4YS3A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
96
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 96
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3A00
3AZNA 5AV6D 5AVBB 3AYWD 4KUDD 5B40C 5B32G 3A6NB 4WV4B 1N1JB 5B0ZA 3C1CA 4YM6C 4YS3A 4J8VA 1AOID 3B0CW 2HUEC 5GT3D 2NQBD 2YFWA 3MGRC 4WU9C 3WA9A 1P3PA 3MNNC 5GSUD 5CPKB 3AZKB 3AZEB 1JFIA 1P3MC 4H9NA 2YFVB 1M19D 3AZMB 3B0BA 3WKJA 4NFTA 4CSRB 5AV6A 3LELB 3W99A 3AYWA 3REIC 1WWSA 1M1AB 2HIOC 2F8NK 4KGCC 4KUDA 1ULYA 5BNVB 3AZGB 1TZYB 3AN2A 1P3ID 4G91C 3AZIB 4H9PB 1AOIA 3AZJC 5GT3A 2CV5A 1ID3D 3MVDB 5JRGA 5AVCD 3REHB 1P3FC 3MNND 4Z5TC 1KU5A 4Z66C 3VH5T 5B0YD 3AZFC 5AV9B 3TU4A 5CPKD 4ZBJB 4ZUXC 3NQUA 3REKB 3UTBB 4LD9C 4HGAB 5B24C 4KGCD 3AV2C 1EQZD 3LELD 5B40A 3W97B 1P3AB 1M1AD 5BO0A 5KDMA 3O62C 1TAFA 1ID3A 4JJNB 3UTAB 1TZYD 3AV1D 5AY8B 5AVCA 3REJB 3W98B 4R8PB 3MNNA 5B31B 1P3KB 5B1LB 1B6WA 5B0YA 4AWLB 3LZ0D 3MVDD 3LJAB 5CPKA 1BH9A 3VH6T 3KUYC 1M18B 3REHD 4X23B 4KGCA 5AV9D 1EQZA 3LELA 1M1AA 4XZQB 3AZNC 5GT0C 3MGQB 3UTBD 3AV1A 1U35B 5DNNB 3W97D 5B0ZC 3X1UC 4YS3C 4J8WB 5BT1D 3LZ0A 4JJND 3UTAD 4J8UB 4Z66A 2AROB 3WA9C 2IO5B 3REHA 4R8PD 2NZDB 5B31D 4KHAB 3X1SB 5B2IB 2RVQD 4UUZA 4H9RA 4LD9A 3WKJC 5B24A 3AV2A 5AV6C 3AFAB 3UTBA 5AV5B 1P3LB 5G49B 3B6GD 4KUDC 1P34B 5F99D 2L5AA 3WAAB 3MGQD 4XUJB 1KX3B 1AOIC 2BYKA 1H3OB 5GT3C 2NQBC 3X1UD 3V9RA 5GSUC 5B31A 5DNND 3AZLB 1P3BC 3WTPB 4CAYA 3AZHD 1P3OB 1M19C 1P3GB 3X1TB 5B1MB 1HQ3D 3B0DC 2AROD 3KSYA 2NZDD 3X1VB 3X1SD 5B2ID 3B6GA 5GT0A 3B6FB 1P3IC 5F99A 5C3IB 3MGQA 5AVBC 3AFAD 2FJ7D 5CHLB 5JA4A 5AV5D 3VH6A 3X1UA 4QLCB 1ID3C 5DNMB 3RELD 4WU8D 5DNNA 4J8XB 4EO5B 5GXQB 5AVCC 3AZHA 1P3BD 5B32B 5B0YC 1HQ3A 2AROA 2BYMB 5CPKC 2NZDA 3AZKC 5B2IA 5CPID 1KX5B 1P3OD 1BH8A 4YM6B 3X1TD 1EQZC 5FUGA 1F1EA 3AFAA 3LELC 3MGRB 2FJ7A 4WU9B 3WTPE 1M1AC 1KX4B 3R45B 5AVBD 3AZGC 1TZYC 3RELA 4WU8A 2NQBA 3AZIC 5CP6B 3AV1C 3MGSB 4NE3A 5GSUA 3A6ND 1P3BA 3KWQB 1F66B 3LZ0C 3MVDC 5DNMD 3REIB 1M19A 5GXQD 3REHC 5CPIA 3AZKD 1P3OA 3AZED 3NQJB 5AV9C 1P3IA 3AZMD 5BNXB 3REKC 5AVBA 3UTBC 5BS7A 3VH5W 1P3FB 4WZSB 4Z5TB 4G92C 3AZGD 3AZFB 1P3AC 3AZID 3W97C 3A6NA 3UT9B 1N1JA 3C1BB 4ZUXB 5BT1C 4H9QB 4JJNC 3UTAC 3W98C 4R8PC 5B31C 1P3KC 3AZKA 5B1LC 2PYOB 3AZEA 4H9OB 3KXBB 2RVQC 1F66D 2F8NG 2YFVA 3AZMA 1Q9CA 3MGPB 3LZ1B 4CSRA 5B33B 4X23C 3W96B 3B6GC 3REKD 5BNVA 3AZGA 1TZYA 3VH6W 2CWEA 3AZIA 4H9PA 5F99C 3MGQC 1P3AD 5B2JB 1S32B 3MVDA 5DNNC 4H9SC 4WNNB 3UT9D 5AY8D 3C1BD 3REJD 4J8WC 3W98D 1F66A 3AZHC 1P3KD 5B1LD 3AZNB 5E5AB 1HQ3C 2AROC 5AV9A 3LJAD 2NZDC 3X1SC 5B2IC 1M18D 2PYOD 3NQJA 3KXBD 3REKA 4X23D 5B0ZB 3C1CB 4YS3B 4J8VB 3LZ1D 1HTAA 2YFWB 3AFAC 2FJ7C 4E44A 5B33D 3W97A 1P3AA 1P3PB 3WA9B 5AV5C 4XZQD 1P3LC 1P34C 4JJNA 3UTAA 3RELC 4WU8C 4NE5A 3UT9A 4H9NB 5AY8A 3C1BA 3REJA 3WAAC 1U35D 3W98A 4R8PA 3WKJB 1P3KA 5B1LA 5CPJB 1WWIA 5B2JD 1ZLAB 4J8WD 3W99B 3AYWB 3LJAA 4J8UD 4KUDB 1M18A 2PYOA 3AZLC 3WTPC 3AN2B 5CPIC 5AV8B 4X23A 1P3OC 5E5AD 3X1TC 1AOIB 3LZ1A 5GT3B 2CV5B 3X1VC 4XZQA 2F8NH 5JRGB 3C1CD 5BS7C 1P3LD 2LY8A 5C3IC 1U35A 1P34D 4DRAA 4H9SA 3A6NC 1P3PD 3TU4B 3WAAD 4J8WA 4XUJD 1KX3D 5DNMC 4J8UA 4EO5C 5GXQC 3B0CT 4KHAA 3X1SA 5CPJD 5E5AA 3AZLD 3AZEC 5B32C 3WTPD 1ZLAD 3W99D 5B40B 5BO0B 5KDMB 1P3GD 3AZMC 1TAFB 1ID3B 5B1MD 2HUEB 3AN2D 1KX5C 5AV8D 3X1VD 5AVCB 5AV5A 1P3LA 5G49A 4E45A 3MNNB 3B6FD 2CV5D 1P34A 5B0YB 1P3MB 1KX4C 3WAAA 4XUJA 1BH9B 1KX3A 5JRGD 1H3OA 5CP6C 4QLCD 3MGSC 2HIOB 4J8XD 4KGCB 1EQZB 3AZLA 5CPJA 3TU4D 3KWQC 3WTPA 1ZLAA 1F66C 4G91B 1P3GA 3X1TA 5B32D 5B1MA 3AZJB 4ZBJC 5AV8A 3AV1B 3X1VA 3B6FA 5B40D 1KX5D 4HGAC 4YM6D 3LZ0B 4Z66B 3MGRD 4WU9D 1KX4D 4QLCA 5DNMA 4J8XA 5CP6D 4UUZB 5GXQA 5AY8C 4H9RB 3MGSD 3C1BC 3REJC 3UT9C 1P3MD 4LD9B 5B24B 3AV2B 3KWQD 5B32A 4AWLC 3LJAC 3REID 2BYMA 2HIOD 3O62B 1M18C 2PYOC 1A7WA 5B31G 4G92B 3KXBC 1KX5A 4YM6A 3MGPC 2BYKB 3LZ1C 4Z2MG 3AZJD 3MGRA 5B33C 2F8NB 4WU9A 3W96C 3V9RB 4XZQC 1KX4A 3R45A 3KUYB 4CAYB 1P3FD 5CP6A 3MGSA 1P3MA 1B67A 1U35C 1R4VA 4Z5TD 4Z66D 3AZFD 5B2JC 3KWQA 4ZUXD 1S32C 3REIA 3B6GB 4J8UC 5GT0B 2HIOA 2IO5C 2JSSA 4LD9D 5B24D 5F99B 3AV2D 5E5AC 5JA4B 3AZJA 3X1UB 3O62D 3MGPD 5BNXA 3C1CC 3W96D 4J8VC 1P3FA 3AZHB 4NE6A 4Z5TA 2F8ND 1HQ3B 3AZFA 1JFIB 1P3PC 1BFMA 4ZUXA 4XUJC 1KX3C 4H9QA 3KUYD 5AV6B 1S32D 1BH8B 5FUGB 5CPJC 4DRBA 4H9OA 3KXBA 1ZLAC 3W99C 3AYWC 2FJ7B 3AZND 5GT0D 1P3GC 3O62A 5B1MC 3MGPA 3AN2C 3RELB 4M6BA 4WU8B 2NQBB 5AV8C 5B33A 3W96A 3VH5A 3B6FC 5GSUB 2CV5C 1P3BB 2F8NA 5B0ZD 4YS3D 4J8VD 1M19B 3KUYA 5JRGC 3B0DB 3WA9D 5CPIB 4QLCC 4Z2MH 5B2JA 1S32A 4J8XC 3NQUB 4WNNA 3TU4C 1P3IB 3WKJD
