4YS3A

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 31
structure length 96
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3A00
5CPKC 4Z5TD 2IO5C 3V9RB 3AN2D 3MGQA 1P3LA 5B1LD 3KXBC 3AZEA 3AN2C 3REHB 4J8XC 1P3IA 1M19B 5B0ZB 5GT3D 1P3BA 5F99D 3UTAA 4YS3C 3B6GB 5B33A 1M18A 5GT3C 3REIB 4H9PB 5GT0C 3LZ0A 3TU4D 1N1JA 1JFIA 1ID3D 5B32C 4QLCC 3LJAD 4H9RA 2NZDA 1TAFA 4QLCD 3AZKA 5AV6C 2CV5B 3KXBB 1B67A 5BNXB 5CPJB 5AV6D 4Z66C 3UT9C 2F8NB 4KGCA 2BYKB 4YM6A 3C1CA 1P3KD 1H3OA 4J8WA 5DNNA 3REJC 5GXQC 3AFAC 3B6FB 3REIC 5AV5B 5B1MB 4WZSB 4KGCB 1F66D 3WAAB 1H3OB 4J8WB 2HUEC 3KWQD 4WNNB 1P34A 1B6WA 3O62C 3AZFD 3MGSC 3REKB 4XUJD 4XUJA 5GXQA 1P3ID 3MGPC 3UTBD 4R8PC 5B31C 4XZQC 5BT1C 4H9RB 2NZDB 5JRGD 5BS7A 1JFIB 4Z5TB 3LZ1B 5AV9D 1P3PC 3LZ1C 3AFAB 1P3BB 2PYOC 3NQJB 5B2JC 1M19A 5GSUB 3C1CD 4ZUXA 1HQ3A 5B31B 4R8PB 5AV6A 4YS3A 1U35B 4WU9D 1U35A 1M1AA 3MGQB 3AZEB 2PYOA 3X1VB 4HGAC 1P3LB 1P3AC 3AZHC 1S32A 1P3AB 4J8VA 1ZLAD 2AROB 3MGQC 1EQZD 4CSRB 5CP6B 4X23C 3B0BA 2L5AA 5AY8C 2F8NG 4JJNA 5B0YD 5AVCA 5CPIA 5B24A 1P34B 4X23A 3AV1A 4WU8D 1KX4D 3WAAA 5B2IB 1P34C 4NE5A 2NQBA 1P3OC 3RELC 5B0YB 4NFTA 3AZMA 3MGRA 1P3OD 3AZNA 3X1TA 5E5AC 3WTPA 3LELA 2F8NK 2HUEB 2F8NA 5E5AB 5AY8B 5B33C 4CAYA 4Z66D 4X23B 1M18C 4KGCC 5CPJA 1P3GB 1M1AC 5KDMB 5GXQD 3W99D 3R45B 5B32A 3AFAD 1F1EA 3AZKB 3A6ND 5AV8A 5AV9B 3W99C 2NQBD 3W97B 3W96B 4H9OA 3AZIC 5DNMC 3C1BB 2LY8A 5AVCD 3MGPD 3AZID 5JA4A 4Z2MG 5B0ZA 3REKD 4WV4B 5DNNC 1P3AA 3X1VA 1F66B 4KHAB 1KX3D 5B40D 5BO0A 5AVBD 1EQZA 1P3FD 3W98C 4YS3B 5JRGB 5AVBC 4DRAA 3AZJA 2NZDD 4J8UA 4DRBA 1M19C 5GSUA 1P3KB 3C1CC 2NZDC 4ZUXC 4KUDB 3AZGC 3AZMC 3RELB 3AZIB 3MGPB 4ZUXD 4QLCB 3UTBA 3WAAC 4H9NA 5B2JB 3WTPD 3B6FD 3X1UD 5AV8B 5AV9A 1Q9CA 3TU4B 5GXQB 4XZQA 1P3GA 1P3GD 3B0CT 4X23D 4WU8A 5AY8A 5AY8D 1KX4A 4KUDD 3WKJD 3AZMB 4G92C 1P3KA 3B6FA 4KUDC 4AWLB 5FUGB 3LJAB 3MNNB 3AZHB 5CPKA 5B2IA 5GT0D 3TU4C 3KWQA 1P34D 5B24B 1F66A 3KXBA 3VH5W 1U35C 1ZLAA 5B32G 4Z2MH 5JA4B 2BYMB 5AVCB 3X1TC 4WU9A 3AZGA 3KUYD 1HTAA 3B0DB 4J8UD 2YFVA 4CSRA 3W96A 2YFVB 1WWIA 3NQUA 1M1AD 3KUYC 2AROC 4UUZA 3WA9C 1P3KC 2AROD 2IO5B 3AZJC 3AZLC 3AZKD 3R45A 5B32B 3MNNC 5B1LC 3AZLD 3AZKC 3AN2A 1P3LD 1ID3A 1AOIB 1F66C 3WKJA 1M1AB 4E44A 3O62D 3V9RA 3MGSD 3AZNB 1TZYD 5BNVA 3UTBC 5GT3A 1TZYC 3AZFA 3W96C 5B32D 3AFAA 4WU8B 1KX4B 3MGRC 1P3FC 3MGRD 1BH9A 3O62A 5CPJC 3AZMD 4ZBJB 3UTBB 3UT9D 5CP6A 3MVDA 3AZNC 5C3IC 4WNNA 3WAAD 5B1MD 1P3PA 5AVBA 1P3AD 5B40A 3AV1C 3X1VD 2FJ7A 5C3IB 3AZJB 5DNNB 4LD9B 3X1VC 2BYKA 4J8VC 3WA9B 2HIOA 4H9SA 3WKJB 1AOIA 5AV6B 5BO0B 1EQZC 4ZUXB 4J8VD 5BNXA 3KXBD 3AYWA 3VH6A 5F99A 3NQJA 1P3BD 1KX3A 3W97C 4J8XD 5AV9C 5B1LA 3AV2B 5AV8D 1P3BC 3X1SA 3X1SB 4H9OB 4YS3D 2PYOD 5AV8C 3B6GC 2CWEA 4H9PA 1KX5D 3LELD 1P3MB 1KX3B 5B33B 1M18B 3B6GD 4Z66A 5F99B 1KX5C 1A7WA 3RELD 4WU9C 1P3IB 4XUJB 5KDMA 3REHD 3A6NA 4H9QB 3KWQB 3C1BD 4CAYB 2F8NH 4LD9A 5CPKB 3WA9A 1BFMA 2RVQD 3LELB 1P3MD 3MGRB 5CPID 2RVQC 3X1SD 5AVBB 1P3MC 5FUGA 5B40B 3REJD 3X1SC 2YFWB 4YM6B 5B31G 4EO5C 1BH8B 3MVDB 4J8XA 4XZQB 2CV5A 3KWQC 1AOIC 3MGSA 4XUJC 3REKC 3VH5A 5DNND 1AOID 2FJ7D 4G91C 4JJNB 2FJ7C 1BH8A 3W99B 3LJAC 3REIA 3AZIA 3UTAB 2AROA 5GT3B 1P3PD 3KUYA 5E5AD 1M19D 1S32B 4E45A 1WWSA 4J8UB 5BNVB 5CP6C 1S32C 3AZGD 5CHLB 5CP6D 4H9QA 1S32D 1EQZB 3AN2B 3A6NC 1HQ3B 4KHAA 5B31A 5B2ID 4R8PA 3W98A 3WTPC 5B2IC 1HQ3D 3AZHD 4UUZB 5DNMD 5DNMA 4G92B 3LZ1A 1TZYA 3AZFC 1ZLAC 1TZYB 3NQUB 3MGQD 3AZGB 4WU9B 4Z5TA 1P3IC 2BYMA 4R8PD 5B31D 4XZQD 1KX3C 4YM6C 5JRGC 3W98B 1ZLAB 2JSSA 4YM6D 2HIOB 1ULYA 3AZHA 3REJB 3AZLA 3LZ1D 5E5AA 3X1UA 3LELC 4JJND 2FJ7B 3WTPB 5B2JD 4WU8C 1KX4C 1KX5A 3KUYB 3LZ0C 5GSUD 3C1CB 5G49B 4J8WC 4J8UC 3LZ0D 5GSUC 4EO5B 3MVDC 5AV5C 4J8WD 3AYWD 5B33D 1M18D 4KGCD 5CPIC 5GT0B 3TU4A 5AV5D 3AYWC 5CPIB 5B24C 3WTPE 1P3FA 3VH6T 1P3GC 3MNND 5GT0A 5CPKD 4H9NB 5B2JA 4HGAB 1P3LC 