4YS3A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 96
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3A00
1P34C 1P3OA 5JA4B 3AZLA 3RELD 3W99B 3UT9A 1P3MB 3VH5A 5B0YD 2FJ7B 4KHAA 3B6GC 1ULYA 3WTPA 5AV6A 3A6ND 4JJNC 5B33A 5B31D 5JRGD 5CPID 5AY8A 1ZLAD 1AOID 1ZLAB 3C1BC 3AN2C 5GT3C 4XZQD 4XZQB 5AV5B 3W98D 3REHB 4EO5B 1HQ3A 5F99D 3LZ1B 5B1MA 3X1UC 3MNND 5B40A 3MGPD 4J8VB 4H9OB 5B2JB 3AZED 3MGRC 4H9NA 3KXBB 4YS3D 3O62C 5DNNB 5B2IB 3REJA 5GXQC 3W97B 5AVCC 3LJAA 1H3OB 2NZDC 3MGQC 4J8WB 2CV5C 5C3IB 5DNMD 4KGCA 3MGSD 3MGSB 3X1SC 1EQZD 3B0CT 3AZKD 3AZNC 4XUJD 5AV9B 3B6FB 3RELC 4H9RA 4WV4B 3WA9D 5GT3A 3W99C 2FJ7C 1N1JA 3WAAB 1P3LA 3A6NC 3VH5T 5BNVB 3X1VA 5E5AB 5CPJA 1M18A 1F66D 5B31C 5JRGC 5CPIC 1ZLAC 3KUYD 1AOIC 1P3OD 4XZQC 2IO5B 4WNNA 3AZLD 1A7WA 5AV5C 5AVBD 3TU4A 4WU9B 5GXQA 4H9QA 3UT9D 3LZ1C 1BH9B 3WTPD 5AV6D 3MNNC 3MGPC 4J8VC 5B33D 3UTAB 3AV2B 5AY8D 3NQJA 5DNNC 5B2IC 2RVQD 3X1SA 5CP6B 3C1CA 3R45A 4AWLB 5JA4A 1HQ3D 1HQ3B 3X1TB 2CWEA 5B1MD 2JSSA 5B1MB 5CPKD 4J8WC 3W99A 1P3MA 5C3IC 5B40D 5B40B 4KUDA 2FJ7A 3MGSC 4NE3A 1EQZC 3AZKC 4XUJC 2LY8A 3REJD 5AV9C 5GT0B 3LJAD 3LJAB 5AV5A 3REHA 4CSRB 5G49A 5E5AC 4KGCD 4HGAC 4J8VA 4H9OA 5B2JA 4LD9B 5B32G 3KXBA 2IO5C 3REIB 5DNNA 3C1BD 4WU9C 5GT3D 3W97A 3UT9C 2BYMB 3WTPE 1N1JB 1BFMA 3B0CW 3AZMB 1P3LB 4QLCB 1P3LD 4NFTA 4E44A 5CPJD 3X1VD 4J8WA 5B33C 5CPJB 2NQBC 1M18D 1M18B 3AV2C 5CP6C 4H9SC 4AWLC 3VH5W 1U35B 3TU4D 3TU4B 5GXQD 1HQ3C 5AV9A 3X1TC 3B6FA 5B1MC 5B40C 3AZFB 2NZDD 3WAAA 1Q9CA 5BO0A 1TZYA 3KWQB 5BNVA 5E5AA 4H9PB 3X1SD 3C1CD 3REJC 1KX4B 3LJAC 5BS7A 3AV1B 4WU9A 3W99D 1P3MD 4KUDB 2BYKA 2F8NK 2FJ7D 4KGCC 1BH9A 4LD9C 3UTAA 3AV2A 5CP6A 4H9SA 1BH8A 5B32B 5AV5D 1P3GB 1KX3A 3REHD 1P3LC 3X1TA 5G49B 3LZ1D 3REKA 3X1VC 5CPJC 2AROB 1M18C 4J8VD 5B2JD 4Z2MG 3AZJB 3KXBD 5DNND 5B2ID 3TU4C 3W97D 5GT0A 4J8WD 4CSRA 1F1EA 4ZUXA 2HUEB 3C1CC 4LD9A 5AV8B 5AV9D 3REIA 3B6FD 3AV1C 1P3MC 5B24A 2BYMA 4KUDC 1P3PA 3WAAD 3AZIB 4J8XA 3VH6A 5BO0B 3AZMA 1TZYD 1TZYB 4QLCA 3AZHB 5E5AD 4WZSB 1M19B 5B32C 1U35A 4NE6A 1P3GC 4WU9D 3REHC 4EO5C 2BYKB 2PYOB 1P3IB 3AZFA 2F8NB 5B2JC 3UTAD 3AZGB 3KWQA 3AZJC 3AV2D 3KXBC 1M1AB 4H9PA 3W96A 3LZ0B 5CP6D 1P3BB 3W97C 1BH8B 1KX4A 1KX3D 1KX3B 3X1TD 3REKB 3AV1A 2HUEC 5BNXA 4DRAA 1KU5A 4WU8B 4G92B 1JFIB 4R8PA 3NQUB 1KX5B 5AV8C 4Z5TB 3B6FC 5GT0D 5B32A 1P3GA 3WAAC 3AZIC 2HIOB 1TZYC 4ZUXD 4ZUXB 3AZHC 3VH6T 2AROA 4LD9D 3AZJA 5BS7C 3REID 5B24B 1P3PD 1P3PB 4J8XD 4J8XB 1P3IC 3AZMD 4QLCD 1P3FB 3LELB 1P3KB 3UTAC 5B0ZB 3AZGC 1P34B 1P3AB 1ID3A 1M1AC 4UUZA 3AYWA 1P3BC 4X23A 1U35D 3B6GB 5AV8A 1KX3C 3REKC 3B0DB 4G91B 3AZFD 3MVDA 3AZIA 5BT1D 4WU8C 3KWQD 3AZHA 3AN2B 5B1LA 1KX5C 3W96D 3W96B 4Z5TC 1WWIA 5GT0C 1KX4D 1M19A 5DNMA 2YFWB 3AV1D 3UTBA 4KUDD 4J8UB 4ZUXC 2PYOA 5BNXB 3AFAB 3O62B 2YFVB 1P3IA 2NQBB 4E45A 2F8NA 5CHLB 4R8PB 4R8PD 3AZGA 1M1AA 5FUGA 3REIC 3LZ0A 1P3BA 5GSUA 2CV5B 5B32D 3V9RB 5B24C 1P3PC 1P3GD 4J8XC 3AZMC 1S32A 4QLCC 2F8NG 1P3FC 1P3KC 4Z66A 3AZNB 5B0ZC 2AROD 1P3AC 4WU8A 1B6WA 3RELB 5AVBA 3AZJD 1JFIA 5B0YB 3NQUA 1KX5A 3WKJA 1U35C 3A6NB 3VH6W 4Z5TA 4NE5A 3B0DC 4G91C 3AZFC 5B31B 5JRGB 5BT1C 2HIOA 5CPIB 1AOIB 1TAFB 3KWQC 1ID3D 1ID3B 4YM6A 4UUZB 3AYWB 3AYWD 3W96C 3W98B 1WWSA 4CAYB 4X23D 4X23B 5F99B 5CPKA 5AV8D 1KX4C 3MNNB 3MGPB 3AZEB 4J8UC 3MVDD 3MVDB 3AZID 3AFAC 4YS3B 3AZHD 1P3FA 3LELA 2NQBA 1P3KA 5B1LD 5B1LB 4R8PC 5B0ZA 1P34A 1P3AA 5KDMB 1M19D 5DNMB 3AZND 3B6GA 3UTBD 4JJNA 3UTBB 2PYOD 1EQZB 3AZKB 1P3ID 2AROC 4XUJB 2F8ND 3AZGD 3C1BA 3AN2A 3WA9B 1M1AD 5B0YC 5FUGB 3LZ0D 1P3BD 5GSUD 5GSUB 3X1UA 4HGAB 1S32D 1S32B 1F66B 3REKD 2YFWA 4Z66D 4Z66B 3MGRA 3KUYB 4J8UA 1P3OB 3AFAA 3O62A 2YFVA 3AZLB 4WU8D 3AYWC 1ID3C 3W98C 4ZBJB 5AVBB 3UT9B 3B0BA 5AVCA 4X23C 5F99C 1KX5D 3WKJB 3WKJD 4KHAB 3WTPB 5AV6B 4M6BA 4Z5TD 2NZDA 3MGQA 3AZEC 5B33B 2CV5A 3V9RA 3MVDC 4YS3C 2HIOD 5AY8B 4YM6D 5B1LC 4YM6B 3AZNA 3RELA 5CPKB 1M19C 5DNMC 5B0YA 4DRBA 3A6NA 3UTBC 5B24D 4H9NB 2PYOC 2F8NH 1P3FD 3REJB 5B31A 5JRGA 3LELD 5CPIA 1P3KD 1AOIA 1TAFA 1ZLAA 5B0ZD 1P34D 1P3AD 3WA9C 2NQBD 4XZQA 3W98A 3LZ0C 4CAYA 4Z2MH 5GSUC 5F99A 1R4VA 3LZ1A 4KGCB 3B6GD 3MNNA 3MGPA 4JJNB 4JJND 1HTAA 5B31G 1S32C 1F66C 3AZEA 3KUYC 4Z66C 3KSYA 1P3OC 3AZLC 4YS3A 5B2IA 4H9RB 3C1BB 4ZBJC 5AVBC 5GT3B 4G92C 3AN2D 3WKJC 5KDMA 3WTPC 5AV6C 1H3OA 3X1VB 3X1UD 3X1UB 3MGSA 5AY8C 2HIOC 3MGRD 3MGRB 2RVQC 4J8UD 1B67A 1EQZA 3AFAD 3O62D 4WNNB 4YM6C 3AZKA 4XUJA 5GXQB 4H9QB 5AVCD 5AVCB 5CPKC 3WA9A 2NZDB 3MGQD 3MGQB 2CV5D 3NQJB 3X1SB 3C1CB 2L5AA 1F66A 3R45B 3LELC 3KUYA
