4YS3A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 31
structure length 96
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3A00
3A6NA 3TU4A 2CV5D 3WAAB 3LJAD 3VH6T 5GT0A 1ID3C 5B31G 3MVDA 4J8XA 4YS3C 4Z66A 5E5AA 3AZFA 2NZDD 2YFVA 5GSUD 5AY8A 3MVDB 3REJD 1BH8A 5AV6D 1M18D 3REJC 3AZHA 5B31C 3AZFB 3REID 1B6WA 1F66D 5F99C 3B6GA 4NE6A 3B6FB 5GT3D 4J8WD 3AYWD 5AV5D 3NQUB 3KUYA 3KXBB 5CP6A 4WU9D 3KXBD 3AZID 3KXBC 1P3MB 4LD9A 3MGPB 1P3MC 3X1TA 4CAYA 3AZNC 1P34B 5B31A 5CP6B 1M1AB 3B6FC 3MGPA 5F99B 5CPJD 4JJNA 3AZGA 5B31B 1M1AA 4G91C 3VH6A 3AFAD 5AV9A 3MGSD 4J8UC 3UT9D 3REIC 2NZDB 5AV6C 2PYOC 3TU4C 2BYMA 5BO0B 5B32B 5AVBD 3X1UA 3B0CT 5BNVB 2JSSA 5AY8D 5CPKC 3LELD 3W99D 1WWIA 5B1MA 3WAAC 2FJ7B 3X1VB 3AN2A 2FJ7D 4G91B 5BS7A 2LY8A 5AVCA 4ZUXD 3KUYD 3AZMA 3WTPD 4J8UA 3WTPE 1P3BD 1R4VA 4H9QB 3V9RB 3C1BD 3W98C 4Z66D 1P34C 4WU8C 3MGPC 1JFIA 3AZMB 5B31D 2NQBD 3AFAB 3MGSB 3REJA 4X23D 3AV1A 1BH8B 4J8WC 1KX4B 4Z2MH 4H9SC 1TZYD 3AFAA 4WZSB 3MGSA 3O62A 3REJB 3LZ1D 4XUJD 5DNNB 1BH9A 3UT9A 3C1CA 5DNND 3MVDC 4Z5TD 3AZJA 2CV5C 4J8VD 3WA9D 3O62B 3KXBA 3X1SC 4H9OB 3KUYC 3AZHC 1P3BC 3X1TB 3LELA 1P3OC 4H9OA 3W97D 2F8NK 3MGPD 3KWQC 5CPJA 3R45B 4Z66C 3WTPB 1P34D 1EQZD 3C1BB 3AYWC 3WKJC 4KUDB 3LJAB 4KGCA 2YFWB 5JRGC 5AV5C 4KUDD 4XZQB 4YS3A 3AV2C 4KGCC 2YFWA 4NE5A 3AV2B 4J8VC 3MGQD 5B1MB 3AN2D 5AV9C 3REHD 2FJ7A 4ZBJC 1TZYA 3B6FD 4QLCA 1HQ3A 3LZ1A 5CPJC 1M19C 5DNMA 4Z5TA 1P3PB 3VH6W 4R8PA 1P3PD 2HIOB 3AZNA 4H9NB 4J8UD 4WU9B 3WA9A 1P3BA 4NFTA 3MNNA 5CPIB 3W97B 3AZEC 3X1SA 5B33D 1P3BB 2IO5C 1ZLAA 1P3FA 3X1SB 3VH5W 3AZLD 3AV1B 5B2JA 4G92B 4EO5B 5DNNA 3WA9C 3AZKD 3C1CB 1U35D 3UTAA 4YS3D 1TAFA 1P3IA 3NQJB 2CWEA 3MGQB 4J8XC 1P3AB 5B1LD 1P3GB 1S32B 3UTAB 4J8VB 4Z2MG 3AZMC 1P3KD 1P3AA 1P3GA 2NQBC 3REKD 1EQZC 5B40B 1HQ3D 4XZQA 4ZUXB 5JRGD 3WKJB 4KUDC 5CPID 3WKJD 3VH5A 5DNMC 5GT0B 5GT0D 4KUDA 3MNND 4Z66B 5AV8B 5B33A 3X1SD 4DRBA 1B67A 5GSUA 1P3LA 2NQBB 4E44A 3AZHB 1ZLAC 3AZHD 1BFMA 3REIA 4AWLC 1U35B 4WNNB 3UTBA 5GT3A 5BT1C 3O62C 4QLCD 3AZGC 1P3AC 1P3GC 5AV6B 3LZ1B 1M18C 1P3KC 3REIB 5B1LB 3TU4D 2CV5A 5GT3B 4H9NA 5KDMB 4WU9A 3WA9B 1P3IC 4LD9B 3LZ1C 1M18B 5B0ZA 3REKB 1TZYC 2HUEB 5B0YD 3RELD 3AZIB 1P3MD 1KX5B 4H9RB 3B0DC 3AZEB 1P3FC 5G49A 5B2IC 5AV8C 3AZEA 5CP6D 2F8ND 1F66C 3AZFC 1Q9CA 1KX3B 3X1VC 4E45A 5F99D 4H9PB 2F8NG 1ID3A 1KU5A 5JA4A 5B1MC 3VH5T 5AVBB 5B1MD 3AN2B 1KX3A 3LELC 1ID3B 1F1EA 2AROB 5AVCD 1S32C 4J8XB 3WKJA 3LJAC 3AZKC 4J8UB 4UUZA 5B0YB 3RELB 3V9RA 5GXQA 4H9SA 3WAAA 3B6GB 3WTPC 4EO5C 5B0YA 3RELA 5CP6C 3AV1C 1P3LB 3AV1D 1KX4A 3X1TC 3X1UC 3AZLB 3KWQA 4WNNA 3UTBB 3W98A 3AZJD 5B32D 4XUJC 2CV5B 5B24B 5AY8C 5B24D 5KDMA 5B24C 5B0ZC 5AVCC 1S32D 5B0ZD 5E5AC 5F99A 5B0ZB 5GXQC 3W99B 1KX4C 3REHC 1P3MA 1H3OA 1M19A 3R45A 4YM6D 5B40D 1KX5A 4CAYB 1P34A 5BT1D 3O62D 4XUJA 4JJNB 5AV5B 3LJAA 3AZED 2F8NA 3B6GC 5B33C 3X1VA 2NZDA 4JJNC 4X23B 1ULYA 5B0YC 3RELC 2F8NB 4CSRA 1KX3D 3REHA 1P3OB 2L5AA 2AROC 3B0BA 3AN2C 1EQZA 5BNXA 3REHB 4R8PB 1P3OA 4R8PD 3TU4B 4M6BA 2F8NH 4UUZB 2NZDC 5AVCB 4J8XD 5GXQB 3AZFD 5E5AB 3X1TD 2HIOD 1F66B 5B2IB 4H9QA 2PYOD 1P3FB 1AOID 4J8WB 5AY8B 3B0DB 5B2JB 1M1AC 4KHAB 1KX5D 1F66A 5B2JD 3B6GD 1M1AD 1KX5C 3B6FA 4J8WA 3AZIC 3UTBC 3W98B 5DNMD 1A7WA 4KHAA 3AZLC 3LZ0C 3NQUA 3AZND 1P3IB 1P3LC 5B24A 1BH9B 3UT9B 5B32G 1S32A 3AZJB 3W99A 1M19D 1P3GD 1P3AD 1H3OB 5B1LC 3AZKB 5B40A 5CPKB 4QLCC 3LELB 3AZGD 3AZGB 3MGRC 4YS3B 5AVBC 3AZKA 5CPKA 3WTPA 2BYKA 5B32C 3A6NC 2PYOB 2BYMB 5BO0A 5AV8A 3AV2A 3C1BA 4XZQC 5GT0C 1KX3C 2NQBA 2PYOA 1P3LD 1AOIA 1HQ3B 4X23A 4ZUXC 5DNMB 4CSRB 1WWSA 3MGRA 4DRAA 4YM6C 3AZNB 3W96D 5B40C 3C1CD 5CPIA 1EQZB 1P3OD 4HGAB 3UTAC 3MGRB 3AZMD 1TZYB 4QLCB 4LD9C 4Z5TB 2HUEC 3KSYA 5GT3C 3REKC 2HIOA 1JFIB 5B2IA 1P3KB 3W97A 3AZJC 4H9RA 4Z5TC 3LZ0B 1ZLAB 3MNNC 3LZ0D 2IO5B 4AWLB 1U35C 4J8VA 5AV8D 4WU8A 4H9PA 1P3PC 3W97C 5FUGB 3W96B 2HIOC 1AOIC 3MGQA 3MGRD 5C3IB 5CPJB 2AROA 5FUGA 3W96A 3A6NB 3A6ND 4ZBJB 5CPKD 2BYKB 4KGCD 5GSUB 3MVDD 4KGCB 3AV2D 5GXQD 5E5AD 2YFVB 3MGQC 1ID3D 5B2ID 1ZLAD 1P3FD 5AV6A 1AOIB 5B33B 3AYWB 3W96C 3AZLA 1N1JB 3KWQB 3C1BC 3C1CC 3UT9C 4WV4B 3KWQD 3W98D 3AYWA 4G92C 1N1JA 3KUYB 1U35A 2RVQC 1P3PA 2RVQD 1P3ID 3AZIA 5CPIC 3MNNB 5B2JC 5B1LA 4WU9C 3WAAD 3W99C 5DNNC 1M19B 3B0CW 5G49B 1P3KA 1M18A 1KX4D 3REKA 2AROD 5AV9B 4XUJB 5AV9D 3LZ0A 4NE3A 4R8PC 5AV5A 5GSUC 5B32A 3UTAD 4HGAC 3AFAC 3MGSC 3X1UB 5AVBA 1TAFB 3X1UD 4WU8D 3X1VD 3NQJA 4WU8B 4LD9D 5BNVA 5BS7C 1HTAA 4YM6B 5C3IC 4X23C 5CHLB 5JRGB 1HQ3C 4YM6A 3UTBD 4JJND 5JA4B 2FJ7C 4XZQD 5JRGA 5BNXB 4ZUXA
