 4ZBJC 4HGAB 3W99D 4J8UC 4AWLB 3REID 5GSUB 5B33C 1F66B 2NZDD 5CPJA 1BFMA 5CPIC 5FUGB 1N1JB 3TU4B 3REHA 5B2JB 1TZYA 1P3LA 4Z5TD 2YFVB 1P3MB 1P3GD 5AV6A 3B0DB 3UT9A 3X1UB 5B32G 4WV4B 3B6GC 2NQBD 3LELB 1KU5A 1U35C 4WU9C 4YS3D 3KXBC 5F99A 3W98C 4J8VD 3NQUA 4JJNA 5B2IA 2AROD 3UTAB 1M18A 4AWLC 4HGAC 5GSUC 3MGQD 1F66C 4KUDB 3X1TA 2L5AA 5AVBD 3TU4C 1P34A 2FJ7A 1ZLAB 5B40A 5B2JC 1R4VA 5BO0B 2RVQC 5BT1D 3AZLA 3UTBD 2F8NB 1P3MC 1P3OA 3WAAD 3B0DC 3MNNA 3X1UC 3AZHA 1P3PB 3MGSA 1TAFB 4QLCD 3LELC 3AZJA 3AZNB 1KX5A 5AV8D 1EQZA 3AYWD 5E5AB 3AZFA 2CV5B 5GXQB 5AY8A 3O62B 3AN2D 3VH5W 4XZQB 4WZSB 4J8WA 3UTAC 3W99B 3REIB 3LJAA 3KUYA 3WKJD 3B6FB 5B1MA 4KUDC 2NZDB 4NE5A 3AZID 1M19D 3A6NA 4NFTA 5AV5A 5B24D 1P3KA 1ZLAC 4KGCD 1S32D 5JA4A 4Z5TB 4X23B 1P3GB 5B0YA 4XUJA 3MVDA 4WNNA 3MGPD 5DNMA 4DRBA 1P3PC 3KSYA 3LZ1D 3C1BD 3KWQB 5GT0D 3AZNC 1P3BA 5E5AC 3X1SA 4YS3B 4LD9A 4J8UA 1M1AD 5B33A 4J8VB 2CV5C 5GXQC 3VH6W 5DNND 3X1VB 3O62C 2PYOD 4XZQC 4H9PB 5CPKD 3W99C 2F8NG 3AV1D 3REIC 5B31A 3AFAD 3MGQB 3REKD 5GT3D 1B67A 3B6FC 2NZDC 1JFIB 3AZMA 5AVBB 4H9NB 5B0ZD 3AZED 5G49A 4R8PA 4WU8A 2BYMB 3UTBB 3B6GA 4Z5TC 4X23C 1P3GC 5CHLB 3WAAB 4H9RA 3C1CA 3AZKD 4WU9A 3KXBA 3W98A 4QLCB 3KWQC 3W96A 5CPJD 5AV8B 3AYWB 4YS3C 4YM6D 4J8VC 1AOID 5B1LB 1Q9CA 3V9RA 3X1VC 3AN2B 1TZYD 1KX4A 3TU4A 1P3LD 3MGQC 5B2JA 3RELD 1M19B 5AVBC 5AVCA 1P3MA 3B0CT 5B24B 4KGCB 1S32B 3X1UA 3UTBC
chains in the Genus database with same CATH superfamily
1P3IA 3REJA 4H9SA 3LELA 3WAAC 3AV2A 5F99D 3WA9D 4UUZB 3FDDA 4JJND 5B2ID 3MGPB 4ZUXA 3EPLA 1M18D 4QLCC 3LZ1B 3C1BB 3WTPA 3X1TD 5AV8C 2Y2MA 3AYWC 1M1AB 2FJ7D 1P34D 5KDMA 5B40D 2BYKB 2ZY5A 2PYOB 5B1LC 3AN2C 4J8XA 5CPKB 3AZLD 4H9OA 3MGRA 3AV1B 1ZLAA 3AFAB 1HQ3A 3REKB 5GT3B 1P3OD 1M19C 3AZHD 5B0ZB 5B24C 3AZEB 3W97A 4KGCC 3MGSD 1S32C 3AZJD 1KX5D 1EQZD 2J8PA 1T3UA 1KX3D 3AZNA 3AZKB 3MGPC 5BS7A 4J8WD 2IO5B 3LJAD 5GXQA 3LZ1C 3KUYD 3C1BC 5B1MD 3O62A 5CPJB 1BH8A 4YM6B 3W99A 3A1KA 1M1AC 3A6ND 1AOIB 3B6FA 5AV5D 4Z66A 1P3KD 2NZDA 2PYOC 1WWSA 2G5HC 5CPKC 1P3LB 3AV1C 4G91B 5B0YD 4XUJD 3MVDD 5GT3C 3AFAC 3REKC 1P3AA 1P3FD 3RELB 2Y2IA 2Y2OA 5DNMD 4X23A 1P3GA 5B0ZC 4G92B 3AZEC 1H3OB 4NE6A 5JRGD 1P3BD 5CP6D 3LZ0A 3X1SD 4LD9D 4J8UD 5F99B 3KWQA 2Y2QA 3NQUB 3WA9B 5B2IB 3AZKC 2IO5C 4KHAA 2DQNC 4J8VA 2HIOA 5B31D 3X1VA 5CPJC 3B0CW 3AZMD 5AV9A 4YM6C 2DF4C 2FJ7B 1AOIC 5B40B 1JFIA 4R8PD 2NQBB 4WU8D 3AZLB 1P3LC 1ULYA 4G91C 5B32A 1P3OB 3RELC 2BYMA 3EG5B 3C1CD 3AZHB 3KXBD 4G92C 5CPIA 3WAAA 2AROB 3W96D 1KX5B 1EQZB 4QLCA 3H0LC 5F99C 1KX3B 3WA9C 3R45B 5B2IC 3AYWA 4J8WB 5BNVA 1KX4D 1M18C 4DRAA 2YFWA 3LJAB 3KUYB 2HUEB 5B1LA 5B1MB 5AVCD 1P3MD 2FJ7C 4NE3A 5AV5B 5B40C 3NQJA 1P3KB 4CAYA 1U35A 1ID3D 3AZGD 2Y2PA 2NQBC 3X1UD 1HTAA 5JA4B 3AZLC 1P3ID 2LY8A 3REJD 5B0YB 1P3OC 3MVDB 3LELD 3AV2D 1P3FB 4WNNB 2FFFB 1W2EA 3REHD 5GSUA 4ZUXD 5DNMB 3AZHC 1F66A 2AROC 5FUGA 2JCHA 4UUZA 1N1JA 5JRGB 3WTPD 3MGPA 1P3BB 1KX5C 1EQZC 5CP6B 3WKJB 5AV6D 3X1SB 4LD9B 1KX3C 3C1BA 3AZIB 3UT9D 2YFVA 4J8WC 4J8XD 3MGRD 1ZLAD 2BYKA 5B31B 3LJAC 3KUYC 2HUEC 1WWIA 1HQ3D 5B1MC 5BT1C 3AZMB 3VH5T 3AFAA 5GT3A 5AV5C 5G49B 1P3KC 3W97D 4Z2MH 4R8PB 5BNXB 4WU8B 5B0ZA 5GT0B 5B0YC 3MVDC 4H9RB 3UTAA 1P3FC 1BH9B 3AZND 2VQRA 3VH5A 3WTPE 3C1CB 4UPKA 5DNMC 4KUDA 5DNNB 1F1EA 5GXQD 5JRGC 3W96B 3AZKA 3O62D 1P3BC 5CP6C 2BG1A 3WKJC 3X1SC 4LD9C 3B6FD 5BO0A 4H9QB 4Z66D 3MNND 3AZIC 2F8NA 3AL0C 3V9RB 4CSRB 4YM6A 1KX4B 2ZY3A 3H0RC 1AOIA 5B31C 1P3AD 1B6WA 3AZMC 1P3PA 1TAFA 3VH6T 5AVCB 3P5JB 4X23D 3AZFD 1ID3B 5AY8D 3RELA 4R8PC 5E5AA 3AZGB 4WU8C 4M6BA 3LZ0D 2CV5A 1P3IB 3REJB 5GT0C 3AV2B 4XZQA 1H3OA 3VH6A 3KWQD 3C1CC 3REIA 3REHB 4ZUXB 5DNNC 2F8NK 1TZYB 2HIOD 3WA9A 5B31G 3WTPB 3W96C 3X1VD 5AV6B 5AV9D 5KDMB 3UT9B 4Z5TA 1KX4C 4J8XB 4DQYB 4H9OB 3MGRB 5B32D 1HQ3B 2G5IC 2Y2NA 3F6TA 2NQBA 5B33D 5AVCC 4JJNB 5CPID 1ID3C 3W97B 3AZGC 4YS3A 1M18B 1P3IC 3REJC 2AROA 4H9SC 3AV2C 3X1TB 4H9PA 3REHC 1P34B 4ZUXC 3MGQA 2CWEA 4EO5B 1KX3A 1TZYC 3WTPC 3R45A 5B1LD 5AVBA 4H9NA 3B6GD 1BH8B 5AV6C 