4YS3A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 96
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3A00
3B6GA 1M1AB 2FJ7D 3MGSB 5GT0D 3REIB 5CPID 2BYKB 4QLCA 3AZND 4H9OB 3WAAD 1P3FD 3RELD 3MGPB 3X1SA 3AV1D 4DRBA 1P3PB 3C1CC 3W98D 2YFWB 5B1LC 3MGQD 4KUDB 5B0ZD 4KGCC 5DNMC 5B33A 5B2JA 1KX4A 3W96C 3AZIC 2HIOA 5CHLB 1F66B 1P3LA 4UUZA 3MNND 5AV5A 1TAFB 1P3OC 3C1BC 1Q9CA 3WKJD 5JRGD 3WTPA 4J8WD 1KX5D 3O62A 5B32D 3KWQB 1TZYC 5B0YD 5C3IC 3LZ0B 5F99D 3B0DC 5FUGA 3B0CW 3AV2B 5AVCD 4Z66A 1BH9B 1KX3C 5CPJA 2NQBB 4J8UB 5B1MA 1U35B 5E5AB 5JA4B 4JJNB 3AZEB 4CAYB 3AYWD 3REHC 4H9SC 3NQUA 5BT1C 3AZKA 5G49B 5B24C 3UT9A 5GXQB 2CV5A 2YFVA 4X23D 4KHAA 3LJAD 1P3BA 5AV8B 3VH5A 3KUYD 3AZMB 4Z2MH 5GT3C 1P3GA 3VH6A 3WA9A 1WWIA 4J8VB 3MVDC 1ZLAB 3KSYA 4WU9C 5CPIA 2L5AA 3AZNA 1M1AC 3WAAA 3R45A 3MGSC 3RELA 1P3FA 5AV6B 3REIC 1HQ3B 4LD9B 5BS7C 3C1CD 5B1LD 3V9RA 5B2IC 2BYMB 3MGPC 1P3KB 4YS3B 1BH8A 3MGQA 3AN2B 1M18A 5DNMD 4KGCD 1P3IA 3W96D 3AZID 1S32B 1P3AA 1ID3B 3TU4B 4KUDC 4EO5B 5GSUC 3MNNA 1P3OD 3C1BD 3REJC 1A7WA 3AZFB 3WKJA 5JRGA 1F66C 4J8WA 1KX5A 1KU5A 1TZYD 1P3MB 5B0YA 2PYOB 3MGRB 2F8ND 5F99A 5AVBB 5AV9B 4H9PB 3LZ0C 1KX3D 3AV2C 4YM6B 3KXBA 2AROB 3REHD 4CSRA 4Z5TB 3AYWA 2NQBC 4NFTA 4J8UC 5BT1D 1U35C 5B24D 5E5AC 4WU8B 5AY8C 5CP6C 3UTAD 3LELB 4X23A 1WWSA 2JSSA 3AZHA 3B6GB 3AZJB 4XZQB 3KUYA 5GT3D 5B31B 4QLCB 5AV8C 3AZGA 3X1UB 3MVDD 1AOIA 3AZMC 4NE6A 3X1SB 4WU9D 2NZDB 4G91C 1M1AD 4J8VC 3MGSD 3REID 4XUJB 4G92B 4H9RB 1M19C 1KX4B 5B40B 3C1CA 5B2ID 5AV6C 5B1LA 3MGPD 5BNVA 5B31G 1P3LB 3X1VB 4UUZB 2F8NK 4KGCA 5DNMA 5AV5B 3W96A 3AZIA 3B6FC 1P3KC 4R8PB 4KUDD 4YS3C 3AN2C 3A6NB 1N1JA 5GSUD 2IO5C 5BO0A 3REJD 1S32C 3C1BA 1ID3C 3TU4C 5FUGB 1F66D 1EQZB 3W99B 4H9QA 5CPKA 4EO5C 4Z2MG 3AZFC 2F8NA 1P3MC 2PYOC 3MGRC 1KX3A 5AVBC 1JFIA 3AFAB 5AV9C 3AZKB 2YFVB 2NQBD 3REHA 1U35D 4H9SA 5E5AD 5AY8D 5CP6D 3UTAA 4H9NA 3WA9B 3LELC 5GT3A 4DRAA 5AV8D 3B6GC 3AZJC 4XZQC 3AZMD 3WAAB 3R45B 3MVDA 1P34B 4WU9A 4ZUXB 5B31C 3UTBB 4J8VD 4HGAB 3X1UC 1M1AA 3V9RB 3REIA 2NZDC 2F8NH 1BH8B 3MGQB 4J8XB 3REKC 1M18B 4H9OA 1M19D 5BS7A 4WZSB 1P3IB 5AV6D 4ZBJB 5B2IA 3VH5T 4XUJC 3MGPA 1P3AB 3VH6T 4G92C 3MNNB 1KX4C 2CWEA 5B40C 3B6FD 2YFWA 1P3KD 2FJ7A 5GT0A 4YS3D 3AN2D 3WKJB 3AZLB 3X1VC 5GSUA 1S32D 3REJA 1ID3D 4R8PC 5F99B 3AV1A 5BNXB 3A6NC 3AZFD 3W98A 1P3PC 3W99C 1EQZC 3KXBB 5B0ZA 1ULYA 1P3MD 2PYOD 3MGRD 4CSRB 5AVBD 5AV9D 5DNNB 3AFAC 4AWLB 3AZHB 3AZKC 1U35A 5B32A 3X1TB 5AY8A 5CP6A 3KUYB 1H3OA 3AZGB 5AVCA 3KWQC 1AOIB 3LELD 3NQJA 5KDMA 3B6GD 5AV8A 3AZJD 4XZQD 3LZ1B 5B31D 3W97B 3X1UD 4J8VA 4JJNC 4NE5A 3AZEC 1HTAA 5B1LB 1P34C 2NZDD 4ZUXC 3LJAA 3REKD 3UTBC 4HGAC 5DNMB 1M19A 5GXQC 3AZIB 4XUJD 3MGQC 4J8XC 1N1JB 1M18C 1KX4D 5B40D 1P3IC 1P3AC 4ZBJC 3B6FA 3C1BB 2BYMA 1P3KA 3AN2A 3X1VD 5CPKB 1S32A 1ZLAC 4R8PD 1ID3A 3WKJC 2F8NB 3B0DB 3A6ND 3AZLC 5B33B 5B2JB 2HIOB 1KX3B 1P3PD 3W99D 1EQZD 1HQ3C 4LD9C 1P3MA 2PYOA 3WTPB 5AVBA 5AV9A 3O62B 3KXBC 1P3OA 2F8NG 3UTAB 3AFAD 3AZKD 5DNNC 1TZYA 4Z66B 5CPJB 4AWLC 3AZHC 5B1MB 3X1TC 3KWQD 3LZ0D 3LELA 3AV2D 3AZGC 3AZJA 3NQUB 4XZQA 1AOIC 3UT9B 2CV5B 4KHAB 5B31A 4J8UD 1P3BB 4YM6C 4JJND 3X1UA 5B24A 2AROC 3AZED 3LZ1C 1P34D 5B2IB 2RVQC 4Z5TC 4ZUXD 2NZDA 3UTBD 1P3GB 3REKA 3W97C 5GXQD 4WNNA 4WU8C 3B0CT 4XUJA 2FJ7B 5GT0B 4J8XD 1M18D 5CPIB 4H9RA 5GSUB 1P3ID 3AZNB 4WV4B 5B40A 1P3AD 3REJB 1P3FB 3RELB 3AV1B 3X1VA 4QLCC 1ZLAD 3MGSA 3W98B 4R8PA 3X1SC 3AZLD 3A6NA 2BYKA 5CPKC 5B0ZB 4NE3A 1HQ3D 1P3PA 1EQZA 3W99A 4LD9D 5B33C 5B2JC 2HIOC 5JRGB 4KUDA 1P3LC 3KXBD 4J8WB 1KX5B 5B32B 3B0BA 5AV5C 1B6WA 5CP6B 5AY8B 1R4VA 5B0YB 1H3OB 3WTPC 3TU4D 3AFAA 1F66A 3O62C 5DNND 5AVCB 1TAFA 3UTAC 3NQJB 3VH5W 5KDMB 3AZHD 3X1TD 3KWQA 3VH6W 3LZ0A 4Z66C 3AYWB 5CPJC 5B32G 4G91B 5B1MC 3AZGD 3AV2A 1AOID 2HUEB 1BH9A 4X23B 2NQBA 3LJAB 4J8UA 4YM6D 1M19B 5JA4A 2AROD 5E5AA 3LZ1D 4JJNA 4M6BA 4CAYA 2RVQD 4Z5TD 3UT9C 3AZEA 2CV5C 1P34A 4ZUXA 1P3BC 3UTBA 3W97D 1B67A 5G49A 4WU8D 5GXQA 3B6FB 1BFMA 1P3GC 4J8XA 3WA9C 2IO5B 3AZMA 2FJ7C 5GT0C 5CPIC 4QLCD 3AZNC 3WAAC 3C1CB 1P3FC 1ZLAA 3RELC 3X1SD 5BNVB 3AV1C 5CPKD 3AZLA 2LY8A 4KGCB 3W98C 3W96B 5AV6A 4E44A 5BNXA 1HQ3A 4LD9A 5B33D 5B2JD 5B0ZC 5BO0B 1P3OB 2HIOD 1P3LD 4YS3A 4H9QB 3MNNC 5AV5D 1TZYB 5C3IB 3WTPD 5JRGC 3TU4A 3O62D 4J8WC 1KX5C 5B32C 5DNNA 5B0YC 4E45A 3AZFA 5F99C 1JFIB 3X1TA 5AVCC 4Z66D 5CPJD 3MGRA 3REHB 5B1MD 3WTPE 4H9PA 5B24B 3AYWC 4H9NB 3REKB 4YM6A 3UT9D 1F1EA 2AROA 4WNNB 3LZ1A 2CV5D 2HUEC 4Z5TA 4X23C 3LJAC 5GT3B 1P3BD 3W97A 4WU8A 3MVDB 3KUYC 1P3GD 4WU9B 3WA9D