chains in the Genus database with same CATH superfamily
3A6NA 3TU4A 2CV5D 3WAAB 3EPJA 3LJAD 3VH6T 5GT0A 1ID3C 5B31G 3MVDA 4J8XA 4YS3C 4Z66A 5E5AA 3AZFA 2NZDD 2YFVA 5GSUD 5AY8A 3MVDB 3REJD 1BH8A 3FDDA 5AV6D 1M18D 3REJC 3AZHA 5B31C 3AZFB 3REID 1B6WA 2Y2LA 1F66D 5F99C 3B6GA 4NE6A 3B6FB 5GT3D 4J8WD 3AYWD 5AV5D 3A1IA 3NQUB 3KUYA 3KXBB 5CP6A 4WU9D 3KXBD 3AZID 3KXBC 2Y2MA 1P3MB 4LD9A 3MGPB 1P3MC 3X1TA 4CAYA 3AZNC 1P34B 5B31A 5CP6B 1M1AB 3B6FC 3MGPA 5F99B 5CPJD 4JJNA 3AZGA 5B31B 1M1AA 4G91C 3VH6A 3AFAD 5AV9A 3MGSD 4J8UC 3UT9D 3REIC 1PZRA 2NZDB 5AV6C 2PYOC 3H0MC 3TU4C 2BYMA 5BO0B 2Y2GA 5B32B 5AVBD 3X1UA 2Y2KA 3B0CT 5BNVB 2JSSA 5AY8D 5CPKC 3LELD 3W99D 1WWIA 5B1MA 3WAAC 2FJ7B 3X1VB 3AN2A 2FJ7D 4G91B 5BS7A 2LY8A 5AVCA 4ZUXD 3F6TA 3KUYD 3AZMA 3WTPD 2VQRA 4J8UA 3WTPE 1P3BD 1R4VA 4H9QB 2XD1A 3V9RB 3C1BD 3W98C 4Z66D 1P34C 4WU8C 3MGPC 1JFIA 3AZMB 5B31D 2NQBD 3AFAB 3MGSB 3REJA 4X23D 3AV1A 1BH8B 4J8WC 1KX4B 2G5IC 4Z2MH 4H9SC 1TZYD 4WZSB 3AFAA 3MGSA 3O62A 4DQYB 3LZ1D 4XUJD 5DNNB 3REJB 1BH9A 3UT9A 3C1CA 5DNND 3MVDC 4Z5TD 3AZJA 2CV5C 4J8VD 3WA9D 3O62B 3KXBA 3X1SC 4H9OB 3KUYC 3AZHC 3H0RC 3X1TB 3LELA 1P3BC 1P3OC 4H9OA 3W97D 2F8NK 3MGPD 3KWQC 5CPJA 3R45B 4Z66C 3WTPB 1P34D 1EQZD 2Y2PA 3C1BB 2Y2QA 3AYWC 2Y2IA 3WKJC 4KUDB 3LJAB 4KGCA 2YFWB 5JRGC 5AV5C 4KUDD 4XZQB 4YS3A 3AV2C 4KGCC 2YFWA 3A1KA 4NE5A 3AV2B 4J8VC 3MGQD 5B1MB 3AN2D 5AV9C 3REHD 2FJ7A 4ZBJC 1TZYA 3B6FD 4QLCA 1HQ3A 3LZ1A 5CPJC 1M19C 5DNMA 4Z5TA 1P3PB 3VH6W 4R8PA 1P3PD 2HIOB 3AZNA 4H9NB 4J8UD 4WU9B 3WA9A 1P3BA 4NFTA 3MNNA 5CPIB 3W97B 3AZEC 3X1SA 5B33D 1P3BB 2IO5C 1ZLAA 1P3FA 3X1SB 3VH5W 3AZLD 3AV1B 5B2JA 4G92B 4EO5B 5DNNA 3WA9C 3AZKD 3C1CB 1U35D 3UTAA 4YS3D 1TAFA 1P3IA 3NQJB 2CWEA 3MGQB 4J8XC 1P3AB 5B1LD 3EPKA 1S32B 1P3GB 3UTAB 2Y2NA 4J8VB 4Z2MG 3AZMC 1P3KD 1P3AA 1P3GA 2NQBC 3REKD 1EQZC 5B40B 1HQ3D 4XZQA 4ZUXB 5JRGD 3WKJB 4KUDC 5CPID 3WKJD 3VH5A 1W2EA 5DNMC 5GT0B 5GT0D 4KUDA 3MNND 4Z66B 5AV8B 5B33A 3X1SD 4DRBA 1B67A 5GSUA 1P3LA 2NQBB 4E44A 3AZHB 1ZLAC 3AZHD 1BFMA 2UWXA 3REIA 3H0LC 4AWLC 1U35B 4WNNB 3UTBA 5GT3A 5BT1C 3O62C 4QLCD 3AZGC 1P3AC 1P3GC 5AV6B 3LZ1B 1M18C 1P3KC 3REIB 5B1LB 3TU4D 2CV5A 5GT3B 4H9NA 5KDMB 4WU9A 3WA9B 1P3IC 4LD9B 3LZ1C 1M18B 5B0ZA 3REKB 1TZYC 2Y2OA 2HUEB 5B0YD 3RELD 3AZIB 1P3MD 2Y2HA 1KX5B 4H9RB 3B0DC 3AZEB 1P3FC 5G49A 5B2IC 5AV8C 3AZEA 5CP6D 2F8ND 1F66C 3AZFC 1Q9CA 1KX3B 3X1VC 4E45A 5F99D 4H9PB 2F8NG 1ID3A 1KU5A 2W8SA 5JA4A 5B1MC 3VH5T 5AVBB 5B1MD 3AN2B 1KX3A 3LELC 1ID3B 1F1EA 2AROB 5AVCD 1S32C 4J8XB 3WKJA 3LJAC 3AZKC 4J8UB 2FFFB 4UUZA 5B0YB 3RELB 3V9RA 5GXQA 4H9SA 3WAAA 3B6GB 3WTPC 4EO5C 5B0YA 2DQNC 3RELA 5CP6C 3AV1C 1P3LB 3AV1D 1KX4A 3X1TC 3IP4C 3X1UC 3AZLB 3KWQA 4WNNA 3UTBB 2ZY3A 3W98A 2Y2JA 3EPLA 3AZJD 5B32D 4XUJC 2CV5B 5B24B 2J8PA 5AY8C 5B24D 5KDMA 5B24C 5B0ZC 5AVCC 1S32D 5B0ZD 5E5AC 5F99A 5B0ZB 5GXQC 3W99B 1KX4C 3REHC 1P3MA 1H3OA 1M19A 3R45A 2G5HC 5B40D 4YM6D 1KX5A 4CAYB 1P34A 4WJ3C 5BT1D 3O62D 4XUJA 4JJNB 5AV5B 3LJAA 3AZED 2XD5A 2F8NA 3B6GC 5B33C 3X1VA 2NZDA 1T3UA 4JJNC 4X23B 1ULYA 5B0YC 3RELC 2F8NB 4CSRA 1KX3D 3REHA 1P3OB 2L5AA 2AROC 3B0BA 3AN2C 1EQZA 5BNXA 3REHB 4R8PB 1P3OA 4R8PD 3TU4B 4M6BA 2F8NH 4UUZB 2NZDC 5AVCB 4J8XD 5GXQB 3AZFD 5E5AB 3X1TD 2HIOD 1F66B 5B2IB 4H9QA 2PYOD 1P3FB 1AOID 4J8WB 5AY8B 3B0DB 5B2JB 1M1AC 4KHAB 1KX5D 1F66A 5B2JD 3B6GD 1M1AD 1KX5C 3B6FA 3EPHA 4J8WA 3AZIC 3UTBC 3W98B 5DNMD 1A7WA 4KHAA 3AZLC 3LZ0C 3NQUA 3AZND 1P3IB 1P3LC 5B24A 1BH9B 3UT9B 5B32G 1S32A 3AZJB 3W99A 1M19D 1P3GD 1P3AD 1H3OB 5B1LC 3AZKB 5B40A 5CPKB 4QLCC 3LELB 3AZGD 3AZGB 3MGRC 4YS3B 5AVBC 3AZKA 5CPKA 3WTPA 2BYKA 5B32C 3A6NC 2PYOB 2BYMB 5BO0A 5AV8A 3AV2A 3C1BA 4XZQC 5GT0C 2ZY4A 1KX3C 2NQBA 2PYOA 1P3LD 1AOIA 1HQ3B 4X23A 4ZUXC 5DNMB 4CSRB 1WWSA 3MGRA 4DRAA 4YM6C 3AZNB 3W96D 5B40C 3C1CD 5CPIA 1EQZB 1P3OD 4HGAB 3UTAC 3MGRB 3AZMD 1TZYB 4QLCB 4LD9C 2ZY5A 4Z5TB 2HUEC 3KSYA 5GT3C 3REKC 2HIOA 2F2AC 1JFIB 5B2IA 1P3KB 3W97A 3AZJC 4H9RA 4Z5TC 3AL0C 3LZ0B 1ZLAB 3MNNC 3LZ0D 2IO5B 4AWLB 1U35C 4J8VA 5AV8D 4WU8A 4H9PA 1P3PC 3W97C 5FUGB 3W96B 2HIOC 1AOIC 3MGQA 2BG1A 3MGRD 5C3IB 5CPJB 2AROA 5FUGA 3W96A 3A6NB 3EG5B 3A6ND 4ZBJB 2ZM5A 5CPKD 3P5JB 1Z2CB 2BYKB 4KGCD 5GSUB 3MVDD 4KGCB 3AV2D 5GXQD 5E5AD 2DF4C 2YFVB 3MGQC 1ID3D 5B2ID 1ZLAD 1P3FD 5AV6A 1AOIB 5B33B 3AYWB 3W96C 3AZLA 1N1JB 3KWQB 3C1BC 3C1CC 3UT9C 4WV4B 3KWQD 3W98D 2JCHA 3AYWA 4G92C 1N1JA 3KUYB 1U35A 2RVQC 1P3PA 2RVQD 1P3ID 3AZIA 5CPIC 2RIQA 3MNNB 5B2JC 5B1LA 4WU9C 3WAAD 3KFUG 3W99C 5DNNC 1M19B 4UPKA 3B0CW 5G49B 1P3KA 1M18A 1KX4D 3REKA 2AROD 5AV9B 4XUJB 5AV9D 3LZ0A 4NE3A 4R8PC 5AV5A 2JE5A 5GSUC 5B32A 3UTAD 2ZY2A 4HGAC 3AFAC 3MGSC 3X1UB 5AVBA 1TAFB 3X1UD 4WU8D 3X1VD 3NQJA 4WU8B 4LD9D 5BNVA 5BS7C 1HTAA 4YM6B 5C3IC 4X23C 5CHLB 5JRGB 1HQ3C 4YM6A 3UTBD 4JJND 5JA4B 2FJ7C 4XZQD 5JRGA 5BNXB 4ZUXA