3MNNB 4Z66B 5C3IB 3UT9C 3UTBA 1U35D 4WU9D 3MGSB 4J8XC 3W98D 3MGRC 3AZJB 1HQ3C 1P3AB 2Y2HA 5GSUD 3AZFB 1F66D 5AV8A 4JJNC 3W97C 5AY8B 1P3FA 3KFUG 2XD1A 3TU4D 3LZ0B 5B2JD 3AN2A 3X1TC 2UWXA 5JRGA 2RVQD 5CP6A 3WKJA 3A6NB 1P34C 5BS7C 4EO5C 4KHAB 2HIOB 4E45A 3AZIA 1M19A 1A7WA 5B24A 4KGCA 4XUJB 5AV9B 1S32A 4Z2MG 3MNNC 5C3IC 4Z66C 3MGSC 4E44A 5B32B 3AZJC 1P3AC 3UTAD 3B0BA 5BNXA 4ZBJB 4J8UB 5B33B 3LZ1A 3AZFC 5GT0A 4KUDD 5CPIB 5AY8C 1BH9A 1M1AA 3LZ0C 5DNNA 2PYOA 5CPKA 2F8ND 3AV1A 3A6NC 3REKA 2F8NH 5BNVB 4H9QA 2HIOC 2YFWB 4CSRA 3B6GB 3AZEA 1P3PD 4XUJC 5AV9C 3NQJB 4CAYB 1U35B 4WU9B 5E5AD 3KXBB 2JSSA 2ZY4A 3W98B 2CV5D 5B32C 1ID3A 3AZGA 4XZQD 4WJ3C 4ZBJC 4HGAB 3W99D 4J8UC 4AWLB 3REID 5GSUB 5B33C 1F66B 2NZDD 5CPJA 1BFMA 3H0MC 5CPIC 5FUGB 1N1JB 3TU4B 3REHA 5B2JB 1TZYA 1P3LA 3IP4C 4Z5TD 2YFVB 1P3MB 1P3GD 5AV6A 3B0DB 3UT9A 3X1UB 5B32G 4WV4B 3B6GC 2NQBD 3LELB 1KU5A 2RIQA 1U35C 4WU9C 4YS3D 3KXBC 2ZY2A 5F99A 3W98C 4J8VD 3NQUA 4JJNA 1Z2CB 5B2IA 2AROD 3UTAB 1M18A 4AWLC 4HGAC 5GSUC 3MGQD 1F66C 4KUDB 3X1TA 2L5AA 2W8SA 5AVBD 3TU4C 1P34A 2FJ7A 1ZLAB 5B40A 5B2JC 1R4VA 2F2AC 5BO0B 2RVQC 5BT1D 3AZLA 3UTBD 2F8NB 1P3MC 1P3OA 2XD5A 3WAAD 3A1IA 3B0DC 3MNNA 3X1UC 3AZHA 1P3PB 3MGSA 1TAFB 4QLCD 3LELC 2Y2JA 3AZJA 3AZNB 1KX5A 5AV8D 1EQZA 3AYWD 5E5AB 2JE5A 3AZFA 2CV5B 5GXQB 5AY8A 3O62B 3AN2D 3VH5W 4XZQB 4WZSB 4J8WA 3UTAC 3W99B 3REIB 3LJAA 3KUYA 3WKJD 3B6FB 5B1MA 4KUDC 2NZDB 4NE5A 3AZID 1M19D 3A6NA 4NFTA 5AV5A 5B24D 1P3KA 1ZLAC 4KGCD 1S32D 5JA4A 4Z5TB 4X23B 1P3GB 5B0YA 4XUJA 3MVDA 4WNNA 3MGPD 5DNMA 4DRBA 1PZRA 1P3PC 3KSYA 3LZ1D 3C1BD 3KWQB 5GT0D 3AZNC 1P3BA 5E5AC 3X1SA 4YS3B 4LD9A 4J8UA 1M1AD 5B33A 4J8VB 2CV5C 5GXQC 3VH6W 5DNND 3X1VB 3O62C 2PYOD 4XZQC 4H9PB 5CPKD 3W99C 2F8NG 3AV1D 3REIC 5B31A 3AFAD 3MGQB 3REKD 5GT3D 1B67A 3B6FC 2NZDC 1JFIB 3EPHA 3AZMA 2Y2GA 5AVBB 3EPKA 4H9NB 5B0ZD 3AZED 5G49A 4R8PA 4WU8A 2BYMB 3UTBB 3B6GA 4Z5TC 4X23C 1P3GC 5CHLB 3WAAB 4H9RA 3C1CA 3AZKD 4WU9A 2Y2LA 3KXBA 3W98A 4QLCB 3KWQC 3W96A 5CPJD 5AV8B 3AYWB 4YS3C 4YM6D 4J8VC 1AOID 5B1LB 1Q9CA 3V9RA 3X1VC 2ZM5A 1TZYD 3AN2B 1KX4A 3TU4A 1P3LD 3MGQC 5B2JA 3RELD 2Y2KA 1M19B 5AVBC 5AVCA 3EPJA 3B0CT 1P3MA 5B24B 4KGCB 1S32B 3X1UA 3UTBC
chains in the Genus database with same CATH topology
1P3IA 3REJA 4H9SA 3LELA 3WAAC 3AV2A 5F99D 3WA9D 4UUZB 3FDDA 4JJND 5B2ID 3MGPB 4ZUXA 3EPLA 1M18D 4QLCC 3LZ1B 3C1BB 3WTPA 3X1TD 5AV8C 2Y2MA 3AYWC 1M1AB 2FJ7D 1P34D 5KDMA 5B40D 2BYKB 2ZY5A 2PYOB 5B1LC 3AN2C 4J8XA 5CPKB 3AZLD 4H9OA 3MGRA 3AV1B 1ZLAA 3AFAB 1HQ3A 3REKB 5GT3B 1P3OD 1M19C 3AZHD 5B0ZB 5B24C 3AZEB 3W97A 4KGCC 3MGSD 1S32C 3AZJD 1KX5D 1EQZD 2J8PA 1T3UA 1KX3D 3AZNA 3AZKB 3MGPC 5BS7A 4J8WD 2IO5B 3LJAD 5GXQA 3LZ1C 3KUYD 3C1BC 5B1MD 3O62A 5CPJB 1BH8A 4YM6B 3W99A 3A1KA 1M1AC 3A6ND 1AOIB 3B6FA 5AV5D 4Z66A 1P3KD 2NZDA 2PYOC 1WWSA 2G5HC 5CPKC 1P3LB 3AV1C 4G91B 5B0YD 4XUJD 3MVDD 5GT3C 3AFAC 3REKC 1P3AA 1P3FD 3RELB 2Y2IA 2Y2OA 5DNMD 4X23A 1P3GA 5B0ZC 4G92B 3AZEC 1H3OB 4NE6A 5JRGD 1P3BD 5CP6D 3LZ0A 3X1SD 4LD9D 4J8UD 5F99B 3KWQA 2Y2QA 3NQUB 3WA9B 5B2IB 3AZKC 2IO5C 4KHAA 2DQNC 4J8VA 2HIOA 5B31D 3X1VA 5CPJC 3B0CW 3AZMD 5AV9A 4YM6C 2DF4C 2FJ7B 1AOIC 5B40B 1JFIA 4R8PD 2NQBB 4WU8D 3AZLB 1P3LC 1ULYA 4G91C 5B32A 1P3OB 3RELC 2BYMA 3EG5B 3C1CD 3AZHB 3KXBD 4G92C 5CPIA 3WAAA 2AROB 3W96D 1KX5B 1EQZB 4QLCA 3H0LC 5F99C 1KX3B 3WA9C 3R45B 5B2IC 3AYWA 4J8WB 5BNVA 1KX4D 1M18C 4DRAA 2YFWA 3LJAB 3KUYB 2HUEB 5B1LA 5B1MB 5AVCD 1P3MD 2FJ7C 4NE3A 5AV5B 5B40C 3NQJA 1P3KB 4CAYA 1U35A 1ID3D 3AZGD 2Y2PA 2NQBC 3X1UD 1HTAA 5JA4B 3AZLC 1P3ID 2LY8A 3REJD 5B0YB 1P3OC 3MVDB 3LELD 3AV2D 1P3FB 4WNNB 2FFFB 1W2EA 3REHD 5GSUA 4ZUXD 5DNMB 3AZHC 1F66A 2AROC 5FUGA 2JCHA 4UUZA 1N1JA 5JRGB 3WTPD 3MGPA 1P3BB 1KX5C 1EQZC 5CP6B 3WKJB 5AV6D 3X1SB 4LD9B 1KX3C 3C1BA 3AZIB 3UT9D 2YFVA 4J8WC 4J8XD 3MGRD 1ZLAD 2BYKA 5B31B 3LJAC 3KUYC 2HUEC 1WWIA 1HQ3D 5B1MC 5BT1C 3AZMB 3VH5T 3AFAA 5GT3A 5AV5C 5G49B 1P3KC 3W97D 4Z2MH 4R8PB 5BNXB 4WU8B 5B0ZA 5GT0B 5B0YC 3MVDC 4H9RB 3UTAA 1P3FC 1BH9B 3AZND 