chains in the Genus database with same CATH superfamily
3B6GA 1M1AB 2FJ7D 3MGSB 5GT0D 3REIB 5CPID 2BYKB 4QLCA 3AZND 4H9OB 3WAAD 1P3FD 3RELD 3MGPB 3X1SA 3AV1D 4DRBA 1P3PB 3C1CC 3W98D 2YFWB 5B1LC 3MGQD 4KUDB 5B0ZD 4KGCC 5DNMC 1PZRA 5B33A 5B2JA 1KX4A 3W96C 3AZIC 2HIOA 5CHLB 1F66B 1P3LA 4UUZA 3MNND 5AV5A 1TAFB 1P3OC 3C1BC 1Q9CA 3WKJD 5JRGD 3WTPA 4J8WD 1KX5D 3O62A 5B32D 3KWQB 1TZYC 5B0YD 5C3IC 3LZ0B 5F99D 3B0DC 5FUGA 3B0CW 3AV2B 5AVCD 4Z66A 1BH9B 1KX3C 5CPJA 2NQBB 4J8UB 5B1MA 1U35B 5E5AB 5JA4B 4JJNB 3AZEB 4CAYB 3AYWD 3REHC 2DQNC 4H9SC 3NQUA 5BT1C 3AZKA 5G49B 5B24C 3UT9A 5GXQB 2CV5A 2YFVA 4X23D 4KHAA 3LJAD 1P3BA 5AV8B 3VH5A 3KUYD 3AZMB 2Y2JA 4Z2MH 5GT3C 1P3GA 3VH6A 3WA9A 1WWIA 4J8VB 3MVDC 1ZLAB 3KSYA 4WU9C 5CPIA 2L5AA 3AZNA 1M1AC 3WAAA 3R45A 3MGSC 2ZY5A 3RELA 5AV6B 2ZY2A 1P3FA 3REIC 1HQ3B 4LD9B 5BS7C 3C1CD 5B1LD 3V9RA 5B2IC 2BYMB 3MGPC 1P3KB 4YS3B 1BH8A 3MGQA 3AN2B 1M18A 5DNMD 4KGCD 1P3IA 3W96D 3AZID 1S32B 1P3AA 1ID3B 3TU4B 4KUDC 4EO5B 5GSUC 3MNNA 1P3OD 3P5JB 3C1BD 3REJC 1A7WA 3AZFB 3WKJA 5JRGA 1F66C 4J8WA 1KX5A 1KU5A 1TZYD 4UPKA 1P3MB 5B0YA 2PYOB 3MGRB 2F8ND 5F99A 5AVBB 5AV9B 4H9PB 3LZ0C 1KX3D 3AV2C 4YM6B 3KXBA 2AROB 3REHD 4CSRA 4Z5TB 3AYWA 2NQBC 2BG1A 4NFTA 4J8UC 5BT1D 1U35C 5B24D 5E5AC 4WU8B 5AY8C 5CP6C 3UTAD 3LELB 4X23A 1WWSA 2JSSA 3AZHA 3B6GB 3AZJB 4XZQB 3KUYA 5GT3D 5B31B 4QLCB 5AV8C 3AZGA 3X1UB 3MVDD 1AOIA 3AZMC 1Z2CB 4NE6A 2G5HC 3X1SB 4WU9D 4DQYB 2NZDB 4G91C 1M1AD 4J8VC 3MGSD 3REID 4XUJB 4G92B 4H9RB 1M19C 1KX4B 5B40B 3C1CA 5B2ID 2VQRA 5AV6C 5B1LA 3MGPD 5BNVA 5B31G 1P3LB 3X1VB 4UUZB 2F8NK 4KGCA 5DNMA 5AV5B 3W96A 3AZIA 3B6FC 1P3KC 4R8PB 4KUDD 4YS3C 3AN2C 3KFUG 3A6NB 1N1JA 5GSUD 2IO5C 2XD1A 5BO0A 3REJD 1S32C 3C1BA 1ID3C 3TU4C 5FUGB 1F66D 1EQZB 3W99B 4H9QA 5CPKA 4EO5C 4Z2MG 3AZFC 2F8NA 3A1KA 2RIQA 1P3MC 2PYOC 3MGRC 1KX3A 5AVBC 1JFIA 3AFAB 5AV9C 3AZKB 2YFVB 2NQBD 3REHA 1U35D 4H9SA 2F2AC 5E5AD 5AY8D 5CP6D 3UTAA 4H9NA 3WA9B 3LELC 5GT3A 4DRAA 2W8SA 5AV8D 3B6GC 3AZJC 4XZQC 3AZMD 2Y2HA 3R45B 3MVDA 3WAAB 1P34B 4WU9A 4ZUXB 5B31C 3UTBB 4J8VD 4HGAB 3X1UC 1M1AA 3V9RB 2Y2PA 3REIA 2NZDC 2F8NH 1BH8B 3MGQB 4J8XB 3REKC 3FDDA 4H9OA 1M18B 1M19D 5BS7A 4WZSB 1P3IB 5AV6D 4ZBJB 5B2IA 3VH5T 4XUJC 3MGPA 1P3AB 3VH6T 4G92C 3MNNB 1KX4C 2CWEA 5B40C 3B6FD 2YFWA 1P3KD 2FJ7A 5GT0A 4YS3D 3AN2D 3WKJB 3AZLB 3X1VC 5GSUA 1S32D 3REJA 1ID3D 4R8PC 5F99B 3H0RC 3AV1A 5BNXB 3A6NC 3IP4C 3AZFD 3W98A 3H0MC 3W99C 1P3PC 1EQZC 2Y2QA 3KXBB 5B0ZA 1ULYA 1P3MD 2PYOD 3MGRD 4CSRB 5AVBD 5AV9D 5DNNB 2ZM5A 3AFAC 4AWLB 3AZHB 3AZKC 1U35A 3EPHA 5B32A 3X1TB 3F6TA 5AY8A 5CP6A 3KUYB 1H3OA 2JE5A 3AZGB 2J8PA 5AVCA 3KWQC 1AOIB 3LELD 3NQJA 5KDMA 3B6GD 5AV8A 3AZJD 4XZQD 3LZ1B 5B31D 3W97B 3X1UD 4J8VA 4JJNC 4NE5A 3AZEC 1HTAA 5B1LB 1P34C 2NZDD 4ZUXC 3LJAA 3REKD 3UTBC 4HGAC 5DNMB 1M19A 5GXQC 2UWXA 4XUJD 3AZIB 3MGQC 3EPKA 4J8XC 1N1JB 2Y2NA 1M18C 1KX4D 5B40D 1P3IC 1P3AC 4ZBJC 3B6FA 3C1BB 2BYMA 1P3KA 2G5IC 3AN2A 3X1VD 5CPKB 1S32A 1ZLAC 4R8PD 1ID3A 3WKJC 2F8NB 3B0DB 3A6ND 3AZLC 2Y2MA 2Y2IA 5B33B 5B2JB 2HIOB 1KX3B 2Y2OA 1P3PD 3W99D 1EQZD 1HQ3C 4LD9C 1P3MA 2XD5A 2PYOA 3WTPB 5AVBA 5AV9A 3O62B 3KXBC 1P3OA 2F8NG 2JCHA 3UTAB 3AFAD 3AZKD 5DNNC 1TZYA 4Z66B 5CPJB 4AWLC 1W2EA 3AZHC 5B1MB 3X1TC 3KWQD 3LZ0D 3LELA 3AV2D 3AZGC 3AZJA 3NQUB 4XZQA 1AOIC 3UT9B 2CV5B 3H0LC 4KHAB 2Y2LA 2Y2KA 5B31A 4J8UD 1P3BB 4YM6C 4JJND 3X1UA 5B24A 2AROC 3AZED 3LZ1C 1P34D 5B2IB 2RVQC 4Z5TC 4ZUXD 2NZDA 3UTBD 1P3GB 2ZY4A 3REKA 3W97C 5GXQD 4WNNA 4WU8C 3B0CT 4XUJA 2FJ7B 5GT0B 4J8XD 1M18D 5CPIB 4H9RA 5GSUB 1P3ID 3AZNB 4WV4B 5B40A 1P3AD 3REJB 1P3FB 3RELB 1T3UA 3AV1B 3X1VA 4QLCC 1ZLAD 3MGSA 3W98B 4R8PA 3X1SC 3AZLD 3A6NA 2BYKA 5CPKC 5B0ZB 4WJ3C 4NE3A 3EPLA 1HQ3D 1P3PA 1EQZA 3W99A 2DF4C 4LD9D 5B33C 5B2JC 2HIOC 5JRGB 4KUDA 1P3LC 3KXBD 4J8WB 1KX5B 5B32B 3B0BA 5AV5C 1B6WA 2ZY3A 5CP6B 1R4VA 5AY8B 1H3OB 5B0YB 2FFFB 3WTPC 3TU4D 3AFAA 1F66A 3O62C 5DNND 5AVCB 1TAFA 3UTAC 3NQJB 3VH5W 5KDMB 3AZHD 3X1TD 3KWQA 3VH6W 3LZ0A 4Z66C 3AYWB 5CPJC 5B32G 4G91B 5B1MC 3AZGD 3AV2A 1AOID 3EPJA 2HUEB 1BH9A 4X23B 2NQBA 3LJAB 4J8UA 4YM6D 1M19B 5JA4A 2AROD 5E5AA 3LZ1D 4JJNA 4M6BA 4CAYA 2RVQD 4Z5TD 3UT9C 3AZEA 2CV5C 1P34A 4ZUXA 1P3BC 3UTBA 3W97D 1B67A 3AL0C 5G49A 4WU8D 5GXQA 3EG5B 3B6FB 1BFMA 1P3GC 4J8XA 3WA9C 2IO5B 3AZMA 2FJ7C 5GT0C 5CPIC 4QLCD 3AZNC 3WAAC 3C1CB 1P3FC 1ZLAA 3RELC 3X1SD 5BNVB 3AV1C 5CPKD 3AZLA 2LY8A 4KGCB 3W98C 3W96B 5AV6A 4E44A 5BNXA 1HQ3A 4LD9A 3A1IA 5B33D 5B2JD 5B0ZC 5BO0B 1P3OB 2HIOD 1P3LD 4YS3A 4H9QB 3MNNC 5AV5D 1TZYB 5C3IB 3WTPD 5JRGC 3TU4A 3O62D 4J8WC 1KX5C 5B32C 5DNNA 5B0YC 4E45A 3AZFA 5F99C 1JFIB 3X1TA 5AVCC 4Z66D 5CPJD 3MGRA 3REHB 5B1MD 3WTPE 4H9PA 5B24B 3AYWC 2Y2GA 4H9NB 3REKB 4YM6A 3UT9D 1F1EA 2AROA 4WNNB 3LZ1A 2CV5D 2HUEC 4Z5TA 4X23C 3LJAC 5GT3B 1P3BD 3W97A 4WU8A 3MVDB 3KUYC 1P3GD 4WU9B 3WA9D