4J8XB 4QLCA 2NQBC 1KU5A 3MGPA 3LZ0B 1R4VA 4AWLC 2CV5C 5B0YC 2YFWA 3AZFB 3B0DC 4J8VB 2CV5D 3VH5T 5F99C 5JRGA 3REHA 1KX5B 2PYOB 3X1UB 1ID3B 3REJA 3AV2D 3A6NB 5B40C 1ID3C 3AV2C 2F8ND 3W98D 5CPJD 4Z66B 1P3MA 3WA9D 1P3OB 3VH6W 3C1BA 4LD9D 3AZJD 5B1LB 3AV2A 3W97A 4LD9C 1P3FB 5B1MC 1HQ3C 3REID 3AYWB 5B0ZD 3REKA 5G49A 5AVCC 3UT9B 5B0ZC 3X1TB 3MNNA 3KSYA 3LJAA 5B1MA 5B0YA 4H9SC 5AV5A 3W96D 3UTAC 3WKJC 1P3PB 5BT1D 3W97D 2NQBB 4NE6A 3UTAD 3UT9A 3B0CW 3AZLB 2HIOD 3W99A 3AV1B 4G91B 4JJNC 3AZEC 2HIOC 4M6BA 3AZED 1TAFB 3MGSB 3AZND 1U35D 1BH9B 3O62B 3REHC 3X1TD 4ZBJC 1N1JB 1P3OA 3MVDD 3C1BC 5DNMB 3RELA 3B6FC 4KUDA 3AV1D 3B6GA 3X1UC 5B24D 4Z5TC 5BS7C 4NE3A
chains in the Genus database with same CATH superfamily
5CPKC 4Z5TD 2IO5C 3V9RB 3AN2D 3MGQA 1P3LA 5B1LD 3KXBC 3AZEA 3AN2C 3REHB 4J8XC 1P3IA 1M19B 3EPHA 5B0ZB 5GT3D 1P3BA 5F99D 3UTAA 4YS3C 3B6GB 5B33A 1M18A 5GT3C 3REIB 3IP4C 4H9PB 5GT0C 3LZ0A 3TU4D 1N1JA 3H0MC 1JFIA 1ID3D 5B32C 4QLCC 3LJAD 4H9RA 2NZDA 1TAFA 4QLCD 3AZKA 5AV6C 2CV5B 3KXBB 1B67A 5BNXB 5CPJB 2ZY5A 5AV6D 4Z66C 3UT9C 2F8NB 4KGCA 2BYKB 4YM6A 3C1CA 1P3KD 1H3OA 4J8WA 5DNNA 3REJC 5GXQC 4DQYB 3AFAC 3B6FB 3REIC 2UWXA 5AV5B 5B1MB 4WZSB 4KGCB 1F66D 3H0RC 3WAAB 1H3OB 4J8WB 2HUEC 3KWQD 4WNNB 1P34A 1B6WA 3O62C 3AZFD 3MGSC 3REKB 4XUJD 4XUJA 5GXQA 1P3ID 3MGPC 3UTBD 4R8PC 5B31C 4XZQC 5BT1C 3H0LC 4H9RB 2NZDB 5JRGD 5BS7A 1JFIB 4Z5TB 2ZM5A 3LZ1B 5AV9D 1P3PC 3A1KA 3LZ1C 3AFAB 1P3BB 2PYOC 3NQJB 5B2JC 1M19A 5GSUB 3C1CD 4ZUXA 1HQ3A 5B31B 4R8PB 5AV6A 3EPKA 4YS3A 1U35B 4WU9D 1U35A 1M1AA 3MGQB 3AZEB 2PYOA 3X1VB 4HGAC 3EPJA 1P3AC 1P3LB 3AZHC 1S32A 1P3AB 4J8VA 1ZLAD 2AROB 3MGQC 1EQZD 4CSRB 5CP6B 3B0BA 4X23C 2L5AA 5AY8C 2F8NG 4JJNA 5B0YD 5AVCA 1PZRA 5CPIA 5B24A 1P34B 4X23A 3AV1A 4WU8D 1KX4D 3WAAA 5B2IB 1P34C 2Y2OA 4NE5A 2NQBA 1P3OC 3RELC 5B0YB 4NFTA 3AZMA 3MGRA 1P3OD 3AZNA 3X1TA 5E5AC 3WTPA 3LELA 2F8NK 2HUEB 2DF4C 2F8NA 5E5AB 5AY8B 5B33C 4CAYA 4Z66D 4X23B 1M18C 4KGCC 5CPJA 1P3GB 1M1AC 5KDMB 1W2EA 5GXQD 3W99D 3R45B 5B32A 3AFAD 1F1EA 2F2AC 3A6ND 3AZKB 5AV8A 5AV9B 3W99C 2NQBD 3W97B 3W96B 4H9OA 3AZIC 5DNMC 3C1BB 2LY8A 5AVCD 3MGPD 3AZID 5JA4A 4Z2MG 5B0ZA 3REKD 4WV4B 5DNNC 1P3AA 2G5IC 3X1VA 1F66B 4KHAB 1KX3D 5B40D 5BO0A 5AVBD 1EQZA 1P3FD 3W98C 4YS3B 5JRGB 5AVBC 2Y2QA 4DRAA 3AZJA 2NZDD 4WJ3C 4J8UA 3EG5B 4DRBA 1M19C 5GSUA 1P3KB 3C1CC 2NZDC 2DQNC 4ZUXC 4KUDB 3AZGC 3AZMC 3RELB 3AZIB 3MGPB 4ZUXD 4QLCB 3UTBA 3WAAC 4H9NA 5B2JB 3WTPD 3B6FD 3X1UD 5AV8B 5AV9A 1Q9CA 3TU4B 2RIQA 5GXQB 4XZQA 1P3GA 1P3GD 3B0CT 3KFUG 4WU8A 4X23D 5AY8A 5AY8D 1KX4A 4KUDD 3WKJD 3AZMB 4G92C 1P3KA 3B6FA 4KUDC 4AWLB 5FUGB 3LJAB 3MNNB 3AZHB 5CPKA 5B2IA 3P5JB 5GT0D 3TU4C 3KWQA 1P34D 2JE5A 5B24B 1F66A 3KXBA 3VH5W 1U35C 1ZLAA 5B32G 4Z2MH 5JA4B 2BYMB 5AVCB 3X1TC 4WU9A 3AZGA 2J8PA 3KUYD 1HTAA 3B0DB 4J8UD 2YFVA 4CSRA 3W96A 2YFVB 1WWIA 3NQUA 1M1AD 3KUYC 2AROC 4UUZA 3WA9C 2ZY2A 1P3KC 2AROD 2IO5B 3AZJC 3AZLC 4UPKA 3AZKD 3R45A 5B32B 3MNNC 5B1LC 3AZLD 3AZKC 3AN2A 1P3LD 1ID3A 1AOIB 1F66C 3WKJA 1M1AB 2Y2MA 4E44A 3O62D 3V9RA 3MGSD 3AZNB 1TZYD 5BNVA 3UTBC 5GT3A 2W8SA 1TZYC 3AZFA 3W96C 5B32D 3AFAA 4WU8B 1KX4B 3MGRC 1P3FC 2Y2JA 3MGRD 1BH9A 3O62A 5CPJC 3AZMD 4ZBJB 3UTBB 3UT9D 5CP6A 3MVDA 3AZNC 5C3IC 2Y2GA 4WNNA 3WAAD 5B1MD 1P3PA 2Y2PA 5AVBA 1P3AD 5B40A 3AV1C 3X1VD 2BG1A 2FFFB 2FJ7A 2Y2IA 5C3IB 3AZJB 5DNNB 4LD9B 3X1VC 2BYKA 4J8VC 3WA9B 2HIOA 4H9SA 3WKJB 1AOIA 5AV6B 5BO0B 1EQZC 4ZUXB 4J8VD 5BNXA 3KXBD 3AYWA 3VH6A 2ZY3A 5F99A 3NQJA 1P3BD 1KX3A 3W97C 4J8XD 5AV9C 5B1LA 3AV2B 5AV8D 1P3BC 3X1SA 2G5HC 3X1SB 4H9OB 4YS3D 2PYOD 5AV8C 3B6GC 2CWEA 4H9PA 1KX5D 3LELD 1P3MB 1KX3B 5B33B 1M18B 3B6GD 4Z66A 5F99B 1KX5C 3A1IA 1A7WA 3RELD 4WU9C 1P3IB 4XUJB 5KDMA 3REHD 3A6NA 4H9QB 3KWQB 1T3UA 4CAYB 3C1BD 2F8NH 4LD9A 5CPKB 3WA9A 1BFMA 2RVQD 3LELB 1P3MD 2JCHA 3MGRB 5CPID 2RVQC 3X1SD 5AVBB 1P3MC 5FUGA 5B40B 3REJD 