chains in the Genus database with same CATH superfamily
3AZNA 5AV6D 5AVBB 3AYWD 4KUDD 5B40C 2BG1A 5B32G 3A6NB 4WV4B 1N1JB 5B0ZA 3C1CA 4YM6C 4YS3A 2Y2QA 4J8VA 1AOID 3B0CW 2HUEC 5GT3D 2NQBD 2YFWA 3MGRC 4WU9C 2G5IC 3WA9A 1P3PA 3MNNC 5GSUD 5CPKB 3AZKB 3AZEB 1JFIA 1P3MC 4H9NA 2YFVB 1M19D 3AZMB 3B0BA 3WKJA 4NFTA 4CSRB 5AV6A 3EPKA 3LELB 3W99A 3AYWA 3REIC 1WWSA 1M1AB 2HIOC 2F8NK 4KGCC 4KUDA 1ULYA 5BNVB 3AZGB 1TZYB 3AN2A 1P3ID 4G91C 3AZIB 4WJ3C 4H9PB 1AOIA 3AZJC 5GT3A 2CV5A 1ID3D 3MVDB 2ZM5A 5JRGA 5AVCD 3REHB 1P3FC 3MNND 4Z5TC 1KU5A 4Z66C 2DF4C 3VH5T 5B0YD 3AZFC 5AV9B 3TU4A 5CPKD 4ZBJB 4ZUXC 3NQUA 3REKB 3UTBB 4LD9C 4HGAB 5B24C 4KGCD 3AV2C 1EQZD 3LELD 5B40A 3W97B 1P3AB 1M1AD 5BO0A 5KDMA 3O62C 1TAFA 1ID3A 4JJNB 3UTAB 1TZYD 3AV1D 5AY8B 5AVCA 3REJB 3W98B 4R8PB 3MNNA 2ZY3A 5B31B 1P3KB 5B1LB 1B6WA 5B0YA 4AWLB 2J8PA 3LZ0D 3MVDD 3LJAB 5CPKA 1BH9A 3VH6T 3KUYC 1M18B 3REHD 4X23B 4KGCA 5AV9D 1EQZA 3LELA 1M1AA 4XZQB 3AZNC 5GT0C 3MGQB 3UTBD 2F2AC 3AV1A 1U35B 5DNNB 3W97D 5B0ZC 3X1UC 4YS3C 4J8WB 5BT1D 3LZ0A 4JJND 3UTAD 4J8UB 4Z66A 2AROB 3WA9C 2IO5B 3REHA 4R8PD 3H0RC 2NZDB 5B31D 4KHAB 3X1SB 5B2IB 2RVQD 4UUZA 3AL0C 4H9RA 4LD9A 3WKJC 5B24A 3AV2A 5AV6C 3AFAB 3UTBA 2DQNC 5AV5B 1P3LB 5G49B 3B6GD 4KUDC 1P34B 5F99D 2L5AA 3WAAB 3A1IA 4XUJB 3MGQD 1KX3B 1AOIC 2BYKA 1H3OB 5GT3C 2NQBC 3X1UD 3V9RA 5GSUC 5B31A 5DNND 3AZLB 1P3BC 3WTPB 4CAYA 3AZHD 1P3OB 1M19C 1P3GB 3X1TB 5B1MB 1HQ3D 3B0DC 2AROD 3KSYA 2NZDD 3X1VB 3X1SD 5B2ID 3B6GA 5GT0A 3B6FB 1P3IC 5F99A 2G5HC 5C3IB 3MGQA 5AVBC 3AFAD 2FJ7D 5CHLB 5JA4A 5AV5D 3VH6A 3X1UA 4QLCB 1ID3C 2ZY5A 5DNMB 1T3UA 3RELD 4WU8D 5DNNA 4J8XB 4EO5B 5GXQB 5AVCC 3AZHA 2ZY4A 1P3BD 5B32B 5B0YC 1HQ3A 2AROA 2BYMB 5CPKC 2NZDA 3AZKC 5B2IA 5CPID 1KX5B 1P3OD 1BH8A 4YM6B 3EPJA 3X1TD 1EQZC 5FUGA 1F1EA 2Y2NA 3AFAA 3LELC 3MGRB 2FJ7A 4WU9B 3WTPE 1M1AC 1KX4B 3R45B 5AVBD 3AZGC 1TZYC 3RELA 4WU8A 2NQBA 3AZIC 5CP6B 3AV1C 3MGSB 4NE3A 5GSUA 3A6ND 1P3BA 3KWQB 1F66B 3LZ0C 3MVDC 5DNMD 3REIB 1M19A 5GXQD 3REHC 2Y2LA 5CPIA 3AZKD 1P3OA 3AZED 3NQJB 5AV9C 1P3IA 3AZMD 5BNXB 3REKC 5AVBA 3UTBC 5BS7A 3VH5W 1P3FB 4WZSB 4Z5TB 4G92C 3AZGD 3KFUG 3AZFB 1P3AC 3AZID 3W97C 3A6NA 3UT9B 1N1JA 3C1BB 1W2EA 4ZUXB 5BT1C 4H9QB 4JJNC 3UTAC 3W98C 4R8PC 1Z2CB 5B31C 1P3KC 3AZKA 5B1LC 2PYOB 3AZEA 4H9OB 3KXBB 2RVQC 1F66D 2F8NG 2YFVA 4DQYB 3AZMA 1Q9CA 3MGPB 3LZ1B 4CSRA 5B33B 4X23C 3W96B 1PZRA 3B6GC 2Y2PA 3REKD 5BNVA 3AZGA 1TZYA 3VH6W 2CWEA 3AZIA 4H9PA 5F99C 3MGQC 1P3AD 5B2JB 1S32B 3MVDA 5DNNC 2W8SA 4H9SC 4WNNB 3UT9D 5AY8D 3C1BD 3REJD 4J8WC 3W98D 1F66A 3AZHC 1P3KD 5B1LD 3AZNB 2RIQA 5E5AB 1HQ3C 2AROC 5AV9A 3LJAD 2NZDC 3X1SC 5B2IC 1M18D 2PYOD 3NQJA 3KXBD 3REKA 4X23D 5B0ZB 3C1CB 4YS3B 4J8VB 3LZ1D 2UWXA 2JCHA 1HTAA 2YFWB 3AFAC 2FJ7C 4E44A 5B33D 3W97A 1P3AA 1P3PB 3WA9B 5AV5C 4XZQD 1P3LC 1P34C 4JJNA 3UTAA 3RELC 4WU8C 4NE5A 3H0LC 3UT9A 4H9NB 5AY8A 3C1BA 3REJA 3WAAC 1U35D 3W98A 4R8PA 3WKJB 1P3KA 5B1LA 5CPJB 1WWIA 5B2JD 1ZLAB 4J8WD 3W99B 3AYWB 3LJAA 4J8UD 4KUDB 1M18A 2PYOA 3AZLC 3WTPC 3AN2B 5CPIC 5AV8B 2VQRA 4X23A 1P3OC 5E5AD 3X1TC 1AOIB 2FFFB 5GT3B 3LZ1A 2CV5B 2Y2IA 3X1VC 4XZQA 2F8NH 3A1KA 5JRGB 3C1CD 5BS7C 1P3LD 2LY8A 5C3IC 1U35A 1P34D 4DRAA 4H9SA 3A6NC 1P3PD 3TU4B 3WAAD 4J8WA 4XUJD 1KX3D 5DNMC 3FDDA 4J8UA 4EO5C 5GXQC 3B0CT 4KHAA 3X1SA 5CPJD 5E5AA 3AZLD 3AZEC 5B32C 3WTPD 1ZLAD 3W99D 5B40B 5BO0B 5KDMB 1P3GD 3AZMC 1TAFB 2Y2OA 5B1MD 1ID3B 2HUEB 3AN2D 1KX5C 5AV8D 3X1VD 5AVCB 2Y2HA 5AV5A 5G49A 4E45A 3MNNB 1P3LA 3B6FD 2CV5D 1P34A 5B0YB 1P3MB 1KX4C 2JE5A 3WAAA 4XUJA 1BH9B 1KX3A 5JRGD 1H3OA 2Y2JA 5CP6C 4QLCD 3MGSC 2HIOB 4J8XD 4KGCB 1EQZB 3AZLA 5CPJA 3TU4D 3H0MC 3WTPA 3KWQC 1ZLAA 1F66C 4G91B 1P3GA 3X1TA 5B32D 5B1MA 2XD5A 3AZJB 4ZBJC 5AV8A 3AV1B 3X1VA 3B6FA 5B40D 1KX5D 4HGAC 4YM6D 3LZ0B 4Z66B 3MGRD 4WU9D 1KX4D 4QLCA 5DNMA 4J8XA 5CP6D 4UUZB 5GXQA 5AY8C 4H9RB 3MGSD 3C1BC 3REJC 3UT9C 1P3MD 4LD9B 5B24B 3AV2B 3KWQD 5B32A 4AWLC 3LJAC 3REID 2BYMA 2HIOD 3O62B 1M18C 2PYOC 1A7WA 5B31G 4G92B 3KXBC 1KX5A 4YM6A 3MGPC 2BYKB 3LZ1C 4Z2MG 3AZJD 3MGRA 5B33C 2F8NB 4WU9A 3W96C 3V9RB 4XZQC 1KX4A 3P5JB 3R45A 3KUYB 4CAYB 1P3FD 5CP6A 3MGSA 1P3MA 1B67A 1U35C 1R4VA 4Z5TD 4Z66D 3AZFD 5B2JC 3KWQA 4ZUXD 1S32C 3REIA 3B6GB 4J8UC 5GT0B 2HIOA 4UPKA 2IO5C 2JSSA 4LD9D 5B24D 5F99B 3AV2D 5E5AC 2Y2MA 5JA4B 3AZJA 3IP4C 3EPHA 3X1UB 3O62D 3MGPD 5BNXA 3C1CC 3W96D 4J8VC 1P3FA 3AZHB 4NE6A 4Z5TA 2F8ND 1HQ3B 3AZFA 1JFIB 1P3PC 1BFMA 4ZUXA 4XUJC 1KX3C 4H9QA 3KUYD 5AV6B 1S32D 1BH8B 2Y2KA 5FUGB 5CPJC 4DRBA 4H9OA 3KXBA 1ZLAC 3W99C 3AYWC 2FJ7B 3AZND 5GT0D 1P3GC 3O62A 2XD1A 5B1MC 3MGPA 3AN2C 3RELB 4M6BA 3EG5B 4WU8B 2NQBB 5AV8C 5B33A 3W96A 3VH5A 3B6FC 5GSUB 2CV5C 1P3BB 2F8NA 5B0ZD 4YS3D 3EPLA 4J8VD 2ZY2A 2Y2GA 1M19B 3KUYA 5JRGC 3B0DB 3F6TA 3WA9D 5CPIB 4QLCC 4Z2MH 5B2JA 1S32A 4J8XC 3NQUB 4WNNA 3TU4C 1P3IB 3WKJD