chains in the Genus database with same CATH superfamily
2RIQA 1P34C 1P3OA 5JA4B 3AZLA 3RELD 3W99B 2Y2KA 3UT9A 1P3MB 3VH5A 5B0YD 2FJ7B 4KHAA 3B6GC 1ULYA 3WTPA 5AV6A 3A6ND 4JJNC 5B33A 3H0MC 5B31D 5JRGD 5CPID 5AY8A 1ZLAD 1AOID 1ZLAB 3C1BC 3AN2C 5GT3C 4XZQD 4XZQB 5AV5B 2Y2NA 3W98D 3REHB 4EO5B 1HQ3A 5F99D 3LZ1B 5B1MA 3X1UC 3MNND 5B40A 3MGPD 4J8VB 4H9OB 5B2JB 3AZED 3MGRC 4H9NA 3KXBB 4YS3D 3O62C 5DNNB 5B2IB 3REJA 5GXQC 3W97B 5AVCC 3LJAA 3EPHA 1H3OB 2NZDC 3MGQC 4J8WB 2CV5C 5C3IB 5DNMD 4KGCA 3MGSD 3MGSB 3X1SC 1EQZD 3B0CT 3AZKD 3AZNC 4XUJD 5AV9B 3B6FB 3RELC 4H9RA 4WV4B 3WA9D 5GT3A 3W99C 2F2AC 2FJ7C 1N1JA 3WAAB 1P3LA 3A6NC 3VH5T 5BNVB 3X1VA 5E5AB 5CPJA 1M18A 1F66D 5B31C 5JRGC 5CPIC 1ZLAC 3KUYD 1AOIC 1P3OD 4XZQC 2IO5B 4WNNA 3AZLD 1A7WA 5AV5C 5AVBD 3TU4A 4WU9B 1W2EA 4H9QA 5GXQA 3UT9D 3LZ1C 1BH9B 3WTPD 5AV6D 3MNNC 3MGPC 4J8VC 5B33D 3UTAB 3AV2B 5AY8D 2ZY2A 3NQJA 5DNNC 5B2IC 2RVQD 3X1SA 5CP6B 3C1CA 3R45A 4AWLB 2Y2PA 5JA4A 1HQ3D 1HQ3B 4UPKA 3X1TB 2CWEA 5B1MD 2JSSA 5B1MB 5CPKD 4J8WC 3W99A 1P3MA 5C3IC 5B40D 5B40B 4KUDA 2FJ7A 3MGSC 4NE3A 1EQZC 3AZKC 4XUJC 2LY8A 3REJD 5AV9C 5GT0B 3LJAD 3LJAB 3FDDA 5AV5A 3REHA 4CSRB 5G49A 1PZRA 5E5AC 4KGCD 4HGAC 4J8VA 4H9OA 5B2JA 3EPJA 4LD9B 5B32G 3KXBA 2IO5C 3REIB 5DNNA 3C1BD 4WU9C 5GT3D 3W97A 3UT9C 2BYMB 3WTPE 1N1JB 1BFMA 3B0CW 3AZMB 1P3LB 4QLCB 1P3LD 4NFTA 4E44A 5CPJD 3X1VD 4J8WA 5B33C 5CPJB 2NQBC 1M18D 2Y2OA 1M18B 3AV2C 3H0LC 5CP6C 4H9SC 4AWLC 3VH5W 1U35B 3TU4D 3TU4B 5GXQD 1HQ3C 5AV9A 3X1TC 3B6FA 3A1KA 5B1MC 5B40C 3AZFB 2NZDD 3WAAA 1Q9CA 5BO0A 1TZYA 3KWQB 5BNVA 5E5AA 4H9PB 3X1SD 3C1CD 3REJC 1KX4B 2Y2LA 3LJAC 5BS7A 3AV1B 4WU9A 3W99D 1P3MD 4KUDB 2BYKA 2F8NK 2FJ7D 4KGCC 1BH9A 4LD9C 3UTAA 2BG1A 3AV2A 5CP6A 4H9SA 1BH8A 5B32B 5AV5D 1P3GB 1KX3A 3REHD 1P3LC 3X1TA 5G49B 3LZ1D 3REKA 3X1VC 5CPJC 2AROB 1M18C 4J8VD 5B2JD 4Z2MG 3AZJB 3KXBD 5DNND 5B2ID 3TU4C 3W97D 5GT0A 4J8WD 4CSRA 1F1EA 4ZUXA 2HUEB 2Y2QA 3C1CC 4LD9A 5AV8B 5AV9D 3REIA 3B6FD 3AV1C 1P3MC 5B24A 2BYMA 4KUDC 1P3PA 3WAAD 3AZIB 4J8XA 3VH6A 5BO0B 3AZMA 1TZYD 1TZYB 2ZY4A 4QLCA 3AZHB 5E5AD 4WZSB 1M19B 5B32C 1U35A 4NE6A 2FFFB 1P3GC 4WU9D 3REHC 4EO5C 2BYKB 2PYOB 2G5IC 1P3IB 3AZFA 2F8NB 5B2JC 3UTAD 3AZGB 3KWQA 3AZJC 3AV2D 3KXBC 1M1AB 4H9PA 3W96A 3LZ0B 5CP6D 1P3BB 3AL0C 3W97C 1BH8B 1KX4A 1KX3D 1KX3B 3X1TD 3F6TA 3REKB 3AV1A 2HUEC 5BNXA 4DRAA 1KU5A 4WU8B 2ZY5A 4G92B 1JFIB 4R8PA 3NQUB 1KX5B 5AV8C 4Z5TB 3B6FC 5GT0D 3EG5B 5B32A 2VQRA 1P3GA 2Y2JA 3WAAC 3AZIC 2HIOB 1TZYC 4ZUXD 4ZUXB 3AZHC 3VH6T 2AROA 4LD9D 3AZJA 5BS7C 3REID 2JCHA 5B24B 1P3PD 1P3PB 4J8XD 4J8XB 1P3IC 3AZMD 4QLCD 1P3FB 3LELB 1P3KB 3UTAC 5B0ZB 3AZGC 1P34B 1P3AB 3IP4C 1ID3A 1M1AC 4UUZA 3AYWA 1P3BC 4X23A 1U35D 3B6GB 5AV8A 1KX3C 2DQNC 3REKC 3B0DB 4G91B 3AZFD 3MVDA 3AZIA 5BT1D 4WU8C 3KWQD 3AZHA 3AN2B 5B1LA 1KX5C 3W96D 3W96B 1Z2CB 4Z5TC 1WWIA 5GT0C 1KX4D 1M19A 5DNMA 2ZM5A 2DF4C 2YFWB 3AV1D 3UTBA 4KUDD 4J8UB 4ZUXC 2PYOA 2J8PA 5BNXB 3AFAB 3O62B 2YFVB 1P3IA 2NQBB 4E45A 2F8NA 5CHLB 4R8PB 4R8PD 3EPKA 3AZGA 1M1AA 5FUGA 3REIC 3LZ0A 1P3BA 5GSUA 2CV5B 5B24C 3V9RB 5B32D 1P3PC 1P3GD 4J8XC 3AZMC 1S32A 4QLCC 2F8NG 3A1IA 1P3FC 1P3KC 4Z66A 3AZNB 3H0RC 5B0ZC 2AROD 1P3AC 4WU8A 1B6WA 3RELB 5AVBA 3AZJD 1JFIA 5B0YB 3NQUA 1KX5A 3WKJA 1U35C 3A6NB 3VH6W 4Z5TA 4NE5A 3B0DC 4G91C 4WJ3C 3AZFC 5B31B 5JRGB 5BT1C 2HIOA 2Y2IA 5CPIB 1TAFB 1AOIB 3KWQC 1ID3D 1ID3B 4YM6A 4UUZB 3AYWB 3AYWD 3W96C 3W98B 1WWSA 4CAYB 4X23D 4X23B 5F99B 5CPKA 5AV8D 1KX4C 3MNNB 3MGPB 3AZEB 4J8UC 3MVDD 3MVDB 3AZID 3AFAC 4DQYB 4YS3B 3AZHD 1P3FA 3LELA 3EPLA 1P3KA 2NQBA 5B1LD 5B1LB 4R8PC 5B0ZA 1P34A 1P3AA 2JE5A 5KDMB 1M19D 5DNMB 3AZND 3B6GA 3UTBD 4JJNA 3UTBB 2PYOD 1EQZB 3AZKB 1P3ID 2AROC 4XUJB 2F8ND 3AZGD 3C1BA 3AN2A 3WA9B 2XD1A 1M1AD 5B0YC 5FUGB 3LZ0D 1P3BD 5GSUD 5GSUB 3X1UA 4HGAB 1S32D 1S32B 1F66B 3REKD 2YFWA 4Z66D 4Z66B 3MGRA 3KUYB 4J8UA 1P3OB 3AFAA 3O62A 2YFVA 3AZLB 4WU8D 3AYWC 1ID3C 2W8SA 3W98C 4ZBJB 5AVBB 3UT9B 3B0BA 5AVCA 4X23C 5F99C 1KX5D 3WKJB 3WKJD 4KHAB 3WTPB 5AV6B 4M6BA 4Z5TD 2NZDA 2G5HC 3MGQA 3AZEC 5B33B 2CV5A 3V9RA 3MVDC 4YS3C 2HIOD 5AY8B 4YM6D 5B1LC 4YM6B 3AZNA 3RELA 5CPKB 1M19C 5DNMC 5B0YA 4DRBA 3A6NA 3UTBC 5B24D 4H9NB 2PYOC 2F8NH 1P3FD 3REJB 5B31A 5JRGA 3LELD 5CPIA 1P3KD 1AOIA 1TAFA 1ZLAA 5B0ZD 1P34D 2ZY3A 1P3AD 3WA9C 2NQBD 4XZQA 3W98A 3LZ0C 4CAYA 4Z2MH 5GSUC 5F99A 1R4VA 2UWXA 3LZ1A 4KGCB 3B6GD 3MNNA 3MGPA 4JJNB 4JJND 1HTAA 5B31G 1S32C 1F66C 3AZEA 3KUYC 4Z66C 3KFUG 2Y2GA 3KSYA 1P3OC 3AZLC 4YS3A 5B2IA 4H9RB 3C1BB 5AVBC 4ZBJC 5GT3B 4G92C 3AN2D 3WKJC 5KDMA 3P5JB 3WTPC 5AV6C 1H3OA 3X1VB 3X1UD 3X1UB 3MGSA 5AY8C 2HIOC 3MGRD 3MGRB 2RVQC 4J8UD 1B67A 1EQZA 2Y2MA 3AFAD 3O62D 4WNNB 4YM6C 3AZKA 4XUJA 5GXQB 4H9QB 5AVCD 5AVCB 5CPKC 3WA9A 2XD5A 2NZDB 3MGQD 3MGQB 2Y2HA 2CV5D 3NQJB 3X1SB 3C1CB 2L5AA 1F66A 3R45B 3LELC 3KUYA 1T3UA