2VQRA 3VH5A 3WTPE 3C1CB 4UPKA 5DNMC 4KUDA 5DNNB 1F1EA 5GXQD 5JRGC 3W96B 3AZKA 3O62D 1P3BC 5CP6C 2BG1A 3WKJC 3X1SC 4LD9C 3B6FD 5BO0A 4H9QB 4Z66D 3MNND 3AZIC 2F8NA 3AL0C 3V9RB 4CSRB 4YM6A 1KX4B 2ZY3A 3H0RC 1AOIA 5B31C 1P3AD 1B6WA 3AZMC 1P3PA 1TAFA 3VH6T 5AVCB 3P5JB 4X23D 3AZFD 1ID3B 5AY8D 3RELA 4R8PC 5E5AA 3AZGB 4WU8C 4M6BA 3LZ0D 2CV5A 1P3IB 3REJB 5GT0C 3AV2B 4XZQA 1H3OA 3VH6A 3KWQD 3C1CC 3REIA 3REHB 4ZUXB 5DNNC 2F8NK 1TZYB 2HIOD 3WA9A 5B31G 3WTPB 3W96C 3X1VD 5AV6B 5AV9D 5KDMB 3UT9B 4Z5TA 1KX4C 4J8XB 4DQYB 4H9OB 3MGRB 5B32D 1HQ3B 2G5IC 2Y2NA 3F6TA 2NQBA 5B33D 5AVCC 4JJNB 5CPID 1ID3C 3W97B 3AZGC 4YS3A 1M18B 1P3IC 3REJC 2AROA 4H9SC 3AV2C 3X1TB 4H9PA 3REHC 1P34B 4ZUXC 3MGQA 2CWEA 4EO5B 1KX3A 1TZYC 3WTPC 3R45A 5B1LD 5AVBA 4H9NA 3B6GD 1BH8B 5AV6C 3MNNB 4Z66B 5C3IB 3UT9C 3UTBA 1U35D 4WU9D 3MGSB 4J8XC 3W98D 3MGRC 3AZJB 1HQ3C 1P3AB 2Y2HA 5GSUD 3AZFB 1F66D 5AV8A 4JJNC 3W97C 5AY8B 1P3FA 3KFUG 2XD1A 3TU4D 3LZ0B 5B2JD 3AN2A 3X1TC 2UWXA 5JRGA 2RVQD 5CP6A 3WKJA 3A6NB 1P34C 5BS7C 4EO5C 4KHAB 2HIOB 4E45A 3AZIA 1M19A 1A7WA 5B24A 4KGCA 4XUJB 5AV9B 1S32A 4Z2MG 3MNNC 5C3IC 4Z66C 3MGSC 4E44A 5B32B 3AZJC 1P3AC 3UTAD 3B0BA 5BNXA 4ZBJB 4J8UB 5B33B 3LZ1A 3AZFC 5GT0A 4KUDD 5CPIB 5AY8C 1BH9A 1M1AA 3LZ0C 5DNNA 2PYOA 5CPKA 2F8ND 3AV1A 3A6NC 3REKA 2F8NH 5BNVB 4H9QA 2HIOC 2YFWB 4CSRA 3B6GB 3AZEA 1P3PD 4XUJC 5AV9C 3NQJB 4CAYB 1U35B 4WU9B 5E5AD 3KXBB 2JSSA 2ZY4A 3W98B 2CV5D 5B32C 1ID3A 3AZGA 4XZQD 4WJ3C 4ZBJC 4HGAB 3W99D 4J8UC 4AWLB 3REID 5GSUB 5B33C 1F66B 2NZDD 5CPJA 1BFMA 3H0MC 5CPIC 5FUGB 1N1JB 3TU4B 3REHA 5B2JB 1TZYA 1P3LA 3IP4C 4Z5TD 2YFVB 1P3MB 1P3GD 5AV6A 3B0DB 3UT9A 3X1UB 5B32G 4WV4B 3B6GC 2NQBD 3LELB 1KU5A 2RIQA 1U35C 4WU9C 4YS3D 3KXBC 2ZY2A 5F99A 3W98C 4J8VD 3NQUA 4JJNA 1Z2CB 5B2IA 2AROD 3UTAB 1M18A 4AWLC 4HGAC 5GSUC 3MGQD 1F66C 4KUDB 3X1TA 2L5AA 2W8SA 5AVBD 3TU4C 1P34A 2FJ7A 1ZLAB 5B40A 5B2JC 1R4VA 2F2AC 5BO0B 2RVQC 5BT1D 3AZLA 3UTBD 2F8NB 1P3MC 1P3OA 2XD5A 3WAAD 3A1IA 3B0DC 3MNNA 3X1UC 3AZHA 1P3PB 3MGSA 1TAFB 4QLCD 3LELC 2Y2JA 3AZJA 3AZNB 1KX5A 5AV8D 1EQZA 3AYWD 5E5AB 2JE5A 3AZFA 2CV5B 5GXQB 5AY8A 3O62B 3AN2D 3VH5W 4XZQB 4WZSB 4J8WA 3UTAC 3W99B 3REIB 3LJAA 3KUYA 3WKJD 3B6FB 5B1MA 4KUDC 2NZDB 4NE5A 3AZID 1M19D 3A6NA 4NFTA 5AV5A 5B24D 1P3KA 1ZLAC 4KGCD 1S32D 5JA4A 4Z5TB 4X23B 1P3GB 5B0YA 4XUJA 3MVDA 4WNNA 3MGPD 5DNMA 4DRBA 1PZRA 1P3PC 3KSYA 3LZ1D 3C1BD 3KWQB 5GT0D 3AZNC 1P3BA 5E5AC 3X1SA 4YS3B 4LD9A 4J8UA 1M1AD 5B33A 4J8VB 2CV5C 5GXQC 3VH6W 5DNND 3X1VB 3O62C 2PYOD 4XZQC 4H9PB 5CPKD 3W99C 2F8NG 3AV1D 3REIC 5B31A 3AFAD 3MGQB 3REKD 5GT3D 1B67A 3B6FC 2NZDC 1JFIB 3EPHA 3AZMA 2Y2GA 5AVBB 3EPKA 4H9NB 5B0ZD 3AZED 5G49A 4R8PA 4WU8A 2BYMB 3UTBB 3B6GA 4Z5TC 4X23C 1P3GC 5CHLB 3WAAB 4H9RA 3C1CA 3AZKD 4WU9A 2Y2LA 3KXBA 3W98A 4QLCB 3KWQC 3W96A 5CPJD 5AV8B 3AYWB 4YS3C 4YM6D 4J8VC 1AOID 5B1LB 1Q9CA 3V9RA 3X1VC 2ZM5A 1TZYD 3AN2B 1KX4A 3TU4A 1P3LD 3MGQC 5B2JA 3RELD 2Y2KA 1M19B 5AVBC 5AVCA 3EPJA 3B0CT 1P3MA 5B24B 4KGCB 1S32B 3X1UA 3UTBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I A;  3REJ A;  4H9S A;  3LEL A;  3WAA C;  3AV2 A;  5F99 D;  3WA9 D;  4UUZ B;  4JJN D;  5B2I D;  3MGP B;  4ZUX A;  1M18 D;  4QLC C;  3LZ1 B;  3C1B B;  3WTP A;  3X1T D;  5AV8 C;  3AYW C;  1M1A B;  2FJ7 D;  1P34 D;  5KDM A;  5B40 D;  2BYK B;  2PYO B;  5B1L C;  3AN2 C;  4J8X A;  5CPK B;  3AZL D;  4H9O A;  3MGR A;  3AV1 B;  1ZLA A;  3AFA B;  1HQ3 A;  3REK B;  5GT3 B;  1P3O D;  1M19 C;  3AZH D;  5B0Z B;  5B24 C;  3AZE B;  3W97 A;  4KGC C;  3MGS D;  1S32 C;  3AZJ D;  1KX5 D;  1EQZ D;  1KX3 D;  3AZN A;  3AZK B;  3MGP C;  5BS7 A;  4J8W D;  2IO5 B;  3LJA D;  5GXQ A;  3LZ1 C;  3KUY D;  3C1B C;  5B1M D;  3O62 A;  5CPJ B;  1BH8 A;  4YM6 B;  3W99 A;  1M1A C;  3A6N D;  1AOI B;  3B6F A;  5AV5 D;  4Z66 A;  1P3K D;  2NZD A;  2PYO C;  1WWS A;  5CPK C;  1P3L B;  3AV1 C;  4G91 B;  5B0Y D;  4XUJ D;  3MVD D;  5GT3 C;  3AFA C;  3REK C;  1P3A A;  1P3F D;  3REL B;  5DNM D;  4X23 A;  1P3G A;  5B0Z C;  4G92 B;  3AZE C;  