3X1SC 2YFWB 4YM6B 5B31G 4EO5C 1BH8B 3MVDB 4J8XA 4XZQB 2CV5A 3KWQC 3F6TA 1AOIC 3MGSA 4XUJC 3REKC 3VH5A 5DNND 1AOID 2FJ7D 4G91C 4JJNB 2FJ7C 1BH8A 3W99B 3LJAC 3REIA 3AZIA 3UTAB 2AROA 3EPLA 5GT3B 1P3PD 3KUYA 5E5AD 1M19D 1S32B 4E45A 1WWSA 4J8UB 5BNVB 5CP6C 1S32C 3AZGD 2Y2HA 5CHLB 5CP6D 4H9QA 1S32D 1EQZB 3AN2B 3A6NC 1HQ3B 4KHAA 5B31A 5B2ID 4R8PA 3W98A 3WTPC 5B2IC 1HQ3D 3AZHD 4UUZB 5DNMD 5DNMA 4G92B 3LZ1A 1TZYA 3AZFC 1ZLAC 1TZYB 3NQUB 3MGQD 3AZGB 4WU9B 4Z5TA 1P3IC 2BYMA 5B31D 4R8PD 4XZQD 1KX3C 4YM6C 5JRGC 3W98B 1ZLAB 2JSSA 4YM6D 2HIOB 1ULYA 3AZHA 3REJB 3AZLA 3LZ1D 5E5AA 3X1UA 3LELC 4JJND 2FJ7B 3WTPB 5B2JD 4WU8C 1KX4C 1KX5A 2Y2LA 3KUYB 3LZ0C 5GSUD 3C1CB 5G49B 4J8WC 4J8UC 3LZ0D 5GSUC 4EO5B 3MVDC 5AV5C 4J8WD 3AYWD 5B33D 1M18D 4KGCD 5CPIC 5GT0B 3TU4A 5AV5D 3AYWC 5CPIB 5B24C 3WTPE 1P3FA 3VH6T 1P3GC 3MNND 5GT0A 3FDDA 5CPKD 4H9NB 5B2JA 4HGAB 1P3LC 4J8XB 4QLCA 2NQBC 1KU5A 2XD5A 3LZ0B 3MGPA 1R4VA 2Y2KA 4AWLC 2CV5C 5B0YC 2YFWA 3AZFB 3B0DC 4J8VB 2CV5D 3VH5T 5F99C 5JRGA 3REHA 1KX5B 2PYOB 3X1UB 1ID3B 3REJA 3AV2D 3A6NB 5B40C 1ID3C 3AV2C 2F8ND 3W98D 5CPJD 4Z66B 1P3MA 3WA9D 1P3OB 3VH6W 3C1BA 4LD9D 3AZJD 5B1LB 3AV2A 3W97A 4LD9C 1P3FB 5B1MC 1HQ3C 3REID 3AYWB 3AL0C 5B0ZD 3REKA 5G49A 2ZY4A 5AVCC 3UT9B 5B0ZC 3X1TB 3MNNA 3KSYA 3LJAA 5B1MA 5B0YA 4H9SC 5AV5A 3W96D 3UTAC 3WKJC 1P3PB 5BT1D 3W97D 2NQBB 4NE6A 3UTAD 3UT9A 3B0CW 3AZLB 2HIOD 3W99A 3AV1B 4G91B 4JJNC 3AZEC 1Z2CB 2HIOC 4M6BA 3AZED 1TAFB 3MGSB 3AZND 1U35D 1BH9B 3O62B 2VQRA 2Y2NA 3REHC 3X1TD 4ZBJC 1N1JB 1P3OA 3MVDD 3C1BC 5DNMB 3RELA 3B6FC 4KUDA 3AV1D 3B6GA 3X1UC 5B24D 4Z5TC 5BS7C 2XD1A 4NE3A
chains in the Genus database with same CATH topology
5CPKC 4Z5TD 2IO5C 3V9RB 3AN2D 3MGQA 1P3LA 5B1LD 3KXBC 3AZEA 3AN2C 3REHB 4J8XC 1P3IA 1M19B 3EPHA 5B0ZB 5GT3D 1P3BA 5F99D 3UTAA 4YS3C 3B6GB 5B33A 1M18A 5GT3C 3REIB 3IP4C 4H9PB 5GT0C 3LZ0A 3TU4D 1N1JA 3H0MC 1JFIA 1ID3D 5B32C 4QLCC 3LJAD 4H9RA 2NZDA 1TAFA 4QLCD 3AZKA 5AV6C 2CV5B 3KXBB 1B67A 5BNXB 5CPJB 2ZY5A 5AV6D 4Z66C 3UT9C 2F8NB 4KGCA 2BYKB 4YM6A 3C1CA 1P3KD 1H3OA 4J8WA 5DNNA 3REJC 5GXQC 4DQYB 3AFAC 3B6FB 3REIC 2UWXA 5AV5B 5B1MB 4WZSB 4KGCB 1F66D 3H0RC 3WAAB 1H3OB 4J8WB 2HUEC 3KWQD 4WNNB 1P34A 1B6WA 3O62C 3AZFD 3MGSC 3REKB 4XUJD 4XUJA 5GXQA 1P3ID 3MGPC 3UTBD 4R8PC 5B31C 4XZQC 5BT1C 3H0LC 4H9RB 2NZDB 5JRGD 5BS7A 1JFIB 4Z5TB 2ZM5A 3LZ1B 5AV9D 1P3PC 3A1KA 3LZ1C 3AFAB 1P3BB 2PYOC 3NQJB 5B2JC 1M19A 5GSUB 3C1CD 4ZUXA 1HQ3A 5B31B 4R8PB 5AV6A 3EPKA 4YS3A 1U35B 4WU9D 1U35A 1M1AA 3MGQB 3AZEB 2PYOA 3X1VB 4HGAC 3EPJA 1P3AC 1P3LB 3AZHC 1S32A 1P3AB 4J8VA 1ZLAD 2AROB 3MGQC 1EQZD 4CSRB 5CP6B 3B0BA 4X23C 2L5AA 5AY8C 2F8NG 4JJNA 5B0YD 5AVCA 1PZRA 5CPIA 5B24A 1P34B 4X23A 3AV1A 4WU8D 1KX4D 3WAAA 5B2IB 1P34C 2Y2OA 4NE5A 2NQBA 1P3OC 3RELC 5B0YB 4NFTA 3AZMA 3MGRA 1P3OD 3AZNA 3X1TA 5E5AC 3WTPA 3LELA 2F8NK 2HUEB 2DF4C 2F8NA 5E5AB 5AY8B 5B33C 4CAYA 4Z66D 4X23B 1M18C 4KGCC 5CPJA 1P3GB 1M1AC 5KDMB 1W2EA 5GXQD 3W99D 3R45B 5B32A 3AFAD 1F1EA 2F2AC 3A6ND 3AZKB 5AV8A 5AV9B 3W99C 2NQBD 3W97B 3W96B 4H9OA 3AZIC 5DNMC 3C1BB 2LY8A 5AVCD 3MGPD 3AZID 5JA4A 4Z2MG 5B0ZA 3REKD 4WV4B 5DNNC 1P3AA 2G5IC 3X1VA 1F66B 4KHAB 1KX3D 5B40D 5BO0A 5AVBD 1EQZA 1P3FD 3W98C 4YS3B 5JRGB 5AVBC 2Y2QA 4DRAA 3AZJA 2NZDD 4WJ3C 4J8UA 3EG5B 4DRBA 1M19C 5GSUA 1P3KB 3C1CC 2NZDC 2DQNC 4ZUXC 4KUDB 3AZGC 3AZMC 3RELB 3AZIB 3MGPB 4ZUXD 4QLCB 3UTBA 3WAAC 4H9NA 5B2JB 3WTPD 3B6FD 3X1UD 5AV8B 5AV9A 1Q9CA 3TU4B 2RIQA 5GXQB 4XZQA 1P3GA 1P3GD 3B0CT 3KFUG 4WU8A 4X23D 5AY8A 5AY8D 1KX4A 4KUDD 3WKJD 3AZMB 4G92C 1P3KA 3B6FA 4KUDC 4AWLB 5FUGB 3LJAB 3MNNB 3AZHB 5CPKA 5B2IA 3P5JB 5GT0D 3TU4C 3KWQA 1P34D 2JE5A 5B24B 1F66A 3KXBA 3VH5W 1U35C 1ZLAA 5B32G 4Z2MH 5JA4B 2BYMB 5AVCB 3X1TC 4WU9A 3AZGA 2J8PA 3KUYD 1HTAA 3B0DB 4J8UD 2YFVA 4CSRA 3W96A 2YFVB 1WWIA 3NQUA 1M1AD 3KUYC 2AROC 4UUZA 3WA9C 2ZY2A 1P3KC 2AROD 2IO5B 3AZJC 3AZLC 