chains in the Genus database with same CATH topology
3B6GA 1M1AB 2FJ7D 3MGSB 5GT0D 3REIB 5CPID 2BYKB 4QLCA 3AZND 4H9OB 3WAAD 1P3FD 3RELD 3MGPB 3X1SA 3AV1D 4DRBA 1P3PB 3C1CC 3W98D 2YFWB 5B1LC 3MGQD 4KUDB 5B0ZD 4KGCC 5DNMC 1PZRA 5B33A 5B2JA 1KX4A 3W96C 3AZIC 2HIOA 5CHLB 1F66B 1P3LA 4UUZA 3MNND 5AV5A 1TAFB 1P3OC 3C1BC 1Q9CA 3WKJD 5JRGD 3WTPA 4J8WD 1KX5D 3O62A 5B32D 3KWQB 1TZYC 5B0YD 5C3IC 3LZ0B 5F99D 3B0DC 5FUGA 3B0CW 3AV2B 5AVCD 4Z66A 1BH9B 1KX3C 5CPJA 2NQBB 4J8UB 5B1MA 1U35B 5E5AB 5JA4B 4JJNB 3AZEB 4CAYB 3AYWD 3REHC 2DQNC 4H9SC 3NQUA 5BT1C 3AZKA 5G49B 5B24C 3UT9A 5GXQB 2CV5A 2YFVA 4X23D 4KHAA 3LJAD 1P3BA 5AV8B 3VH5A 3KUYD 3AZMB 2Y2JA 4Z2MH 5GT3C 1P3GA 3VH6A 3WA9A 1WWIA 4J8VB 3MVDC 1ZLAB 3KSYA 4WU9C 5CPIA 2L5AA 3AZNA 1M1AC 3WAAA 3R45A 3MGSC 2ZY5A 3RELA 5AV6B 2ZY2A 1P3FA 3REIC 1HQ3B 4LD9B 5BS7C 3C1CD 5B1LD 3V9RA 5B2IC 2BYMB 3MGPC 1P3KB 4YS3B 1BH8A 3MGQA 3AN2B 1M18A 5DNMD 4KGCD 1P3IA 3W96D 3AZID 1S32B 1P3AA 1ID3B 3TU4B 4KUDC 4EO5B 5GSUC 3MNNA 1P3OD 3P5JB 3C1BD 3REJC 1A7WA 3AZFB 3WKJA 5JRGA 1F66C 4J8WA 1KX5A 1KU5A 1TZYD 4UPKA 1P3MB 5B0YA 2PYOB 3MGRB 2F8ND 5F99A 5AVBB 5AV9B 4H9PB 3LZ0C 1KX3D 3AV2C 4YM6B 3KXBA 2AROB 3REHD 4CSRA 4Z5TB 3AYWA 2NQBC 2BG1A 4NFTA 4J8UC 5BT1D 1U35C 5B24D 5E5AC 4WU8B 5AY8C 5CP6C 3UTAD 3LELB 4X23A 1WWSA 2JSSA 3AZHA 3B6GB 3AZJB 4XZQB 3KUYA 5GT3D 5B31B 4QLCB 5AV8C 3AZGA 3X1UB 3MVDD 1AOIA 3AZMC 1Z2CB 4NE6A 2G5HC 3X1SB 4WU9D 4DQYB 2NZDB 4G91C 1M1AD 4J8VC 3MGSD 3REID 4XUJB 4G92B 4H9RB 1M19C 1KX4B 5B40B 3C1CA 5B2ID 2VQRA 5AV6C 5B1LA 3MGPD 5BNVA 5B31G 1P3LB 3X1VB 4UUZB 2F8NK 4KGCA 5DNMA 5AV5B 3W96A 3AZIA 3B6FC 1P3KC 4R8PB 4KUDD 4YS3C 3AN2C 3KFUG 3A6NB 1N1JA 5GSUD 2IO5C 2XD1A 5BO0A 3REJD 1S32C 3C1BA 1ID3C 3TU4C 5FUGB 1F66D 1EQZB 3W99B 4H9QA 5CPKA 4EO5C 4Z2MG 3AZFC 2F8NA 3A1KA 2RIQA 1P3MC 2PYOC 3MGRC 1KX3A 5AVBC 1JFIA 3AFAB 5AV9C 3AZKB 2YFVB 2NQBD 3REHA 1U35D 4H9SA 2F2AC 5E5AD 5AY8D 5CP6D 3UTAA 4H9NA 3WA9B 3LELC 5GT3A 4DRAA 2W8SA 5AV8D 3B6GC 3AZJC 4XZQC 3AZMD 2Y2HA 3R45B 3MVDA 3WAAB 1P34B 4WU9A 4ZUXB 5B31C 3UTBB 4J8VD 4HGAB 3X1UC 1M1AA 3V9RB 2Y2PA 3REIA 2NZDC 2F8NH 1BH8B 3MGQB 4J8XB 3REKC 3FDDA 4H9OA 1M18B 1M19D 5BS7A 4WZSB 1P3IB 5AV6D 4ZBJB 5B2IA 3VH5T 4XUJC 3MGPA 1P3AB 3VH6T 4G92C 3MNNB 1KX4C 2CWEA 5B40C 3B6FD 2YFWA 1P3KD 2FJ7A 5GT0A 4YS3D 3AN2D 3WKJB 3AZLB 3X1VC 5GSUA 1S32D 3REJA 1ID3D 4R8PC 5F99B 3H0RC 3AV1A 5BNXB 3A6NC 3IP4C 3AZFD 3W98A 3H0MC 3W99C 1P3PC 1EQZC 2Y2QA 3KXBB 5B0ZA 1ULYA 1P3MD 2PYOD 3MGRD 4CSRB 5AVBD 5AV9D 5DNNB 2ZM5A 3AFAC 4AWLB 3AZHB 3AZKC 1U35A 3EPHA 5B32A 3X1TB 3F6TA 5AY8A 5CP6A 3KUYB 1H3OA 2JE5A 3AZGB 2J8PA 5AVCA 3KWQC 1AOIB 3LELD 3NQJA 5KDMA 3B6GD 5AV8A 3AZJD 4XZQD 3LZ1B 5B31D 3W97B 3X1UD 4J8VA 4JJNC 4NE5A 3AZEC 1HTAA 5B1LB 1P34C 2NZDD 4ZUXC 3LJAA 3REKD 3UTBC 4HGAC 5DNMB 1M19A 5GXQC 2UWXA 4XUJD 3AZIB 3MGQC 3EPKA 4J8XC 1N1JB 2Y2NA 1M18C 1KX4D 5B40D 1P3IC 1P3AC 4ZBJC 3B6FA 3C1BB 2BYMA 1P3KA 2G5IC 3AN2A 3X1VD 5CPKB 1S32A 1ZLAC 4R8PD 1ID3A 3WKJC 2F8NB 3B0DB 3A6ND 3AZLC 2Y2MA 2Y2IA 5B33B 5B2JB 2HIOB 1KX3B 2Y2OA 1P3PD 3W99D 1EQZD 1HQ3C 4LD9C 1P3MA 2XD5A 2PYOA 3WTPB 5AVBA 5AV9A 3O62B 3KXBC 1P3OA 2F8NG 2JCHA 3UTAB 3AFAD 3AZKD 5DNNC 1TZYA 4Z66B 5CPJB 4AWLC 1W2EA 3AZHC 5B1MB 3X1TC 3KWQD 3LZ0D 3LELA 3AV2D 3AZGC 3AZJA 3NQUB 4XZQA 1AOIC 3UT9B 2CV5B 3H0LC 4KHAB 2Y2LA 2Y2KA 5B31A 4J8UD 1P3BB 4YM6C 4JJND 3X1UA 5B24A 2AROC 3AZED 3LZ1C 1P34D 5B2IB 2RVQC 4Z5TC 4ZUXD 2NZDA 3UTBD 1P3GB 2ZY4A 3REKA 3W97C 5GXQD 4WNNA 4WU8C 3B0CT 4XUJA 2FJ7B 5GT0B 4J8XD 1M18D 5CPIB 4H9RA 5GSUB 1P3ID 3AZNB 4WV4B 5B40A 1P3AD 3REJB 1P3FB 3RELB 1T3UA 3AV1B 3X1VA 4QLCC 1ZLAD 3MGSA 3W98B 4R8PA 3X1SC 3AZLD 3A6NA 2BYKA 5CPKC 5B0ZB 4WJ3C 4NE3A 3EPLA 1HQ3D 1P3PA 1EQZA 3W99A 2DF4C 4LD9D 5B33C 5B2JC 2HIOC 5JRGB 4KUDA 1P3LC 3KXBD 4J8WB 1KX5B 5B32B 3B0BA 5AV5C 1B6WA 2ZY3A 5CP6B 1R4VA 5AY8B 1H3OB 5B0YB 2FFFB 3WTPC 3TU4D 