1H3O B;  4NE6 A;  5JRG D;  1P3B D;  5CP6 D;  3LZ0 A;  3X1S D;  4LD9 D;  4J8U D;  5F99 B;  3KWQ A;  3NQU B;  3WA9 B;  5B2I B;  3AZK C;  2IO5 C;  4KHA A;  4J8V A;  2HIO A;  5B31 D;  3X1V A;  5CPJ C;  3B0C W;  3AZM D;  5AV9 A;  4YM6 C;  2FJ7 B;  1AOI C;  5B40 B;  1JFI A;  4R8P D;  2NQB B;  4WU8 D;  3AZL B;  1P3L C;  1ULY A;  4G91 C;  5B32 A;  1P3O B;  3REL C;  2BYM A;  3C1C D;  3AZH B;  3KXB D;  4G92 C;  5CPI A;  3WAA A;  2ARO B;  3W96 D;  1KX5 B;  1EQZ B;  4QLC A;  5F99 C;  1KX3 B;  3WA9 C;  3R45 B;  5B2I C;  3AYW A;  4J8W B;  5BNV A;  1KX4 D;  1M18 C;  4DRA A;  2YFW A;  3LJA B;  3KUY B;  2HUE B;  5B1L A;  5B1M B;  5AVC D;  1P3M D;  2FJ7 C;  4NE3 A;  5AV5 B;  5B40 C;  3NQJ A;  1P3K B;  4CAY A;  1U35 A;  1ID3 D;  3AZG D;  2NQB C;  3X1U D;  1HTA A;  5JA4 B;  3AZL C;  1P3I D;  2LY8 A;  3REJ D;  5B0Y B;  1P3O C;  3MVD B;  3LEL D;  3AV2 D;  1P3F B;  4WNN B;  3REH D;  5GSU A;  4ZUX D;  5DNM B;  3AZH C;  1F66 A;  2ARO C;  5FUG A;  4UUZ A;  5JRG B;  1N1J A;  3WTP D;  3MGP A;  1P3B B;  1KX5 C;  1EQZ C;  5CP6 B;  3WKJ B;  5AV6 D;  3X1S B;  4LD9 B;  1KX3 C;  3C1B A;  3AZI B;  3UT9 D;  2YFV A;  4J8W C;  4J8X D;  3MGR D;  1ZLA D;  2BYK A;  5B31 B;  3LJA C;  3KUY C;  2HUE C;  1WWI A;  1HQ3 D;  5B1M C;  5BT1 C;  3AZM B;  3VH5 T;  3AFA A;  5GT3 A;  5AV5 C;  5G49 B;  1P3K C;  3W97 D;  4Z2M H;  4R8P B;  5BNX B;  4WU8 B;  5B0Z A;  5GT0 B;  5B0Y C;  3MVD C;  4H9R B;  3UTA A;  1P3F C;  1BH9 B;  3AZN D;  3VH5 A;  3WTP E;  3C1C B;  5DNM C;  4KUD A;  5DNN B;  1F1E A;  5GXQ D;  5JRG C;  3W96 B;  3AZK A;  3O62 D;  1P3B C;  5CP6 C;  3WKJ C;  3X1S C;  4LD9 C;  3B6F D;  5BO0 A;  4H9Q B;  4Z66 D;  3MNN D;  3AZI C;  2F8N A;  3V9R B;  4CSR B;  4YM6 A;  1KX4 B;  1AOI A;  5B31 C;  1P3A D;  1B6W A;  3AZM C;  1P3P A;  1TAF A;  3VH6 T;  5AVC B;  4X23 D;  3AZF D;  1ID3 B;  5AY8 D;  3REL A;  4R8P C;  5E5A A;  3AZG B;  4WU8 C;  4M6B A;  3LZ0 D;  2CV5 A;  1P3I B;  3REJ B;  5GT0 C;  3AV2 B;  4XZQ A;  1H3O A;  3VH6 A;  3KWQ D;  3C1C C;  3REI A;  3REH B;  4ZUX B;  5DNN C;  2F8N K;  1TZY B;  2HIO D;  3WA9 A;  5B31 G;  3WTP B;  3W96 C;  3X1V D;  5AV6 B;  5AV9 D;  5KDM B;  3UT9 B;  4Z5T A;  1KX4 C;  4J8X B;  4H9O B;  3MGR B;  5B32 D;  1HQ3 B;  2NQB A;  5B33 D;  5AVC C;  4JJN B;  5CPI D;  1ID3 C;  3W97 B;  3AZG C;  4YS3 A;  1M18 B;  1P3I C;  3REJ C;  2ARO A;  4H9S C;  3AV2 C;  3X1T B;  4H9P A;  3REH C;  1P34 B;  4ZUX C;  3MGQ A;  2CWE A;  4EO5 B;  1KX3 A;  1TZY C;  3WTP C;  3R45 A;  5B1L D;  5AVB A;  4H9N A;  3B6G D;  1BH8 B;  5AV6 C;  3MNN B;  4Z66 B;  5C3I B;  3UT9 C;  3UTB A;  1U35 D;  4WU9 D;  3MGS B;  4J8X C;  3W98 D;  3MGR C;  3AZJ B;  1HQ3 C;  1P3A B;  5GSU D;  3AZF B;  1F66 D;  5AV8 A;  4JJN C;  3W97 C;  5AY8 B;  1P3F A;  3TU4 D;  3LZ0 B;  5B2J D;  3AN2 A;  3X1T C;  5JRG A;  2RVQ D;  5CP6 A;  3WKJ A;  3A6N B;  1P34 C;  5BS7 C;  4EO5 C;  4KHA B;  2HIO B;  4E45 A;  3AZI A;  1M19 A;  1A7W A;  5B24 A;  4KGC A;  4XUJ B;  5AV9 B;  1S32 A;  4Z2M G;  3MNN C;  5C3I C;  4Z66 C;  3MGS C;  4E44 A;  5B32 B;  3AZJ C;  1P3A C;  3UTA D;  3B0B A;  5BNX A;  4ZBJ B;  4J8U B;  5B33 B;  3LZ1 A;  3AZF C;  5GT0 A;  4KUD D;  5CPI B;  5AY8 C;  1BH9 A;  1M1A A;  3LZ0 C;  5DNN A;  2PYO A;  5CPK A;  2F8N D;  3AV1 A;  3A6N C;  3REK A;  2F8N H;  5BNV B;  4H9Q A;  2HIO C;  2YFW B;  4CSR A;  3B6G B;  3AZE A;  1P3P D;  4XUJ C;  5AV9 C;  3NQJ B;  4CAY B;  1U35 B;  4WU9 B;  5E5A D;  3KXB B;  2JSS A;  3W98 B;  2CV5 D;  5B32 C;  1ID3 A;  3AZG A;  4XZQ D;  4ZBJ C;  4HGA B;  3W99 D;  4J8U C;  4AWL B;  3REI D;  5GSU B;  5B33 C;  1F66 B;  2NZD D;  5CPJ A;  1BFM A;  5CPI C;  5FUG B;  1N1J B;  3TU4 B;  3REH A;  5B2J B;  1TZY A;  1P3L A;  4Z5T D;  2YFV B;  1P3M B;  1P3G D;  5AV6 A;  3B0D B;  3UT9 A;  3X1U B;  5B32 G;  4WV4 B;  3B6G C;  2NQB D;  3LEL B;  1KU5 A;  1U35 C;  4WU9 C;  4YS3 D;  3KXB C;  5F99 A;  3W98 C;  4J8V D;  3NQU A;  4JJN A;  5B2I A;  2ARO D;  3UTA B;  1M18 A;  4AWL C;  4HGA C;  5GSU C;  3MGQ D;  1F66 