chains in the Genus database with same CATH topology
3AZNA 5AV6D 5AVBB 3AYWD 4KUDD 5B40C 2BG1A 5B32G 3A6NB 4WV4B 1N1JB 5B0ZA 3C1CA 4YM6C 4YS3A 2Y2QA 4J8VA 1AOID 3B0CW 2HUEC 5GT3D 2NQBD 2YFWA 3MGRC 4WU9C 2G5IC 3WA9A 1P3PA 3MNNC 5GSUD 5CPKB 3AZKB 3AZEB 1JFIA 1P3MC 4H9NA 2YFVB 1M19D 3AZMB 3B0BA 3WKJA 4NFTA 4CSRB 5AV6A 3EPKA 3LELB 3W99A 3AYWA 3REIC 1WWSA 1M1AB 2HIOC 2F8NK 4KGCC 4KUDA 1ULYA 5BNVB 3AZGB 1TZYB 3AN2A 1P3ID 4G91C 3AZIB 4WJ3C 4H9PB 1AOIA 3AZJC 5GT3A 2CV5A 1ID3D 3MVDB 2ZM5A 5JRGA 5AVCD 3REHB 1P3FC 3MNND 4Z5TC 1KU5A 4Z66C 2DF4C 3VH5T 5B0YD 3AZFC 5AV9B 3TU4A 5CPKD 4ZBJB 4ZUXC 3NQUA 3REKB 3UTBB 4LD9C 4HGAB 5B24C 4KGCD 3AV2C 1EQZD 3LELD 5B40A 3W97B 1P3AB 1M1AD 5BO0A 5KDMA 3O62C 1TAFA 1ID3A 4JJNB 3UTAB 1TZYD 3AV1D 5AY8B 5AVCA 3REJB 3W98B 4R8PB 3MNNA 2ZY3A 5B31B 1P3KB 5B1LB 1B6WA 5B0YA 4AWLB 2J8PA 3LZ0D 3MVDD 3LJAB 5CPKA 1BH9A 3VH6T 3KUYC 1M18B 3REHD 4X23B 4KGCA 5AV9D 1EQZA 3LELA 1M1AA 4XZQB 3AZNC 5GT0C 3MGQB 3UTBD 2F2AC 3AV1A 1U35B 5DNNB 3W97D 5B0ZC 3X1UC 4YS3C 4J8WB 5BT1D 3LZ0A 4JJND 3UTAD 4J8UB 4Z66A 2AROB 3WA9C 2IO5B 3REHA 4R8PD 3H0RC 2NZDB 5B31D 4KHAB 3X1SB 5B2IB 2RVQD 4UUZA 3AL0C 4H9RA 4LD9A 3WKJC 5B24A 3AV2A 5AV6C 3AFAB 3UTBA 2DQNC 5AV5B 1P3LB 5G49B 3B6GD 4KUDC 1P34B 5F99D 2L5AA 3WAAB 3A1IA 4XUJB 3MGQD 1KX3B 1AOIC 2BYKA 1H3OB 5GT3C 2NQBC 3X1UD 3V9RA 5GSUC 5B31A 5DNND 3AZLB 1P3BC 3WTPB 4CAYA 3AZHD 1P3OB 1M19C 1P3GB 3X1TB 5B1MB 1HQ3D 3B0DC 2AROD 3KSYA 2NZDD 3X1VB 3X1SD 5B2ID 3B6GA 5GT0A 3B6FB 1P3IC 5F99A 2G5HC 5C3IB 3MGQA 5AVBC 3AFAD 2FJ7D 5CHLB 5JA4A 5AV5D 3VH6A 3X1UA 4QLCB 1ID3C 2ZY5A 5DNMB 1T3UA 3RELD 4WU8D 5DNNA 4J8XB 4EO5B 5GXQB 5AVCC 3AZHA 2ZY4A 1P3BD 5B32B 5B0YC 1HQ3A 2AROA 2BYMB 5CPKC 2NZDA 3AZKC 5B2IA 5CPID 1KX5B 1P3OD 1BH8A 4YM6B 3EPJA 3X1TD 1EQZC 5FUGA 1F1EA 2Y2NA 3AFAA 3LELC 3MGRB 2FJ7A 4WU9B 3WTPE 1M1AC 1KX4B 3R45B 5AVBD 3AZGC 1TZYC 3RELA 4WU8A 2NQBA 3AZIC 5CP6B 3AV1C 3MGSB 4NE3A 5GSUA 3A6ND 1P3BA 3KWQB 1F66B 3LZ0C 3MVDC 5DNMD 3REIB 1M19A 5GXQD 3REHC 2Y2LA 5CPIA 3AZKD 1P3OA 3AZED 3NQJB 5AV9C 1P3IA 3AZMD 5BNXB 3REKC 5AVBA 3UTBC 5BS7A 3VH5W 1P3FB 4WZSB 4Z5TB 4G92C 3AZGD 3KFUG 3AZFB 1P3AC 3AZID 3W97C 3A6NA 3UT9B 1N1JA 3C1BB 1W2EA 4ZUXB 5BT1C 4H9QB 4JJNC 3UTAC 3W98C 4R8PC 1Z2CB 5B31C 1P3KC 3AZKA 5B1LC 2PYOB 3AZEA 4H9OB 3KXBB 2RVQC 1F66D 2F8NG 2YFVA 4DQYB 3AZMA 1Q9CA 3MGPB 3LZ1B 4CSRA 5B33B 4X23C 3W96B 1PZRA 3B6GC 2Y2PA 3REKD 5BNVA 3AZGA 1TZYA 3VH6W 2CWEA 3AZIA 4H9PA 5F99C 3MGQC 1P3AD 5B2JB 1S32B 3MVDA 5DNNC 2W8SA 4H9SC 4WNNB 3UT9D 5AY8D 3C1BD 3REJD 4J8WC 3W98D 1F66A 3AZHC 1P3KD 5B1LD 3AZNB 2RIQA 5E5AB 1HQ3C 2AROC 5AV9A 3LJAD 2NZDC 3X1SC 5B2IC 1M18D 2PYOD 3NQJA 3KXBD 3REKA 4X23D 5B0ZB 3C1CB 4YS3B 4J8VB 3LZ1D 2UWXA 2JCHA 1HTAA 2YFWB 3AFAC 2FJ7C 4E44A 5B33D 3W97A 1P3AA 1P3PB 3WA9B 5AV5C 4XZQD 1P3LC 1P34C 4JJNA 3UTAA 3RELC 4WU8C 4NE5A 3H0LC 3UT9A 4H9NB 5AY8A 3C1BA 3REJA 3WAAC 1U35D 3W98A 4R8PA 3WKJB 1P3KA 5B1LA 5CPJB 1WWIA 5B2JD 1ZLAB 4J8WD 3W99B 3AYWB 3LJAA 4J8UD 4KUDB 1M18A 2PYOA 3AZLC 3WTPC 3AN2B 5CPIC 5AV8B 2VQRA 4X23A 1P3OC 5E5AD 3X1TC 1AOIB 2FFFB 5GT3B 3LZ1A 2CV5B 2Y2IA 3X1VC 4XZQA 2F8NH 3A1KA 5JRGB 3C1CD 5BS7C 1P3LD 2LY8A 5C3IC 1U35A 1P34D 4DRAA 4H9SA 3A6NC 1P3PD 3TU4B 3WAAD 4J8WA 4XUJD 1KX3D 5DNMC 3FDDA 4J8UA 4EO5C 5GXQC 3B0CT 4KHAA 3X1SA 5CPJD 5E5AA 3AZLD 3AZEC 5B32C 3WTPD 1ZLAD 3W99D 5B40B 5BO0B 5KDMB 1P3GD 3AZMC 1TAFB 2Y2OA 5B1MD 1ID3B 2HUEB 3AN2D 1KX5C 5AV8D 3X1VD 5AVCB 2Y2HA 5AV5A 5G49A 4E45A 3MNNB 1P3LA 3B6FD 2CV5D 1P34A 5B0YB 1P3MB 1KX4C 2JE5A 3WAAA 4XUJA 1BH9B 1KX3A 5JRGD 1H3OA 2Y2JA 5CP6C 4QLCD 3MGSC 2HIOB 4J8XD 4KGCB 1EQZB 3AZLA 5CPJA 3TU4D 3H0MC 3WTPA 3KWQC 1ZLAA 1F66C 4G91B 1P3GA 3X1TA 5B32D 5B1MA 2XD5A 3AZJB 4ZBJC 5AV8A 3AV1B 3X1VA 3B6FA 5B40D 1KX5D 4HGAC 4YM6D 3LZ0B 4Z66B 3MGRD 4WU9D 1KX4D 4QLCA 5DNMA 4J8XA 5CP6D 4UUZB 5GXQA 5AY8C 