3AFAA 1F66A 3O62C 5DNND 5AVCB 1TAFA 3UTAC 3NQJB 3VH5W 5KDMB 3AZHD 3X1TD 3KWQA 3VH6W 3LZ0A 4Z66C 3AYWB 5CPJC 5B32G 4G91B 5B1MC 3AZGD 3AV2A 1AOID 3EPJA 2HUEB 1BH9A 4X23B 2NQBA 3LJAB 4J8UA 4YM6D 1M19B 5JA4A 2AROD 5E5AA 3LZ1D 4JJNA 4M6BA 4CAYA 2RVQD 4Z5TD 3UT9C 3AZEA 2CV5C 1P34A 4ZUXA 1P3BC 3UTBA 3W97D 1B67A 3AL0C 5G49A 4WU8D 5GXQA 3EG5B 3B6FB 1BFMA 1P3GC 4J8XA 3WA9C 2IO5B 3AZMA 2FJ7C 5GT0C 5CPIC 4QLCD 3AZNC 3WAAC 3C1CB 1P3FC 1ZLAA 3RELC 3X1SD 5BNVB 3AV1C 5CPKD 3AZLA 2LY8A 4KGCB 3W98C 3W96B 5AV6A 4E44A 5BNXA 1HQ3A 4LD9A 3A1IA 5B33D 5B2JD 5B0ZC 5BO0B 1P3OB 2HIOD 1P3LD 4YS3A 4H9QB 3MNNC 5AV5D 1TZYB 5C3IB 3WTPD 5JRGC 3TU4A 3O62D 4J8WC 1KX5C 5B32C 5DNNA 5B0YC 4E45A 3AZFA 5F99C 1JFIB 3X1TA 5AVCC 4Z66D 5CPJD 3MGRA 3REHB 5B1MD 3WTPE 4H9PA 5B24B 3AYWC 2Y2GA 4H9NB 3REKB 4YM6A 3UT9D 1F1EA 2AROA 4WNNB 3LZ1A 2CV5D 2HUEC 4Z5TA 4X23C 3LJAC 5GT3B 1P3BD 3W97A 4WU8A 3MVDB 3KUYC 1P3GD 4WU9B 3WA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G A;  1M1A B;  2FJ7 D;  3MGS B;  5GT0 D;  3REI B;  5CPI D;  2BYK B;  4QLC A;  3AZN D;  4H9O B;  3WAA D;  1P3F D;  3REL D;  3MGP B;  3X1S A;  3AV1 D;  4DRB A;  1P3P B;  3C1C C;  3W98 D;  2YFW B;  5B1L C;  3MGQ D;  4KUD B;  5B0Z D;  4KGC C;  5DNM C;  5B33 A;  5B2J A;  1KX4 A;  3W96 C;  3AZI C;  2HIO A;  5CHL B;  1F66 B;  1P3L A;  4UUZ A;  3MNN D;  5AV5 A;  1TAF B;  1P3O C;  3C1B C;  1Q9C A;  3WKJ D;  5JRG D;  3WTP A;  4J8W D;  1KX5 D;  3O62 A;  5B32 D;  3KWQ B;  1TZY C;  5B0Y D;  5C3I C;  3LZ0 B;  5F99 D;  3B0D C;  5FUG A;  3B0C W;  3AV2 B;  5AVC D;  4Z66 A;  1BH9 B;  1KX3 C;  5CPJ A;  2NQB B;  4J8U B;  5B1M A;  1U35 B;  5E5A B;  5JA4 B;  4JJN B;  3AZE B;  4CAY B;  3AYW D;  3REH C;  4H9S C;  3NQU A;  5BT1 C;  3AZK A;  5G49 B;  5B24 C;  3UT9 A;  5GXQ B;  2CV5 A;  2YFV A;  4X23 D;  4KHA A;  3LJA D;  1P3B A;  5AV8 B;  3VH5 A;  3KUY D;  3AZM B;  4Z2M H;  5GT3 C;  1P3G A;  3VH6 A;  3WA9 A;  1WWI A;  4J8V B;  3MVD C;  1ZLA B;  3KSY A;  4WU9 C;  5CPI A;  2L5A A;  3AZN A;  1M1A C;  3WAA A;  3R45 A;  3MGS C;  3REL A;  1P3F A;  5AV6 B;  3REI C;  1HQ3 B;  4LD9 B;  5BS7 C;  3C1C D;  5B1L D;  3V9R A;  5B2I C;  2BYM B;  3MGP C;  1P3K B;  4YS3 B;  1BH8 A;  3MGQ A;  3AN2 B;  1M18 A;  5DNM D;  4KGC D;  1P3I A;  3W96 D;  3AZI D;  1S32 B;  1P3A A;  1ID3 B;  3TU4 B;  4KUD C;  4EO5 B;  5GSU C;  3MNN A;  1P3O D;  3C1B D;  3REJ C;  1A7W A;  3AZF B;  3WKJ A;  5JRG A;  1F66 C;  4J8W A;  1KX5 A;  1KU5 A;  1TZY D;  1P3M B;  5B0Y A;  2PYO B;  3MGR B;  2F8N D;  5F99 A;  5AVB B;  5AV9 B;  4H9P B;  3LZ0 C;  1KX3 D;  3AV2 C;  4YM6 B;  3KXB A;  2ARO B;  3REH D;  4CSR A;  4Z5T B;  3AYW A;  2NQB C;  4NFT A;  4J8U C;  5BT1 D;  1U35 C;  5B24 D;  5E5A C;  4WU8 B;  5AY8 C;  5CP6 C;  3UTA D;  3LEL B;  4X23 A;  1WWS A;  2JSS A;  3AZH A;  3B6G B;  3AZJ B;  4XZQ B;  3KUY A;  5GT3 D;  5B31 B;  4QLC B;  5AV8 C;  3AZG A;  3X1U B;  3MVD D;  1AOI A;  3AZM C;  4NE6 A;  3X1S B;  4WU9 D;  2NZD B;  4G91 C;  1M1A D;  4J8V C;  3MGS D;  3REI D;  4XUJ B;  4G92 B;  4H9R B;  1M19 C;  1KX4 B;  5B40 B;  3C1C A;  5B2I D;  5AV6 C;  5B1L A;  3MGP D;  5BNV A;  5B31 G;  1P3L B;  3X1V B;  4UUZ B;  2F8N K;  4KGC A;  5DNM A;  5AV5 B;  3W96 A;  3AZI A;  3B6F C;  1P3K C;  4R8P B;  4KUD D;  4YS3 C;  3AN2 C;  3A6N B;  1N1J A;  5GSU D;  2IO5 C;  5BO0 A;  3REJ D;  1S32 C;  3C1B A;  1ID3 C;  3TU4 C;  5FUG B;  1F66 D;  1EQZ B;  3W99 B;  4H9Q A;  5CPK A;  4EO5 C;  4Z2M G;  3AZF C;  2F8N A;  1P3M C;  2PYO C;  3MGR C;  1KX3 A;  5AVB C;  1JFI A;  3AFA B;  5AV9 C;  3AZK B;  2YFV B;  2NQB D;  3REH A;  1U35 D;  4H9S A;  5E5A D;  5AY8 D;  5CP6 D;  3UTA A;  4H9N A;  3WA9 B;  3LEL C;  5GT3 A;  4DRA A;  5AV8 D;  3B6G C;  3AZJ C;  4XZQ C;  3AZM D;  3WAA B;  3R45 B;  3MVD A;  1P34 B;  4WU9 A;  4ZUX B;  5B31 C;  3UTB B;  4J8V D;  4HGA B;  3X1U C;  1M1A A;  3V9R B;  3REI A;  2NZD C;  2F8N H;  1BH8 B;  3MGQ B;  4J8X B;  3REK C;  1M18 B;  4H9O A;  1M19 D;  5BS7 A;  4WZS B;  1P3I B;  5AV6 D;  4ZBJ B;  5B2I A;  3VH5 T;  4XUJ C;  3MGP A;  1P3A B;  3VH6 T;  4G92 C;  3MNN B;  1KX4 C;  2CWE A;  5B40 C;  3B6F D;  2YFW A;  1P3K D;  2FJ7 A;  5GT0 A;  4YS3 D;  3AN2 D;  3WKJ B;  3AZL B;  3X1V C;  5GSU A;  1S32 D;  3REJ A;  1ID3 D;  4R8P C;  5F99 B;  3AV1 A;  5BNX B;  3A6N C;  3AZF D;  3W98 A;  1P3P C;  3W99 C;  1EQZ C;  3KXB B;  5B0Z A;  1ULY A;  1P3M D;  2PYO D;  3MGR D;  4CSR