chains in the Genus database with same CATH topology
3A6NA 3TU4A 2CV5D 3WAAB 3EPJA 3LJAD 3VH6T 5GT0A 1ID3C 5B31G 3MVDA 4J8XA 4YS3C 4Z66A 5E5AA 3AZFA 2NZDD 2YFVA 5GSUD 5AY8A 3MVDB 3REJD 1BH8A 3FDDA 5AV6D 1M18D 3REJC 3AZHA 5B31C 3AZFB 3REID 1B6WA 2Y2LA 1F66D 5F99C 3B6GA 4NE6A 3B6FB 5GT3D 4J8WD 3AYWD 5AV5D 3A1IA 3NQUB 3KUYA 3KXBB 5CP6A 4WU9D 3KXBD 3AZID 3KXBC 2Y2MA 1P3MB 4LD9A 3MGPB 1P3MC 3X1TA 4CAYA 3AZNC 1P34B 5B31A 5CP6B 1M1AB 3B6FC 3MGPA 5F99B 5CPJD 4JJNA 3AZGA 5B31B 1M1AA 4G91C 3VH6A 3AFAD 5AV9A 3MGSD 4J8UC 3UT9D 3REIC 1PZRA 2NZDB 5AV6C 2PYOC 3H0MC 3TU4C 2BYMA 5BO0B 2Y2GA 5B32B 5AVBD 3X1UA 2Y2KA 3B0CT 5BNVB 2JSSA 5AY8D 5CPKC 3LELD 3W99D 1WWIA 5B1MA 3WAAC 2FJ7B 3X1VB 3AN2A 2FJ7D 4G91B 5BS7A 2LY8A 5AVCA 4ZUXD 3F6TA 3KUYD 3AZMA 3WTPD 2VQRA 4J8UA 3WTPE 1P3BD 1R4VA 4H9QB 2XD1A 3V9RB 3C1BD 3W98C 4Z66D 1P34C 4WU8C 3MGPC 1JFIA 3AZMB 5B31D 2NQBD 3AFAB 3MGSB 3REJA 4X23D 3AV1A 1BH8B 4J8WC 1KX4B 2G5IC 4Z2MH 4H9SC 1TZYD 4WZSB 3AFAA 3MGSA 3O62A 4DQYB 3LZ1D 4XUJD 5DNNB 3REJB 1BH9A 3UT9A 3C1CA 5DNND 3MVDC 4Z5TD 3AZJA 2CV5C 4J8VD 3WA9D 3O62B 3KXBA 3X1SC 4H9OB 3KUYC 3AZHC 3H0RC 3X1TB 3LELA 1P3BC 1P3OC 4H9OA 3W97D 2F8NK 3MGPD 3KWQC 5CPJA 3R45B 4Z66C 3WTPB 1P34D 1EQZD 2Y2PA 3C1BB 2Y2QA 3AYWC 2Y2IA 3WKJC 4KUDB 3LJAB 4KGCA 2YFWB 5JRGC 5AV5C 4KUDD 4XZQB 4YS3A 3AV2C 4KGCC 2YFWA 3A1KA 4NE5A 3AV2B 4J8VC 3MGQD 5B1MB 3AN2D 5AV9C 3REHD 2FJ7A 4ZBJC 1TZYA 3B6FD 4QLCA 1HQ3A 3LZ1A 5CPJC 1M19C 5DNMA 4Z5TA 1P3PB 3VH6W 4R8PA 1P3PD 2HIOB 3AZNA 4H9NB 4J8UD 4WU9B 3WA9A 1P3BA 4NFTA 3MNNA 5CPIB 3W97B 3AZEC 3X1SA 5B33D 1P3BB 2IO5C 1ZLAA 1P3FA 3X1SB 3VH5W 3AZLD 3AV1B 5B2JA 4G92B 4EO5B 5DNNA 3WA9C 3AZKD 3C1CB 1U35D 3UTAA 4YS3D 1TAFA 1P3IA 3NQJB 2CWEA 3MGQB 4J8XC 1P3AB 5B1LD 3EPKA 1S32B 1P3GB 3UTAB 2Y2NA 4J8VB 4Z2MG 3AZMC 1P3KD 1P3AA 1P3GA 2NQBC 3REKD 1EQZC 5B40B 1HQ3D 4XZQA 4ZUXB 5JRGD 3WKJB 4KUDC 5CPID 3WKJD 3VH5A 1W2EA 5DNMC 5GT0B 5GT0D 4KUDA 3MNND 4Z66B 5AV8B 5B33A 3X1SD 4DRBA 1B67A 5GSUA 1P3LA 2NQBB 4E44A 3AZHB 1ZLAC 3AZHD 1BFMA 2UWXA 3REIA 3H0LC 4AWLC 1U35B 4WNNB 3UTBA 5GT3A 5BT1C 3O62C 4QLCD 3AZGC 1P3AC 1P3GC 5AV6B 3LZ1B 1M18C 1P3KC 3REIB 5B1LB 3TU4D 2CV5A 5GT3B 4H9NA 5KDMB 4WU9A 3WA9B 1P3IC 4LD9B 3LZ1C 1M18B 5B0ZA 3REKB 1TZYC 2Y2OA 2HUEB 5B0YD 3RELD 3AZIB 1P3MD 2Y2HA 1KX5B 4H9RB 3B0DC 3AZEB 1P3FC 5G49A 5B2IC 5AV8C 3AZEA 5CP6D 2F8ND 1F66C 3AZFC 1Q9CA 1KX3B 3X1VC 4E45A 5F99D 4H9PB 2F8NG 1ID3A 1KU5A 2W8SA 5JA4A 5B1MC 3VH5T 5AVBB 5B1MD 3AN2B 1KX3A 3LELC 1ID3B 1F1EA 2AROB 5AVCD 1S32C 4J8XB 3WKJA 3LJAC 3AZKC 4J8UB 2FFFB 4UUZA 5B0YB 3RELB 3V9RA 5GXQA 4H9SA 3WAAA 3B6GB 3WTPC 4EO5C 5B0YA 2DQNC 3RELA 5CP6C 3AV1C 1P3LB 3AV1D 1KX4A 3X1TC 3IP4C 3X1UC 3AZLB 3KWQA 4WNNA 3UTBB 2ZY3A 3W98A 2Y2JA 3EPLA 3AZJD 5B32D 4XUJC 2CV5B 5B24B 2J8PA 5AY8C 5B24D 5KDMA 5B24C 5B0ZC 5AVCC 1S32D 5B0ZD 5E5AC 5F99A 5B0ZB 5GXQC 3W99B 1KX4C 3REHC 1P3MA 1H3OA 1M19A 3R45A 2G5HC 5B40D 4YM6D 1KX5A 4CAYB 1P34A 4WJ3C 5BT1D 3O62D 4XUJA 4JJNB 5AV5B 3LJAA 3AZED 2XD5A 2F8NA 3B6GC 5B33C 3X1VA 2NZDA 1T3UA 4JJNC 4X23B 1ULYA 5B0YC 3RELC 2F8NB 4CSRA 1KX3D 3REHA 1P3OB 2L5AA 2AROC 3B0BA 3AN2C 1EQZA 5BNXA 3REHB 4R8PB 1P3OA 4R8PD 3TU4B 4M6BA 2F8NH 4UUZB 2NZDC 5AVCB 4J8XD 5GXQB 3AZFD 5E5AB 3X1TD 2HIOD 1F66B 5B2IB 4H9QA 2PYOD 1P3FB 1AOID 4J8WB 5AY8B 3B0DB 5B2JB 1M1AC 4KHAB 1KX5D 1F66A 5B2JD 3B6GD 1M1AD 1KX5C 3B6FA 3EPHA 4J8WA 3AZIC 3UTBC 3W98B 5DNMD 1A7WA 4KHAA 3AZLC 3LZ0C 3NQUA 3AZND 1P3IB 1P3LC 5B24A 1BH9B 3UT9B 5B32G 1S32A 3AZJB 3W99A 1M19D 1P3GD 1P3AD 1H3OB 5B1LC 3AZKB 5B40A 5CPKB 4QLCC 3LELB 3AZGD 3AZGB 3MGRC 4YS3B 5AVBC 3AZKA 5CPKA 3WTPA 2BYKA 5B32C 3A6NC 2PYOB 2BYMB 5BO0A 5AV8A 3AV2A 3C1BA 4XZQC 5GT0C 2ZY4A 1KX3C 2NQBA 2PYOA 1P3LD 1AOIA 1HQ3B 4X23A 4ZUXC 5DNMB 4CSRB 1WWSA 3MGRA 4DRAA 4YM6C 3AZNB 3W96D 5B40C 3C1CD 5CPIA 1EQZB 1P3OD 4HGAB 3UTAC 3MGRB 3AZMD 1TZYB 4QLCB 4LD9C 