C;  4KUD B;  3X1T A;  2L5A A;  5AVB D;  3TU4 C;  1P34 A;  2FJ7 A;  1ZLA B;  5B40 A;  5B2J C;  1R4V A;  5BO0 B;  2RVQ C;  5BT1 D;  3AZL A;  3UTB D;  2F8N B;  1P3M C;  1P3O A;  3WAA D;  3B0D C;  3MNN A;  3X1U C;  3AZH A;  1P3P B;  3MGS A;  1TAF B;  4QLC D;  3LEL C;  3AZJ A;  3AZN B;  1KX5 A;  5AV8 D;  1EQZ A;  3AYW D;  5E5A B;  3AZF A;  2CV5 B;  5GXQ B;  5AY8 A;  3O62 B;  3AN2 D;  3VH5 W;  4XZQ B;  4WZS B;  4J8W A;  3UTA C;  3W99 B;  3REI B;  3LJA A;  3KUY A;  3WKJ D;  3B6F B;  5B1M A;  4KUD C;  2NZD B;  4NE5 A;  3AZI D;  1M19 D;  3A6N A;  4NFT A;  5AV5 A;  5B24 D;  1P3K A;  1ZLA C;  4KGC D;  1S32 D;  5JA4 A;  4Z5T B;  4X23 B;  1P3G B;  5B0Y A;  4XUJ A;  3MVD A;  4WNN A;  3MGP D;  5DNM A;  4DRB A;  1P3P C;  3KSY A;  3LZ1 D;  3C1B D;  3KWQ B;  5GT0 D;  3AZN C;  1P3B A;  5E5A C;  3X1S A;  4YS3 B;  4LD9 A;  4J8U A;  1M1A D;  5B33 A;  4J8V B;  2CV5 C;  5GXQ C;  3VH6 W;  5DNN D;  3X1V B;  3O62 C;  2PYO D;  4XZQ C;  4H9P B;  5CPK D;  3W99 C;  2F8N G;  3AV1 D;  3REI C;  5B31 A;  3AFA D;  3MGQ B;  3REK D;  5GT3 D;  1B67 A;  3B6F C;  2NZD C;  1JFI B;  3AZM A;  5AVB B;  4H9N B;  5B0Z D;  3AZE D;  5G49 A;  4R8P A;  4WU8 A;  2BYM B;  3UTB B;  3B6G A;  4Z5T C;  4X23 C;  1P3G C;  5CHL B;  3WAA B;  4H9R A;  3C1C A;  3AZK D;  4WU9 A;  3KXB A;  3W98 A;  4QLC B;  3KWQ C;  3W96 A;  5CPJ D;  5AV8 B;  3AYW B;  4YS3 C;  4YM6 D;  4J8V C;  1AOI D;  5B1L B;  1Q9C A;  3V9R A;  3X1V C;  3AN2 B;  1TZY D;  1KX4 A;  3TU4 A;  1P3L D;  3MGQ C;  5B2J A;  3REL D;  1M19 B;  5AVB C;  5AVC A;  1P3M A;  3B0C T;  5B24 B;  4KGC B;  1S32 B;  3X1U A;  3UTB C; 
#chains in the Genus database with same CATH topology
 1P3I A;  3REJ A;  4H9S A;  3LEL A;  3WAA C;  3AV2 A;  5F99 D;  3WA9 D;  4UUZ B;  3FDD A;  4JJN D;  5B2I D;  3MGP B;  4ZUX A;  3EPL A;  1M18 D;  4QLC C;  3LZ1 B;  3C1B B;  3WTP A;  3X1T D;  5AV8 C;  2Y2M A;  3AYW C;  1M1A B;  2FJ7 D;  1P34 D;  5KDM A;  5B40 D;  2BYK B;  2ZY5 A;  2PYO B;  5B1L C;  3AN2 C;  4J8X A;  5CPK B;  3AZL D;  4H9O A;  3MGR A;  3AV1 B;  1ZLA A;  3AFA B;  1HQ3 A;  3REK B;  5GT3 B;  1P3O D;  1M19 C;  3AZH D;  5B0Z B;  5B24 C;  3AZE B;  3W97 A;  4KGC C;  3MGS D;  1S32 C;  3AZJ D;  1KX5 D;  1EQZ D;  2J8P A;  1T3U A;  1KX3 D;  3AZN A;  3AZK B;  3MGP C;  5BS7 A;  4J8W D;  2IO5 B;  3LJA D;  5GXQ A;  3LZ1 C;  3KUY D;  3C1B C;  5B1M D;  3O62 A;  5CPJ B;  1BH8 A;  4YM6 B;  3W99 A;  3A1K A;  1M1A C;  3A6N D;  1AOI B;  3B6F A;  5AV5 D;  4Z66 A;  1P3K D;  2NZD A;  2PYO C;  1WWS A;  2G5H C;  5CPK C;  1P3L B;  3AV1 C;  4G91 B;  5B0Y D;  4XUJ D;  3MVD D;  5GT3 C;  3AFA C;  3REK C;  1P3A A;  1P3F D;  3REL B;  2Y2I A;  2Y2O A;  5DNM D;  4X23 A;  1P3G A;  5B0Z C;  4G92 B;  3AZE C;  1H3O B;  4NE6 A;  5JRG D;  1P3B D;  5CP6 D;  3LZ0 A;  3X1S D;  4LD9 D;  4J8U D;  5F99 B;  3KWQ A;  2Y2Q A;  3NQU B;  3WA9 B;  5B2I B;  3AZK C;  2IO5 C;  4KHA A;  2DQN C;  4J8V A;  2HIO A;  5B31 D;  3X1V A;  5CPJ C;  3B0C W;  3AZM D;  5AV9 A;  4YM6 C;  2DF4 C;  2FJ7 B;  1AOI C;  5B40 B;  1JFI A;  4R8P D;  2NQB B;  4WU8 D;  3AZL B;  1P3L C;  1ULY A;  4G91 C;  5B32 A;  1P3O B;  3REL C;  2BYM A;  3EG5 B;  3C1C D;  3AZH B;  3KXB D;  4G92 C;  5CPI A;  3WAA A;  2ARO B;  3W96 D;  1KX5 B;  1EQZ B;  4QLC A;  3H0L C;  5F99 C;  1KX3 B;  3WA9 C;  3R45 B;  5B2I C;  3AYW A;  4J8W B;  5BNV A;  1KX4 D;  1M18 C;  4DRA A;  2YFW A;  3LJA B;  3KUY B;  2HUE B;  5B1L A;  5B1M B;  5AVC D;  1P3M D;  2FJ7 C;  4NE3 A;  5AV5 B;  5B40 C;  3NQJ A;  1P3K B;  4CAY A;  1U35 A;  1ID3 D;  3AZG D;  2Y2P A;  2NQB C;  3X1U D;  1HTA A;  5JA4 B;  3AZL C;  1P3I D;  2LY8 A;  3REJ D;  5B0Y B;  1P3O C;  3MVD B;  3LEL D;  3AV2 D;  1P3F B;  4WNN B;  2FFF B;  1W2E A;  3REH D;  5GSU A;  4ZUX D;  5DNM B;  3AZH C;  1F66 A;  2ARO C;  5FUG A;  2JCH A;  4UUZ A;  1N1J A;  5JRG B;  3WTP D;  3MGP A;  1P3B B;  1KX5 C;  1EQZ C;  5CP6 B;  3WKJ B;  5AV6 D;  3X1S B;  4LD9 B;  1KX3 C;  3C1B A;  3AZI B;  3UT9 D;  2YFV A;  4J8W C;  4J8X D;  3MGR