4UPKA 3AZKD 3R45A 5B32B 3MNNC 5B1LC 3AZLD 3AZKC 3AN2A 1P3LD 1ID3A 1AOIB 1F66C 3WKJA 1M1AB 2Y2MA 4E44A 3O62D 3V9RA 3MGSD 3AZNB 1TZYD 5BNVA 3UTBC 5GT3A 2W8SA 1TZYC 3AZFA 3W96C 5B32D 3AFAA 4WU8B 1KX4B 3MGRC 1P3FC 2Y2JA 3MGRD 1BH9A 3O62A 5CPJC 3AZMD 4ZBJB 3UTBB 3UT9D 5CP6A 3MVDA 3AZNC 5C3IC 2Y2GA 4WNNA 3WAAD 5B1MD 1P3PA 2Y2PA 5AVBA 1P3AD 5B40A 3AV1C 3X1VD 2BG1A 2FFFB 2FJ7A 2Y2IA 5C3IB 3AZJB 5DNNB 4LD9B 3X1VC 2BYKA 4J8VC 3WA9B 2HIOA 4H9SA 3WKJB 1AOIA 5AV6B 5BO0B 1EQZC 4ZUXB 4J8VD 5BNXA 3KXBD 3AYWA 3VH6A 2ZY3A 5F99A 3NQJA 1P3BD 1KX3A 3W97C 4J8XD 5AV9C 5B1LA 3AV2B 5AV8D 1P3BC 3X1SA 2G5HC 3X1SB 4H9OB 4YS3D 2PYOD 5AV8C 3B6GC 2CWEA 4H9PA 1KX5D 3LELD 1P3MB 1KX3B 5B33B 1M18B 3B6GD 4Z66A 5F99B 1KX5C 3A1IA 1A7WA 3RELD 4WU9C 1P3IB 4XUJB 5KDMA 3REHD 3A6NA 4H9QB 3KWQB 1T3UA 4CAYB 3C1BD 2F8NH 4LD9A 5CPKB 3WA9A 1BFMA 2RVQD 3LELB 1P3MD 2JCHA 3MGRB 5CPID 2RVQC 3X1SD 5AVBB 1P3MC 5FUGA 5B40B 3REJD 3X1SC 2YFWB 4YM6B 5B31G 4EO5C 1BH8B 3MVDB 4J8XA 4XZQB 2CV5A 3KWQC 3F6TA 1AOIC 3MGSA 4XUJC 3REKC 3VH5A 5DNND 1AOID 2FJ7D 4G91C 4JJNB 2FJ7C 1BH8A 3W99B 3LJAC 3REIA 3AZIA 3UTAB 2AROA 3EPLA 5GT3B 1P3PD 3KUYA 5E5AD 1M19D 1S32B 4E45A 1WWSA 4J8UB 5BNVB 5CP6C 1S32C 3AZGD 2Y2HA 5CHLB 5CP6D 4H9QA 1S32D 1EQZB 3AN2B 3A6NC 1HQ3B 4KHAA 5B31A 5B2ID 4R8PA 3W98A 3WTPC 5B2IC 1HQ3D 3AZHD 4UUZB 5DNMD 5DNMA 4G92B 3LZ1A 1TZYA 3AZFC 1ZLAC 1TZYB 3NQUB 3MGQD 3AZGB 4WU9B 4Z5TA 1P3IC 2BYMA 5B31D 4R8PD 4XZQD 1KX3C 4YM6C 5JRGC 3W98B 1ZLAB 2JSSA 4YM6D 2HIOB 1ULYA 3AZHA 3REJB 3AZLA 3LZ1D 5E5AA 3X1UA 3LELC 4JJND 2FJ7B 3WTPB 5B2JD 4WU8C 1KX4C 1KX5A 2Y2LA 3KUYB 3LZ0C 5GSUD 3C1CB 5G49B 4J8WC 4J8UC 3LZ0D 5GSUC 4EO5B 3MVDC 5AV5C 4J8WD 3AYWD 5B33D 1M18D 4KGCD 5CPIC 5GT0B 3TU4A 5AV5D 3AYWC 5CPIB 5B24C 3WTPE 1P3FA 3VH6T 1P3GC 3MNND 5GT0A 3FDDA 5CPKD 4H9NB 5B2JA 4HGAB 1P3LC 4J8XB 4QLCA 2NQBC 1KU5A 2XD5A 3LZ0B 3MGPA 1R4VA 2Y2KA 4AWLC 2CV5C 5B0YC 2YFWA 3AZFB 3B0DC 4J8VB 2CV5D 3VH5T 5F99C 5JRGA 3REHA 1KX5B 2PYOB 3X1UB 1ID3B 3REJA 3AV2D 3A6NB 5B40C 1ID3C 3AV2C 2F8ND 3W98D 5CPJD 4Z66B 1P3MA 3WA9D 1P3OB 3VH6W 3C1BA 4LD9D 3AZJD 5B1LB 3AV2A 3W97A 4LD9C 1P3FB 5B1MC 1HQ3C 3REID 3AYWB 3AL0C 5B0ZD 3REKA 5G49A 2ZY4A 5AVCC 3UT9B 5B0ZC 3X1TB 3MNNA 3KSYA 3LJAA 5B1MA 5B0YA 4H9SC 5AV5A 3W96D 3UTAC 3WKJC 1P3PB 5BT1D 3W97D 2NQBB 4NE6A 3UTAD 3UT9A 3B0CW 3AZLB 2HIOD 3W99A 3AV1B 4G91B 4JJNC 3AZEC 1Z2CB 2HIOC 4M6BA 3AZED 1TAFB 3MGSB 3AZND 1U35D 1BH9B 3O62B 2VQRA 2Y2NA 3REHC 3X1TD 4ZBJC 1N1JB 1P3OA 3MVDD 3C1BC 5DNMB 3RELA 3B6FC 4KUDA 3AV1D 3B6GA 3X1UC 5B24D 4Z5TC 5BS7C 2XD1A 4NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPK C;  4Z5T D;  2IO5 C;  3V9R B;  3AN2 D;  3MGQ A;  1P3L A;  5B1L D;  3KXB C;  3AZE A;  3AN2 C;  3REH B;  4J8X C;  1P3I A;  1M19 B;  5B0Z B;  5GT3 D;  1P3B A;  5F99 D;  3UTA A;  4YS3 C;  3B6G B;  5B33 A;  1M18 A;  5GT3 C;  3REI B;  4H9P B;  5GT0 C;  3LZ0 A;  3TU4 D;  1N1J A;  1JFI A;  1ID3 D;  5B32 C;  4QLC C;  3LJA D;  4H9R A;  2NZD A;  1TAF A;  4QLC D;  3AZK A;  5AV6 C;  2CV5 B;  3KXB B;  1B67 A;  5BNX B;  5CPJ B;  5AV6 D;  4Z66 C;  3UT9 C;  2F8N B;  4KGC A;  2BYK B;  4YM6 A;  3C1C A;  1P3K D;  1H3O A;  4J8W A;  5DNN A;  3REJ C;  5GXQ C;  3AFA C;  3B6F B;  3REI C;  5AV5 B;  5B1M B;  4WZS B;  4KGC B;  1F66 D;  3WAA B;  1H3O B;  4J8W B;  2HUE C;  3KWQ D;  4WNN B;  1P34 A;  1B6W A;  3O62 C;  3AZF D;  3MGS C;  3REK B;  4XUJ D;  4XUJ A;  5GXQ A;  1P3I D;  3MGP C;  3UTB D;  4R8P C;  5B31 C;  4XZQ C;  5BT1 C;  4H9R B;  2NZD B;  5JRG D;  5BS7 A;  1JFI B;  4Z5T B;  3LZ1 B;  5AV9 D;  1P3P C;  3LZ1 C;  3AFA B;  1P3B B;  2PYO C;  3NQJ B;  5B2J C;  1M19 A;  5GSU B;  3C1C D;  4ZUX A;  1HQ3 A;  5B31 B;  4R8P B;  5AV6 A;  4YS3 A;  1U35 B;  4WU9 D;  1U35 A;  1M1A A;  3MGQ B;  3AZE B;  2PYO A;  3X1V B;  4HGA C;  1P3L B;  1P3A C;  3AZH C;  1S32 A;  1P3A B;  4J8V A;  1ZLA D;  2ARO B;  