2ZY5A 4Z5TB 2HUEC 3KSYA 5GT3C 3REKC 2HIOA 2F2AC 1JFIB 5B2IA 1P3KB 3W97A 3AZJC 4H9RA 4Z5TC 3AL0C 3LZ0B 1ZLAB 3MNNC 3LZ0D 2IO5B 4AWLB 1U35C 4J8VA 5AV8D 4WU8A 4H9PA 1P3PC 3W97C 5FUGB 3W96B 2HIOC 1AOIC 3MGQA 2BG1A 3MGRD 5C3IB 5CPJB 2AROA 5FUGA 3W96A 3A6NB 3EG5B 3A6ND 4ZBJB 2ZM5A 5CPKD 3P5JB 1Z2CB 2BYKB 4KGCD 5GSUB 3MVDD 4KGCB 3AV2D 5GXQD 5E5AD 2DF4C 2YFVB 3MGQC 1ID3D 5B2ID 1ZLAD 1P3FD 5AV6A 1AOIB 5B33B 3AYWB 3W96C 3AZLA 1N1JB 3KWQB 3C1BC 3C1CC 3UT9C 4WV4B 3KWQD 3W98D 2JCHA 3AYWA 4G92C 1N1JA 3KUYB 1U35A 2RVQC 1P3PA 2RVQD 1P3ID 3AZIA 5CPIC 2RIQA 3MNNB 5B2JC 5B1LA 4WU9C 3WAAD 3KFUG 3W99C 5DNNC 1M19B 4UPKA 3B0CW 5G49B 1P3KA 1M18A 1KX4D 3REKA 2AROD 5AV9B 4XUJB 5AV9D 3LZ0A 4NE3A 4R8PC 5AV5A 2JE5A 5GSUC 5B32A 3UTAD 2ZY2A 4HGAC 3AFAC 3MGSC 3X1UB 5AVBA 1TAFB 3X1UD 4WU8D 3X1VD 3NQJA 4WU8B 4LD9D 5BNVA 5BS7C 1HTAA 4YM6B 5C3IC 4X23C 5CHLB 5JRGB 1HQ3C 4YM6A 3UTBD 4JJND 5JA4B 2FJ7C 4XZQD 5JRGA 5BNXB 4ZUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  3TU4 A;  2CV5 D;  3WAA B;  3LJA D;  3VH6 T;  5GT0 A;  1ID3 C;  5B31 G;  3MVD A;  4J8X A;  4YS3 C;  4Z66 A;  5E5A A;  3AZF A;  2NZD D;  2YFV A;  5GSU D;  5AY8 A;  3MVD B;  3REJ D;  1BH8 A;  5AV6 D;  1M18 D;  3REJ C;  3AZH A;  5B31 C;  3AZF B;  3REI D;  1B6W A;  1F66 D;  5F99 C;  3B6G A;  4NE6 A;  3B6F B;  5GT3 D;  4J8W D;  3AYW D;  5AV5 D;  3NQU B;  3KUY A;  3KXB B;  5CP6 A;  4WU9 D;  3KXB D;  3AZI D;  3KXB C;  1P3M B;  4LD9 A;  3MGP B;  1P3M C;  3X1T A;  4CAY A;  3AZN C;  1P34 B;  5B31 A;  5CP6 B;  1M1A B;  3B6F C;  3MGP A;  5F99 B;  5CPJ D;  4JJN A;  3AZG A;  5B31 B;  1M1A A;  4G91 C;  3VH6 A;  3AFA D;  5AV9 A;  3MGS D;  4J8U C;  3UT9 D;  3REI C;  2NZD B;  5AV6 C;  2PYO C;  3TU4 C;  2BYM A;  5BO0 B;  5B32 B;  5AVB D;  3X1U A;  3B0C T;  5BNV B;  2JSS A;  5AY8 D;  5CPK C;  3LEL D;  3W99 D;  1WWI A;  5B1M A;  3WAA C;  2FJ7 B;  3X1V B;  3AN2 A;  2FJ7 D;  4G91 B;  5BS7 A;  2LY8 A;  5AVC A;  4ZUX D;  3KUY D;  3AZM A;  3WTP D;  4J8U A;  3WTP E;  1P3B D;  1R4V A;  4H9Q B;  3V9R B;  3C1B D;  3W98 C;  4Z66 D;  1P34 C;  4WU8 C;  3MGP C;  1JFI A;  3AZM B;  5B31 D;  2NQB D;  3AFA B;  3MGS B;  3REJ A;  4X23 D;  3AV1 A;  1BH8 B;  4J8W C;  1KX4 B;  4Z2M H;  4H9S C;  1TZY D;  3AFA A;  4WZS B;  3MGS A;  3O62 A;  3REJ B;  3LZ1 D;  4XUJ D;  5DNN B;  1BH9 A;  3UT9 A;  3C1C A;  5DNN D;  3MVD C;  4Z5T D;  3AZJ A;  2CV5 C;  4J8V D;  3WA9 D;  3O62 B;  3KXB A;  3X1S C;  4H9O B;  3KUY C;  3AZH C;  1P3B C;  3X1T B;  3LEL A;  1P3O C;  4H9O A;  3W97 D;  2F8N K;  3MGP D;  3KWQ C;  5CPJ A;  3R45 B;  4Z66 C;  3WTP B;  1P34 D;  1EQZ D;  3C1B B;  3AYW C;  3WKJ C;  4KUD B;  3LJA B;  4KGC A;  2YFW B;  5JRG C;  5AV5 C;  4KUD D;  4XZQ B;  4YS3 A;  3AV2 C;  4KGC C;  2YFW A;  4NE5 A;  3AV2 B;  4J8V C;  3MGQ D;  5B1M B;  3AN2 D;  5AV9 C;  3REH D;  2FJ7 A;  4ZBJ C;  1TZY A;  3B6F D;  4QLC A;  1HQ3 A;  3LZ1 A;  5CPJ C;  1M19 C;  5DNM A;  4Z5T A;  1P3P B;  3VH6 W;  4R8P A;  1P3P D;  2HIO B;  3AZN A;  4H9N B;  4J8U D;  4WU9 B;  3WA9 A;  1P3B A;  4NFT A;  3MNN A;  5CPI B;  3W97 B;  3AZE C;  3X1S A;  5B33 D;  1P3B B;  2IO5 C;  1ZLA A;  1P3F A;  3X1S B;  3VH5 W;  3AZL D;  3AV1 B;  5B2J A;  4G92 B;  4EO5 B;  5DNN A;  3WA9 C;  3AZK D;  3C1C B;  1U35 D;  3UTA A;  4YS3 D;  1TAF A;  1P3I A;  3NQJ B;  2CWE A;  3MGQ B;  4J8X C;  1P3A B;  5B1L D;  1P3G B;  1S32 B;  3UTA B;  4J8V B;  4Z2M G;  3AZM C;  1P3K D;  1P3A A;  1P3G A;  2NQB C;  3REK D;  1EQZ C;  5B40 B;  1HQ3 D;  4XZQ A;  4ZUX B;  5JRG D;  3WKJ B;  4KUD C;  5CPI D;  3WKJ D;  3VH5 A;  5DNM C;  5GT0 B;  5GT0 D;  4KUD A;  3MNN D;  4Z66 B;  5AV8 B;  5B33 A;  3X1S D;  4DRB A;  1B67 A;  5GSU A;  1P3L A;  2NQB B;  4E44 A;  3AZH B;  1ZLA C;  3AZH D;  1BFM A;  3REI A;  4AWL C;  1U35 B;  4WNN B;  3UTB A;  5GT3 A;  5BT1 C;  3O62 C;  4QLC D;  3AZG C;  1P3A C;  1P3G C;  5AV6 B;  3LZ1 B;  1M18 C;  1P3K C;  3REI B;  5B1L B;  3TU4 D;  2CV5 A;  5GT3 B;  4H9N A;  5KDM B;  4WU9 A;  3WA9 B;  1P3I C;  4LD9 B;  3LZ1 C;  1M18 B;  5B0Z A;  3REK B;  1TZY C;  2HUE B;  5B0Y D;  3REL D;  3AZI B;  1P3M D;  1KX5 B;  4H9R B;  3B0D C;  3AZE B;  1P3F C;  5G49 A;  5B2I C;  5AV8 C;  3AZE A;  5CP6 D;  2F8N D;  1F66 C;  3AZF C;  1Q9C A;  1KX3 B;  3X1V C;  4E45 A;  5F99 D;  4H9P B;  2F8N G;  1ID3 A;  1KU5 A;  5JA4 A;  5B1M C;  3VH5 T;  5AVB B;  5B1M D;  3AN2 B;  1KX3 A;  3LEL C;  1ID3 B;  1F1E