chains in the Genus database with same CATH topology
2RIQA 1P34C 1P3OA 5JA4B 3AZLA 3RELD 3W99B 2Y2KA 3UT9A 1P3MB 3VH5A 5B0YD 2FJ7B 4KHAA 3B6GC 1ULYA 3WTPA 5AV6A 3A6ND 4JJNC 5B33A 3H0MC 5B31D 5JRGD 5CPID 5AY8A 1ZLAD 1AOID 1ZLAB 3C1BC 3AN2C 5GT3C 4XZQD 4XZQB 5AV5B 2Y2NA 3W98D 3REHB 4EO5B 1HQ3A 5F99D 3LZ1B 5B1MA 3X1UC 3MNND 5B40A 3MGPD 4J8VB 4H9OB 5B2JB 3AZED 3MGRC 4H9NA 3KXBB 4YS3D 3O62C 5DNNB 5B2IB 3REJA 5GXQC 3W97B 5AVCC 3LJAA 3EPHA 1H3OB 2NZDC 3MGQC 4J8WB 2CV5C 5C3IB 5DNMD 4KGCA 3MGSD 3MGSB 3X1SC 1EQZD 3B0CT 3AZKD 3AZNC 4XUJD 5AV9B 3B6FB 3RELC 4H9RA 4WV4B 3WA9D 5GT3A 3W99C 2F2AC 2FJ7C 1N1JA 3WAAB 1P3LA 3A6NC 3VH5T 5BNVB 3X1VA 5E5AB 5CPJA 1M18A 1F66D 5B31C 5JRGC 5CPIC 1ZLAC 3KUYD 1AOIC 1P3OD 4XZQC 2IO5B 4WNNA 3AZLD 1A7WA 5AV5C 5AVBD 3TU4A 4WU9B 1W2EA 4H9QA 5GXQA 3UT9D 3LZ1C 1BH9B 3WTPD 5AV6D 3MNNC 3MGPC 4J8VC 5B33D 3UTAB 3AV2B 5AY8D 2ZY2A 3NQJA 5DNNC 5B2IC 2RVQD 3X1SA 5CP6B 3C1CA 3R45A 4AWLB 2Y2PA 5JA4A 1HQ3D 1HQ3B 4UPKA 3X1TB 2CWEA 5B1MD 2JSSA 5B1MB 5CPKD 4J8WC 3W99A 1P3MA 5C3IC 5B40D 5B40B 4KUDA 2FJ7A 3MGSC 4NE3A 1EQZC 3AZKC 4XUJC 2LY8A 3REJD 5AV9C 5GT0B 3LJAD 3LJAB 3FDDA 5AV5A 3REHA 4CSRB 5G49A 1PZRA 5E5AC 4KGCD 4HGAC 4J8VA 4H9OA 5B2JA 3EPJA 4LD9B 5B32G 3KXBA 2IO5C 3REIB 5DNNA 3C1BD 4WU9C 5GT3D 3W97A 3UT9C 2BYMB 3WTPE 1N1JB 1BFMA 3B0CW 3AZMB 1P3LB 4QLCB 1P3LD 4NFTA 4E44A 5CPJD 3X1VD 4J8WA 5B33C 5CPJB 2NQBC 1M18D 2Y2OA 1M18B 3AV2C 3H0LC 5CP6C 4H9SC 4AWLC 3VH5W 1U35B 3TU4D 3TU4B 5GXQD 1HQ3C 5AV9A 3X1TC 3B6FA 3A1KA 5B1MC 5B40C 3AZFB 2NZDD 3WAAA 1Q9CA 5BO0A 1TZYA 3KWQB 5BNVA 5E5AA 4H9PB 3X1SD 3C1CD 3REJC 1KX4B 2Y2LA 3LJAC 5BS7A 3AV1B 4WU9A 3W99D 1P3MD 4KUDB 2BYKA 2F8NK 2FJ7D 4KGCC 1BH9A 4LD9C 3UTAA 2BG1A 3AV2A 5CP6A 4H9SA 1BH8A 5B32B 5AV5D 1P3GB 1KX3A 3REHD 1P3LC 3X1TA 5G49B 3LZ1D 3REKA 3X1VC 5CPJC 2AROB 1M18C 4J8VD 5B2JD 4Z2MG 3AZJB 3KXBD 5DNND 5B2ID 3TU4C 3W97D 5GT0A 4J8WD 4CSRA 1F1EA 4ZUXA 2HUEB 2Y2QA 3C1CC 4LD9A 5AV8B 5AV9D 3REIA 3B6FD 3AV1C 1P3MC 5B24A 2BYMA 4KUDC 1P3PA 3WAAD 3AZIB 4J8XA 3VH6A 5BO0B 3AZMA 1TZYD 1TZYB 2ZY4A 4QLCA 3AZHB 5E5AD 4WZSB 1M19B 5B32C 1U35A 4NE6A 2FFFB 1P3GC 4WU9D 3REHC 4EO5C 2BYKB 2PYOB 2G5IC 1P3IB 3AZFA 2F8NB 5B2JC 3UTAD 3AZGB 3KWQA 3AZJC 3AV2D 3KXBC 1M1AB 4H9PA 3W96A 3LZ0B 5CP6D 1P3BB 3AL0C 3W97C 1BH8B 1KX4A 1KX3D 1KX3B 3X1TD 3F6TA 3REKB 3AV1A 2HUEC 5BNXA 4DRAA 1KU5A 4WU8B 2ZY5A 4G92B 1JFIB 4R8PA 3NQUB 1KX5B 5AV8C 4Z5TB 3B6FC 5GT0D 3EG5B 5B32A 2VQRA 1P3GA 2Y2JA 3WAAC 3AZIC 2HIOB 1TZYC 4ZUXD 4ZUXB 3AZHC 3VH6T 2AROA 4LD9D 3AZJA 5BS7C 3REID 2JCHA 5B24B 1P3PD 1P3PB 4J8XD 4J8XB 1P3IC 3AZMD 4QLCD 1P3FB 3LELB 1P3KB 3UTAC 5B0ZB 3AZGC 1P34B 1P3AB 3IP4C 1ID3A 1M1AC 4UUZA 3AYWA 1P3BC 4X23A 1U35D 3B6GB 5AV8A 1KX3C 2DQNC 3REKC 3B0DB 4G91B 3AZFD 3MVDA 3AZIA 5BT1D 4WU8C 3KWQD 3AZHA 3AN2B 5B1LA 1KX5C 3W96D 3W96B 1Z2CB 4Z5TC 1WWIA 5GT0C 1KX4D 1M19A 5DNMA 2ZM5A 2DF4C 2YFWB 3AV1D 3UTBA 4KUDD 4J8UB 4ZUXC 2PYOA 2J8PA 5BNXB 3AFAB 3O62B 2YFVB 1P3IA 2NQBB 4E45A 2F8NA 5CHLB 4R8PB 4R8PD 3EPKA 3AZGA 1M1AA 5FUGA 3REIC 3LZ0A 1P3BA 5GSUA 2CV5B 5B24C 3V9RB 5B32D 1P3PC 1P3GD 4J8XC 3AZMC 1S32A 4QLCC 2F8NG 3A1IA 1P3FC 1P3KC 4Z66A 3AZNB 3H0RC 5B0ZC 2AROD 1P3AC 4WU8A 1B6WA 3RELB 5AVBA 3AZJD 1JFIA 5B0YB 3NQUA 1KX5A 3WKJA 1U35C 3A6NB 3VH6W 4Z5TA 4NE5A 3B0DC 4G91C 4WJ3C 3AZFC 5B31B 5JRGB 5BT1C 2HIOA 2Y2IA 5CPIB 1TAFB 1AOIB 3KWQC 1ID3D 1ID3B 4YM6A 4UUZB 3AYWB 3AYWD 3W96C 3W98B 1WWSA 4CAYB 4X23D 4X23B 5F99B 5CPKA 5AV8D 1KX4C 3MNNB 3MGPB 3AZEB 4J8UC 3MVDD 3MVDB 3AZID 3AFAC 4DQYB 4YS3B 3AZHD 1P3FA 3LELA 3EPLA 1P3KA 2NQBA 5B1LD 5B1LB 4R8PC 5B0ZA 1P34A 1P3AA 2JE5A 5KDMB 1M19D 5DNMB 3AZND 3B6GA 3UTBD 4JJNA 3UTBB 2PYOD 1EQZB 3AZKB 1P3ID 2AROC 4XUJB 2F8ND 3AZGD 3C1BA 3AN2A 3WA9B 2XD1A 1M1AD 5B0YC 5FUGB 3LZ0D 1P3BD 5GSUD 5GSUB 3X1UA 4HGAB 1S32D 1S32B 1F66B 3REKD 2YFWA 4Z66D 4Z66B 3MGRA 3KUYB 4J8UA 1P3OB 3AFAA 