3MGQ C;  1EQZ D;  4CSR B;  5CP6 B;  4X23 C;  3B0B A;  2L5A A;  5AY8 C;  2F8N G;  4JJN A;  5B0Y D;  5AVC A;  5CPI A;  5B24 A;  1P34 B;  4X23 A;  3AV1 A;  4WU8 D;  1KX4 D;  3WAA A;  5B2I B;  1P34 C;  4NE5 A;  2NQB A;  1P3O C;  3REL C;  5B0Y B;  4NFT A;  3AZM A;  3MGR A;  1P3O D;  3AZN A;  3X1T A;  5E5A C;  3WTP A;  3LEL A;  2F8N K;  2HUE B;  2F8N A;  5E5A B;  5AY8 B;  5B33 C;  4CAY A;  4Z66 D;  4X23 B;  1M18 C;  4KGC C;  5CPJ A;  1P3G B;  1M1A C;  5KDM B;  5GXQ D;  3W99 D;  3R45 B;  5B32 A;  3AFA D;  1F1E A;  3AZK B;  3A6N D;  5AV8 A;  5AV9 B;  3W99 C;  2NQB D;  3W97 B;  3W96 B;  4H9O A;  3AZI C;  5DNM C;  3C1B B;  2LY8 A;  5AVC D;  3MGP D;  3AZI D;  5JA4 A;  4Z2M G;  5B0Z A;  3REK D;  4WV4 B;  5DNN C;  1P3A A;  3X1V A;  1F66 B;  4KHA B;  1KX3 D;  5B40 D;  5BO0 A;  5AVB D;  1EQZ A;  1P3F D;  3W98 C;  4YS3 B;  5JRG B;  5AVB C;  4DRA A;  3AZJ A;  2NZD D;  4J8U A;  4DRB A;  1M19 C;  5GSU A;  1P3K B;  3C1C C;  2NZD C;  4ZUX C;  4KUD B;  3AZG C;  3AZM C;  3REL B;  3AZI B;  3MGP B;  4ZUX D;  4QLC B;  3UTB A;  3WAA C;  4H9N A;  5B2J B;  3WTP D;  3B6F D;  3X1U D;  5AV8 B;  5AV9 A;  1Q9C A;  3TU4 B;  5GXQ B;  4XZQ A;  1P3G A;  1P3G D;  3B0C T;  4X23 D;  4WU8 A;  5AY8 A;  5AY8 D;  1KX4 A;  4KUD D;  3WKJ D;  3AZM B;  4G92 C;  1P3K A;  3B6F A;  4KUD C;  4AWL B;  5FUG B;  3LJA B;  3MNN B;  3AZH B;  5CPK A;  5B2I A;  5GT0 D;  3TU4 C;  3KWQ A;  1P34 D;  5B24 B;  1F66 A;  3KXB A;  3VH5 W;  1U35 C;  1ZLA A;  5B32 G;  4Z2M H;  5JA4 B;  2BYM B;  5AVC B;  3X1T C;  4WU9 A;  3AZG A;  3KUY D;  1HTA A;  3B0D B;  4J8U D;  2YFV A;  4CSR A;  3W96 A;  2YFV B;  1WWI A;  3NQU A;  1M1A D;  3KUY C;  2ARO C;  4UUZ A;  3WA9 C;  1P3K C;  2ARO D;  2IO5 B;  3AZJ C;  3AZL C;  3AZK D;  3R45 A;  5B32 B;  3MNN C;  5B1L C;  3AZL D;  3AZK C;  3AN2 A;  1P3L D;  1ID3 A;  1AOI B;  1F66 C;  3WKJ A;  1M1A B;  4E44 A;  3O62 D;  3V9R A;  3MGS D;  3AZN B;  1TZY D;  5BNV A;  3UTB C;  5GT3 A;  1TZY C;  3AZF A;  3W96 C;  5B32 D;  3AFA A;  4WU8 B;  1KX4 B;  3MGR C;  1P3F C;  3MGR D;  1BH9 A;  3O62 A;  5CPJ C;  3AZM D;  4ZBJ B;  3UTB B;  3UT9 D;  5CP6 A;  3MVD A;  3AZN C;  5C3I C;  4WNN A;  3WAA D;  5B1M D;  1P3P A;  5AVB A;  1P3A D;  5B40 A;  3AV1 C;  3X1V D;  2FJ7 A;  5C3I B;  3AZJ B;  5DNN B;  4LD9 B;  3X1V C;  2BYK A;  4J8V C;  3WA9 B;  2HIO A;  4H9S A;  3WKJ B;  1AOI A;  5AV6 B;  5BO0 B;  1EQZ C;  4ZUX B;  4J8V D;  5BNX A;  3KXB D;  3AYW A;  3VH6 A;  5F99 A;  3NQJ A;  1P3B D;  1KX3 A;  3W97 C;  4J8X D;  5AV9 C;  5B1L A;  3AV2 B;  5AV8 D;  1P3B C;  3X1S A;  3X1S B;  4H9O B;  4YS3 D;  2PYO D;  5AV8 C;  3B6G C;  2CWE A;  4H9P A;  1KX5 D;  3LEL D;  1P3M B;  1KX3 B;  5B33 B;  1M18 B;  3B6G D;  4Z66 A;  5F99 B;  1KX5 C;  1A7W A;  3REL D;  4WU9 C;  1P3I B;  4XUJ B;  5KDM A;  3REH D;  3A6N A;  4H9Q B;  3KWQ B;  3C1B D;  4CAY B;  2F8N H;  4LD9 A;  5CPK B;  3WA9 A;  1BFM A;  2RVQ D;  3LEL B;  1P3M D;  3MGR B;  5CPI D;  2RVQ C;  3X1S D;  5AVB B;  1P3M C;  5FUG A;  5B40 B;  3REJ D;  3X1S C;  2YFW B;  4YM6 B;  5B31 G;  4EO5 C;  1BH8 B;  3MVD B;  4J8X A;  4XZQ B;  2CV5 A;  3KWQ C;  1AOI C;  3MGS A;  4XUJ C;  3REK C;  3VH5 A;  5DNN D;  1AOI D;  2FJ7 D;  4G91 C;  4JJN B;  2FJ7 C;  1BH8 A;  3W99 B;  3LJA C;  3REI A;  3AZI A;  3UTA B;  2ARO A;  5GT3 B;  1P3P D;  3KUY A;  5E5A D;  1M19 D;  1S32 B;  4E45 A;  1WWS A;  4J8U B;  5BNV B;  5CP6 C;  1S32 C;  3AZG D;  5CHL B;  5CP6 D;  4H9Q A;  1S32 D;  1EQZ B;  3AN2 B;  3A6N C;  1HQ3 B;  4KHA A;  5B31 A;  5B2I D;  4R8P A;  3W98 A;  3WTP C;  5B2I C;  1HQ3 D;  3AZH D;  4UUZ B;  5DNM D;  5DNM A;  4G92 B;  3LZ1 A;  1TZY A;  3AZF C;  1ZLA C;  1TZY B;  3NQU B;  3MGQ D;  3AZG B;  4WU9 B;  4Z5T A;  1P3I C;  2BYM A;  4R8P D;  5B31 D;  4XZQ D;  1KX3 C;  4YM6 C;  5JRG C;  3W98 B;  1ZLA B;  2JSS A;  4YM6 D;  2HIO B;  1ULY A;  3AZH A;  