A;  2ARO B;  5AVC D;  1S32 C;  4J8X B;  3WKJ A;  3LJA C;  3AZK C;  4J8U B;  4UUZ A;  5B0Y B;  3REL B;  3V9R A;  5GXQ A;  4H9S A;  3WAA A;  3B6G B;  3WTP C;  4EO5 C;  5B0Y A;  3REL A;  5CP6 C;  3AV1 C;  1P3L B;  3AV1 D;  1KX4 A;  3X1T C;  3X1U C;  3AZL B;  3KWQ A;  4WNN A;  3UTB B;  3W98 A;  3AZJ D;  5B32 D;  4XUJ C;  2CV5 B;  5B24 B;  5AY8 C;  5B24 D;  5KDM A;  5B24 C;  5B0Z C;  5AVC C;  1S32 D;  5B0Z D;  5E5A C;  5F99 A;  5B0Z B;  5GXQ C;  3W99 B;  1KX4 C;  3REH C;  1P3M A;  1H3O A;  1M19 A;  3R45 A;  4YM6 D;  5B40 D;  1KX5 A;  4CAY B;  1P34 A;  5BT1 D;  3O62 D;  4XUJ A;  4JJN B;  5AV5 B;  3LJA A;  3AZE D;  2F8N A;  3B6G C;  5B33 C;  3X1V A;  2NZD A;  4JJN C;  4X23 B;  1ULY A;  5B0Y C;  3REL C;  2F8N B;  4CSR A;  1KX3 D;  3REH A;  1P3O B;  2L5A A;  2ARO C;  3B0B A;  3AN2 C;  1EQZ A;  5BNX A;  3REH B;  4R8P B;  1P3O A;  4R8P D;  3TU4 B;  4M6B A;  2F8N H;  4UUZ B;  2NZD C;  5AVC B;  4J8X D;  5GXQ B;  3AZF D;  5E5A B;  3X1T D;  2HIO D;  1F66 B;  5B2I B;  4H9Q A;  2PYO D;  1P3F B;  1AOI D;  4J8W B;  5AY8 B;  3B0D B;  5B2J B;  1M1A C;  4KHA B;  1KX5 D;  1F66 A;  5B2J D;  3B6G D;  1M1A D;  1KX5 C;  3B6F A;  4J8W A;  3AZI C;  3UTB C;  3W98 B;  5DNM D;  1A7W A;  4KHA A;  3AZL C;  3LZ0 C;  3NQU A;  3AZN D;  1P3I B;  1P3L C;  5B24 A;  1BH9 B;  3UT9 B;  5B32 G;  1S32 A;  3AZJ B;  3W99 A;  1M19 D;  1P3G D;  1P3A D;  1H3O B;  5B1L C;  3AZK B;  5B40 A;  5CPK B;  4QLC C;  3LEL B;  3AZG D;  3AZG B;  3MGR C;  4YS3 B;  5AVB C;  3AZK A;  5CPK A;  3WTP A;  2BYK A;  5B32 C;  3A6N C;  2PYO B;  2BYM B;  5BO0 A;  5AV8 A;  3AV2 A;  3C1B A;  4XZQ C;  5GT0 C;  1KX3 C;  2NQB A;  2PYO A;  1P3L D;  1AOI A;  1HQ3 B;  4X23 A;  4ZUX C;  5DNM B;  4CSR B;  1WWS A;  3MGR A;  4DRA A;  4YM6 C;  3AZN B;  3W96 D;  5B40 C;  3C1C D;  5CPI A;  1EQZ B;  1P3O D;  4HGA B;  3UTA C;  3MGR B;  3AZM D;  1TZY B;  4QLC B;  4LD9 C;  4Z5T B;  2HUE C;  3KSY A;  5GT3 C;  3REK C;  2HIO A;  1JFI B;  5B2I A;  1P3K B;  3W97 A;  3AZJ C;  4H9R A;  4Z5T C;  3LZ0 B;  1ZLA B;  3MNN C;  3LZ0 D;  2IO5 B;  4AWL B;  1U35 C;  4J8V A;  5AV8 D;  4WU8 A;  4H9P A;  1P3P C;  3W97 C;  5FUG B;  3W96 B;  2HIO C;  1AOI C;  3MGQ A;  3MGR D;  5C3I B;  5CPJ B;  2ARO A;  5FUG A;  3W96 A;  3A6N B;  3A6N D;  4ZBJ B;  5CPK D;  2BYK B;  4KGC D;  5GSU B;  3MVD D;  4KGC B;  3AV2 D;  5GXQ D;  5E5A D;  2YFV B;  3MGQ C;  1ID3 D;  5B2I D;  1ZLA D;  1P3F D;  5AV6 A;  1AOI B;  5B33 B;  3AYW B;  3W96 C;  3AZL A;  1N1J B;  3KWQ B;  3C1B C;  3C1C C;  3UT9 C;  4WV4 B;  3KWQ D;  3W98 D;  3AYW A;  4G92 C;  1N1J A;  3KUY B;  1U35 A;  2RVQ C;  1P3P A;  2RVQ D;  1P3I D;  3AZI A;  5CPI C;  3MNN B;  5B2J C;  5B1L A;  4WU9 C;  3WAA D;  3W99 C;  5DNN C;  1M19 B;  3B0C W;  5G49 B;  1P3K A;  1M18 A;  1KX4 D;  3REK A;  2ARO D;  5AV9 B;  4XUJ B;  5AV9 D;  3LZ0 A;  4NE3 A;  4R8P C;  5AV5 A;  5GSU C;  5B32 A;  3UTA D;  4HGA C;  3AFA C;  3MGS C;  3X1U B;  5AVB A;  1TAF B;  3X1U D;  4WU8 D;  3X1V D;  3NQJ A;  4WU8 B;  4LD9 D;  5BNV A;  5BS7 C;  1HTA A;  4YM6 B;  5C3I C;  4X23 C;  5CHL B;  5JRG B;  1HQ3 C;  4YM6 A;  3UTB D;  4JJN D;  5JA4 B;  2FJ7 C;  4XZQ D;  5JRG A;  5BNX B;  4ZUX A; 
#chains in the Genus database with same CATH topology
 3A6N A;  3TU4 A;  2CV5 D;  3WAA B;  3EPJ A;  3LJA D;  3VH6 T;  5GT0 A;  1ID3 C;  5B31 G;  3MVD A;  4J8X A;  4YS3 C;  4Z66 A;  5E5A A;  3AZF A;  2NZD D;  2YFV A;  5GSU D;  5AY8 A;  3MVD B;  3REJ D;  1BH8 A;  3FDD A;  5AV6 D;  1M18 D;  3REJ C;  3AZH A;  5B31 C;  3AZF B;  3REI D;  1B6W A;  2Y2L A;  1F66 D;  5F99 C;  3B6G A;  4NE6 A;  3B6F B;  5GT3 D;  4J8W D;  3AYW D;  5AV5 D;  3A1I A;  3NQU B;  3KUY A;  3KXB B;  5CP6 A;  4WU9 D;  3KXB D;  3AZI D;  3KXB C;  2Y2M A;  1P3M B;  4LD9 A;  3MGP B;  1P3M C;  3X1T A;  4CAY A;  3AZN C;  1P34 B;  5B31 A;  5CP6 B;  1M1A B;  3B6F C;  3MGP A;  5F99 B;  5CPJ D;  4JJN A;  3AZG A;  5B31 B;  1M1A A;  4G91 C;  3VH6 A;  3AFA D;  5AV9 A;  3MGS D;  4J8U C;  3UT9 D;  3REI C;  1PZR A;  2NZD B;  5AV6 C;  2PYO C;  3H0M C;  3TU4 C;  2BYM A;  5BO0 B;  2Y2G A;  5B32 B;  5AVB D;  3X1U A;  2Y2K A;  3B0C T;  5BNV B;  2JSS A;  5AY8 D;  5CPK C;  3LEL D;  3W99 D;  1WWI A;  5B1M A;  3WAA C;  2FJ7 B;  3X1V B;  3AN2 A;  2FJ7 D;  4G91 B;  5BS7 A;  2LY8 A;  5AVC A;  4ZUX D;  3F6T A;  3KUY D;  3AZM A;  3WTP D;  2VQR A;  4J8U A;  3WTP E;  1P3B D;  1R4V A;  4H9Q B;  