B;  5AVB D;  5AV9 D;  5DNN B;  3AFA C;  4AWL B;  3AZH B;  3AZK C;  1U35 A;  5B32 A;  3X1T B;  5AY8 A;  5CP6 A;  3KUY B;  1H3O A;  3AZG B;  5AVC A;  3KWQ C;  1AOI B;  3LEL D;  3NQJ A;  5KDM A;  3B6G D;  5AV8 A;  3AZJ D;  4XZQ D;  3LZ1 B;  5B31 D;  3W97 B;  3X1U D;  4J8V A;  4JJN C;  4NE5 A;  3AZE C;  1HTA A;  5B1L B;  1P34 C;  2NZD D;  4ZUX C;  3LJA A;  3REK D;  3UTB C;  4HGA C;  5DNM B;  1M19 A;  5GXQ C;  3AZI B;  4XUJ D;  3MGQ C;  4J8X C;  1N1J B;  1M18 C;  1KX4 D;  5B40 D;  1P3I C;  1P3A C;  4ZBJ C;  3B6F A;  3C1B B;  2BYM A;  1P3K A;  3AN2 A;  3X1V D;  5CPK B;  1S32 A;  1ZLA C;  4R8P D;  1ID3 A;  3WKJ C;  2F8N B;  3B0D B;  3A6N D;  3AZL C;  5B33 B;  5B2J B;  2HIO B;  1KX3 B;  1P3P D;  3W99 D;  1EQZ D;  1HQ3 C;  4LD9 C;  1P3M A;  2PYO A;  3WTP B;  5AVB A;  5AV9 A;  3O62 B;  3KXB C;  1P3O A;  2F8N G;  3UTA B;  3AFA D;  3AZK D;  5DNN C;  1TZY A;  4Z66 B;  5CPJ B;  4AWL C;  3AZH C;  5B1M B;  3X1T C;  3KWQ D;  3LZ0 D;  3LEL A;  3AV2 D;  3AZG C;  3AZJ A;  3NQU B;  4XZQ A;  1AOI C;  3UT9 B;  2CV5 B;  4KHA B;  5B31 A;  4J8U D;  1P3B B;  4YM6 C;  4JJN D;  3X1U A;  5B24 A;  2ARO C;  3AZE D;  3LZ1 C;  1P34 D;  5B2I B;  2RVQ C;  4Z5T C;  4ZUX D;  2NZD A;  3UTB D;  1P3G B;  3REK A;  3W97 C;  5GXQ D;  4WNN A;  4WU8 C;  3B0C T;  4XUJ A;  2FJ7 B;  5GT0 B;  4J8X D;  1M18 D;  5CPI B;  4H9R A;  5GSU B;  1P3I D;  3AZN B;  4WV4 B;  5B40 A;  1P3A D;  3REJ B;  1P3F B;  3REL B;  3AV1 B;  3X1V A;  4QLC C;  1ZLA D;  3MGS A;  3W98 B;  4R8P A;  3X1S C;  3AZL D;  3A6N A;  2BYK A;  5CPK C;  5B0Z B;  4NE3 A;  1HQ3 D;  1P3P A;  1EQZ A;  3W99 A;  4LD9 D;  5B33 C;  5B2J C;  2HIO C;  5JRG B;  4KUD A;  1P3L C;  3KXB D;  4J8W B;  1KX5 B;  5B32 B;  3B0B A;  5AV5 C;  1B6W A;  5CP6 B;  5AY8 B;  1R4V A;  5B0Y B;  1H3O B;  3WTP C;  3TU4 D;  3AFA A;  1F66 A;  3O62 C;  5DNN D;  5AVC B;  1TAF A;  3UTA C;  3NQJ B;  3VH5 W;  5KDM B;  3AZH D;  3X1T D;  3KWQ A;  3VH6 W;  3LZ0 A;  4Z66 C;  3AYW B;  5CPJ C;  5B32 G;  4G91 B;  5B1M C;  3AZG D;  3AV2 A;  1AOI D;  2HUE B;  1BH9 A;  4X23 B;  2NQB A;  3LJA B;  4J8U A;  4YM6 D;  1M19 B;  5JA4 A;  2ARO D;  5E5A A;  3LZ1 D;  4JJN A;  4M6B A;  4CAY A;  2RVQ D;  4Z5T D;  3UT9 C;  3AZE A;  2CV5 C;  1P34 A;  4ZUX A;  1P3B C;  3UTB A;  3W97 D;  1B67 A;  5G49 A;  4WU8 D;  5GXQ A;  3B6F B;  1BFM A;  1P3G C;  4J8X A;  3WA9 C;  2IO5 B;  3AZM A;  2FJ7 C;  5GT0 C;  5CPI C;  4QLC D;  3AZN C;  3WAA C;  3C1C B;  1P3F C;  1ZLA A;  3REL C;  3X1S D;  5BNV B;  3AV1 C;  5CPK D;  3AZL A;  2LY8 A;  4KGC B;  3W98 C;  3W96 B;  5AV6 A;  4E44 A;  5BNX A;  1HQ3 A;  4LD9 A;  5B33 D;  5B2J D;  5B0Z C;  5BO0 B;  1P3O B;  2HIO D;  1P3L D;  4YS3 A;  4H9Q B;  3MNN C;  5AV5 D;  1TZY B;  5C3I B;  3WTP D;  5JRG C;  3TU4 A;  3O62 D;  4J8W C;  1KX5 C;  5B32 C;  5DNN A;  5B0Y C;  4E45 A;  3AZF A;  5F99 C;  1JFI B;  3X1T A;  5AVC C;  4Z66 D;  5CPJ D;  3MGR A;  3REH B;  5B1M D;  3WTP E;  4H9P A;  5B24 B;  3AYW C;  4H9N B;  3REK B;  4YM6 A;  3UT9 D;  1F1E A;  2ARO A;  4WNN B;  3LZ1 A;  2CV5 D;  2HUE C;  4Z5T A;  4X23 C;  3LJA C;  5GT3 B;  1P3B D;  3W97 A;  4WU8 A;  3MVD B;  3KUY C;  1P3G D;  4WU9 B;  3WA9 D; 
#chains in the Genus database with same CATH topology
 3B6G A;  1M1A B;  2FJ7 D;  3MGS B;  5GT0 D;  3REI B;  5CPI D;  2BYK B;  4QLC A;  3AZN D;  4H9O B;  3WAA D;  1P3F D;  3REL D;  3MGP B;  3X1S A;  3AV1 D;  4DRB A;  1P3P B;  3C1C C;  3W98 D;  2YFW B;  5B1L C;  3MGQ D;  4KUD B;  5B0Z D;  4KGC C;  5DNM C;  1PZR A;  5B33 A;  5B2J A;  1KX4 A;  3W96 C;  3AZI C;  2HIO A;  5CHL B;  1F66 B;  1P3L A;  4UUZ A;  3MNN D;  5AV5 A;  1TAF B;  1P3O C;  3C1B C;  1Q9C A;  3WKJ D;  5JRG D;  3WTP A;  4J8W D;  1KX5 D;  3O62 A;  5B32 D;  3KWQ B;  1TZY C;  5B0Y D;  5C3I C;  3LZ0 B;  5F99 D;  3B0D C;  5FUG A;  3B0C W;  3AV2 B;  5AVC D;  4Z66 A;  1BH9 B;  1KX3 C;  5CPJ A;  2NQB B;  4J8U B;  5B1M A;  1U35 B;  5E5A B;  5JA4 B;  4JJN B;  3AZE B;  4CAY B;  3AYW D;  3REH C;  2DQN C;  4H9S C;  3NQU A;  5BT1 C;  3AZK A;  5G49 B;  5B24 C;  3UT9 A;  5GXQ B;  2CV5 A;  2YFV A;  4X23 D;  4KHA A;  3LJA D;  1P3B A;  5AV8 B;  3VH5 A;  3KUY D;  3AZM B;  2Y2J A;  4Z2M H;  5GT3 C;  1P3G A;  3VH6 A;  3WA9 A;  1WWI A;  4J8V B;  3MVD C;  1ZLA B;  3KSY A;  4WU9 C;  5CPI A;  2L5A A;  3AZN A;  1M1A C;  3WAA A;  3R45 A;  3MGS C;  2ZY5 A;  3REL A;  5AV6 B;  2ZY2 A;  1P3F A;  3REI