4H9RB 3MGSD 3C1BC 3REJC 3UT9C 1P3MD 4LD9B 5B24B 3AV2B 3KWQD 5B32A 4AWLC 3LJAC 3REID 2BYMA 2HIOD 3O62B 1M18C 2PYOC 1A7WA 5B31G 4G92B 3KXBC 1KX5A 4YM6A 3MGPC 2BYKB 3LZ1C 4Z2MG 3AZJD 3MGRA 5B33C 2F8NB 4WU9A 3W96C 3V9RB 4XZQC 1KX4A 3P5JB 3R45A 3KUYB 4CAYB 1P3FD 5CP6A 3MGSA 1P3MA 1B67A 1U35C 1R4VA 4Z5TD 4Z66D 3AZFD 5B2JC 3KWQA 4ZUXD 1S32C 3REIA 3B6GB 4J8UC 5GT0B 2HIOA 4UPKA 2IO5C 2JSSA 4LD9D 5B24D 5F99B 3AV2D 5E5AC 2Y2MA 5JA4B 3AZJA 3IP4C 3EPHA 3X1UB 3O62D 3MGPD 5BNXA 3C1CC 3W96D 4J8VC 1P3FA 3AZHB 4NE6A 4Z5TA 2F8ND 1HQ3B 3AZFA 1JFIB 1P3PC 1BFMA 4ZUXA 4XUJC 1KX3C 4H9QA 3KUYD 5AV6B 1S32D 1BH8B 2Y2KA 5FUGB 5CPJC 4DRBA 4H9OA 3KXBA 1ZLAC 3W99C 3AYWC 2FJ7B 3AZND 5GT0D 1P3GC 3O62A 2XD1A 5B1MC 3MGPA 3AN2C 3RELB 4M6BA 3EG5B 4WU8B 2NQBB 5AV8C 5B33A 3W96A 3VH5A 3B6FC 5GSUB 2CV5C 1P3BB 2F8NA 5B0ZD 4YS3D 3EPLA 4J8VD 2ZY2A 2Y2GA 1M19B 3KUYA 5JRGC 3B0DB 3F6TA 3WA9D 5CPIB 4QLCC 4Z2MH 5B2JA 1S32A 4J8XC 3NQUB 4WNNA 3TU4C 1P3IB 3WKJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN A;  5AV6 D;  5AVB B;  3AYW D;  4KUD D;  5B40 C;  5B32 G;  3A6N B;  4WV4 B;  1N1J B;  5B0Z A;  3C1C A;  4YM6 C;  4YS3 A;  4J8V A;  1AOI D;  3B0C W;  2HUE C;  5GT3 D;  2NQB D;  2YFW A;  3MGR C;  4WU9 C;  3WA9 A;  1P3P A;  3MNN C;  5GSU D;  5CPK B;  3AZK B;  3AZE B;  1JFI A;  1P3M C;  4H9N A;  2YFV B;  1M19 D;  3AZM B;  3B0B A;  3WKJ A;  4NFT A;  4CSR B;  5AV6 A;  3LEL B;  3W99 A;  3AYW A;  3REI C;  1WWS A;  1M1A B;  2HIO C;  2F8N K;  4KGC C;  4KUD A;  1ULY A;  5BNV B;  3AZG B;  1TZY B;  3AN2 A;  1P3I D;  4G91 C;  3AZI B;  4H9P B;  1AOI A;  3AZJ C;  5GT3 A;  2CV5 A;  1ID3 D;  3MVD B;  5JRG A;  5AVC D;  3REH B;  1P3F C;  3MNN D;  4Z5T C;  1KU5 A;  4Z66 C;  3VH5 T;  5B0Y D;  3AZF C;  5AV9 B;  3TU4 A;  5CPK D;  4ZBJ B;  4ZUX C;  3NQU A;  3REK B;  3UTB B;  4LD9 C;  4HGA B;  5B24 C;  4KGC D;  3AV2 C;  1EQZ D;  3LEL D;  5B40 A;  3W97 B;  1P3A B;  1M1A D;  5BO0 A;  5KDM A;  3O62 C;  1TAF A;  1ID3 A;  4JJN B;  3UTA B;  1TZY D;  3AV1 D;  5AY8 B;  5AVC A;  3REJ B;  3W98 B;  4R8P B;  3MNN A;  5B31 B;  1P3K B;  5B1L B;  1B6W A;  5B0Y A;  4AWL B;  3LZ0 D;  3MVD D;  3LJA B;  5CPK A;  1BH9 A;  3VH6 T;  3KUY C;  1M18 B;  3REH D;  4X23 B;  4KGC A;  5AV9 D;  1EQZ A;  3LEL A;  1M1A A;  4XZQ B;  3AZN C;  5GT0 C;  3MGQ B;  3UTB D;  3AV1 A;  1U35 B;  5DNN B;  3W97 D;  5B0Z C;  3X1U C;  4YS3 C;  4J8W B;  5BT1 D;  3LZ0 A;  4JJN D;  3UTA D;  4J8U B;  4Z66 A;  2ARO B;  3WA9 C;  2IO5 B;  3REH A;  4R8P D;  2NZD B;  5B31 D;  4KHA B;  3X1S B;  5B2I B;  2RVQ D;  4UUZ A;  4H9R A;  4LD9 A;  3WKJ C;  5B24 A;  3AV2 A;  5AV6 C;  3AFA B;  3UTB A;  5AV5 B;  1P3L B;  5G49 B;  3B6G D;  4KUD C;  1P34 B;  5F99 D;  2L5A A;  3WAA B;  3MGQ D;  4XUJ B;  1KX3 B;  1AOI C;  2BYK A;  1H3O B;  5GT3 C;  2NQB C;  3X1U D;  3V9R A;  5GSU C;  5B31 A;  5DNN D;  3AZL B;  1P3B C;  3WTP B;  4CAY A;  3AZH D;  1P3O B;  1M19 C;  1P3G B;  3X1T B;  5B1M B;  1HQ3 D;  3B0D C;  2ARO D;  3KSY A;  2NZD D;  3X1V B;  3X1S D;  5B2I D;  3B6G A;  5GT0 A;  3B6F B;  1P3I C;  5F99 A;  5C3I B;  3MGQ A;  5AVB C;  3AFA D;  2FJ7 D;  5CHL B;  5JA4 A;  5AV5 D;  3VH6 A;  3X1U A;  4QLC B;  1ID3 C;  5DNM B;  3REL D;  4WU8 D;  5DNN A;  4J8X B;  4EO5 B;  5GXQ B;  5AVC C;  3AZH A;  1P3B D;  5B32 B;  5B0Y C;  1HQ3 A;  2ARO A;  2BYM B;  5CPK C;  2NZD A;  3AZK C;  5B2I A;  5CPI D;  1KX5 B;  1P3O D;  1BH8 A;  4YM6 B;  3X1T D;  1EQZ C;  5FUG A;  1F1E A;  3AFA A;  3LEL C;  3MGR B;  2FJ7 A;  4WU9 B;  3WTP E;  1M1A C;  1KX4 B;  3R45 B;  5AVB D;  3AZG C;  1TZY C;  3REL A;  4WU8 A;  2NQB A;  3AZI C;  5CP6 B;  3AV1 C;  3MGS B;  4NE3 A;  5GSU A;  3A6N D;  1P3B A;  3KWQ B;  1F66 B;  3LZ0 C;  3MVD C;  5DNM D;  3REI B;  1M19 A;  5GXQ D;  3REH C;  5CPI A;  3AZK D;  1P3O A;  3AZE D;  3NQJ B;  5AV9 C;  1P3I A;  3AZM D;  5BNX B;  3REK C;  5AVB A;  3UTB C;  5BS7 A;  3VH5 W;  1P3F B;  4WZS B;  4Z5T B;  4G92 C;  3AZG D;  3AZF B;  1P3A C;  3AZI D;  3W97 C;  3A6N A;  3UT9 B;  1N1J A;  3C1B B;  4ZUX B;  5BT1 C;  4H9Q B;  4JJN C;  3UTA C;  3W98 C;  4R8P C;  5B31 C;  1P3K C;  3AZK A;  5B1L C;  2PYO B;  3AZE A;  4H9O B;  3KXB B;  2RVQ C;  1F66 D;  2F8N G;  2YFV A;  3AZM A;  1Q9C A;  3MGP B;  3LZ1 B;  4CSR A;  5B33 B;  4X23 C;  3W96 B;  3B6G C;  3REK D;  5BNV A;  3AZG A;  1TZY A;  3VH6 W;  2CWE A;  3AZI A;  4H9P A;  5F99 C;  3MGQ C;  1P3A D;  5B2J B;  1S32 B;  