2XD1 A;  3V9R B;  3C1B D;  3W98 C;  4Z66 D;  1P34 C;  4WU8 C;  3MGP C;  1JFI A;  3AZM B;  5B31 D;  2NQB D;  3AFA B;  3MGS B;  3REJ A;  4X23 D;  3AV1 A;  1BH8 B;  4J8W C;  1KX4 B;  2G5I C;  4Z2M H;  4H9S C;  1TZY D;  4WZS B;  3AFA A;  3MGS A;  3O62 A;  4DQY B;  3LZ1 D;  4XUJ D;  5DNN B;  3REJ B;  1BH9 A;  3UT9 A;  3C1C A;  5DNN D;  3MVD C;  4Z5T D;  3AZJ A;  2CV5 C;  4J8V D;  3WA9 D;  3O62 B;  3KXB A;  3X1S C;  4H9O B;  3KUY C;  3AZH C;  3H0R C;  3X1T B;  3LEL A;  1P3B C;  1P3O C;  4H9O A;  3W97 D;  2F8N K;  3MGP D;  3KWQ C;  5CPJ A;  3R45 B;  4Z66 C;  3WTP B;  1P34 D;  1EQZ D;  2Y2P A;  3C1B B;  2Y2Q A;  3AYW C;  2Y2I A;  3WKJ C;  4KUD B;  3LJA B;  4KGC A;  2YFW B;  5JRG C;  5AV5 C;  4KUD D;  4XZQ B;  4YS3 A;  3AV2 C;  4KGC C;  2YFW A;  3A1K A;  4NE5 A;  3AV2 B;  4J8V C;  3MGQ D;  5B1M B;  3AN2 D;  5AV9 C;  3REH D;  2FJ7 A;  4ZBJ C;  1TZY A;  3B6F D;  4QLC A;  1HQ3 A;  3LZ1 A;  5CPJ C;  1M19 C;  5DNM A;  4Z5T A;  1P3P B;  3VH6 W;  4R8P A;  1P3P D;  2HIO B;  3AZN A;  4H9N B;  4J8U D;  4WU9 B;  3WA9 A;  1P3B A;  4NFT A;  3MNN A;  5CPI B;  3W97 B;  3AZE C;  3X1S A;  5B33 D;  1P3B B;  2IO5 C;  1ZLA A;  1P3F A;  3X1S B;  3VH5 W;  3AZL D;  3AV1 B;  5B2J A;  4G92 B;  4EO5 B;  5DNN A;  3WA9 C;  3AZK D;  3C1C B;  1U35 D;  3UTA A;  4YS3 D;  1TAF A;  1P3I A;  3NQJ B;  2CWE A;  3MGQ B;  4J8X C;  1P3A B;  5B1L D;  3EPK A;  1S32 B;  1P3G B;  3UTA B;  2Y2N A;  4J8V B;  4Z2M G;  3AZM C;  1P3K D;  1P3A A;  1P3G A;  2NQB C;  3REK D;  1EQZ C;  5B40 B;  1HQ3 D;  4XZQ A;  4ZUX B;  5JRG D;  3WKJ B;  4KUD C;  5CPI D;  3WKJ D;  3VH5 A;  1W2E A;  5DNM C;  5GT0 B;  5GT0 D;  4KUD A;  3MNN D;  4Z66 B;  5AV8 B;  5B33 A;  3X1S D;  4DRB A;  1B67 A;  5GSU A;  1P3L A;  2NQB B;  4E44 A;  3AZH B;  1ZLA C;  3AZH D;  1BFM A;  2UWX A;  3REI A;  3H0L C;  4AWL C;  1U35 B;  4WNN B;  3UTB A;  5GT3 A;  5BT1 C;  3O62 C;  4QLC D;  3AZG C;  1P3A C;  1P3G C;  5AV6 B;  3LZ1 B;  1M18 C;  1P3K C;  3REI B;  5B1L B;  3TU4 D;  2CV5 A;  5GT3 B;  4H9N A;  5KDM B;  4WU9 A;  3WA9 B;  1P3I C;  4LD9 B;  3LZ1 C;  1M18 B;  5B0Z A;  3REK B;  1TZY C;  2Y2O A;  2HUE B;  5B0Y D;  3REL D;  3AZI B;  1P3M D;  2Y2H A;  1KX5 B;  4H9R B;  3B0D C;  3AZE B;  1P3F C;  5G49 A;  5B2I C;  5AV8 C;  3AZE A;  5CP6 D;  2F8N D;  1F66 C;  3AZF C;  1Q9C A;  1KX3 B;  3X1V C;  4E45 A;  5F99 D;  4H9P B;  2F8N G;  1ID3 A;  1KU5 A;  2W8S A;  5JA4 A;  5B1M C;  3VH5 T;  5AVB B;  5B1M D;  3AN2 B;  1KX3 A;  3LEL C;  1ID3 B;  1F1E A;  2ARO B;  5AVC D;  1S32 C;  4J8X B;  3WKJ A;  3LJA C;  3AZK C;  4J8U B;  2FFF B;  4UUZ A;  5B0Y B;  3REL B;  3V9R A;  5GXQ A;  4H9S A;  3WAA A;  3B6G B;  3WTP C;  4EO5 C;  5B0Y A;  2DQN C;  3REL A;  5CP6 C;  3AV1 C;  1P3L B;  3AV1 D;  1KX4 A;  3X1T C;  3IP4 C;  3X1U C;  3AZL B;  3KWQ A;  4WNN A;  3UTB B;  2ZY3 A;  3W98 A;  2Y2J A;  3EPL A;  3AZJ D;  5B32 D;  4XUJ C;  2CV5 B;  5B24 B;  2J8P A;  5AY8 C;  5B24 D;  5KDM A;  5B24 C;  5B0Z C;  5AVC C;  1S32 D;  5B0Z D;  5E5A C;  5F99 A;  5B0Z B;  5GXQ C;  3W99 B;  1KX4 C;  3REH C;  1P3M A;  1H3O A;  1M19 A;  3R45 A;  2G5H C;  5B40 D;  4YM6 D;  1KX5 A;  4CAY B;  1P34 A;  4WJ3 C;  5BT1 D;  3O62 D;  4XUJ A;  4JJN B;  5AV5 B;  3LJA A;  3AZE D;  2XD5 A;  2F8N A;  3B6G C;  5B33 C;  3X1V A;  2NZD A;  1T3U A;  4JJN C;  4X23 B;  1ULY A;  5B0Y C;  3REL C;  2F8N B;  4CSR A;  1KX3 D;  3REH A;  1P3O B;  2L5A A;  2ARO C;  3B0B A;  3AN2 C;  1EQZ A;  5BNX A;  3REH B;  4R8P B;  1P3O A;  4R8P D;  3TU4 B;  4M6B A;  2F8N H;  4UUZ B;  2NZD C;  5AVC B;  4J8X D;  5GXQ B;  3AZF D;  5E5A B;  3X1T D;  2HIO D;  1F66 B;  5B2I B;  4H9Q A;  2PYO D;  1P3F B;  1AOI D;  4J8W B;  5AY8 B;  3B0D B;  5B2J B;  1M1A C;  4KHA B;  1KX5 D;  1F66 A;  5B2J D;  3B6G D;  1M1A D;  1KX5 C;  3B6F A;  3EPH A;  4J8W A;  3AZI C;  3UTB C;  3W98 B;  5DNM D;  1A7W A;  4KHA A;  3AZL C;  3LZ0 C;  3NQU A;  3AZN D;  1P3I B;  1P3L C;  5B24 A;  1BH9 B;  3UT9 B;  5B32 G;  1S32 A;  3AZJ B;  3W99 A;  1M19 D;  1P3G D;  1P3A D;  1H3O B;  5B1L C;  3AZK B;  5B40 A;  5CPK B;  4QLC C;  3LEL B;  3AZG D;  3AZG B;  3MGR C;  4YS3 B;  5AVB C;  3AZK A;  5CPK A;  3WTP A;  2BYK A;  5B32 C;  3A6N C;  2PYO B;  2BYM B;  5BO0 A;  5AV8 A;  3AV2 A;  3C1B A;  4XZQ C;  5GT0 C;  2ZY4 A;  1KX3 C;  2NQB A;  2PYO A;  1P3L D;  1AOI A;  1HQ3 B;  4X23 A;  4ZUX C;  5DNM B;  4CSR B;  1WWS A;  3MGR A;  4DRA