3O62A 2YFVA 3AZLB 4WU8D 3AYWC 1ID3C 2W8SA 3W98C 4ZBJB 5AVBB 3UT9B 3B0BA 5AVCA 4X23C 5F99C 1KX5D 3WKJB 3WKJD 4KHAB 3WTPB 5AV6B 4M6BA 4Z5TD 2NZDA 2G5HC 3MGQA 3AZEC 5B33B 2CV5A 3V9RA 3MVDC 4YS3C 2HIOD 5AY8B 4YM6D 5B1LC 4YM6B 3AZNA 3RELA 5CPKB 1M19C 5DNMC 5B0YA 4DRBA 3A6NA 3UTBC 5B24D 4H9NB 2PYOC 2F8NH 1P3FD 3REJB 5B31A 5JRGA 3LELD 5CPIA 1P3KD 1AOIA 1TAFA 1ZLAA 5B0ZD 1P34D 2ZY3A 1P3AD 3WA9C 2NQBD 4XZQA 3W98A 3LZ0C 4CAYA 4Z2MH 5GSUC 5F99A 1R4VA 2UWXA 3LZ1A 4KGCB 3B6GD 3MNNA 3MGPA 4JJNB 4JJND 1HTAA 5B31G 1S32C 1F66C 3AZEA 3KUYC 4Z66C 3KFUG 2Y2GA 3KSYA 1P3OC 3AZLC 4YS3A 5B2IA 4H9RB 3C1BB 5AVBC 4ZBJC 5GT3B 4G92C 3AN2D 3WKJC 5KDMA 3P5JB 3WTPC 5AV6C 1H3OA 3X1VB 3X1UD 3X1UB 3MGSA 5AY8C 2HIOC 3MGRD 3MGRB 2RVQC 4J8UD 1B67A 1EQZA 2Y2MA 3AFAD 3O62D 4WNNB 4YM6C 3AZKA 4XUJA 5GXQB 4H9QB 5AVCD 5AVCB 5CPKC 3WA9A 2XD5A 2NZDB 3MGQD 3MGQB 2Y2HA 2CV5D 3NQJB 3X1SB 3C1CB 2L5AA 1F66A 3R45B 3LELC 3KUYA 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 C;  1P3O A;  5JA4 B;  3AZL A;  3REL D;  3W99 B;  3UT9 A;  1P3M B;  3VH5 A;  5B0Y D;  2FJ7 B;  4KHA A;  3B6G C;  1ULY A;  3WTP A;  5AV6 A;  3A6N D;  4JJN C;  5B33 A;  5B31 D;  5JRG D;  5CPI D;  5AY8 A;  1ZLA D;  1AOI D;  1ZLA B;  3C1B C;  3AN2 C;  5GT3 C;  4XZQ D;  4XZQ B;  5AV5 B;  3W98 D;  3REH B;  4EO5 B;  1HQ3 A;  5F99 D;  3LZ1 B;  5B1M A;  3X1U C;  3MNN D;  5B40 A;  3MGP D;  4J8V B;  4H9O B;  5B2J B;  3AZE D;  3MGR C;  4H9N A;  3KXB B;  4YS3 D;  3O62 C;  5DNN B;  5B2I B;  3REJ A;  5GXQ C;  3W97 B;  5AVC C;  3LJA A;  1H3O B;  2NZD C;  3MGQ C;  4J8W B;  2CV5 C;  5C3I B;  5DNM D;  4KGC A;  3MGS D;  3MGS B;  3X1S C;  1EQZ D;  3B0C T;  3AZK D;  3AZN C;  4XUJ D;  5AV9 B;  3B6F B;  3REL C;  4H9R A;  4WV4 B;  3WA9 D;  5GT3 A;  3W99 C;  2FJ7 C;  1N1J A;  3WAA B;  1P3L A;  3A6N C;  3VH5 T;  5BNV B;  3X1V A;  5E5A B;  5CPJ A;  1M18 A;  1F66 D;  5B31 C;  5JRG C;  5CPI C;  1ZLA C;  3KUY D;  1AOI C;  1P3O D;  4XZQ C;  2IO5 B;  4WNN A;  3AZL D;  1A7W A;  5AV5 C;  5AVB D;  3TU4 A;  4WU9 B;  5GXQ A;  4H9Q A;  3UT9 D;  3LZ1 C;  1BH9 B;  3WTP D;  5AV6 D;  3MNN C;  3MGP C;  4J8V C;  5B33 D;  3UTA B;  3AV2 B;  5AY8 D;  3NQJ A;  5DNN C;  5B2I C;  2RVQ D;  3X1S A;  5CP6 B;  3C1C A;  3R45 A;  4AWL B;  5JA4 A;  1HQ3 D;  1HQ3 B;  3X1T B;  2CWE A;  5B1M D;  2JSS A;  5B1M B;  5CPK D;  4J8W C;  3W99 A;  1P3M A;  5C3I C;  5B40 D;  5B40 B;  4KUD A;  2FJ7 A;  3MGS C;  4NE3 A;  1EQZ C;  3AZK C;  4XUJ C;  2LY8 A;  3REJ D;  5AV9 C;  5GT0 B;  3LJA D;  3LJA B;  5AV5 A;  3REH A;  4CSR B;  5G49 A;  5E5A C;  4KGC D;  4HGA C;  4J8V A;  4H9O A;  5B2J A;  4LD9 B;  5B32 G;  3KXB A;  2IO5 C;  3REI B;  5DNN A;  3C1B D;  4WU9 C;  5GT3 D;  3W97 A;  3UT9 C;  2BYM B;  3WTP E;  1N1J B;  1BFM A;  3B0C W;  3AZM B;  1P3L B;  4QLC B;  1P3L D;  4NFT A;  4E44 A;  5CPJ D;  3X1V D;  4J8W A;  5B33 C;  5CPJ B;  2NQB C;  1M18 D;  1M18 B;  3AV2 C;  5CP6 C;  4H9S C;  4AWL C;  3VH5 W;  1U35 B;  3TU4 D;  3TU4 B;  5GXQ D;  1HQ3 C;  5AV9 A;  3X1T C;  3B6F A;  5B1M C;  5B40 C;  3AZF B;  2NZD D;  3WAA A;  1Q9C A;  5BO0 A;  1TZY A;  3KWQ B;  5BNV A;  5E5A A;  4H9P B;  3X1S D;  3C1C D;  3REJ C;  1KX4 B;  3LJA C;  5BS7 A;  3AV1 B;  4WU9 A;  3W99 D;  1P3M D;  4KUD B;  2BYK A;  2F8N K;  2FJ7 D;  4KGC C;  1BH9 A;  4LD9 C;  3UTA A;  3AV2 A;  5CP6 A;  4H9S A;  1BH8 A;  5B32 B;  5AV5 D;  1P3G B;  1KX3 A;  3REH D;  1P3L C;  3X1T A;  5G49 B;  3LZ1 D;  3REK A;  3X1V C;  5CPJ C;  2ARO B;  1M18 C;  4J8V D;  5B2J D;  4Z2M G;  3AZJ B;  3KXB D;  5DNN D;  5B2I D;  3TU4 C;  3W97 D;  5GT0 A;  4J8W D;  4CSR A;  1F1E A;  4ZUX A;  2HUE B;  3C1C C;  4LD9 A;  5AV8 B;  5AV9 D;  3REI A;  3B6F D;  3AV1 C;  1P3M C;  5B24 A;  2BYM A;  4KUD C;  1P3P A;  3WAA D;  3AZI B;  4J8X A;  3VH6 A;  5BO0 B;  3AZM A;  1TZY D;  1TZY B;  4QLC A;  3AZH B;  5E5A D;  4WZS B;  1M19 B;  5B32 C;  1U35 A;  4NE6 A;  1P3G C;  4WU9 D;  3REH C;  4EO5 C;  2BYK B;  2PYO B;  1P3I B;  3AZF A;  2F8N B;  5B2J C;  3UTA D;  3AZG B;  3KWQ A;  3AZJ C;  3AV2 D;  3KXB C;  1M1A B;  4H9P A;  3W96 A;  3LZ0 B;  5CP6 D;  1P3B B;  3W97 C;  1BH8 B;  1KX4 A;  1KX3 D;  1KX3 B;  3X1T D;  3REK B;  3AV1 A;  2HUE C;  5BNX A;  4DRA A;  1KU5 A;  4WU8 B;  4G92 B;  1JFI B;  4R8P A;  3NQU B;  1KX5 B;  5AV8 C;  4Z5T B;  3B6F C;  5GT0 D;  5B32 A;  1P3G A;  3WAA C;  3AZI C;  2HIO B;  1TZY C;  4ZUX D;  4ZUX B;  3AZH C;  