3REJ B;  3AZL A;  3LZ1 D;  5E5A A;  3X1U A;  3LEL C;  4JJN D;  2FJ7 B;  3WTP B;  5B2J D;  4WU8 C;  1KX4 C;  1KX5 A;  3KUY B;  3LZ0 C;  5GSU D;  3C1C B;  5G49 B;  4J8W C;  4J8U C;  3LZ0 D;  5GSU C;  4EO5 B;  3MVD C;  5AV5 C;  4J8W D;  3AYW D;  5B33 D;  1M18 D;  4KGC D;  5CPI C;  5GT0 B;  3TU4 A;  5AV5 D;  3AYW C;  5CPI B;  5B24 C;  3WTP E;  1P3F A;  3VH6 T;  1P3G C;  3MNN D;  5GT0 A;  5CPK D;  4H9N B;  5B2J A;  4HGA B;  1P3L C;  4J8X B;  4QLC A;  2NQB C;  1KU5 A;  3MGP A;  3LZ0 B;  1R4V A;  4AWL C;  2CV5 C;  5B0Y C;  2YFW A;  3AZF B;  3B0D C;  4J8V B;  2CV5 D;  3VH5 T;  5F99 C;  5JRG A;  3REH A;  1KX5 B;  2PYO B;  3X1U B;  1ID3 B;  3REJ A;  3AV2 D;  3A6N B;  5B40 C;  1ID3 C;  3AV2 C;  2F8N D;  3W98 D;  5CPJ D;  4Z66 B;  1P3M A;  3WA9 D;  1P3O B;  3VH6 W;  3C1B A;  4LD9 D;  3AZJ D;  5B1L B;  3AV2 A;  3W97 A;  4LD9 C;  1P3F B;  5B1M C;  1HQ3 C;  3REI D;  3AYW B;  5B0Z D;  3REK A;  5G49 A;  5AVC C;  3UT9 B;  5B0Z C;  3X1T B;  3MNN A;  3KSY A;  3LJA A;  5B1M A;  5B0Y A;  4H9S C;  5AV5 A;  3W96 D;  3UTA C;  3WKJ C;  1P3P B;  5BT1 D;  3W97 D;  2NQB B;  4NE6 A;  3UTA D;  3UT9 A;  3B0C W;  3AZL B;  2HIO D;  3W99 A;  3AV1 B;  4G91 B;  4JJN C;  3AZE C;  2HIO C;  4M6B A;  3AZE D;  1TAF B;  3MGS B;  3AZN D;  1U35 D;  1BH9 B;  3O62 B;  3REH C;  3X1T D;  4ZBJ C;  1N1J B;  1P3O A;  3MVD D;  3C1B C;  5DNM B;  3REL A;  3B6F C;  4KUD A;  3AV1 D;  3B6G A;  3X1U C;  5B24 D;  4Z5T C;  5BS7 C;  4NE3 A; 
#chains in the Genus database with same CATH topology
 5CPK C;  4Z5T D;  2IO5 C;  3V9R B;  3AN2 D;  3MGQ A;  1P3L A;  5B1L D;  3KXB C;  3AZE A;  3AN2 C;  3REH B;  4J8X C;  1P3I A;  1M19 B;  3EPH A;  5B0Z B;  5GT3 D;  1P3B A;  5F99 D;  3UTA A;  4YS3 C;  3B6G B;  5B33 A;  1M18 A;  5GT3 C;  3REI B;  3IP4 C;  4H9P B;  5GT0 C;  3LZ0 A;  3TU4 D;  1N1J A;  3H0M C;  1JFI A;  1ID3 D;  5B32 C;  4QLC C;  3LJA D;  4H9R A;  2NZD A;  1TAF A;  4QLC D;  3AZK A;  5AV6 C;  2CV5 B;  3KXB B;  1B67 A;  5BNX B;  5CPJ B;  2ZY5 A;  5AV6 D;  4Z66 C;  3UT9 C;  2F8N B;  4KGC A;  2BYK B;  4YM6 A;  3C1C A;  1P3K D;  1H3O A;  4J8W A;  5DNN A;  3REJ C;  5GXQ C;  4DQY B;  3AFA C;  3B6F B;  3REI C;  2UWX A;  5AV5 B;  5B1M B;  4WZS B;  4KGC B;  1F66 D;  3H0R C;  3WAA B;  1H3O B;  4J8W B;  2HUE C;  3KWQ D;  4WNN B;  1P34 A;  1B6W A;  3O62 C;  3AZF D;  3MGS C;  3REK B;  4XUJ D;  4XUJ A;  5GXQ A;  1P3I D;  3MGP C;  3UTB D;  4R8P C;  5B31 C;  4XZQ C;  5BT1 C;  3H0L C;  4H9R B;  2NZD B;  5JRG D;  5BS7 A;  1JFI B;  4Z5T B;  2ZM5 A;  3LZ1 B;  5AV9 D;  1P3P C;  3A1K A;  3LZ1 C;  3AFA B;  1P3B B;  2PYO C;  3NQJ B;  5B2J C;  1M19 A;  5GSU B;  3C1C D;  4ZUX A;  1HQ3 A;  5B31 B;  4R8P B;  5AV6 A;  3EPK A;  4YS3 A;  1U35 B;  4WU9 D;  1U35 A;  1M1A A;  3MGQ B;  3AZE B;  2PYO A;  3X1V B;  4HGA C;  3EPJ A;  1P3A C;  1P3L B;  3AZH C;  1S32 A;  1P3A B;  4J8V A;  1ZLA D;  2ARO B;  3MGQ C;  1EQZ D;  4CSR B;  5CP6 B;  3B0B A;  4X23 C;  2L5A A;  5AY8 C;  2F8N G;  4JJN A;  5B0Y D;  5AVC A;  1PZR A;  5CPI A;  5B24 A;  1P34 B;  4X23 A;  3AV1 A;  4WU8 D;  1KX4 D;  3WAA A;  5B2I B;  1P34 C;  2Y2O A;  4NE5 A;  2NQB A;  1P3O C;  3REL C;  5B0Y B;  4NFT A;  3AZM A;  3MGR A;  1P3O D;  3AZN A;  3X1T A;  5E5A C;  3WTP A;  3LEL A;  2F8N K;  2HUE B;  2DF4 C;  2F8N A;  5E5A B;  5AY8 B;  5B33 C;  4CAY A;  4Z66 D;  4X23 B;  1M18 C;  4KGC C;  5CPJ A;  1P3G B;  1M1A C;  5KDM B;  1W2E A;  5GXQ D;  3W99 D;  3R45 B;  5B32 A;  3AFA D;  1F1E A;  2F2A C;  3A6N D;  3AZK B;  5AV8 A;  5AV9 B;  3W99 C;  2NQB D;  3W97 B;  3W96 B;  4H9O A;  3AZI C;  5DNM C;  3C1B B;  2LY8 A;  5AVC D;  3MGP D;  3AZI D;  5JA4 A;  4Z2M G;  5B0Z A;  3REK D;  4WV4 B;  5DNN C;  1P3A A;  2G5I C;  3X1V A;  1F66 B;  4KHA B;  1KX3 D;  5B40 D;  5BO0 A;  5AVB D;  1EQZ A;  1P3F D;  3W98 C;  4YS3 B;  5JRG B;  5AVB C;  2Y2Q A;  4DRA A;  