A;  4YM6 C;  3AZN B;  3W96 D;  5B40 C;  3C1C D;  5CPI A;  1EQZ B;  1P3O D;  4HGA B;  3UTA C;  3MGR B;  3AZM D;  1TZY B;  4QLC B;  4LD9 C;  2ZY5 A;  4Z5T B;  2HUE C;  3KSY A;  5GT3 C;  3REK C;  2HIO A;  2F2A C;  1JFI B;  5B2I A;  1P3K B;  3W97 A;  3AZJ C;  4H9R A;  4Z5T C;  3AL0 C;  3LZ0 B;  1ZLA B;  3MNN C;  3LZ0 D;  2IO5 B;  4AWL B;  1U35 C;  4J8V A;  5AV8 D;  4WU8 A;  4H9P A;  1P3P C;  3W97 C;  5FUG B;  3W96 B;  2HIO C;  1AOI C;  3MGQ A;  2BG1 A;  3MGR D;  5C3I B;  5CPJ B;  2ARO A;  5FUG A;  3W96 A;  3A6N B;  3EG5 B;  3A6N D;  4ZBJ B;  2ZM5 A;  5CPK D;  3P5J B;  1Z2C B;  2BYK B;  4KGC D;  5GSU B;  3MVD D;  4KGC B;  3AV2 D;  5GXQ D;  5E5A D;  2DF4 C;  2YFV B;  3MGQ C;  1ID3 D;  5B2I D;  1ZLA D;  1P3F D;  5AV6 A;  1AOI B;  5B33 B;  3AYW B;  3W96 C;  3AZL A;  1N1J B;  3KWQ B;  3C1B C;  3C1C C;  3UT9 C;  4WV4 B;  3KWQ D;  3W98 D;  2JCH A;  3AYW A;  4G92 C;  1N1J A;  3KUY B;  1U35 A;  2RVQ C;  1P3P A;  2RVQ D;  1P3I D;  3AZI A;  5CPI C;  2RIQ A;  3MNN B;  5B2J C;  5B1L A;  4WU9 C;  3WAA D;  3KFU G;  3W99 C;  5DNN C;  1M19 B;  4UPK A;  3B0C W;  5G49 B;  1P3K A;  1M18 A;  1KX4 D;  3REK A;  2ARO D;  5AV9 B;  4XUJ B;  5AV9 D;  3LZ0 A;  4NE3 A;  4R8P C;  5AV5 A;  2JE5 A;  5GSU C;  5B32 A;  3UTA D;  2ZY2 A;  4HGA C;  3AFA C;  3MGS C;  3X1U B;  5AVB A;  1TAF B;  3X1U D;  4WU8 D;  3X1V D;  3NQJ A;  4WU8 B;  4LD9 D;  5BNV A;  5BS7 C;  1HTA A;  4YM6 B;  5C3I C;  4X23 C;  5CHL B;  5JRG B;  1HQ3 C;  4YM6 A;  3UTB D;  4JJN D;  5JA4 B;  2FJ7 C;  4XZQ D;  5JRG A;  5BNX B;  4ZUX A; 
#chains in the Genus database with same CATH homology
 3A6N A;  3TU4 A;  2CV5 D;  3WAA B;  3EPJ A;  3LJA D;  3VH6 T;  5GT0 A;  1ID3 C;  5B31 G;  3MVD A;  4J8X A;  4YS3 C;  4Z66 A;  5E5A A;  3AZF A;  2NZD D;  2YFV A;  5GSU D;  5AY8 A;  3MVD B;  3REJ D;  1BH8 A;  3FDD A;  5AV6 D;  1M18 D;  3REJ C;  3AZH A;  5B31 C;  3AZF B;  3REI D;  1B6W A;  2Y2L A;  1F66 D;  5F99 C;  3B6G A;  4NE6 A;  3B6F B;  5GT3 D;  4J8W D;  3AYW D;  5AV5 D;  3A1I A;  3NQU B;  3KUY A;  3KXB B;  5CP6 A;  4WU9 D;  3KXB D;  3AZI D;  3KXB C;  2Y2M A;  1P3M B;  4LD9 A;  3MGP B;  1P3M C;  3X1T A;  4CAY A;  3AZN C;  1P34 B;  5B31 A;  5CP6 B;  1M1A B;  3B6F C;  3MGP A;  5F99 B;  5CPJ D;  4JJN A;  3AZG A;  5B31 B;  1M1A A;  4G91 C;  3VH6 A;  3AFA D;  5AV9 A;  3MGS D;  4J8U C;  3UT9 D;  3REI C;  1PZR A;  2NZD B;  5AV6 C;  2PYO C;  3H0M C;  3TU4 C;  2BYM A;  5BO0 B;  2Y2G A;  5B32 B;  5AVB D;  3X1U A;  2Y2K A;  3B0C T;  5BNV B;  2JSS A;  5AY8 D;  5CPK C;  3LEL D;  3W99 D;  1WWI A;  5B1M A;  3WAA C;  2FJ7 B;  3X1V B;  3AN2 A;  2FJ7 D;  4G91 B;  5BS7 A;  2LY8 A;  5AVC A;  4ZUX D;  3F6T A;  3KUY D;  3AZM A;  3WTP D;  2VQR A;  4J8U A;  3WTP E;  1P3B D;  1R4V A;  4H9Q B;  2XD1 A;  3V9R B;  3C1B D;  3W98 C;  4Z66 D;  1P34 C;  4WU8 C;  3MGP C;  1JFI A;  3AZM B;  5B31 D;  2NQB D;  3AFA B;  3MGS B;  3REJ A;  4X23 D;  3AV1 A;  1BH8 B;  4J8W C;  1KX4 B;  2G5I C;  4Z2M H;  4H9S C;  1TZY D;  4WZS B;  3AFA A;  3MGS A;  3O62 A;  4DQY B;  3LZ1 D;  4XUJ D;  5DNN B;  3REJ B;  1BH9 A;  3UT9 A;  3C1C A;  5DNN D;  3MVD C;  4Z5T D;  3AZJ A;  2CV5 C;  4J8V D;  3WA9 D;  3O62 B;  3KXB A;  3X1S C;  4H9O B;  3KUY C;  3AZH C;  3H0R C;  3X1T B;  3LEL A;  1P3B C;  1P3O C;  4H9O A;  3W97 D;  2F8N K;  3MGP D;  3KWQ C;  5CPJ A;  3R45 B;  4Z66 C;  3WTP B;  1P34 D;  1EQZ D;  2Y2P A;  3C1B B;  2Y2Q A;  3AYW C;  2Y2I A;  3WKJ C;  4KUD B;  3LJA B;  4KGC A;  2YFW B;  5JRG C;  5AV5 C;  4KUD D;  4XZQ B;  4YS3 A;  3AV2 C;  4KGC C;  2YFW A;  3A1K A;  4NE5 A;  3AV2 B;  4J8V C;  3MGQ D;  5B1M B;  3AN2 D;  5AV9 C;  3REH D;  2FJ7 A;  4ZBJ C;  1TZY A;  3B6F D;  4QLC A;  1HQ3 A;  3LZ1 A;  5CPJ C;  1M19 C;  5DNM A;  4Z5T A;  1P3P B;  3VH6 W;  4R8P A;  1P3P D;  2HIO B;  3AZN A;  4H9N B;  4J8U D;  4WU9 B;  3WA9 A;  1P3B A;  4NFT A;  3MNN A;  5CPI B;  3W97 B;  3AZE C;  3X1S A;  5B33 D;  1P3B B;  2IO5 C;  1ZLA A;  1P3F A;  3X1S B;  3VH5 W;  3AZL D;  3AV1 B;  5B2J A;  4G92 B;  4EO5 B;  5DNN A;  3WA9 C;  3AZK D;  3C1C B;  1U35 D;  3UTA A;  4YS3 D;  1TAF A;  1P3I A;  3NQJ B;  2CWE A;  3MGQ B;  4J8X C;  1P3A B;  5B1L D;  3EPK A;  1S32 B;  1P3G B;  3UTA B;  2Y2N A;  4J8V B;  4Z2M G;  3AZM C;  1P3K D;  1P3A A;  1P3G A;  2NQB C;  3REK D;  1EQZ C;  5B40 B;  1HQ3 D;  4XZQ A;  4ZUX B;  5JRG D;  3WKJ B;  4KUD C;  5CPI D;  3WKJ D;  3VH5 A;  