C;  1HQ3 B;  4LD9 B;  5BS7 C;  3C1C D;  5B1L D;  3V9R A;  5B2I C;  2BYM B;  3MGP C;  1P3K B;  4YS3 B;  1BH8 A;  3MGQ A;  3AN2 B;  1M18 A;  5DNM D;  4KGC D;  1P3I A;  3W96 D;  3AZI D;  1S32 B;  1P3A A;  1ID3 B;  3TU4 B;  4KUD C;  4EO5 B;  5GSU C;  3MNN A;  1P3O D;  3P5J B;  3C1B D;  3REJ C;  1A7W A;  3AZF B;  3WKJ A;  5JRG A;  1F66 C;  4J8W A;  1KX5 A;  1KU5 A;  1TZY D;  4UPK A;  1P3M B;  5B0Y A;  2PYO B;  3MGR B;  2F8N D;  5F99 A;  5AVB B;  5AV9 B;  4H9P B;  3LZ0 C;  1KX3 D;  3AV2 C;  4YM6 B;  3KXB A;  2ARO B;  3REH D;  4CSR A;  4Z5T B;  3AYW A;  2NQB C;  2BG1 A;  4NFT A;  4J8U C;  5BT1 D;  1U35 C;  5B24 D;  5E5A C;  4WU8 B;  5AY8 C;  5CP6 C;  3UTA D;  3LEL B;  4X23 A;  1WWS A;  2JSS A;  3AZH A;  3B6G B;  3AZJ B;  4XZQ B;  3KUY A;  5GT3 D;  5B31 B;  4QLC B;  5AV8 C;  3AZG A;  3X1U B;  3MVD D;  1AOI A;  3AZM C;  1Z2C B;  4NE6 A;  2G5H C;  3X1S B;  4WU9 D;  4DQY B;  2NZD B;  4G91 C;  1M1A D;  4J8V C;  3MGS D;  3REI D;  4XUJ B;  4G92 B;  4H9R B;  1M19 C;  1KX4 B;  5B40 B;  3C1C A;  5B2I D;  2VQR A;  5AV6 C;  5B1L A;  3MGP D;  5BNV A;  5B31 G;  1P3L B;  3X1V B;  4UUZ B;  2F8N K;  4KGC A;  5DNM A;  5AV5 B;  3W96 A;  3AZI A;  3B6F C;  1P3K C;  4R8P B;  4KUD D;  4YS3 C;  3AN2 C;  3KFU G;  3A6N B;  1N1J A;  5GSU D;  2IO5 C;  2XD1 A;  5BO0 A;  3REJ D;  1S32 C;  3C1B A;  1ID3 C;  3TU4 C;  5FUG B;  1F66 D;  1EQZ B;  3W99 B;  4H9Q A;  5CPK A;  4EO5 C;  4Z2M G;  3AZF C;  2F8N A;  3A1K A;  2RIQ A;  1P3M C;  2PYO C;  3MGR C;  1KX3 A;  5AVB C;  1JFI A;  3AFA B;  5AV9 C;  3AZK B;  2YFV B;  2NQB D;  3REH A;  1U35 D;  4H9S A;  2F2A C;  5E5A D;  5AY8 D;  5CP6 D;  3UTA A;  4H9N A;  3WA9 B;  3LEL C;  5GT3 A;  4DRA A;  2W8S A;  5AV8 D;  3B6G C;  3AZJ C;  4XZQ C;  3AZM D;  2Y2H A;  3R45 B;  3MVD A;  3WAA B;  1P34 B;  4WU9 A;  4ZUX B;  5B31 C;  3UTB B;  4J8V D;  4HGA B;  3X1U C;  1M1A A;  3V9R B;  2Y2P A;  3REI A;  2NZD C;  2F8N H;  1BH8 B;  3MGQ B;  4J8X B;  3REK C;  3FDD A;  4H9O A;  1M18 B;  1M19 D;  5BS7 A;  4WZS B;  1P3I B;  5AV6 D;  4ZBJ B;  5B2I A;  3VH5 T;  4XUJ C;  3MGP A;  1P3A B;  3VH6 T;  4G92 C;  3MNN B;  1KX4 C;  2CWE A;  5B40 C;  3B6F D;  2YFW A;  1P3K D;  2FJ7 A;  5GT0 A;  4YS3 D;  3AN2 D;  3WKJ B;  3AZL B;  3X1V C;  5GSU A;  1S32 D;  3REJ A;  1ID3 D;  4R8P C;  5F99 B;  3H0R C;  3AV1 A;  5BNX B;  3A6N C;  3IP4 C;  3AZF D;  3W98 A;  3H0M C;  3W99 C;  1P3P C;  1EQZ C;  2Y2Q A;  3KXB B;  5B0Z A;  1ULY A;  1P3M D;  2PYO D;  3MGR D;  4CSR B;  5AVB D;  5AV9 D;  5DNN B;  2ZM5 A;  3AFA C;  4AWL B;  3AZH B;  3AZK C;  1U35 A;  3EPH A;  5B32 A;  3X1T B;  3F6T A;  5AY8 A;  5CP6 A;  3KUY B;  1H3O A;  2JE5 A;  3AZG B;  2J8P A;  5AVC A;  3KWQ C;  1AOI B;  3LEL D;  3NQJ A;  5KDM A;  3B6G D;  5AV8 A;  3AZJ D;  4XZQ D;  3LZ1 B;  5B31 D;  3W97 B;  3X1U D;  4J8V A;  4JJN C;  4NE5 A;  3AZE C;  1HTA A;  5B1L B;  1P34 C;  2NZD D;  4ZUX C;  3LJA A;  3REK D;  3UTB C;  4HGA C;  5DNM B;  1M19 A;  5GXQ C;  2UWX A;  4XUJ D;  3AZI B;  3MGQ C;  3EPK A;  4J8X C;  1N1J B;  2Y2N A;  1M18 C;  1KX4 D;  5B40 D;  1P3I C;  1P3A C;  4ZBJ C;  3B6F A;  3C1B B;  2BYM A;  1P3K A;  2G5I C;  3AN2 A;  3X1V D;  5CPK B;  1S32 A;  1ZLA C;  4R8P D;  1ID3 A;  3WKJ C;  2F8N B;  3B0D B;  3A6N D;  3AZL C;  2Y2M A;  2Y2I A;  5B33 B;  5B2J B;  2HIO B;  1KX3 B;  2Y2O A;  1P3P D;  3W99 D;  1EQZ D;  1HQ3 C;  4LD9 C;  1P3M A;  2XD5 A;  2PYO A;  3WTP B;  5AVB A;  5AV9 A;  3O62 B;  3KXB C;  1P3O A;  2F8N G;  2JCH A;  3UTA B;  3AFA D;  3AZK D;  5DNN C;  1TZY A;  4Z66 B;  5CPJ B;  4AWL C;  1W2E A;  3AZH C;  5B1M B;  3X1T C;  3KWQ D;  3LZ0 D;  3LEL A;  3AV2 D;  3AZG C;  3AZJ A;  3NQU B;  4XZQ A;  1AOI C;  3UT9 B;  2CV5 B;  3H0L C;  4KHA B;  2Y2L A;  2Y2K A;  5B31 A;  4J8U D;  1P3B B;  4YM6 C;  4JJN D;  3X1U A;  5B24 A;  2ARO C;  3AZE D;  3LZ1 C;  1P34 D;  5B2I B;  2RVQ C;  4Z5T C;  4ZUX D;  2NZD A;  3UTB D;  1P3G B;  2ZY4 A;  3REK A;  3W97 C;  5GXQ D;  4WNN A;  4WU8 C;  3B0C T;  4XUJ A;  2FJ7 B;  5GT0 B;  4J8X D;  1M18 D;  5CPI B;  4H9R A;  5GSU B;  1P3I D;  3AZN B;  4WV4 B;  5B40 A;  1P3A D;  3REJ B;  1P3F B;  3REL B;  1T3U A;  3AV1 B;  3X1V A;  4QLC C;  1ZLA D;  3MGS A;  3W98 B;  4R8P A;  3X1S C;  3AZL D;  3A6N A;  2BYK A;  5CPK C;  5B0Z B;  4WJ3 C;  4NE3 A;  3EPL A;  1HQ3 D;  1P3P A;  1EQZ A;  3W99 A;  2DF4 C;  4LD9 D;  5B33 C;  5B2J C;  2HIO C;  5JRG B;  4KUD A;  