3AZJ A;  2NZD D;  4WJ3 C;  4J8U A;  3EG5 B;  4DRB A;  1M19 C;  5GSU A;  1P3K B;  3C1C C;  2NZD C;  2DQN C;  4ZUX C;  4KUD B;  3AZG C;  3AZM C;  3REL B;  3AZI B;  3MGP B;  4ZUX D;  4QLC B;  3UTB A;  3WAA C;  4H9N A;  5B2J B;  3WTP D;  3B6F D;  3X1U D;  5AV8 B;  5AV9 A;  1Q9C A;  3TU4 B;  2RIQ A;  5GXQ B;  4XZQ A;  1P3G A;  1P3G D;  3B0C T;  3KFU G;  4WU8 A;  4X23 D;  5AY8 A;  5AY8 D;  1KX4 A;  4KUD D;  3WKJ D;  3AZM B;  4G92 C;  1P3K A;  3B6F A;  4KUD C;  4AWL B;  5FUG B;  3LJA B;  3MNN B;  3AZH B;  5CPK A;  5B2I A;  3P5J B;  5GT0 D;  3TU4 C;  3KWQ A;  1P34 D;  2JE5 A;  5B24 B;  1F66 A;  3KXB A;  3VH5 W;  1U35 C;  1ZLA A;  5B32 G;  4Z2M H;  5JA4 B;  2BYM B;  5AVC B;  3X1T C;  4WU9 A;  3AZG A;  2J8P A;  3KUY D;  1HTA A;  3B0D B;  4J8U D;  2YFV A;  4CSR A;  3W96 A;  2YFV B;  1WWI A;  3NQU A;  1M1A D;  3KUY C;  2ARO C;  4UUZ A;  3WA9 C;  2ZY2 A;  1P3K C;  2ARO D;  2IO5 B;  3AZJ C;  3AZL C;  4UPK A;  3AZK D;  3R45 A;  5B32 B;  3MNN C;  5B1L C;  3AZL D;  3AZK C;  3AN2 A;  1P3L D;  1ID3 A;  1AOI B;  1F66 C;  3WKJ A;  1M1A B;  2Y2M A;  4E44 A;  3O62 D;  3V9R A;  3MGS D;  3AZN B;  1TZY D;  5BNV A;  3UTB C;  5GT3 A;  2W8S A;  1TZY C;  3AZF A;  3W96 C;  5B32 D;  3AFA A;  4WU8 B;  1KX4 B;  3MGR C;  1P3F C;  2Y2J A;  3MGR D;  1BH9 A;  3O62 A;  5CPJ C;  3AZM D;  4ZBJ B;  3UTB B;  3UT9 D;  5CP6 A;  3MVD A;  3AZN C;  5C3I C;  2Y2G A;  4WNN A;  3WAA D;  5B1M D;  1P3P A;  2Y2P A;  5AVB A;  1P3A D;  5B40 A;  3AV1 C;  3X1V D;  2BG1 A;  2FFF B;  2FJ7 A;  2Y2I A;  5C3I B;  3AZJ B;  5DNN B;  4LD9 B;  3X1V C;  2BYK A;  4J8V C;  3WA9 B;  2HIO A;  4H9S A;  3WKJ B;  1AOI A;  5AV6 B;  5BO0 B;  1EQZ C;  4ZUX B;  4J8V D;  5BNX A;  3KXB D;  3AYW A;  3VH6 A;  2ZY3 A;  5F99 A;  3NQJ A;  1P3B D;  1KX3 A;  3W97 C;  4J8X D;  5AV9 C;  5B1L A;  3AV2 B;  5AV8 D;  1P3B C;  3X1S A;  2G5H C;  3X1S B;  4H9O B;  4YS3 D;  2PYO D;  5AV8 C;  3B6G C;  2CWE A;  4H9P A;  1KX5 D;  3LEL D;  1P3M B;  1KX3 B;  5B33 B;  1M18 B;  3B6G D;  4Z66 A;  5F99 B;  1KX5 C;  3A1I A;  1A7W A;  3REL D;  4WU9 C;  1P3I B;  4XUJ B;  5KDM A;  3REH D;  3A6N A;  4H9Q B;  3KWQ B;  1T3U A;  4CAY B;  3C1B D;  2F8N H;  4LD9 A;  5CPK B;  3WA9 A;  1BFM A;  2RVQ D;  3LEL B;  1P3M D;  2JCH A;  3MGR B;  5CPI D;  2RVQ C;  3X1S D;  5AVB B;  1P3M C;  5FUG A;  5B40 B;  3REJ D;  3X1S C;  2YFW B;  4YM6 B;  5B31 G;  4EO5 C;  1BH8 B;  3MVD B;  4J8X A;  4XZQ B;  2CV5 A;  3KWQ C;  3F6T A;  1AOI C;  3MGS A;  4XUJ C;  3REK C;  3VH5 A;  5DNN D;  1AOI D;  2FJ7 D;  4G91 C;  4JJN B;  2FJ7 C;  1BH8 A;  3W99 B;  3LJA C;  3REI A;  3AZI A;  3UTA B;  2ARO A;  3EPL A;  5GT3 B;  1P3P D;  3KUY A;  5E5A D;  1M19 D;  1S32 B;  4E45 A;  1WWS A;  4J8U B;  5BNV B;  5CP6 C;  1S32 C;  3AZG D;  2Y2H A;  5CHL B;  5CP6 D;  4H9Q A;  1S32 D;  1EQZ B;  3AN2 B;  3A6N C;  1HQ3 B;  4KHA A;  5B31 A;  5B2I D;  4R8P A;  3W98 A;  3WTP C;  5B2I C;  1HQ3 D;  3AZH D;  4UUZ B;  5DNM D;  5DNM A;  4G92 B;  3LZ1 A;  1TZY A;  3AZF C;  1ZLA C;  1TZY B;  3NQU B;  3MGQ D;  3AZG B;  4WU9 B;  4Z5T A;  1P3I C;  2BYM A;  5B31 D;  4R8P D;  4XZQ D;  1KX3 C;  4YM6 C;  5JRG C;  3W98 B;  1ZLA B;  2JSS A;  4YM6 D;  2HIO B;  1ULY A;  3AZH A;  3REJ B;  3AZL A;  3LZ1 D;  5E5A A;  3X1U A;  3LEL C;  4JJN D;  2FJ7 B;  3WTP B;  5B2J D;  4WU8 C;  1KX4 C;  1KX5 A;  2Y2L A;  3KUY B;  3LZ0 C;  5GSU D;  3C1C B;  5G49 B;  4J8W C;  4J8U C;  3LZ0 D;  5GSU C;  4EO5 B;  3MVD C;  5AV5 C;  4J8W D;  3AYW D;  5B33 D;  1M18 D;  4KGC D;  5CPI C;  5GT0 B;  3TU4 A;  5AV5 D;  3AYW C;  5CPI B;  5B24 C;  3WTP E;  1P3F A;  3VH6 T;  1P3G C;  3MNN D;  5GT0 A;  3FDD A;  5CPK D;  4H9N B;  5B2J A;  4HGA B;  1P3L C;  4J8X B;  4QLC A;  2NQB C;  1KU5 A;  2XD5 A;  3LZ0 B;  3MGP A;  1R4V A;  2Y2K A;  4AWL C;  2CV5 C;  5B0Y C;  2YFW A;  3AZF B;  3B0D C;  4J8V B;  2CV5 D;  3VH5 T;  