3VH6 T;  2ARO A;  4LD9 D;  3AZJ A;  5BS7 C;  3REI D;  5B24 B;  1P3P D;  1P3P B;  4J8X D;  4J8X B;  1P3I C;  3AZM D;  4QLC D;  1P3F B;  3LEL B;  1P3K B;  3UTA C;  5B0Z B;  3AZG C;  1P34 B;  1P3A B;  1ID3 A;  1M1A C;  4UUZ A;  3AYW A;  1P3B C;  4X23 A;  1U35 D;  3B6G B;  5AV8 A;  1KX3 C;  3REK C;  3B0D B;  4G91 B;  3AZF D;  3MVD A;  3AZI A;  5BT1 D;  4WU8 C;  3KWQ D;  3AZH A;  3AN2 B;  5B1L A;  1KX5 C;  3W96 D;  3W96 B;  4Z5T C;  1WWI A;  5GT0 C;  1KX4 D;  1M19 A;  5DNM A;  2YFW B;  3AV1 D;  3UTB A;  4KUD D;  4J8U B;  4ZUX C;  2PYO A;  5BNX B;  3AFA B;  3O62 B;  2YFV B;  1P3I A;  2NQB B;  4E45 A;  2F8N A;  5CHL B;  4R8P B;  4R8P D;  3AZG A;  1M1A A;  5FUG A;  3REI C;  3LZ0 A;  1P3B A;  5GSU A;  2CV5 B;  5B32 D;  3V9R B;  5B24 C;  1P3P C;  1P3G D;  4J8X C;  3AZM C;  1S32 A;  4QLC C;  2F8N G;  1P3F C;  1P3K C;  4Z66 A;  3AZN B;  5B0Z C;  2ARO D;  1P3A C;  4WU8 A;  1B6W A;  3REL B;  5AVB A;  3AZJ D;  1JFI A;  5B0Y B;  3NQU A;  1KX5 A;  3WKJ A;  1U35 C;  3A6N B;  3VH6 W;  4Z5T A;  4NE5 A;  3B0D C;  4G91 C;  3AZF C;  5B31 B;  5JRG B;  5BT1 C;  2HIO A;  5CPI B;  1AOI B;  1TAF B;  3KWQ C;  1ID3 D;  1ID3 B;  4YM6 A;  4UUZ B;  3AYW B;  3AYW D;  3W96 C;  3W98 B;  1WWS A;  4CAY B;  4X23 D;  4X23 B;  5F99 B;  5CPK A;  5AV8 D;  1KX4 C;  3MNN B;  3MGP B;  3AZE B;  4J8U C;  3MVD D;  3MVD B;  3AZI D;  3AFA C;  4YS3 B;  3AZH D;  1P3F A;  3LEL A;  2NQB A;  1P3K A;  5B1L D;  5B1L B;  4R8P C;  5B0Z A;  1P34 A;  1P3A A;  5KDM B;  1M19 D;  5DNM B;  3AZN D;  3B6G A;  3UTB D;  4JJN A;  3UTB B;  2PYO D;  1EQZ B;  3AZK B;  1P3I D;  2ARO C;  4XUJ B;  2F8N D;  3AZG D;  3C1B A;  3AN2 A;  3WA9 B;  1M1A D;  5B0Y C;  5FUG B;  3LZ0 D;  1P3B D;  5GSU D;  5GSU B;  3X1U A;  4HGA B;  1S32 D;  1S32 B;  1F66 B;  3REK D;  2YFW A;  4Z66 D;  4Z66 B;  3MGR A;  3KUY B;  4J8U A;  1P3O B;  3AFA A;  3O62 A;  2YFV A;  3AZL B;  4WU8 D;  3AYW C;  1ID3 C;  3W98 C;  4ZBJ B;  5AVB B;  3UT9 B;  3B0B A;  5AVC A;  4X23 C;  5F99 C;  1KX5 D;  3WKJ B;  3WKJ D;  4KHA B;  3WTP B;  5AV6 B;  4M6B A;  4Z5T D;  2NZD A;  3MGQ A;  3AZE C;  5B33 B;  2CV5 A;  3V9R A;  3MVD C;  4YS3 C;  2HIO D;  5AY8 B;  4YM6 D;  5B1L C;  4YM6 B;  3AZN A;  3REL A;  5CPK B;  1M19 C;  5DNM C;  5B0Y A;  4DRB A;  3A6N A;  3UTB C;  5B24 D;  4H9N B;  2PYO C;  2F8N H;  1P3F D;  3REJ B;  5B31 A;  5JRG A;  3LEL D;  5CPI A;  1P3K D;  1AOI A;  1TAF A;  1ZLA A;  5B0Z D;  1P34 D;  1P3A D;  3WA9 C;  2NQB D;  4XZQ A;  3W98 A;  3LZ0 C;  4CAY A;  4Z2M H;  5GSU C;  5F99 A;  1R4V A;  3LZ1 A;  4KGC B;  3B6G D;  3MNN A;  3MGP A;  4JJN B;  4JJN D;  1HTA A;  5B31 G;  1S32 C;  1F66 C;  3AZE A;  3KUY C;  4Z66 C;  3KSY A;  1P3O C;  3AZL C;  4YS3 A;  5B2I A;  4H9R B;  3C1B B;  4ZBJ C;  5AVB C;  5GT3 B;  4G92 C;  3AN2 D;  3WKJ C;  5KDM A;  3WTP C;  5AV6 C;  1H3O A;  3X1V B;  3X1U D;  3X1U B;  3MGS A;  5AY8 C;  2HIO C;  3MGR D;  3MGR B;  2RVQ C;  4J8U D;  1B67 A;  1EQZ A;  3AFA D;  3O62 D;  4WNN B;  4YM6 C;  3AZK A;  4XUJ A;  5GXQ B;  4H9Q B;  5AVC D;  5AVC B;  5CPK C;  3WA9 A;  2NZD B;  3MGQ D;  3MGQ B;  2CV5 D;  3NQJ B;  3X1S B;  3C1C B;  2L5A A;  1F66 A;  3R45 B;  3LEL C;  3KUY A; 
#chains in the Genus database with same CATH topology
 2RIQ A;  1P34 C;  1P3O A;  5JA4 B;  3AZL A;  3REL D;  3W99 B;  2Y2K A;  3UT9 A;  1P3M B;  3VH5 A;  5B0Y D;  2FJ7 B;  4KHA A;  3B6G C;  1ULY A;  3WTP A;  5AV6 A;  3A6N D;  4JJN C;  5B33 A;  3H0M C;  5B31 D;  5JRG D;  5CPI D;  5AY8 A;  1ZLA D;  1AOI D;  1ZLA B;  3C1B C;  3AN2 C;  5GT3 C;  4XZQ D;  4XZQ B;  5AV5 B;  2Y2N A;  3W98 D;  3REH B;  4EO5 B;  1HQ3 A;  5F99 D;  3LZ1 B;  5B1M A;  3X1U C;  3MNN D;  5B40 A;  3MGP D;  4J8V B;  4H9O B;  5B2J B;  3AZE D;  3MGR C;  4H9N A;  3KXB B;  4YS3 D;  3O62 C;  5DNN B;  5B2I B;  3REJ A;  5GXQ C;  3W97 B;  5AVC C;  3LJA A;  3EPH A;  1H3O B;  2NZD C;  3MGQ C;  4J8W B;  2CV5 C;  5C3I B;  5DNM D;  4KGC A;  3MGS D;  3MGS B;  3X1S C;  1EQZ D;  3B0C T;  3AZK D;  3AZN C;  4XUJ D;  5AV9 B;  3B6F B;  3REL C;  4H9R A;  4WV4 B;  3WA9 D;  5GT3 A;  3W99 C;  2F2A C;  2FJ7 C;  1N1J A;  3WAA B;  1P3L A;  3A6N C;  3VH5 T;  5BNV B;  3X1V A;  5E5A B;  5CPJ A;  1M18 A;  1F66 D;  5B31 C;  5JRG C;  5CPI C;  1ZLA C;  3KUY D;  1AOI C;  1P3O D;  4XZQ C;  2IO5 B;  4WNN A;  3AZL D;  1A7W A;  5AV5 C;  5AVB D;  3TU4 A;  4WU9 B;  1W2E A;  4H9Q A;  5GXQ A;  3UT9 D;  3LZ1 