1P3L C;  3KXB D;  4J8W B;  1KX5 B;  5B32 B;  3B0B A;  5AV5 C;  1B6W A;  2ZY3 A;  5CP6 B;  1R4V A;  5AY8 B;  1H3O B;  5B0Y B;  2FFF B;  3WTP C;  3TU4 D;  3AFA A;  1F66 A;  3O62 C;  5DNN D;  5AVC B;  1TAF A;  3UTA C;  3NQJ B;  3VH5 W;  5KDM B;  3AZH D;  3X1T D;  3KWQ A;  3VH6 W;  3LZ0 A;  4Z66 C;  3AYW B;  5CPJ C;  5B32 G;  4G91 B;  5B1M C;  3AZG D;  3AV2 A;  1AOI D;  3EPJ A;  2HUE B;  1BH9 A;  4X23 B;  2NQB A;  3LJA B;  4J8U A;  4YM6 D;  1M19 B;  5JA4 A;  2ARO D;  5E5A A;  3LZ1 D;  4JJN A;  4M6B A;  4CAY A;  2RVQ D;  4Z5T D;  3UT9 C;  3AZE A;  2CV5 C;  1P34 A;  4ZUX A;  1P3B C;  3UTB A;  3W97 D;  1B67 A;  3AL0 C;  5G49 A;  4WU8 D;  5GXQ A;  3EG5 B;  3B6F B;  1BFM A;  1P3G C;  4J8X A;  3WA9 C;  2IO5 B;  3AZM A;  2FJ7 C;  5GT0 C;  5CPI C;  4QLC D;  3AZN C;  3WAA C;  3C1C B;  1P3F C;  1ZLA A;  3REL C;  3X1S D;  5BNV B;  3AV1 C;  5CPK D;  3AZL A;  2LY8 A;  4KGC B;  3W98 C;  3W96 B;  5AV6 A;  4E44 A;  5BNX A;  1HQ3 A;  4LD9 A;  3A1I A;  5B33 D;  5B2J D;  5B0Z C;  5BO0 B;  1P3O B;  2HIO D;  1P3L D;  4YS3 A;  4H9Q B;  3MNN C;  5AV5 D;  1TZY B;  5C3I B;  3WTP D;  5JRG C;  3TU4 A;  3O62 D;  4J8W C;  1KX5 C;  5B32 C;  5DNN A;  5B0Y C;  4E45 A;  3AZF A;  5F99 C;  1JFI B;  3X1T A;  5AVC C;  4Z66 D;  5CPJ D;  3MGR A;  3REH B;  5B1M D;  3WTP E;  4H9P A;  5B24 B;  3AYW C;  2Y2G A;  4H9N B;  3REK B;  4YM6 A;  3UT9 D;  1F1E A;  2ARO A;  4WNN B;  3LZ1 A;  2CV5 D;  2HUE C;  4Z5T A;  4X23 C;  3LJA C;  5GT3 B;  1P3B D;  3W97 A;  4WU8 A;  3MVD B;  3KUY C;  1P3G D;  4WU9 B;  3WA9 D; 
#chains in the Genus database with same CATH homology
 3B6G A;  1M1A B;  2FJ7 D;  3MGS B;  5GT0 D;  3REI B;  5CPI D;  2BYK B;  4QLC A;  3AZN D;  4H9O B;  3WAA D;  1P3F D;  3REL D;  3MGP B;  3X1S A;  3AV1 D;  4DRB A;  1P3P B;  3C1C C;  3W98 D;  2YFW B;  5B1L C;  3MGQ D;  4KUD B;  5B0Z D;  4KGC C;  5DNM C;  1PZR A;  5B33 A;  5B2J A;  1KX4 A;  3W96 C;  3AZI C;  2HIO A;  5CHL B;  1F66 B;  1P3L A;  4UUZ A;  3MNN D;  5AV5 A;  1TAF B;  1P3O C;  3C1B C;  1Q9C A;  3WKJ D;  5JRG D;  3WTP A;  4J8W D;  1KX5 D;  3O62 A;  5B32 D;  3KWQ B;  1TZY C;  5B0Y D;  5C3I C;  3LZ0 B;  5F99 D;  3B0D C;  5FUG A;  3B0C W;  3AV2 B;  5AVC D;  4Z66 A;  1BH9 B;  1KX3 C;  5CPJ A;  2NQB B;  4J8U B;  5B1M A;  1U35 B;  5E5A B;  5JA4 B;  4JJN B;  3AZE B;  4CAY B;  3AYW D;  3REH C;  2DQN C;  4H9S C;  3NQU A;  5BT1 C;  3AZK A;  5G49 B;  5B24 C;  3UT9 A;  5GXQ B;  2CV5 A;  2YFV A;  4X23 D;  4KHA A;  3LJA D;  1P3B A;  5AV8 B;  3VH5 A;  3KUY D;  3AZM B;  2Y2J A;  4Z2M H;  5GT3 C;  1P3G A;  3VH6 A;  3WA9 A;  1WWI A;  4J8V B;  3MVD C;  1ZLA B;  3KSY A;  4WU9 C;  5CPI A;  2L5A A;  3AZN A;  1M1A C;  3WAA A;  3R45 A;  3MGS C;  2ZY5 A;  3REL A;  5AV6 B;  2ZY2 A;  1P3F A;  3REI C;  1HQ3 B;  4LD9 B;  5BS7 C;  3C1C D;  5B1L D;  3V9R A;  5B2I C;  2BYM B;  3MGP C;  1P3K B;  4YS3 B;  1BH8 A;  3MGQ A;  3AN2 B;  1M18 A;  5DNM D;  4KGC D;  1P3I A;  3W96 D;  3AZI D;  1S32 B;  1P3A A;  1ID3 B;  3TU4 B;  4KUD C;  4EO5 B;  5GSU C;  3MNN A;  1P3O D;  3P5J B;  3C1B D;  3REJ C;  1A7W A;  3AZF B;  3WKJ A;  5JRG A;  1F66 C;  4J8W A;  1KX5 A;  1KU5 A;  1TZY D;  4UPK A;  1P3M B;  5B0Y A;  2PYO B;  3MGR B;  2F8N D;  5F99 A;  5AVB B;  5AV9 B;  4H9P B;  3LZ0 C;  1KX3 D;  3AV2 C;  4YM6 B;  3KXB A;  2ARO B;  3REH D;  4CSR A;  4Z5T B;  3AYW A;  2NQB C;  2BG1 A;  4NFT A;  4J8U C;  5BT1 D;  1U35 C;  5B24 D;  5E5A C;  4WU8 B;  5AY8 C;  5CP6 C;  3UTA D;  3LEL B;  4X23 A;  1WWS A;  2JSS A;  3AZH A;  3B6G B;  3AZJ B;  4XZQ B;  3KUY A;  5GT3 D;  5B31 B;  4QLC B;  5AV8 C;  3AZG A;  3X1U B;  3MVD D;  1AOI A;  3AZM C;  1Z2C B;  4NE6 A;  2G5H C;  3X1S B;  4WU9 D;  4DQY B;  2NZD B;  4G91 C;  1M1A D;  4J8V C;  3MGS D;  3REI D;  4XUJ B;  4G92 B;  4H9R B;  1M19 C;  1KX4 B;  5B40 B;  3C1C A;  5B2I D;  2VQR A;  5AV6 C;  5B1L A;  3MGP D;  5BNV A;  5B31 G;  1P3L B;  3X1V B;  4UUZ B;  2F8N K;  4KGC A;  5DNM A;  5AV5 B;  3W96 A;  3AZI A;  3B6F C;  1P3K C;  4R8P B;  4KUD D;  4YS3 C;  3AN2 C;  3KFU G;  3A6N B;  1N1J A;  5GSU D;  2IO5 C;  2XD1 A;  5BO0 A;  3REJ D;  1S32 C;  3C1B A;  1ID3 C;  3TU4 C;  5FUG B;  1F66 D;  1EQZ B;  3W99 B;  4H9Q A;  5CPK A;  4EO5 C;  4Z2M G;  3AZF C;  2F8N A;  3A1K A;  2RIQ A;  1P3M C;  2PYO C;  3MGR C;  1KX3 A;  5AVB C;  1JFI A;  3AFA B;  5AV9 C;  3AZK B;  2YFV B;  2NQB D;  3REH A;  1U35 D;  4H9S A;  