D;  1ZLA D;  2BYK A;  5B31 B;  3LJA C;  3KUY C;  2HUE C;  1WWI A;  1HQ3 D;  5B1M C;  5BT1 C;  3AZM B;  3VH5 T;  3AFA A;  5GT3 A;  5AV5 C;  5G49 B;  1P3K C;  3W97 D;  4Z2M H;  4R8P B;  5BNX B;  4WU8 B;  5B0Z A;  5GT0 B;  5B0Y C;  3MVD C;  4H9R B;  3UTA A;  1P3F C;  1BH9 B;  3AZN D;  2VQR A;  3VH5 A;  3WTP E;  3C1C B;  4UPK A;  5DNM C;  4KUD A;  5DNN B;  1F1E A;  5GXQ D;  5JRG C;  3W96 B;  3AZK A;  3O62 D;  1P3B C;  5CP6 C;  2BG1 A;  3WKJ C;  3X1S C;  4LD9 C;  3B6F D;  5BO0 A;  4H9Q B;  4Z66 D;  3MNN D;  3AZI C;  2F8N A;  3AL0 C;  3V9R B;  4CSR B;  4YM6 A;  1KX4 B;  2ZY3 A;  3H0R C;  1AOI A;  5B31 C;  1P3A D;  1B6W A;  3AZM C;  1P3P A;  1TAF A;  3VH6 T;  5AVC B;  3P5J B;  4X23 D;  3AZF D;  1ID3 B;  5AY8 D;  3REL A;  4R8P C;  5E5A A;  3AZG B;  4WU8 C;  4M6B A;  3LZ0 D;  2CV5 A;  1P3I B;  3REJ B;  5GT0 C;  3AV2 B;  4XZQ A;  1H3O A;  3VH6 A;  3KWQ D;  3C1C C;  3REI A;  3REH B;  4ZUX B;  5DNN C;  2F8N K;  1TZY B;  2HIO D;  3WA9 A;  5B31 G;  3WTP B;  3W96 C;  3X1V D;  5AV6 B;  5AV9 D;  5KDM B;  3UT9 B;  4Z5T A;  1KX4 C;  4J8X B;  4DQY B;  4H9O B;  3MGR B;  5B32 D;  1HQ3 B;  2G5I C;  2Y2N A;  3F6T A;  2NQB A;  5B33 D;  5AVC C;  4JJN B;  5CPI D;  1ID3 C;  3W97 B;  3AZG C;  4YS3 A;  1M18 B;  1P3I C;  3REJ C;  2ARO A;  4H9S C;  3AV2 C;  3X1T B;  4H9P A;  3REH C;  1P34 B;  4ZUX C;  3MGQ A;  2CWE A;  4EO5 B;  1KX3 A;  1TZY C;  3WTP C;  3R45 A;  5B1L D;  5AVB A;  4H9N A;  3B6G D;  1BH8 B;  5AV6 C;  3MNN B;  4Z66 B;  5C3I B;  3UT9 C;  3UTB A;  1U35 D;  4WU9 D;  3MGS B;  4J8X C;  3W98 D;  3MGR C;  3AZJ B;  1HQ3 C;  1P3A B;  2Y2H A;  5GSU D;  3AZF B;  1F66 D;  5AV8 A;  4JJN C;  3W97 C;  5AY8 B;  1P3F A;  3KFU G;  2XD1 A;  3TU4 D;  3LZ0 B;  5B2J D;  3AN2 A;  3X1T C;  2UWX A;  5JRG A;  2RVQ D;  5CP6 A;  3WKJ A;  3A6N B;  1P34 C;  5BS7 C;  4EO5 C;  4KHA B;  2HIO B;  4E45 A;  3AZI A;  1M19 A;  1A7W A;  5B24 A;  4KGC A;  4XUJ B;  5AV9 B;  1S32 A;  4Z2M G;  3MNN C;  5C3I C;  4Z66 C;  3MGS C;  4E44 A;  5B32 B;  3AZJ C;  1P3A C;  3UTA D;  3B0B A;  5BNX A;  4ZBJ B;  4J8U B;  5B33 B;  3LZ1 A;  3AZF C;  5GT0 A;  4KUD D;  5CPI B;  5AY8 C;  1BH9 A;  1M1A A;  3LZ0 C;  5DNN A;  2PYO A;  5CPK A;  2F8N D;  3AV1 A;  3A6N C;  3REK A;  2F8N H;  5BNV B;  4H9Q A;  2HIO C;  2YFW B;  4CSR A;  3B6G B;  3AZE A;  1P3P D;  4XUJ C;  5AV9 C;  3NQJ B;  4CAY B;  1U35 B;  4WU9 B;  5E5A D;  3KXB B;  2JSS A;  2ZY4 A;  3W98 B;  2CV5 D;  5B32 C;  1ID3 A;  3AZG A;  4XZQ D;  4WJ3 C;  4ZBJ C;  4HGA B;  3W99 D;  4J8U C;  4AWL B;  3REI D;  5GSU B;  5B33 C;  1F66 B;  2NZD D;  5CPJ A;  1BFM A;  3H0M C;  5CPI C;  5FUG B;  1N1J B;  3TU4 B;  3REH A;  5B2J B;  1TZY A;  1P3L A;  3IP4 C;  4Z5T D;  2YFV B;  1P3M B;  1P3G D;  5AV6 A;  3B0D B;  3UT9 A;  3X1U B;  5B32 G;  4WV4 B;  3B6G C;  2NQB D;  3LEL B;  1KU5 A;  2RIQ A;  1U35 C;  4WU9 C;  4YS3 D;  3KXB C;  2ZY2 A;  5F99 A;  3W98 C;  4J8V D;  3NQU A;  4JJN A;  1Z2C B;  5B2I A;  2ARO D;  3UTA B;  1M18 A;  4AWL C;  4HGA C;  5GSU C;  3MGQ D;  1F66 C;  4KUD B;  3X1T A;  2L5A A;  2W8S A;  5AVB D;  3TU4 C;  1P34 A;  2FJ7 A;  1ZLA B;  5B40 A;  5B2J C;  1R4V A;  2F2A C;  5BO0 B;  2RVQ C;  5BT1 D;  3AZL A;  3UTB D;  2F8N B;  1P3M C;  1P3O A;  2XD5 A;  3WAA D;  3A1I A;  3B0D C;  3MNN A;  3X1U C;  3AZH A;  1P3P B;  3MGS A;  1TAF B;  4QLC D;  3LEL C;  2Y2J A;  3AZJ A;  3AZN B;  1KX5 A;  5AV8 D;  1EQZ A;  3AYW D;  5E5A B;  2JE5 A;  3AZF A;  2CV5 B;  5GXQ B;  5AY8 A;  3O62 B;  3AN2 D;  3VH5 W;  4XZQ B;  4WZS B;  4J8W A;  3UTA C;  3W99 B;  3REI B;  3LJA A;  3KUY A;  3WKJ D;  3B6F B;  5B1M A;  4KUD C;  2NZD B;  4NE5 A;  3AZI D;  1M19 D;  3A6N A;  4NFT A;  5AV5 A;  5B24 D;  1P3K A;  1ZLA C;  4KGC D;  1S32 D;  5JA4 A;  4Z5T B;  4X23 B;  1P3G B;  5B0Y A;  4XUJ A;  3MVD A;  4WNN A;  3MGP D;  5DNM A;  4DRB A;  1PZR A;  1P3P C;  3KSY A;  3LZ1 D;  3C1B D;  3KWQ B;  5GT0 D;  3AZN C;  1P3B A;  5E5A C;  3X1S A;  4YS3 B;  4LD9 A;  4J8U A;  1M1A D;  5B33 A;  4J8V B;  2CV5 C;  