C;  1BH9 B;  3WTP D;  5AV6 D;  3MNN C;  3MGP C;  4J8V C;  5B33 D;  3UTA B;  3AV2 B;  5AY8 D;  2ZY2 A;  3NQJ A;  5DNN C;  5B2I C;  2RVQ D;  3X1S A;  5CP6 B;  3C1C A;  3R45 A;  4AWL B;  2Y2P A;  5JA4 A;  1HQ3 D;  1HQ3 B;  4UPK A;  3X1T B;  2CWE A;  5B1M D;  2JSS A;  5B1M B;  5CPK D;  4J8W C;  3W99 A;  1P3M A;  5C3I C;  5B40 D;  5B40 B;  4KUD A;  2FJ7 A;  3MGS C;  4NE3 A;  1EQZ C;  3AZK C;  4XUJ C;  2LY8 A;  3REJ D;  5AV9 C;  5GT0 B;  3LJA D;  3LJA B;  3FDD A;  5AV5 A;  3REH A;  4CSR B;  5G49 A;  1PZR A;  5E5A C;  4KGC D;  4HGA C;  4J8V A;  4H9O A;  5B2J A;  3EPJ A;  4LD9 B;  5B32 G;  3KXB A;  2IO5 C;  3REI B;  5DNN A;  3C1B D;  4WU9 C;  5GT3 D;  3W97 A;  3UT9 C;  2BYM B;  3WTP E;  1N1J B;  1BFM A;  3B0C W;  3AZM B;  1P3L B;  4QLC B;  1P3L D;  4NFT A;  4E44 A;  5CPJ D;  3X1V D;  4J8W A;  5B33 C;  5CPJ B;  2NQB C;  1M18 D;  2Y2O A;  1M18 B;  3AV2 C;  3H0L C;  5CP6 C;  4H9S C;  4AWL C;  3VH5 W;  1U35 B;  3TU4 D;  3TU4 B;  5GXQ D;  1HQ3 C;  5AV9 A;  3X1T C;  3B6F A;  3A1K A;  5B1M C;  5B40 C;  3AZF B;  2NZD D;  3WAA A;  1Q9C A;  5BO0 A;  1TZY A;  3KWQ B;  5BNV A;  5E5A A;  4H9P B;  3X1S D;  3C1C D;  3REJ C;  1KX4 B;  2Y2L A;  3LJA C;  5BS7 A;  3AV1 B;  4WU9 A;  3W99 D;  1P3M D;  4KUD B;  2BYK A;  2F8N K;  2FJ7 D;  4KGC C;  1BH9 A;  4LD9 C;  3UTA A;  2BG1 A;  3AV2 A;  5CP6 A;  4H9S A;  1BH8 A;  5B32 B;  5AV5 D;  1P3G B;  1KX3 A;  3REH D;  1P3L C;  3X1T A;  5G49 B;  3LZ1 D;  3REK A;  3X1V C;  5CPJ C;  2ARO B;  1M18 C;  4J8V D;  5B2J D;  4Z2M G;  3AZJ B;  3KXB D;  5DNN D;  5B2I D;  3TU4 C;  3W97 D;  5GT0 A;  4J8W D;  4CSR A;  1F1E A;  4ZUX A;  2HUE B;  2Y2Q A;  3C1C C;  4LD9 A;  5AV8 B;  5AV9 D;  3REI A;  3B6F D;  3AV1 C;  1P3M C;  5B24 A;  2BYM A;  4KUD C;  1P3P A;  3WAA D;  3AZI B;  4J8X A;  3VH6 A;  5BO0 B;  3AZM A;  1TZY D;  1TZY B;  2ZY4 A;  4QLC A;  3AZH B;  5E5A D;  4WZS B;  1M19 B;  5B32 C;  1U35 A;  4NE6 A;  2FFF B;  1P3G C;  4WU9 D;  3REH C;  4EO5 C;  2BYK B;  2PYO B;  2G5I C;  1P3I B;  3AZF A;  2F8N B;  5B2J C;  3UTA D;  3AZG B;  3KWQ A;  3AZJ C;  3AV2 D;  3KXB C;  1M1A B;  4H9P A;  3W96 A;  3LZ0 B;  5CP6 D;  1P3B B;  3AL0 C;  3W97 C;  1BH8 B;  1KX4 A;  1KX3 D;  1KX3 B;  3X1T D;  3F6T A;  3REK B;  3AV1 A;  2HUE C;  5BNX A;  4DRA A;  1KU5 A;  4WU8 B;  2ZY5 A;  4G92 B;  1JFI B;  4R8P A;  3NQU B;  1KX5 B;  5AV8 C;  4Z5T B;  3B6F C;  5GT0 D;  3EG5 B;  5B32 A;  2VQR A;  1P3G A;  2Y2J A;  3WAA C;  3AZI C;  2HIO B;  1TZY C;  4ZUX D;  4ZUX B;  3AZH C;  3VH6 T;  2ARO A;  4LD9 D;  3AZJ A;  5BS7 C;  3REI D;  2JCH A;  5B24 B;  1P3P D;  1P3P B;  4J8X D;  4J8X B;  1P3I C;  3AZM D;  4QLC D;  1P3F B;  3LEL B;  1P3K B;  3UTA C;  5B0Z B;  3AZG C;  1P34 B;  1P3A B;  3IP4 C;  1ID3 A;  1M1A C;  4UUZ A;  3AYW A;  1P3B C;  4X23 A;  1U35 D;  3B6G B;  5AV8 A;  1KX3 C;  2DQN C;  3REK C;  3B0D B;  4G91 B;  3AZF D;  3MVD A;  3AZI A;  5BT1 D;  4WU8 C;  3KWQ D;  3AZH A;  3AN2 B;  5B1L A;  1KX5 C;  3W96 D;  3W96 B;  1Z2C B;  4Z5T C;  1WWI A;  5GT0 C;  1KX4 D;  1M19 A;  5DNM A;  2ZM5 A;  2DF4 C;  2YFW B;  3AV1 D;  3UTB A;  4KUD D;  4J8U B;  4ZUX C;  2PYO A;  2J8P A;  5BNX B;  3AFA B;  3O62 B;  2YFV B;  1P3I A;  2NQB B;  4E45 A;  2F8N A;  5CHL B;  4R8P B;  4R8P D;  3EPK A;  3AZG A;  1M1A A;  5FUG A;  3REI C;  3LZ0 A;  1P3B A;  5GSU A;  2CV5 B;  5B24 C;  3V9R B;  5B32 D;  1P3P C;  1P3G D;  4J8X C;  3AZM C;  1S32 A;  4QLC C;  2F8N G;  3A1I A;  1P3F C;  1P3K C;  4Z66 A;  3AZN B;  3H0R C;  5B0Z C;  2ARO D;  1P3A C;  4WU8 A;  1B6W A;  3REL B;  5AVB A;  3AZJ D;  1JFI A;  5B0Y B;  3NQU A;  1KX5 A;  3WKJ A;  1U35 C;  3A6N B;  3VH6 W;  4Z5T A;  4NE5 A;  3B0D C;  4G91 C;  4WJ3 C;  3AZF C;  5B31 B;  5JRG B;  5BT1 C;  2HIO A;  2Y2I A;  5CPI B;  1TAF B;  1AOI B;  3KWQ C;  1ID3 D;  1ID3 B;  4YM6 A;  4UUZ B;  3AYW B;  3AYW D;  3W96 C;  3W98 B;  1WWS A;  4CAY B;  4X23 D;  4X23 B;  5F99 B;  5CPK A;  5AV8 D;  1KX4 C;  3MNN B;  3MGP B;  3AZE B;  4J8U C;  3MVD D;  3MVD B;  3AZI D;  3AFA C;  4DQY B;  4YS3 B;  3AZH D;  1P3F A;  3LEL A;  3EPL A;  1P3K A;  2NQB A;  5B1L D;  5B1L B;  4R8P C;  5B0Z A;  1P34 A;  1P3A A;  2JE5 A;  5KDM B;  1M19 D;  5DNM B;  3AZN D;  3B6G A;  3UTB D;  4JJN A;  3UTB B;  2PYO D;  1EQZ B;  3AZK B;  1P3I D;  2ARO C;  4XUJ B;  2F8N D;  3AZG D;  3C1B A;  3AN2 A;  3WA9 B;  2XD1 A;  1M1A D;  5B0Y C;  5FUG B;  3LZ0 D;  1P3B