3MVD A;  5DNN C;  4H9S C;  4WNN B;  3UT9 D;  5AY8 D;  3C1B D;  3REJ D;  4J8W C;  3W98 D;  1F66 A;  3AZH C;  1P3K D;  5B1L D;  3AZN B;  5E5A B;  1HQ3 C;  2ARO C;  5AV9 A;  3LJA D;  2NZD C;  3X1S C;  5B2I C;  1M18 D;  2PYO D;  3NQJ A;  3KXB D;  3REK A;  4X23 D;  5B0Z B;  3C1C B;  4YS3 B;  4J8V B;  3LZ1 D;  1HTA A;  2YFW B;  3AFA C;  2FJ7 C;  4E44 A;  5B33 D;  3W97 A;  1P3A A;  1P3P B;  3WA9 B;  5AV5 C;  4XZQ D;  1P3L C;  1P34 C;  4JJN A;  3UTA A;  3REL C;  4WU8 C;  4NE5 A;  3UT9 A;  4H9N B;  5AY8 A;  3C1B A;  3REJ A;  3WAA C;  1U35 D;  3W98 A;  4R8P A;  3WKJ B;  1P3K A;  5B1L A;  5CPJ B;  1WWI A;  5B2J D;  1ZLA B;  4J8W D;  3W99 B;  3AYW B;  3LJA A;  4J8U D;  4KUD B;  1M18 A;  2PYO A;  3AZL C;  3WTP C;  3AN2 B;  5CPI C;  5AV8 B;  4X23 A;  1P3O C;  5E5A D;  3X1T C;  1AOI B;  3LZ1 A;  5GT3 B;  2CV5 B;  3X1V C;  4XZQ A;  2F8N H;  5JRG B;  3C1C D;  5BS7 C;  1P3L D;  2LY8 A;  5C3I C;  1U35 A;  1P34 D;  4DRA A;  4H9S A;  3A6N C;  1P3P D;  3TU4 B;  3WAA D;  4J8W A;  4XUJ D;  1KX3 D;  5DNM C;  4J8U A;  4EO5 C;  5GXQ C;  3B0C T;  4KHA A;  3X1S A;  5CPJ D;  5E5A A;  3AZL D;  3AZE C;  5B32 C;  3WTP D;  1ZLA D;  3W99 D;  5B40 B;  5BO0 B;  5KDM B;  1P3G D;  3AZM C;  1TAF B;  1ID3 B;  5B1M D;  2HUE B;  3AN2 D;  1KX5 C;  5AV8 D;  3X1V D;  5AVC B;  5AV5 A;  1P3L A;  5G49 A;  4E45 A;  3MNN B;  3B6F D;  2CV5 D;  1P34 A;  5B0Y B;  1P3M B;  1KX4 C;  3WAA A;  4XUJ A;  1BH9 B;  1KX3 A;  5JRG D;  1H3O A;  5CP6 C;  4QLC D;  3MGS C;  2HIO B;  4J8X D;  4KGC B;  1EQZ B;  3AZL A;  5CPJ A;  3TU4 D;  3KWQ C;  3WTP A;  1ZLA A;  1F66 C;  4G91 B;  1P3G A;  3X1T A;  5B32 D;  5B1M A;  3AZJ B;  4ZBJ C;  5AV8 A;  3AV1 B;  3X1V A;  3B6F A;  5B40 D;  1KX5 D;  4HGA C;  4YM6 D;  3LZ0 B;  4Z66 B;  3MGR D;  4WU9 D;  1KX4 D;  4QLC A;  5DNM A;  4J8X A;  5CP6 D;  4UUZ B;  5GXQ A;  5AY8 C;  4H9R B;  3MGS D;  3C1B C;  3REJ C;  3UT9 C;  1P3M D;  4LD9 B;  5B24 B;  3AV2 B;  3KWQ D;  5B32 A;  4AWL C;  3LJA C;  3REI D;  2BYM A;  2HIO D;  3O62 B;  1M18 C;  2PYO C;  1A7W A;  5B31 G;  4G92 B;  3KXB C;  1KX5 A;  4YM6 A;  3MGP C;  2BYK B;  3LZ1 C;  4Z2M G;  3AZJ D;  3MGR A;  5B33 C;  2F8N B;  4WU9 A;  3W96 C;  3V9R B;  4XZQ C;  1KX4 A;  3R45 A;  3KUY B;  4CAY B;  1P3F D;  5CP6 A;  3MGS A;  1P3M A;  1B67 A;  1U35 C;  1R4V A;  4Z5T D;  4Z66 D;  3AZF D;  5B2J C;  3KWQ A;  4ZUX D;  1S32 C;  3REI A;  3B6G B;  4J8U C;  5GT0 B;  2HIO A;  2IO5 C;  2JSS A;  4LD9 D;  5B24 D;  5F99 B;  3AV2 D;  5E5A C;  5JA4 B;  3AZJ A;  3X1U B;  3O62 D;  3MGP D;  5BNX A;  3C1C C;  3W96 D;  4J8V C;  1P3F A;  3AZH B;  4NE6 A;  4Z5T A;  2F8N D;  1HQ3 B;  3AZF A;  1JFI B;  1P3P C;  1BFM A;  4ZUX A;  4XUJ C;  1KX3 C;  4H9Q A;  3KUY D;  5AV6 B;  1S32 D;  1BH8 B;  5FUG B;  5CPJ C;  4DRB A;  4H9O A;  3KXB A;  1ZLA C;  3W99 C;  3AYW C;  2FJ7 B;  3AZN D;  5GT0 D;  1P3G C;  3O62 A;  5B1M C;  3MGP A;  3AN2 C;  3REL B;  4M6B A;  4WU8 B;  2NQB B;  5AV8 C;  5B33 A;  3W96 A;  3VH5 A;  3B6F C;  5GSU B;  2CV5 C;  1P3B B;  2F8N A;  5B0Z D;  4YS3 D;  4J8V D;  1M19 B;  3KUY A;  5JRG C;  3B0D B;  3WA9 D;  5CPI B;  4QLC C;  4Z2M H;  5B2J A;  1S32 A;  4J8X C;  3NQU B;  4WNN A;  3TU4 C;  1P3I B;  3WKJ D; 
#chains in the Genus database with same CATH topology
 3AZN A;  5AV6 D;  5AVB B;  3AYW D;  4KUD D;  5B40 C;  2BG1 A;  5B32 G;  3A6N B;  4WV4 B;  1N1J B;  5B0Z A;  3C1C A;  4YM6 C;  4YS3 A;  2Y2Q A;  4J8V A;  1AOI D;  3B0C W;  2HUE C;  5GT3 D;  2NQB D;  2YFW A;  3MGR C;  4WU9 C;  2G5I C;  3WA9 A;  1P3P A;  3MNN C;  5GSU D;  5CPK B;  3AZK B;  3AZE B;  1JFI A;  1P3M C;  4H9N A;  2YFV B;  1M19 D;  3AZM B;  3B0B A;  3WKJ A;  4NFT A;  4CSR B;  5AV6 A;  3EPK A;  3LEL B;  3W99 A;  3AYW A;  3REI C;  1WWS A;  1M1A B;  2HIO C;  2F8N K;  4KGC C;  4KUD A;  1ULY A;  5BNV B;  3AZG B;  1TZY B;  3AN2 A;  1P3I D;  4G91 C;  3AZI B;  4WJ3 C;  4H9P B;  1AOI A;  3AZJ C;  5GT3 A;  2CV5 A;  1ID3 D;  3MVD B;  2ZM5 A;  5JRG A;  5AVC D;  3REH B;  1P3F C;  3MNN D;  4Z5T C;  1KU5 A;  4Z66 C;  2DF4 C;  3VH5 T;  5B0Y D;  3AZF C;  5AV9 B;  3TU4 A;  5CPK D;  4ZBJ B;  4ZUX C;  3NQU A;  3REK B;  3UTB B;  4LD9 C;  4HGA B;  5B24 C;  4KGC D;  3AV2 C;  1EQZ D;  3LEL D;  5B40 A;  3W97 B;  1P3A B;  1M1A D;  5BO0 A;  5KDM A;  3O62 C;  1TAF A;  1ID3 A;  4JJN B;  3UTA B;  1TZY D;  3AV1 D;  5AY8 B;  5AVC A;  3REJ B;  3W98 B;  4R8P B;  3MNN A;  2ZY3 A;  