5GXQ C;  3VH6 W;  5DNN D;  3X1V B;  3O62 C;  2PYO D;  4XZQ C;  4H9P B;  5CPK D;  3W99 C;  2F8N G;  3AV1 D;  3REI C;  5B31 A;  3AFA D;  3MGQ B;  3REK D;  5GT3 D;  1B67 A;  3B6F C;  2NZD C;  1JFI B;  3EPH A;  3AZM A;  2Y2G A;  5AVB B;  3EPK A;  4H9N B;  5B0Z D;  3AZE D;  5G49 A;  4R8P A;  4WU8 A;  2BYM B;  3UTB B;  3B6G A;  4Z5T C;  4X23 C;  1P3G C;  5CHL B;  3WAA B;  4H9R A;  3C1C A;  3AZK D;  4WU9 A;  2Y2L A;  3KXB A;  3W98 A;  4QLC B;  3KWQ C;  3W96 A;  5CPJ D;  5AV8 B;  3AYW B;  4YS3 C;  4YM6 D;  4J8V C;  1AOI D;  5B1L B;  1Q9C A;  3V9R A;  3X1V C;  2ZM5 A;  1TZY D;  3AN2 B;  1KX4 A;  3TU4 A;  1P3L D;  3MGQ C;  5B2J A;  3REL D;  2Y2K A;  1M19 B;  5AVB C;  5AVC A;  3EPJ A;  3B0C T;  1P3M A;  5B24 B;  4KGC B;  1S32 B;  3X1U A;  3UTB C; 
#chains in the Genus database with same CATH homology
 1P3I A;  3REJ A;  4H9S A;  3LEL A;  3WAA C;  3AV2 A;  5F99 D;  3WA9 D;  4UUZ B;  3FDD A;  4JJN D;  5B2I D;  3MGP B;  4ZUX A;  3EPL A;  1M18 D;  4QLC C;  3LZ1 B;  3C1B B;  3WTP A;  3X1T D;  5AV8 C;  2Y2M A;  3AYW C;  1M1A B;  2FJ7 D;  1P34 D;  5KDM A;  5B40 D;  2BYK B;  2ZY5 A;  2PYO B;  5B1L C;  3AN2 C;  4J8X A;  5CPK B;  3AZL D;  4H9O A;  3MGR A;  3AV1 B;  1ZLA A;  3AFA B;  1HQ3 A;  3REK B;  5GT3 B;  1P3O D;  1M19 C;  3AZH D;  5B0Z B;  5B24 C;  3AZE B;  3W97 A;  4KGC C;  3MGS D;  1S32 C;  3AZJ D;  1KX5 D;  1EQZ D;  2J8P A;  1T3U A;  1KX3 D;  3AZN A;  3AZK B;  3MGP C;  5BS7 A;  4J8W D;  2IO5 B;  3LJA D;  5GXQ A;  3LZ1 C;  3KUY D;  3C1B C;  5B1M D;  3O62 A;  5CPJ B;  1BH8 A;  4YM6 B;  3W99 A;  3A1K A;  1M1A C;  3A6N D;  1AOI B;  3B6F A;  5AV5 D;  4Z66 A;  1P3K D;  2NZD A;  2PYO C;  1WWS A;  2G5H C;  5CPK C;  1P3L B;  3AV1 C;  4G91 B;  5B0Y D;  4XUJ D;  3MVD D;  5GT3 C;  3AFA C;  3REK C;  1P3A A;  1P3F D;  3REL B;  2Y2I A;  2Y2O A;  5DNM D;  4X23 A;  1P3G A;  5B0Z C;  4G92 B;  3AZE C;  1H3O B;  4NE6 A;  5JRG D;  1P3B D;  5CP6 D;  3LZ0 A;  3X1S D;  4LD9 D;  4J8U D;  5F99 B;  3KWQ A;  2Y2Q A;  3NQU B;  3WA9 B;  5B2I B;  3AZK C;  2IO5 C;  4KHA A;  2DQN C;  4J8V A;  2HIO A;  5B31 D;  3X1V A;  5CPJ C;  3B0C W;  3AZM D;  5AV9 A;  4YM6 C;  2DF4 C;  2FJ7 B;  1AOI C;  5B40 B;  1JFI A;  4R8P D;  2NQB B;  4WU8 D;  3AZL B;  1P3L C;  1ULY A;  4G91 C;  5B32 A;  1P3O B;  3REL C;  2BYM A;  3EG5 B;  3C1C D;  3AZH B;  3KXB D;  4G92 C;  5CPI A;  3WAA A;  2ARO B;  3W96 D;  1KX5 B;  1EQZ B;  4QLC A;  3H0L C;  5F99 C;  1KX3 B;  3WA9 C;  3R45 B;  5B2I C;  3AYW A;  4J8W B;  5BNV A;  1KX4 D;  1M18 C;  4DRA A;  2YFW A;  3LJA B;  3KUY B;  2HUE B;  5B1L A;  5B1M B;  5AVC D;  1P3M D;  2FJ7 C;  4NE3 A;  5AV5 B;  5B40 C;  3NQJ A;  1P3K B;  4CAY A;  1U35 A;  1ID3 D;  3AZG D;  2Y2P A;  2NQB C;  3X1U D;  1HTA A;  5JA4 B;  3AZL C;  1P3I D;  2LY8 A;  3REJ D;  5B0Y B;  1P3O C;  3MVD B;  3LEL D;  3AV2 D;  1P3F B;  4WNN B;  2FFF B;  1W2E A;  3REH D;  5GSU A;  4ZUX D;  5DNM B;  3AZH C;  1F66 A;  2ARO C;  5FUG A;  2JCH A;  4UUZ A;  1N1J A;  5JRG B;  3WTP D;  3MGP A;  1P3B B;  1KX5 C;  1EQZ C;  5CP6 B;  3WKJ B;  5AV6 D;  3X1S B;  4LD9 B;  1KX3 C;  3C1B A;  3AZI B;  3UT9 D;  2YFV A;  4J8W C;  4J8X D;  3MGR D;  1ZLA D;  2BYK A;  5B31 B;  3LJA C;  3KUY C;  2HUE C;  1WWI A;  1HQ3 D;  5B1M C;  5BT1 C;  3AZM B;  3VH5 T;  3AFA A;  5GT3 A;  5AV5 C;  5G49 B;  1P3K C;  3W97 D;  4Z2M H;  4R8P B;  5BNX B;  4WU8 B;  5B0Z A;  5GT0 B;  5B0Y C;  3MVD C;  4H9R B;  3UTA A;  1P3F C;  1BH9 B;  3AZN D;  2VQR A;  3VH5 A;  3WTP E;  3C1C B;  4UPK A;  5DNM C;  4KUD A;  5DNN B;  1F1E A;  5GXQ D;  5JRG C;  3W96 B;  3AZK A;  3O62 D;  1P3B C;  5CP6 C;  2BG1 A;  3WKJ C;  3X1S C;  4LD9 C;  3B6F D;  5BO0 A;  4H9Q B;  4Z66 D;  3MNN D;  3AZI C;  2F8N A;  3AL0 C;  3V9R B;  4CSR B;  4YM6 A;  1KX4 B;  2ZY3 A;  3H0R C;  1AOI A;  5B31 C;  1P3A D;  1B6W A;  3AZM C;  1P3P A;  1TAF A;  3VH6 T;  5AVC B;  3P5J B;  4X23 D;  3AZF D;  1ID3 B;  5AY8 D;  3REL A;  4R8P C;  5E5A A;  3AZG B;  4WU8 C;  4M6B A;  3LZ0 D;  2CV5 A;  1P3I B;  