D;  5GSU D;  5GSU B;  3X1U A;  4HGA B;  1S32 D;  1S32 B;  1F66 B;  3REK D;  2YFW A;  4Z66 D;  4Z66 B;  3MGR A;  3KUY B;  4J8U A;  1P3O B;  3AFA A;  3O62 A;  2YFV A;  3AZL B;  4WU8 D;  3AYW C;  1ID3 C;  2W8S A;  3W98 C;  4ZBJ B;  5AVB B;  3UT9 B;  3B0B A;  5AVC A;  4X23 C;  5F99 C;  1KX5 D;  3WKJ B;  3WKJ D;  4KHA B;  3WTP B;  5AV6 B;  4M6B A;  4Z5T D;  2NZD A;  2G5H C;  3MGQ A;  3AZE C;  5B33 B;  2CV5 A;  3V9R A;  3MVD C;  4YS3 C;  2HIO D;  5AY8 B;  4YM6 D;  5B1L C;  4YM6 B;  3AZN A;  3REL A;  5CPK B;  1M19 C;  5DNM C;  5B0Y A;  4DRB A;  3A6N A;  3UTB C;  5B24 D;  4H9N B;  2PYO C;  2F8N H;  1P3F D;  3REJ B;  5B31 A;  5JRG A;  3LEL D;  5CPI A;  1P3K D;  1AOI A;  1TAF A;  1ZLA A;  5B0Z D;  1P34 D;  2ZY3 A;  1P3A D;  3WA9 C;  2NQB D;  4XZQ A;  3W98 A;  3LZ0 C;  4CAY A;  4Z2M H;  5GSU C;  5F99 A;  1R4V A;  2UWX A;  3LZ1 A;  4KGC B;  3B6G D;  3MNN A;  3MGP A;  4JJN B;  4JJN D;  1HTA A;  5B31 G;  1S32 C;  1F66 C;  3AZE A;  3KUY C;  4Z66 C;  3KFU G;  2Y2G A;  3KSY A;  1P3O C;  3AZL C;  4YS3 A;  5B2I A;  4H9R B;  3C1B B;  5AVB C;  4ZBJ C;  5GT3 B;  4G92 C;  3AN2 D;  3WKJ C;  5KDM A;  3P5J B;  3WTP C;  5AV6 C;  1H3O A;  3X1V B;  3X1U D;  3X1U B;  3MGS A;  5AY8 C;  2HIO C;  3MGR D;  3MGR B;  2RVQ C;  4J8U D;  1B67 A;  1EQZ A;  2Y2M A;  3AFA D;  3O62 D;  4WNN B;  4YM6 C;  3AZK A;  4XUJ A;  5GXQ B;  4H9Q B;  5AVC D;  5AVC B;  5CPK C;  3WA9 A;  2XD5 A;  2NZD B;  3MGQ D;  3MGQ B;  2Y2H A;  2CV5 D;  3NQJ B;  3X1S B;  3C1C B;  2L5A A;  1F66 A;  3R45 B;  3LEL C;  3KUY A;  1T3U A; 
#chains in the Genus database with same CATH homology
 2RIQ A;  1P34 C;  1P3O A;  5JA4 B;  3AZL A;  3REL D;  3W99 B;  2Y2K A;  3UT9 A;  1P3M B;  3VH5 A;  5B0Y D;  2FJ7 B;  4KHA A;  3B6G C;  1ULY A;  3WTP A;  5AV6 A;  3A6N D;  4JJN C;  5B33 A;  3H0M C;  5B31 D;  5JRG D;  5CPI D;  5AY8 A;  1ZLA D;  1AOI D;  1ZLA B;  3C1B C;  3AN2 C;  5GT3 C;  4XZQ D;  4XZQ B;  5AV5 B;  2Y2N A;  3W98 D;  3REH B;  4EO5 B;  1HQ3 A;  5F99 D;  3LZ1 B;  5B1M A;  3X1U C;  3MNN D;  5B40 A;  3MGP D;  4J8V B;  4H9O B;  5B2J B;  3AZE D;  3MGR C;  4H9N A;  3KXB B;  4YS3 D;  3O62 C;  5DNN B;  5B2I B;  3REJ A;  5GXQ C;  3W97 B;  5AVC C;  3LJA A;  3EPH A;  1H3O B;  2NZD C;  3MGQ C;  4J8W B;  2CV5 C;  5C3I B;  5DNM D;  4KGC A;  3MGS D;  3MGS B;  3X1S C;  1EQZ D;  3B0C T;  3AZK D;  3AZN C;  4XUJ D;  5AV9 B;  3B6F B;  3REL C;  4H9R A;  4WV4 B;  3WA9 D;  5GT3 A;  3W99 C;  2F2A C;  2FJ7 C;  1N1J A;  3WAA B;  1P3L A;  3A6N C;  3VH5 T;  5BNV B;  3X1V A;  5E5A B;  5CPJ A;  1M18 A;  1F66 D;  5B31 C;  5JRG C;  5CPI C;  1ZLA C;  3KUY D;  1AOI C;  1P3O D;  4XZQ C;  2IO5 B;  4WNN A;  3AZL D;  1A7W A;  5AV5 C;  5AVB D;  3TU4 A;  4WU9 B;  1W2E A;  4H9Q A;  5GXQ A;  3UT9 D;  3LZ1 C;  1BH9 B;  3WTP D;  5AV6 D;  3MNN C;  3MGP C;  4J8V C;  5B33 D;  3UTA B;  3AV2 B;  5AY8 D;  2ZY2 A;  3NQJ A;  5DNN C;  5B2I C;  2RVQ D;  3X1S A;  5CP6 B;  3C1C A;  3R45 A;  4AWL B;  2Y2P A;  5JA4 A;  1HQ3 D;  1HQ3 B;  4UPK A;  3X1T B;  2CWE A;  5B1M D;  2JSS A;  5B1M B;  5CPK D;  4J8W C;  3W99 A;  1P3M A;  5C3I C;  5B40 D;  5B40 B;  4KUD A;  2FJ7 A;  3MGS C;  4NE3 A;  1EQZ C;  3AZK C;  4XUJ C;  2LY8 A;  3REJ D;  5AV9 C;  5GT0 B;  3LJA D;  3LJA B;  3FDD A;  5AV5 A;  3REH A;  4CSR B;  5G49 A;  1PZR A;  5E5A C;  4KGC D;  4HGA C;  4J8V A;  4H9O A;  5B2J A;  3EPJ A;  4LD9 B;  5B32 G;  3KXB A;  2IO5 C;  3REI B;  5DNN A;  3C1B D;  4WU9 C;  5GT3 D;  3W97 A;  3UT9 C;  2BYM B;  3WTP E;  1N1J B;  1BFM A;  3B0C W;  3AZM B;  1P3L B;  4QLC B;  1P3L D;  4NFT A;  4E44 A;  5CPJ D;  3X1V D;  4J8W A;  5B33 C;  5CPJ B;  2NQB C;  1M18 D;  2Y2O A;  1M18 B;  3AV2 C;  3H0L C;  5CP6 C;  4H9S C;  4AWL C;  3VH5 W;  1U35 B;  3TU4 D;  3TU4 B;  5GXQ D;  1HQ3 C;  5AV9 A;  3X1T C;  3B6F A;  3A1K A;  5B1M C;  5B40 C;  3AZF B;  2NZD D;  3WAA A;  1Q9C A;  5BO0 A;  1TZY A;  3KWQ B;  5BNV A;  5E5A A;  4H9P B;  3X1S D;  3C1C D;  3REJ C;  1KX4 B;  2Y2L A;  3LJA C;  5BS7 A;  3AV1 B;  4WU9 A;  3W99 D;  1P3M D;  4KUD B;  2BYK A;  2F8N K;  2FJ7 D;  4KGC C;  1BH9 A;  4LD9 C;  3UTA A;  2BG1 A;  3AV2 A;  5CP6 A;  4H9S A;  1BH8 A;  5B32 B;  5AV5 D;  1P3G B;  1KX3 A;  3REH D;  1P3L C;  3X1T A;  5G49 B;  3LZ1 D;  3REK A;  3X1V C;  5CPJ C;  2ARO B;  1M18 C;  4J8V D;  5B2J D;  4Z2M G;  3AZJ B;  3KXB D;  5DNN D;  5B2I D;  3TU4 C;  3W97 D;  5GT0 A;  4J8W