1W2E A;  5DNM C;  5GT0 B;  5GT0 D;  4KUD A;  3MNN D;  4Z66 B;  5AV8 B;  5B33 A;  3X1S D;  4DRB A;  1B67 A;  5GSU A;  1P3L A;  2NQB B;  4E44 A;  3AZH B;  1ZLA C;  3AZH D;  1BFM A;  2UWX A;  3REI A;  3H0L C;  4AWL C;  1U35 B;  4WNN B;  3UTB A;  5GT3 A;  5BT1 C;  3O62 C;  4QLC D;  3AZG C;  1P3A C;  1P3G C;  5AV6 B;  3LZ1 B;  1M18 C;  1P3K C;  3REI B;  5B1L B;  3TU4 D;  2CV5 A;  5GT3 B;  4H9N A;  5KDM B;  4WU9 A;  3WA9 B;  1P3I C;  4LD9 B;  3LZ1 C;  1M18 B;  5B0Z A;  3REK B;  1TZY C;  2Y2O A;  2HUE B;  5B0Y D;  3REL D;  3AZI B;  1P3M D;  2Y2H A;  1KX5 B;  4H9R B;  3B0D C;  3AZE B;  1P3F C;  5G49 A;  5B2I C;  5AV8 C;  3AZE A;  5CP6 D;  2F8N D;  1F66 C;  3AZF C;  1Q9C A;  1KX3 B;  3X1V C;  4E45 A;  5F99 D;  4H9P B;  2F8N G;  1ID3 A;  1KU5 A;  2W8S A;  5JA4 A;  5B1M C;  3VH5 T;  5AVB B;  5B1M D;  3AN2 B;  1KX3 A;  3LEL C;  1ID3 B;  1F1E A;  2ARO B;  5AVC D;  1S32 C;  4J8X B;  3WKJ A;  3LJA C;  3AZK C;  4J8U B;  2FFF B;  4UUZ A;  5B0Y B;  3REL B;  3V9R A;  5GXQ A;  4H9S A;  3WAA A;  3B6G B;  3WTP C;  4EO5 C;  5B0Y A;  2DQN C;  3REL A;  5CP6 C;  3AV1 C;  1P3L B;  3AV1 D;  1KX4 A;  3X1T C;  3IP4 C;  3X1U C;  3AZL B;  3KWQ A;  4WNN A;  3UTB B;  2ZY3 A;  3W98 A;  2Y2J A;  3EPL A;  3AZJ D;  5B32 D;  4XUJ C;  2CV5 B;  5B24 B;  2J8P A;  5AY8 C;  5B24 D;  5KDM A;  5B24 C;  5B0Z C;  5AVC C;  1S32 D;  5B0Z D;  5E5A C;  5F99 A;  5B0Z B;  5GXQ C;  3W99 B;  1KX4 C;  3REH C;  1P3M A;  1H3O A;  1M19 A;  3R45 A;  2G5H C;  5B40 D;  4YM6 D;  1KX5 A;  4CAY B;  1P34 A;  4WJ3 C;  5BT1 D;  3O62 D;  4XUJ A;  4JJN B;  5AV5 B;  3LJA A;  3AZE D;  2XD5 A;  2F8N A;  3B6G C;  5B33 C;  3X1V A;  2NZD A;  1T3U A;  4JJN C;  4X23 B;  1ULY A;  5B0Y C;  3REL C;  2F8N B;  4CSR A;  1KX3 D;  3REH A;  1P3O B;  2L5A A;  2ARO C;  3B0B A;  3AN2 C;  1EQZ A;  5BNX A;  3REH B;  4R8P B;  1P3O A;  4R8P D;  3TU4 B;  4M6B A;  2F8N H;  4UUZ B;  2NZD C;  5AVC B;  4J8X D;  5GXQ B;  3AZF D;  5E5A B;  3X1T D;  2HIO D;  1F66 B;  5B2I B;  4H9Q A;  2PYO D;  1P3F B;  1AOI D;  4J8W B;  5AY8 B;  3B0D B;  5B2J B;  1M1A C;  4KHA B;  1KX5 D;  1F66 A;  5B2J D;  3B6G D;  1M1A D;  1KX5 C;  3B6F A;  3EPH A;  4J8W A;  3AZI C;  3UTB C;  3W98 B;  5DNM D;  1A7W A;  4KHA A;  3AZL C;  3LZ0 C;  3NQU A;  3AZN D;  1P3I B;  1P3L C;  5B24 A;  1BH9 B;  3UT9 B;  5B32 G;  1S32 A;  3AZJ B;  3W99 A;  1M19 D;  1P3G D;  1P3A D;  1H3O B;  5B1L C;  3AZK B;  5B40 A;  5CPK B;  4QLC C;  3LEL B;  3AZG D;  3AZG B;  3MGR C;  4YS3 B;  5AVB C;  3AZK A;  5CPK A;  3WTP A;  2BYK A;  5B32 C;  3A6N C;  2PYO B;  2BYM B;  5BO0 A;  5AV8 A;  3AV2 A;  3C1B A;  4XZQ C;  5GT0 C;  2ZY4 A;  1KX3 C;  2NQB A;  2PYO A;  1P3L D;  1AOI A;  1HQ3 B;  4X23 A;  4ZUX C;  5DNM B;  4CSR B;  1WWS A;  3MGR A;  4DRA A;  4YM6 C;  3AZN B;  3W96 D;  5B40 C;  3C1C D;  5CPI A;  1EQZ B;  1P3O D;  4HGA B;  3UTA C;  3MGR B;  3AZM D;  1TZY B;  4QLC B;  4LD9 C;  2ZY5 A;  4Z5T B;  2HUE C;  3KSY A;  5GT3 C;  3REK C;  2HIO A;  2F2A C;  1JFI B;  5B2I A;  1P3K B;  3W97 A;  3AZJ C;  4H9R A;  4Z5T C;  3AL0 C;  3LZ0 B;  1ZLA B;  3MNN C;  3LZ0 D;  2IO5 B;  4AWL B;  1U35 C;  4J8V A;  5AV8 D;  4WU8 A;  4H9P A;  1P3P C;  3W97 C;  5FUG B;  3W96 B;  2HIO C;  1AOI C;  3MGQ A;  2BG1 A;  3MGR D;  5C3I B;  5CPJ B;  2ARO A;  5FUG A;  3W96 A;  3A6N B;  3EG5 B;  3A6N D;  4ZBJ B;  2ZM5 A;  5CPK D;  3P5J B;  1Z2C B;  2BYK B;  4KGC D;  5GSU B;  3MVD D;  4KGC B;  3AV2 D;  5GXQ D;  5E5A D;  2DF4 C;  2YFV B;  3MGQ C;  1ID3 D;  5B2I D;  1ZLA D;  1P3F D;  5AV6 A;  1AOI B;  5B33 B;  3AYW B;  3W96 C;  3AZL A;  1N1J B;  3KWQ B;  3C1B C;  3C1C C;  3UT9 C;  4WV4 B;  3KWQ D;  3W98 D;  2JCH A;  3AYW A;  4G92 C;  1N1J A;  3KUY B;  1U35 A;  2RVQ C;  1P3P A;  2RVQ D;  1P3I D;  3AZI A;  5CPI C;  2RIQ A;  3MNN B;  5B2J C;  5B1L A;  4WU9 C;  3WAA D;  3KFU G;  3W99 C;  5DNN C;  1M19 B;  4UPK A;  3B0C W;  5G49 B;  1P3K A;  1M18 A;  1KX4 D;  3REK A;  2ARO D;  5AV9 B;  4XUJ B;  5AV9 D;  3LZ0 A;  4NE3 A;  4R8P C;  5AV5 A;  2JE5 A;  5GSU C;  5B32 A;  3UTA D;  2ZY2 A;  4HGA C;  3AFA C;  3MGS C;  3X1U B;  5AVB A;  1TAF B;  3X1U D;  4WU8 D;  3X1V D;  3NQJ A;  4WU8 B;  4LD9 D;  5BNV A;  5BS7 C;  1HTA A;  4YM6 B;  5C3I C;  4X23 C;  5CHL B;  5JRG B;  1HQ3 C;  4YM6 A;  3UTB D;  4JJN D;  5JA4 B;  2FJ7 C;  4XZQ D;  5JRG A;  5BNX B;  4ZUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...