5B31 B;  1P3K B;  5B1L B;  1B6W A;  5B0Y A;  4AWL B;  2J8P A;  3LZ0 D;  3MVD D;  3LJA B;  5CPK A;  1BH9 A;  3VH6 T;  3KUY C;  1M18 B;  3REH D;  4X23 B;  4KGC A;  5AV9 D;  1EQZ A;  3LEL A;  1M1A A;  4XZQ B;  3AZN C;  5GT0 C;  3MGQ B;  3UTB D;  2F2A C;  3AV1 A;  1U35 B;  5DNN B;  3W97 D;  5B0Z C;  3X1U C;  4YS3 C;  4J8W B;  5BT1 D;  3LZ0 A;  4JJN D;  3UTA D;  4J8U B;  4Z66 A;  2ARO B;  3WA9 C;  2IO5 B;  3REH A;  4R8P D;  3H0R C;  2NZD B;  5B31 D;  4KHA B;  3X1S B;  5B2I B;  2RVQ D;  4UUZ A;  3AL0 C;  4H9R A;  4LD9 A;  3WKJ C;  5B24 A;  3AV2 A;  5AV6 C;  3AFA B;  3UTB A;  2DQN C;  5AV5 B;  1P3L B;  5G49 B;  3B6G D;  4KUD C;  1P34 B;  5F99 D;  2L5A A;  3WAA B;  3A1I A;  4XUJ B;  3MGQ D;  1KX3 B;  1AOI C;  2BYK A;  1H3O B;  5GT3 C;  2NQB C;  3X1U D;  3V9R A;  5GSU C;  5B31 A;  5DNN D;  3AZL B;  1P3B C;  3WTP B;  4CAY A;  3AZH D;  1P3O B;  1M19 C;  1P3G B;  3X1T B;  5B1M B;  1HQ3 D;  3B0D C;  2ARO D;  3KSY A;  2NZD D;  3X1V B;  3X1S D;  5B2I D;  3B6G A;  5GT0 A;  3B6F B;  1P3I C;  5F99 A;  2G5H C;  5C3I B;  3MGQ A;  5AVB C;  3AFA D;  2FJ7 D;  5CHL B;  5JA4 A;  5AV5 D;  3VH6 A;  3X1U A;  4QLC B;  1ID3 C;  2ZY5 A;  5DNM B;  1T3U A;  3REL D;  4WU8 D;  5DNN A;  4J8X B;  4EO5 B;  5GXQ B;  5AVC C;  3AZH A;  2ZY4 A;  1P3B D;  5B32 B;  5B0Y C;  1HQ3 A;  2ARO A;  2BYM B;  5CPK C;  2NZD A;  3AZK C;  5B2I A;  5CPI D;  1KX5 B;  1P3O D;  1BH8 A;  4YM6 B;  3EPJ A;  3X1T D;  1EQZ C;  5FUG A;  1F1E A;  2Y2N A;  3AFA A;  3LEL C;  3MGR B;  2FJ7 A;  4WU9 B;  3WTP E;  1M1A C;  1KX4 B;  3R45 B;  5AVB D;  3AZG C;  1TZY C;  3REL A;  4WU8 A;  2NQB A;  3AZI C;  5CP6 B;  3AV1 C;  3MGS B;  4NE3 A;  5GSU A;  3A6N D;  1P3B A;  3KWQ B;  1F66 B;  3LZ0 C;  3MVD C;  5DNM D;  3REI B;  1M19 A;  5GXQ D;  3REH C;  2Y2L A;  5CPI A;  3AZK D;  1P3O A;  3AZE D;  3NQJ B;  5AV9 C;  1P3I A;  3AZM D;  5BNX B;  3REK C;  5AVB A;  3UTB C;  5BS7 A;  3VH5 W;  1P3F B;  4WZS B;  4Z5T B;  4G92 C;  3AZG D;  3KFU G;  3AZF B;  1P3A C;  3AZI D;  3W97 C;  3A6N A;  3UT9 B;  1N1J A;  3C1B B;  1W2E A;  4ZUX B;  5BT1 C;  4H9Q B;  4JJN C;  3UTA C;  3W98 C;  4R8P C;  1Z2C B;  5B31 C;  1P3K C;  3AZK A;  5B1L C;  2PYO B;  3AZE A;  4H9O B;  3KXB B;  2RVQ C;  1F66 D;  2F8N G;  2YFV A;  4DQY B;  3AZM A;  1Q9C A;  3MGP B;  3LZ1 B;  4CSR A;  5B33 B;  4X23 C;  3W96 B;  1PZR A;  3B6G C;  2Y2P A;  3REK D;  5BNV A;  3AZG A;  1TZY A;  3VH6 W;  2CWE A;  3AZI A;  4H9P A;  5F99 C;  3MGQ C;  1P3A D;  5B2J B;  1S32 B;  3MVD A;  5DNN C;  2W8S A;  4H9S C;  4WNN B;  3UT9 D;  5AY8 D;  3C1B D;  3REJ D;  4J8W C;  3W98 D;  1F66 A;  3AZH C;  1P3K D;  5B1L D;  3AZN B;  2RIQ A;  5E5A B;  1HQ3 C;  2ARO C;  5AV9 A;  3LJA D;  2NZD C;  3X1S C;  5B2I C;  1M18 D;  2PYO D;  3NQJ A;  3KXB D;  3REK A;  4X23 D;  5B0Z B;  3C1C B;  4YS3 B;  4J8V B;  3LZ1 D;  2UWX A;  2JCH A;  1HTA A;  2YFW B;  3AFA C;  2FJ7 C;  4E44 A;  5B33 D;  3W97 A;  1P3A A;  1P3P B;  3WA9 B;  5AV5 C;  4XZQ D;  1P3L C;  1P34 C;  4JJN A;  3UTA A;  3REL C;  4WU8 C;  4NE5 A;  3H0L C;  3UT9 A;  4H9N B;  5AY8 A;  3C1B A;  3REJ A;  3WAA C;  1U35 D;  3W98 A;  4R8P A;  3WKJ B;  1P3K A;  5B1L A;  5CPJ B;  1WWI A;  5B2J D;  1ZLA B;  4J8W D;  3W99 B;  3AYW B;  3LJA A;  4J8U D;  4KUD B;  1M18 A;  2PYO A;  3AZL C;  3WTP C;  3AN2 B;  5CPI C;  5AV8 B;  2VQR A;  4X23 A;  1P3O C;  5E5A D;  3X1T C;  1AOI B;  2FFF B;  5GT3 B;  3LZ1 A;  2CV5 B;  2Y2I A;  3X1V C;  4XZQ A;  2F8N H;  3A1K A;  5JRG B;  3C1C D;  5BS7 C;  1P3L D;  2LY8 A;  5C3I C;  1U35 A;  1P34 D;  4DRA A;  4H9S A;  3A6N C;  1P3P D;  3TU4 B;  3WAA D;  4J8W A;  4XUJ D;  1KX3 D;  5DNM C;  3FDD A;  4J8U A;  4EO5 C;  5GXQ C;  3B0C T;  4KHA A;  3X1S A;  5CPJ D;  5E5A A;  3AZL D;  3AZE C;  5B32 C;  3WTP D;  1ZLA D;  3W99 D;  5B40 B;  5BO0 B;  5KDM B;  1P3G D;  3AZM C;  1TAF B;  2Y2O A;  5B1M D;  1ID3 B;  2HUE B;  3AN2 D;  1KX5 C;  5AV8 D;  3X1V D;  5AVC B;  2Y2H A;  5AV5 A;  5G49 A;  4E45 A;  3MNN B;  1P3L A;  3B6F D;  2CV5 D;  1P34 A;  5B0Y B;  1P3M B;  1KX4 C;  2JE5 A;  3WAA A;  4XUJ A;  1BH9 B;  1KX3 A;  5JRG D;  1H3O A;  2Y2J A;  5CP6 C;  4QLC D;  3MGS C;  2HIO B;  4J8X D;  4KGC B;  1EQZ B;  3AZL A;  5CPJ A;  3TU4 D;  3H0M C;  3WTP A;  3KWQ C;  1ZLA A;  1F66 C;  4G91 B;  1P3G A;  3X1T A;  5B32 D;  5B1M A;  2XD5 A;  3AZJ B;  4ZBJ C;  5AV8 A;  3AV1 B;  3X1V A;  3B6F A;  5B40 D;  1KX5 D;  4HGA C;  4YM6 