D;  4CSR A;  1F1E A;  4ZUX A;  2HUE B;  2Y2Q A;  3C1C C;  4LD9 A;  5AV8 B;  5AV9 D;  3REI A;  3B6F D;  3AV1 C;  1P3M C;  5B24 A;  2BYM A;  4KUD C;  1P3P A;  3WAA D;  3AZI B;  4J8X A;  3VH6 A;  5BO0 B;  3AZM A;  1TZY D;  1TZY B;  2ZY4 A;  4QLC A;  3AZH B;  5E5A D;  4WZS B;  1M19 B;  5B32 C;  1U35 A;  4NE6 A;  2FFF B;  1P3G C;  4WU9 D;  3REH C;  4EO5 C;  2BYK B;  2PYO B;  2G5I C;  1P3I B;  3AZF A;  2F8N B;  5B2J C;  3UTA D;  3AZG B;  3KWQ A;  3AZJ C;  3AV2 D;  3KXB C;  1M1A B;  4H9P A;  3W96 A;  3LZ0 B;  5CP6 D;  1P3B B;  3AL0 C;  3W97 C;  1BH8 B;  1KX4 A;  1KX3 D;  1KX3 B;  3X1T D;  3F6T A;  3REK B;  3AV1 A;  2HUE C;  5BNX A;  4DRA A;  1KU5 A;  4WU8 B;  2ZY5 A;  4G92 B;  1JFI B;  4R8P A;  3NQU B;  1KX5 B;  5AV8 C;  4Z5T B;  3B6F C;  5GT0 D;  3EG5 B;  5B32 A;  2VQR A;  1P3G A;  2Y2J A;  3WAA C;  3AZI C;  2HIO B;  1TZY C;  4ZUX D;  4ZUX B;  3AZH C;  3VH6 T;  2ARO A;  4LD9 D;  3AZJ A;  5BS7 C;  3REI D;  2JCH A;  5B24 B;  1P3P D;  1P3P B;  4J8X D;  4J8X B;  1P3I C;  3AZM D;  4QLC D;  1P3F B;  3LEL B;  1P3K B;  3UTA C;  5B0Z B;  3AZG C;  1P34 B;  1P3A B;  3IP4 C;  1ID3 A;  1M1A C;  4UUZ A;  3AYW A;  1P3B C;  4X23 A;  1U35 D;  3B6G B;  5AV8 A;  1KX3 C;  2DQN C;  3REK C;  3B0D B;  4G91 B;  3AZF D;  3MVD A;  3AZI A;  5BT1 D;  4WU8 C;  3KWQ D;  3AZH A;  3AN2 B;  5B1L A;  1KX5 C;  3W96 D;  3W96 B;  1Z2C B;  4Z5T C;  1WWI A;  5GT0 C;  1KX4 D;  1M19 A;  5DNM A;  2ZM5 A;  2DF4 C;  2YFW B;  3AV1 D;  3UTB A;  4KUD D;  4J8U B;  4ZUX C;  2PYO A;  2J8P A;  5BNX B;  3AFA B;  3O62 B;  2YFV B;  1P3I A;  2NQB B;  4E45 A;  2F8N A;  5CHL B;  4R8P B;  4R8P D;  3EPK A;  3AZG A;  1M1A A;  5FUG A;  3REI C;  3LZ0 A;  1P3B A;  5GSU A;  2CV5 B;  5B24 C;  3V9R B;  5B32 D;  1P3P C;  1P3G D;  4J8X C;  3AZM C;  1S32 A;  4QLC C;  2F8N G;  3A1I A;  1P3F C;  1P3K C;  4Z66 A;  3AZN B;  3H0R C;  5B0Z C;  2ARO D;  1P3A C;  4WU8 A;  1B6W A;  3REL B;  5AVB A;  3AZJ D;  1JFI A;  5B0Y B;  3NQU A;  1KX5 A;  3WKJ A;  1U35 C;  3A6N B;  3VH6 W;  4Z5T A;  4NE5 A;  3B0D C;  4G91 C;  4WJ3 C;  3AZF C;  5B31 B;  5JRG B;  5BT1 C;  2HIO A;  2Y2I A;  5CPI B;  1TAF B;  1AOI B;  3KWQ C;  1ID3 D;  1ID3 B;  4YM6 A;  4UUZ B;  3AYW B;  3AYW D;  3W96 C;  3W98 B;  1WWS A;  4CAY B;  4X23 D;  4X23 B;  5F99 B;  5CPK A;  5AV8 D;  1KX4 C;  3MNN B;  3MGP B;  3AZE B;  4J8U C;  3MVD D;  3MVD B;  3AZI D;  3AFA C;  4DQY B;  4YS3 B;  3AZH D;  1P3F A;  3LEL A;  3EPL A;  1P3K A;  2NQB A;  5B1L D;  5B1L B;  4R8P C;  5B0Z A;  1P34 A;  1P3A A;  2JE5 A;  5KDM B;  1M19 D;  5DNM B;  3AZN D;  3B6G A;  3UTB D;  4JJN A;  3UTB B;  2PYO D;  1EQZ B;  3AZK B;  1P3I D;  2ARO C;  4XUJ B;  2F8N D;  3AZG D;  3C1B A;  3AN2 A;  3WA9 B;  2XD1 A;  1M1A D;  5B0Y C;  5FUG B;  3LZ0 D;  1P3B D;  5GSU D;  5GSU B;  3X1U A;  4HGA B;  1S32 D;  1S32 B;  1F66 B;  3REK D;  2YFW A;  4Z66 D;  4Z66 B;  3MGR A;  3KUY B;  4J8U A;  1P3O B;  3AFA A;  3O62 A;  2YFV A;  3AZL B;  4WU8 D;  3AYW C;  1ID3 C;  2W8S A;  3W98 C;  4ZBJ B;  5AVB B;  3UT9 B;  3B0B A;  5AVC A;  4X23 C;  5F99 C;  1KX5 D;  3WKJ B;  3WKJ D;  4KHA B;  3WTP B;  5AV6 B;  4M6B A;  4Z5T D;  2NZD A;  2G5H C;  3MGQ A;  3AZE C;  5B33 B;  2CV5 A;  3V9R A;  3MVD C;  4YS3 C;  2HIO D;  5AY8 B;  4YM6 D;  5B1L C;  4YM6 B;  3AZN A;  3REL A;  5CPK B;  1M19 C;  5DNM C;  5B0Y A;  4DRB A;  3A6N A;  3UTB C;  5B24 D;  4H9N B;  2PYO C;  2F8N H;  1P3F D;  3REJ B;  5B31 A;  5JRG A;  3LEL D;  5CPI A;  1P3K D;  1AOI A;  1TAF A;  1ZLA A;  5B0Z D;  1P34 D;  2ZY3 A;  1P3A D;  3WA9 C;  2NQB D;  4XZQ A;  3W98 A;  3LZ0 C;  4CAY A;  4Z2M H;  5GSU C;  5F99 A;  1R4V A;  2UWX A;  3LZ1 A;  4KGC B;  3B6G D;  3MNN A;  3MGP A;  4JJN B;  4JJN D;  1HTA A;  5B31 G;  1S32 C;  1F66 C;  3AZE A;  3KUY C;  4Z66 C;  3KFU G;  2Y2G A;  3KSY A;  1P3O C;  3AZL C;  4YS3 A;  5B2I A;  4H9R B;  3C1B B;  5AVB C;  4ZBJ C;  5GT3 B;  4G92 C;  3AN2 D;  3WKJ C;  5KDM A;  3P5J B;  3WTP C;  5AV6 C;  1H3O A;  3X1V B;  3X1U D;  3X1U B;  3MGS A;  5AY8 C;  2HIO C;  3MGR D;  3MGR B;  2RVQ C;  4J8U D;  1B67 A;  1EQZ A;  2Y2M A;  3AFA D;  3O62 D;  4WNN B;  4YM6 C;  3AZK A;  4XUJ A;  5GXQ B;  4H9Q B;  5AVC D;  5AVC B;  5CPK C;  3WA9 A;  2XD5 A;  2NZD B;  3MGQ D;  3MGQ B;  2Y2H A;  2CV5 D;  3NQJ B;  3X1S B;  3C1C B;  2L5A A;  1F66 A;  3R45 B;  3LEL C;  3KUY A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...