2F2A C;  5E5A D;  5AY8 D;  5CP6 D;  3UTA A;  4H9N A;  3WA9 B;  3LEL C;  5GT3 A;  4DRA A;  2W8S A;  5AV8 D;  3B6G C;  3AZJ C;  4XZQ C;  3AZM D;  2Y2H A;  3R45 B;  3MVD A;  3WAA B;  1P34 B;  4WU9 A;  4ZUX B;  5B31 C;  3UTB B;  4J8V D;  4HGA B;  3X1U C;  1M1A A;  3V9R B;  2Y2P A;  3REI A;  2NZD C;  2F8N H;  1BH8 B;  3MGQ B;  4J8X B;  3REK C;  3FDD A;  4H9O A;  1M18 B;  1M19 D;  5BS7 A;  4WZS B;  1P3I B;  5AV6 D;  4ZBJ B;  5B2I A;  3VH5 T;  4XUJ C;  3MGP A;  1P3A B;  3VH6 T;  4G92 C;  3MNN B;  1KX4 C;  2CWE A;  5B40 C;  3B6F D;  2YFW A;  1P3K D;  2FJ7 A;  5GT0 A;  4YS3 D;  3AN2 D;  3WKJ B;  3AZL B;  3X1V C;  5GSU A;  1S32 D;  3REJ A;  1ID3 D;  4R8P C;  5F99 B;  3H0R C;  3AV1 A;  5BNX B;  3A6N C;  3IP4 C;  3AZF D;  3W98 A;  3H0M C;  3W99 C;  1P3P C;  1EQZ C;  2Y2Q A;  3KXB B;  5B0Z A;  1ULY A;  1P3M D;  2PYO D;  3MGR D;  4CSR B;  5AVB D;  5AV9 D;  5DNN B;  2ZM5 A;  3AFA C;  4AWL B;  3AZH B;  3AZK C;  1U35 A;  3EPH A;  5B32 A;  3X1T B;  3F6T A;  5AY8 A;  5CP6 A;  3KUY B;  1H3O A;  2JE5 A;  3AZG B;  2J8P A;  5AVC A;  3KWQ C;  1AOI B;  3LEL D;  3NQJ A;  5KDM A;  3B6G D;  5AV8 A;  3AZJ D;  4XZQ D;  3LZ1 B;  5B31 D;  3W97 B;  3X1U D;  4J8V A;  4JJN C;  4NE5 A;  3AZE C;  1HTA A;  5B1L B;  1P34 C;  2NZD D;  4ZUX C;  3LJA A;  3REK D;  3UTB C;  4HGA C;  5DNM B;  1M19 A;  5GXQ C;  2UWX A;  4XUJ D;  3AZI B;  3MGQ C;  3EPK A;  4J8X C;  1N1J B;  2Y2N A;  1M18 C;  1KX4 D;  5B40 D;  1P3I C;  1P3A C;  4ZBJ C;  3B6F A;  3C1B B;  2BYM A;  1P3K A;  2G5I C;  3AN2 A;  3X1V D;  5CPK B;  1S32 A;  1ZLA C;  4R8P D;  1ID3 A;  3WKJ C;  2F8N B;  3B0D B;  3A6N D;  3AZL C;  2Y2M A;  2Y2I A;  5B33 B;  5B2J B;  2HIO B;  1KX3 B;  2Y2O A;  1P3P D;  3W99 D;  1EQZ D;  1HQ3 C;  4LD9 C;  1P3M A;  2XD5 A;  2PYO A;  3WTP B;  5AVB A;  5AV9 A;  3O62 B;  3KXB C;  1P3O A;  2F8N G;  2JCH A;  3UTA B;  3AFA D;  3AZK D;  5DNN C;  1TZY A;  4Z66 B;  5CPJ B;  4AWL C;  1W2E A;  3AZH C;  5B1M B;  3X1T C;  3KWQ D;  3LZ0 D;  3LEL A;  3AV2 D;  3AZG C;  3AZJ A;  3NQU B;  4XZQ A;  1AOI C;  3UT9 B;  2CV5 B;  3H0L C;  4KHA B;  2Y2L A;  2Y2K A;  5B31 A;  4J8U D;  1P3B B;  4YM6 C;  4JJN D;  3X1U A;  5B24 A;  2ARO C;  3AZE D;  3LZ1 C;  1P34 D;  5B2I B;  2RVQ C;  4Z5T C;  4ZUX D;  2NZD A;  3UTB D;  1P3G B;  2ZY4 A;  3REK A;  3W97 C;  5GXQ D;  4WNN A;  4WU8 C;  3B0C T;  4XUJ A;  2FJ7 B;  5GT0 B;  4J8X D;  1M18 D;  5CPI B;  4H9R A;  5GSU B;  1P3I D;  3AZN B;  4WV4 B;  5B40 A;  1P3A D;  3REJ B;  1P3F B;  3REL B;  1T3U A;  3AV1 B;  3X1V A;  4QLC C;  1ZLA D;  3MGS A;  3W98 B;  4R8P A;  3X1S C;  3AZL D;  3A6N A;  2BYK A;  5CPK C;  5B0Z B;  4WJ3 C;  4NE3 A;  3EPL A;  1HQ3 D;  1P3P A;  1EQZ A;  3W99 A;  2DF4 C;  4LD9 D;  5B33 C;  5B2J C;  2HIO C;  5JRG B;  4KUD A;  1P3L C;  3KXB D;  4J8W B;  1KX5 B;  5B32 B;  3B0B A;  5AV5 C;  1B6W A;  2ZY3 A;  5CP6 B;  1R4V A;  5AY8 B;  1H3O B;  5B0Y B;  2FFF B;  3WTP C;  3TU4 D;  3AFA A;  1F66 A;  3O62 C;  5DNN D;  5AVC B;  1TAF A;  3UTA C;  3NQJ B;  3VH5 W;  5KDM B;  3AZH D;  3X1T D;  3KWQ A;  3VH6 W;  3LZ0 A;  4Z66 C;  3AYW B;  5CPJ C;  5B32 G;  4G91 B;  5B1M C;  3AZG D;  3AV2 A;  1AOI D;  3EPJ A;  2HUE B;  1BH9 A;  4X23 B;  2NQB A;  3LJA B;  4J8U A;  4YM6 D;  1M19 B;  5JA4 A;  2ARO D;  5E5A A;  3LZ1 D;  4JJN A;  4M6B A;  4CAY A;  2RVQ D;  4Z5T D;  3UT9 C;  3AZE A;  2CV5 C;  1P34 A;  4ZUX A;  1P3B C;  3UTB A;  3W97 D;  1B67 A;  3AL0 C;  5G49 A;  4WU8 D;  5GXQ A;  3EG5 B;  3B6F B;  1BFM A;  1P3G C;  4J8X A;  3WA9 C;  2IO5 B;  3AZM A;  2FJ7 C;  5GT0 C;  5CPI C;  4QLC D;  3AZN C;  3WAA C;  3C1C B;  1P3F C;  1ZLA A;  3REL C;  3X1S D;  5BNV B;  3AV1 C;  5CPK D;  3AZL A;  2LY8 A;  4KGC B;  3W98 C;  3W96 B;  5AV6 A;  4E44 A;  5BNX A;  1HQ3 A;  4LD9 A;  3A1I A;  5B33 D;  5B2J D;  5B0Z C;  5BO0 B;  1P3O B;  2HIO D;  1P3L D;  4YS3 A;  4H9Q B;  3MNN C;  5AV5 D;  1TZY B;  5C3I B;  3WTP D;  5JRG C;  3TU4 A;  3O62 D;  4J8W C;  1KX5 C;  5B32 C;  5DNN A;  5B0Y C;  4E45 A;  3AZF A;  5F99 C;  1JFI B;  3X1T A;  5AVC C;  4Z66 D;  5CPJ D;  3MGR A;  3REH B;  5B1M D;  3WTP E;  4H9P A;  5B24 B;  3AYW C;  2Y2G A;  4H9N B;  3REK B;  4YM6 A;  3UT9 D;  1F1E A;  2ARO A;  4WNN B;  3LZ1 A;  2CV5 D;  2HUE C;  4Z5T A;  4X23 C;  3LJA C;  5GT3 B;  1P3B D;  3W97 A;  4WU8 A;  3MVD B;  3KUY C;  1P3G D;  4WU9 B;  3WA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...