D;  3LZ0 B;  4Z66 B;  3MGR D;  4WU9 D;  1KX4 D;  4QLC A;  5DNM A;  4J8X A;  5CP6 D;  4UUZ B;  5GXQ A;  5AY8 C;  4H9R B;  3MGS D;  3C1B C;  3REJ C;  3UT9 C;  1P3M D;  4LD9 B;  5B24 B;  3AV2 B;  3KWQ D;  5B32 A;  4AWL C;  3LJA C;  3REI D;  2BYM A;  2HIO D;  3O62 B;  1M18 C;  2PYO C;  1A7W A;  5B31 G;  4G92 B;  3KXB C;  1KX5 A;  4YM6 A;  3MGP C;  2BYK B;  3LZ1 C;  4Z2M G;  3AZJ D;  3MGR A;  5B33 C;  2F8N B;  4WU9 A;  3W96 C;  3V9R B;  4XZQ C;  1KX4 A;  3P5J B;  3R45 A;  3KUY B;  4CAY B;  1P3F D;  5CP6 A;  3MGS A;  1P3M A;  1B67 A;  1U35 C;  1R4V A;  4Z5T D;  4Z66 D;  3AZF D;  5B2J C;  3KWQ A;  4ZUX D;  1S32 C;  3REI A;  3B6G B;  4J8U C;  5GT0 B;  2HIO A;  4UPK A;  2IO5 C;  2JSS A;  4LD9 D;  5B24 D;  5F99 B;  3AV2 D;  5E5A C;  2Y2M A;  5JA4 B;  3AZJ A;  3IP4 C;  3EPH A;  3X1U B;  3O62 D;  3MGP D;  5BNX A;  3C1C C;  3W96 D;  4J8V C;  1P3F A;  3AZH B;  4NE6 A;  4Z5T A;  2F8N D;  1HQ3 B;  3AZF A;  1JFI B;  1P3P C;  1BFM A;  4ZUX A;  4XUJ C;  1KX3 C;  4H9Q A;  3KUY D;  5AV6 B;  1S32 D;  1BH8 B;  2Y2K A;  5FUG B;  5CPJ C;  4DRB A;  4H9O A;  3KXB A;  1ZLA C;  3W99 C;  3AYW C;  2FJ7 B;  3AZN D;  5GT0 D;  1P3G C;  3O62 A;  2XD1 A;  5B1M C;  3MGP A;  3AN2 C;  3REL B;  4M6B A;  3EG5 B;  4WU8 B;  2NQB B;  5AV8 C;  5B33 A;  3W96 A;  3VH5 A;  3B6F C;  5GSU B;  2CV5 C;  1P3B B;  2F8N A;  5B0Z D;  4YS3 D;  3EPL A;  4J8V D;  2ZY2 A;  2Y2G A;  1M19 B;  3KUY A;  5JRG C;  3B0D B;  3F6T A;  3WA9 D;  5CPI B;  4QLC C;  4Z2M H;  5B2J A;  1S32 A;  4J8X C;  3NQU B;  4WNN A;  3TU4 C;  1P3I B;  3WKJ D; 
#chains in the Genus database with same CATH homology
 3AZN A;  5AV6 D;  5AVB B;  3AYW D;  4KUD D;  5B40 C;  2BG1 A;  5B32 G;  3A6N B;  4WV4 B;  1N1J B;  5B0Z A;  3C1C A;  4YM6 C;  4YS3 A;  2Y2Q A;  4J8V A;  1AOI D;  3B0C W;  2HUE C;  5GT3 D;  2NQB D;  2YFW A;  3MGR C;  4WU9 C;  2G5I C;  3WA9 A;  1P3P A;  3MNN C;  5GSU D;  5CPK B;  3AZK B;  3AZE B;  1JFI A;  1P3M C;  4H9N A;  2YFV B;  1M19 D;  3AZM B;  3B0B A;  3WKJ A;  4NFT A;  4CSR B;  5AV6 A;  3EPK A;  3LEL B;  3W99 A;  3AYW A;  3REI C;  1WWS A;  1M1A B;  2HIO C;  2F8N K;  4KGC C;  4KUD A;  1ULY A;  5BNV B;  3AZG B;  1TZY B;  3AN2 A;  1P3I D;  4G91 C;  3AZI B;  4WJ3 C;  4H9P B;  1AOI A;  3AZJ C;  5GT3 A;  2CV5 A;  1ID3 D;  3MVD B;  2ZM5 A;  5JRG A;  5AVC D;  3REH B;  1P3F C;  3MNN D;  4Z5T C;  1KU5 A;  4Z66 C;  2DF4 C;  3VH5 T;  5B0Y D;  3AZF C;  5AV9 B;  3TU4 A;  5CPK D;  4ZBJ B;  4ZUX C;  3NQU A;  3REK B;  3UTB B;  4LD9 C;  4HGA B;  5B24 C;  4KGC D;  3AV2 C;  1EQZ D;  3LEL D;  5B40 A;  3W97 B;  1P3A B;  1M1A D;  5BO0 A;  5KDM A;  3O62 C;  1TAF A;  1ID3 A;  4JJN B;  3UTA B;  1TZY D;  3AV1 D;  5AY8 B;  5AVC A;  3REJ B;  3W98 B;  4R8P B;  3MNN A;  2ZY3 A;  5B31 B;  1P3K B;  5B1L B;  1B6W A;  5B0Y A;  4AWL B;  2J8P A;  3LZ0 D;  3MVD D;  3LJA B;  5CPK A;  1BH9 A;  3VH6 T;  3KUY C;  1M18 B;  3REH D;  4X23 B;  4KGC A;  5AV9 D;  1EQZ A;  3LEL A;  1M1A A;  4XZQ B;  3AZN C;  5GT0 C;  3MGQ B;  3UTB D;  2F2A C;  3AV1 A;  1U35 B;  5DNN B;  3W97 D;  5B0Z C;  3X1U C;  4YS3 C;  4J8W B;  5BT1 D;  3LZ0 A;  4JJN D;  3UTA D;  4J8U B;  4Z66 A;  2ARO B;  3WA9 C;  2IO5 B;  3REH A;  4R8P D;  3H0R C;  2NZD B;  5B31 D;  4KHA B;  3X1S B;  5B2I B;  2RVQ D;  4UUZ A;  3AL0 C;  4H9R A;  4LD9 A;  3WKJ C;  5B24 A;  3AV2 A;  5AV6 C;  3AFA B;  3UTB A;  2DQN C;  5AV5 B;  1P3L B;  5G49 B;  3B6G D;  4KUD C;  1P34 B;  5F99 D;  2L5A A;  3WAA B;  3A1I A;  4XUJ B;  3MGQ D;  1KX3 B;  1AOI C;  2BYK A;  1H3O B;  5GT3 C;  2NQB C;  3X1U D;  3V9R A;  5GSU C;  5B31 A;  5DNN D;  3AZL B;  1P3B C;  3WTP B;  4CAY A;  3AZH D;  1P3O B;  1M19 C;  1P3G B;  3X1T B;  5B1M B;  1HQ3 D;  3B0D C;  2ARO D;  3KSY A;  2NZD D;  3X1V B;  3X1S D;  5B2I D;  3B6G A;  5GT0 A;  3B6F B;  1P3I C;  5F99 A;  2G5H C;  5C3I B;  3MGQ A;  5AVB C;  3AFA D;  2FJ7 D;  5CHL B;  5JA4 A;  5AV5 D;  3VH6 A;  3X1U A;  4QLC B;  1ID3 C;  2ZY5 A;  5DNM B;  1T3U A;  3REL D;  4WU8 D;  5DNN A;  4J8X B;  4EO5 B;  5GXQ B;  5AVC C;  3AZH A;  2ZY4 A;  1P3B D;  5B32 B;  5B0Y C;  1HQ3 A;  2ARO A;  2BYM B;  5CPK C;  2NZD A;  3AZK C;  5B2I A;  5CPI D;  1KX5 B;  1P3O D;  1BH8 A;  4YM6 B;  3EPJ A;  3X1T D;  1EQZ C;  5FUG A;  1F1E A;  2Y2N A;  3AFA A;  3LEL C;  3MGR B;  2FJ7 A;  4WU9 B;  3WTP E;  1M1A C;  1KX4 B;  3R45 B;  5AVB D;  3AZG C;  1TZY C;  3REL A;  4WU8 A;  2NQB A;  3AZI