3REJ B;  5GT0 C;  3AV2 B;  4XZQ A;  1H3O A;  3VH6 A;  3KWQ D;  3C1C C;  3REI A;  3REH B;  4ZUX B;  5DNN C;  2F8N K;  1TZY B;  2HIO D;  3WA9 A;  5B31 G;  3WTP B;  3W96 C;  3X1V D;  5AV6 B;  5AV9 D;  5KDM B;  3UT9 B;  4Z5T A;  1KX4 C;  4J8X B;  4DQY B;  4H9O B;  3MGR B;  5B32 D;  1HQ3 B;  2G5I C;  2Y2N A;  3F6T A;  2NQB A;  5B33 D;  5AVC C;  4JJN B;  5CPI D;  1ID3 C;  3W97 B;  3AZG C;  4YS3 A;  1M18 B;  1P3I C;  3REJ C;  2ARO A;  4H9S C;  3AV2 C;  3X1T B;  4H9P A;  3REH C;  1P34 B;  4ZUX C;  3MGQ A;  2CWE A;  4EO5 B;  1KX3 A;  1TZY C;  3WTP C;  3R45 A;  5B1L D;  5AVB A;  4H9N A;  3B6G D;  1BH8 B;  5AV6 C;  3MNN B;  4Z66 B;  5C3I B;  3UT9 C;  3UTB A;  1U35 D;  4WU9 D;  3MGS B;  4J8X C;  3W98 D;  3MGR C;  3AZJ B;  1HQ3 C;  1P3A B;  2Y2H A;  5GSU D;  3AZF B;  1F66 D;  5AV8 A;  4JJN C;  3W97 C;  5AY8 B;  1P3F A;  3KFU G;  2XD1 A;  3TU4 D;  3LZ0 B;  5B2J D;  3AN2 A;  3X1T C;  2UWX A;  5JRG A;  2RVQ D;  5CP6 A;  3WKJ A;  3A6N B;  1P34 C;  5BS7 C;  4EO5 C;  4KHA B;  2HIO B;  4E45 A;  3AZI A;  1M19 A;  1A7W A;  5B24 A;  4KGC A;  4XUJ B;  5AV9 B;  1S32 A;  4Z2M G;  3MNN C;  5C3I C;  4Z66 C;  3MGS C;  4E44 A;  5B32 B;  3AZJ C;  1P3A C;  3UTA D;  3B0B A;  5BNX A;  4ZBJ B;  4J8U B;  5B33 B;  3LZ1 A;  3AZF C;  5GT0 A;  4KUD D;  5CPI B;  5AY8 C;  1BH9 A;  1M1A A;  3LZ0 C;  5DNN A;  2PYO A;  5CPK A;  2F8N D;  3AV1 A;  3A6N C;  3REK A;  2F8N H;  5BNV B;  4H9Q A;  2HIO C;  2YFW B;  4CSR A;  3B6G B;  3AZE A;  1P3P D;  4XUJ C;  5AV9 C;  3NQJ B;  4CAY B;  1U35 B;  4WU9 B;  5E5A D;  3KXB B;  2JSS A;  2ZY4 A;  3W98 B;  2CV5 D;  5B32 C;  1ID3 A;  3AZG A;  4XZQ D;  4WJ3 C;  4ZBJ C;  4HGA B;  3W99 D;  4J8U C;  4AWL B;  3REI D;  5GSU B;  5B33 C;  1F66 B;  2NZD D;  5CPJ A;  1BFM A;  3H0M C;  5CPI C;  5FUG B;  1N1J B;  3TU4 B;  3REH A;  5B2J B;  1TZY A;  1P3L A;  3IP4 C;  4Z5T D;  2YFV B;  1P3M B;  1P3G D;  5AV6 A;  3B0D B;  3UT9 A;  3X1U B;  5B32 G;  4WV4 B;  3B6G C;  2NQB D;  3LEL B;  1KU5 A;  2RIQ A;  1U35 C;  4WU9 C;  4YS3 D;  3KXB C;  2ZY2 A;  5F99 A;  3W98 C;  4J8V D;  3NQU A;  4JJN A;  1Z2C B;  5B2I A;  2ARO D;  3UTA B;  1M18 A;  4AWL C;  4HGA C;  5GSU C;  3MGQ D;  1F66 C;  4KUD B;  3X1T A;  2L5A A;  2W8S A;  5AVB D;  3TU4 C;  1P34 A;  2FJ7 A;  1ZLA B;  5B40 A;  5B2J C;  1R4V A;  2F2A C;  5BO0 B;  2RVQ C;  5BT1 D;  3AZL A;  3UTB D;  2F8N B;  1P3M C;  1P3O A;  2XD5 A;  3WAA D;  3A1I A;  3B0D C;  3MNN A;  3X1U C;  3AZH A;  1P3P B;  3MGS A;  1TAF B;  4QLC D;  3LEL C;  2Y2J A;  3AZJ A;  3AZN B;  1KX5 A;  5AV8 D;  1EQZ A;  3AYW D;  5E5A B;  2JE5 A;  3AZF A;  2CV5 B;  5GXQ B;  5AY8 A;  3O62 B;  3AN2 D;  3VH5 W;  4XZQ B;  4WZS B;  4J8W A;  3UTA C;  3W99 B;  3REI B;  3LJA A;  3KUY A;  3WKJ D;  3B6F B;  5B1M A;  4KUD C;  2NZD B;  4NE5 A;  3AZI D;  1M19 D;  3A6N A;  4NFT A;  5AV5 A;  5B24 D;  1P3K A;  1ZLA C;  4KGC D;  1S32 D;  5JA4 A;  4Z5T B;  4X23 B;  1P3G B;  5B0Y A;  4XUJ A;  3MVD A;  4WNN A;  3MGP D;  5DNM A;  4DRB A;  1PZR A;  1P3P C;  3KSY A;  3LZ1 D;  3C1B D;  3KWQ B;  5GT0 D;  3AZN C;  1P3B A;  5E5A C;  3X1S A;  4YS3 B;  4LD9 A;  4J8U A;  1M1A D;  5B33 A;  4J8V B;  2CV5 C;  5GXQ C;  3VH6 W;  5DNN D;  3X1V B;  3O62 C;  2PYO D;  4XZQ C;  4H9P B;  5CPK D;  3W99 C;  2F8N G;  3AV1 D;  3REI C;  5B31 A;  3AFA D;  3MGQ B;  3REK D;  5GT3 D;  1B67 A;  3B6F C;  2NZD C;  1JFI B;  3EPH A;  3AZM A;  2Y2G A;  5AVB B;  3EPK A;  4H9N B;  5B0Z D;  3AZE D;  5G49 A;  4R8P A;  4WU8 A;  2BYM B;  3UTB B;  3B6G A;  4Z5T C;  4X23 C;  1P3G C;  5CHL B;  3WAA B;  4H9R A;  3C1C A;  3AZK D;  4WU9 A;  2Y2L A;  3KXB A;  3W98 A;  4QLC B;  3KWQ C;  3W96 A;  5CPJ D;  5AV8 B;  3AYW B;  4YS3 C;  4YM6 D;  4J8V C;  1AOI D;  5B1L B;  1Q9C A;  3V9R A;  3X1V C;  2ZM5 A;  1TZY D;  3AN2 B;  1KX4 A;  3TU4 A;  1P3L D;  3MGQ C;  5B2J A;  3REL D;  2Y2K A;  1M19 B;  5AVB C;  5AVC A;  3EPJ A;  3B0C T;  1P3M A;  5B24 B;  4KGC B;  1S32 B;  3X1U A;  3UTB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...