C;  5CP6 B;  3AV1 C;  3MGS B;  4NE3 A;  5GSU A;  3A6N D;  1P3B A;  3KWQ B;  1F66 B;  3LZ0 C;  3MVD C;  5DNM D;  3REI B;  1M19 A;  5GXQ D;  3REH C;  2Y2L A;  5CPI A;  3AZK D;  1P3O A;  3AZE D;  3NQJ B;  5AV9 C;  1P3I A;  3AZM D;  5BNX B;  3REK C;  5AVB A;  3UTB C;  5BS7 A;  3VH5 W;  1P3F B;  4WZS B;  4Z5T B;  4G92 C;  3AZG D;  3KFU G;  3AZF B;  1P3A C;  3AZI D;  3W97 C;  3A6N A;  3UT9 B;  1N1J A;  3C1B B;  1W2E A;  4ZUX B;  5BT1 C;  4H9Q B;  4JJN C;  3UTA C;  3W98 C;  4R8P C;  1Z2C B;  5B31 C;  1P3K C;  3AZK A;  5B1L C;  2PYO B;  3AZE A;  4H9O B;  3KXB B;  2RVQ C;  1F66 D;  2F8N G;  2YFV A;  4DQY B;  3AZM A;  1Q9C A;  3MGP B;  3LZ1 B;  4CSR A;  5B33 B;  4X23 C;  3W96 B;  1PZR A;  3B6G C;  2Y2P A;  3REK D;  5BNV A;  3AZG A;  1TZY A;  3VH6 W;  2CWE A;  3AZI A;  4H9P A;  5F99 C;  3MGQ C;  1P3A D;  5B2J B;  1S32 B;  3MVD A;  5DNN C;  2W8S A;  4H9S C;  4WNN B;  3UT9 D;  5AY8 D;  3C1B D;  3REJ D;  4J8W C;  3W98 D;  1F66 A;  3AZH C;  1P3K D;  5B1L D;  3AZN B;  2RIQ A;  5E5A B;  1HQ3 C;  2ARO C;  5AV9 A;  3LJA D;  2NZD C;  3X1S C;  5B2I C;  1M18 D;  2PYO D;  3NQJ A;  3KXB D;  3REK A;  4X23 D;  5B0Z B;  3C1C B;  4YS3 B;  4J8V B;  3LZ1 D;  2UWX A;  2JCH A;  1HTA A;  2YFW B;  3AFA C;  2FJ7 C;  4E44 A;  5B33 D;  3W97 A;  1P3A A;  1P3P B;  3WA9 B;  5AV5 C;  4XZQ D;  1P3L C;  1P34 C;  4JJN A;  3UTA A;  3REL C;  4WU8 C;  4NE5 A;  3H0L C;  3UT9 A;  4H9N B;  5AY8 A;  3C1B A;  3REJ A;  3WAA C;  1U35 D;  3W98 A;  4R8P A;  3WKJ B;  1P3K A;  5B1L A;  5CPJ B;  1WWI A;  5B2J D;  1ZLA B;  4J8W D;  3W99 B;  3AYW B;  3LJA A;  4J8U D;  4KUD B;  1M18 A;  2PYO A;  3AZL C;  3WTP C;  3AN2 B;  5CPI C;  5AV8 B;  2VQR A;  4X23 A;  1P3O C;  5E5A D;  3X1T C;  1AOI B;  2FFF B;  5GT3 B;  3LZ1 A;  2CV5 B;  2Y2I A;  3X1V C;  4XZQ A;  2F8N H;  3A1K A;  5JRG B;  3C1C D;  5BS7 C;  1P3L D;  2LY8 A;  5C3I C;  1U35 A;  1P34 D;  4DRA A;  4H9S A;  3A6N C;  1P3P D;  3TU4 B;  3WAA D;  4J8W A;  4XUJ D;  1KX3 D;  5DNM C;  3FDD A;  4J8U A;  4EO5 C;  5GXQ C;  3B0C T;  4KHA A;  3X1S A;  5CPJ D;  5E5A A;  3AZL D;  3AZE C;  5B32 C;  3WTP D;  1ZLA D;  3W99 D;  5B40 B;  5BO0 B;  5KDM B;  1P3G D;  3AZM C;  1TAF B;  2Y2O A;  5B1M D;  1ID3 B;  2HUE B;  3AN2 D;  1KX5 C;  5AV8 D;  3X1V D;  5AVC B;  2Y2H A;  5AV5 A;  5G49 A;  4E45 A;  3MNN B;  1P3L A;  3B6F D;  2CV5 D;  1P34 A;  5B0Y B;  1P3M B;  1KX4 C;  2JE5 A;  3WAA A;  4XUJ A;  1BH9 B;  1KX3 A;  5JRG D;  1H3O A;  2Y2J A;  5CP6 C;  4QLC D;  3MGS C;  2HIO B;  4J8X D;  4KGC B;  1EQZ B;  3AZL A;  5CPJ A;  3TU4 D;  3H0M C;  3WTP A;  3KWQ C;  1ZLA A;  1F66 C;  4G91 B;  1P3G A;  3X1T A;  5B32 D;  5B1M A;  2XD5 A;  3AZJ B;  4ZBJ C;  5AV8 A;  3AV1 B;  3X1V A;  3B6F A;  5B40 D;  1KX5 D;  4HGA C;  4YM6 D;  3LZ0 B;  4Z66 B;  3MGR D;  4WU9 D;  1KX4 D;  4QLC A;  5DNM A;  4J8X A;  5CP6 D;  4UUZ B;  5GXQ A;  5AY8 C;  4H9R B;  3MGS D;  3C1B C;  3REJ C;  3UT9 C;  1P3M D;  4LD9 B;  5B24 B;  3AV2 B;  3KWQ D;  5B32 A;  4AWL C;  3LJA C;  3REI D;  2BYM A;  2HIO D;  3O62 B;  1M18 C;  2PYO C;  1A7W A;  5B31 G;  4G92 B;  3KXB C;  1KX5 A;  4YM6 A;  3MGP C;  2BYK B;  3LZ1 C;  4Z2M G;  3AZJ D;  3MGR A;  5B33 C;  2F8N B;  4WU9 A;  3W96 C;  3V9R B;  4XZQ C;  1KX4 A;  3P5J B;  3R45 A;  3KUY B;  4CAY B;  1P3F D;  5CP6 A;  3MGS A;  1P3M A;  1B67 A;  1U35 C;  1R4V A;  4Z5T D;  4Z66 D;  3AZF D;  5B2J C;  3KWQ A;  4ZUX D;  1S32 C;  3REI A;  3B6G B;  4J8U C;  5GT0 B;  2HIO A;  4UPK A;  2IO5 C;  2JSS A;  4LD9 D;  5B24 D;  5F99 B;  3AV2 D;  5E5A C;  2Y2M A;  5JA4 B;  3AZJ A;  3IP4 C;  3EPH A;  3X1U B;  3O62 D;  3MGP D;  5BNX A;  3C1C C;  3W96 D;  4J8V C;  1P3F A;  3AZH B;  4NE6 A;  4Z5T A;  2F8N D;  1HQ3 B;  3AZF A;  1JFI B;  1P3P C;  1BFM A;  4ZUX A;  4XUJ C;  1KX3 C;  4H9Q A;  3KUY D;  5AV6 B;  1S32 D;  1BH8 B;  2Y2K A;  5FUG B;  5CPJ C;  4DRB A;  4H9O A;  3KXB A;  1ZLA C;  3W99 C;  3AYW C;  2FJ7 B;  3AZN D;  5GT0 D;  1P3G C;  3O62 A;  2XD1 A;  5B1M C;  3MGP A;  3AN2 C;  3REL B;  4M6B A;  3EG5 B;  4WU8 B;  2NQB B;  5AV8 C;  5B33 A;  3W96 A;  3VH5 A;  3B6F C;  5GSU B;  2CV5 C;  1P3B B;  2F8N A;  5B0Z D;  4YS3 D;  3EPL A;  4J8V D;  2ZY2 A;  2Y2G A;  1M19 B;  3KUY A;  5JRG C;  3B0D B;  3F6T A;  3WA9 D;  5CPI B;  4QLC C;  4Z2M H;  5B2J A;  1S32 A;  4J8X C;  3NQU B;  4WNN A;  3TU4 C;  1P3I B;  3WKJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...