5F99 C;  5JRG A;  3REH A;  1KX5 B;  2PYO B;  3X1U B;  1ID3 B;  3REJ A;  3AV2 D;  3A6N B;  5B40 C;  1ID3 C;  3AV2 C;  2F8N D;  3W98 D;  5CPJ D;  4Z66 B;  1P3M A;  3WA9 D;  1P3O B;  3VH6 W;  3C1B A;  4LD9 D;  3AZJ D;  5B1L B;  3AV2 A;  3W97 A;  4LD9 C;  1P3F B;  5B1M C;  1HQ3 C;  3REI D;  3AYW B;  3AL0 C;  5B0Z D;  3REK A;  5G49 A;  2ZY4 A;  5AVC C;  3UT9 B;  5B0Z C;  3X1T B;  3MNN A;  3KSY A;  3LJA A;  5B1M A;  5B0Y A;  4H9S C;  5AV5 A;  3W96 D;  3UTA C;  3WKJ C;  1P3P B;  5BT1 D;  3W97 D;  2NQB B;  4NE6 A;  3UTA D;  3UT9 A;  3B0C W;  3AZL B;  2HIO D;  3W99 A;  3AV1 B;  4G91 B;  4JJN C;  3AZE C;  1Z2C B;  2HIO C;  4M6B A;  3AZE D;  1TAF B;  3MGS B;  3AZN D;  1U35 D;  1BH9 B;  3O62 B;  2VQR A;  2Y2N A;  3REH C;  3X1T D;  4ZBJ C;  1N1J B;  1P3O A;  3MVD D;  3C1B C;  5DNM B;  3REL A;  3B6F C;  4KUD A;  3AV1 D;  3B6G A;  3X1U C;  5B24 D;  4Z5T C;  5BS7 C;  2XD1 A;  4NE3 A; 
#chains in the Genus database with same CATH homology
 5CPK C;  4Z5T D;  2IO5 C;  3V9R B;  3AN2 D;  3MGQ A;  1P3L A;  5B1L D;  3KXB C;  3AZE A;  3AN2 C;  3REH B;  4J8X C;  1P3I A;  1M19 B;  3EPH A;  5B0Z B;  5GT3 D;  1P3B A;  5F99 D;  3UTA A;  4YS3 C;  3B6G B;  5B33 A;  1M18 A;  5GT3 C;  3REI B;  3IP4 C;  4H9P B;  5GT0 C;  3LZ0 A;  3TU4 D;  1N1J A;  3H0M C;  1JFI A;  1ID3 D;  5B32 C;  4QLC C;  3LJA D;  4H9R A;  2NZD A;  1TAF A;  4QLC D;  3AZK A;  5AV6 C;  2CV5 B;  3KXB B;  1B67 A;  5BNX B;  5CPJ B;  2ZY5 A;  5AV6 D;  4Z66 C;  3UT9 C;  2F8N B;  4KGC A;  2BYK B;  4YM6 A;  3C1C A;  1P3K D;  1H3O A;  4J8W A;  5DNN A;  3REJ C;  5GXQ C;  4DQY B;  3AFA C;  3B6F B;  3REI C;  2UWX A;  5AV5 B;  5B1M B;  4WZS B;  4KGC B;  1F66 D;  3H0R C;  3WAA B;  1H3O B;  4J8W B;  2HUE C;  3KWQ D;  4WNN B;  1P34 A;  1B6W A;  3O62 C;  3AZF D;  3MGS C;  3REK B;  4XUJ D;  4XUJ A;  5GXQ A;  1P3I D;  3MGP C;  3UTB D;  4R8P C;  5B31 C;  4XZQ C;  5BT1 C;  3H0L C;  4H9R B;  2NZD B;  5JRG D;  5BS7 A;  1JFI B;  4Z5T B;  2ZM5 A;  3LZ1 B;  5AV9 D;  1P3P C;  3A1K A;  3LZ1 C;  3AFA B;  1P3B B;  2PYO C;  3NQJ B;  5B2J C;  1M19 A;  5GSU B;  3C1C D;  4ZUX A;  1HQ3 A;  5B31 B;  4R8P B;  5AV6 A;  3EPK A;  4YS3 A;  1U35 B;  4WU9 D;  1U35 A;  1M1A A;  3MGQ B;  3AZE B;  2PYO A;  3X1V B;  4HGA C;  3EPJ A;  1P3A C;  1P3L B;  3AZH C;  1S32 A;  1P3A B;  4J8V A;  1ZLA D;  2ARO B;  3MGQ C;  1EQZ D;  4CSR B;  5CP6 B;  3B0B A;  4X23 C;  2L5A A;  5AY8 C;  2F8N G;  4JJN A;  5B0Y D;  5AVC A;  1PZR A;  5CPI A;  5B24 A;  1P34 B;  4X23 A;  3AV1 A;  4WU8 D;  1KX4 D;  3WAA A;  5B2I B;  1P34 C;  2Y2O A;  4NE5 A;  2NQB A;  1P3O C;  3REL C;  5B0Y B;  4NFT A;  3AZM A;  3MGR A;  1P3O D;  3AZN A;  3X1T A;  5E5A C;  3WTP A;  3LEL A;  2F8N K;  2HUE B;  2DF4 C;  2F8N A;  5E5A B;  5AY8 B;  5B33 C;  4CAY A;  4Z66 D;  4X23 B;  1M18 C;  4KGC C;  5CPJ A;  1P3G B;  1M1A C;  5KDM B;  1W2E A;  5GXQ D;  3W99 D;  3R45 B;  5B32 A;  3AFA D;  1F1E A;  2F2A C;  3A6N D;  3AZK B;  5AV8 A;  5AV9 B;  3W99 C;  2NQB D;  3W97 B;  3W96 B;  4H9O A;  3AZI C;  5DNM C;  3C1B B;  2LY8 A;  5AVC D;  3MGP D;  3AZI D;  5JA4 A;  4Z2M G;  5B0Z A;  3REK D;  4WV4 B;  5DNN C;  1P3A A;  2G5I C;  3X1V A;  1F66 B;  4KHA B;  1KX3 D;  5B40 D;  5BO0 A;  5AVB D;  1EQZ A;  1P3F D;  3W98 C;  4YS3 B;  5JRG B;  5AVB C;  2Y2Q A;  4DRA A;  3AZJ A;  2NZD D;  4WJ3 C;  4J8U A;  3EG5 B;  4DRB A;  1M19 C;  5GSU A;  1P3K B;  3C1C C;  2NZD C;  2DQN C;  4ZUX C;  4KUD B;  3AZG C;  3AZM C;  3REL B;  3AZI B;  3MGP B;  4ZUX D;  4QLC B;  3UTB A;  3WAA C;  4H9N A;  5B2J B;  3WTP D;  3B6F D;  3X1U D;  5AV8 B;  5AV9 A;  1Q9C A;  3TU4 B;  2RIQ A;  5GXQ B;  4XZQ A;  1P3G A;  1P3G D;  3B0C T;  3KFU G;  4WU8 A;  4X23 D;  5AY8 A;  5AY8 D;  1KX4 A;  4KUD D;  3WKJ D;  3AZM B;  4G92 C;  1P3K A;  3B6F A;  4KUD C;  4AWL B;  5FUG B;  3LJA B;  3MNN B;  3AZH B;  5CPK A;  5B2I A;  3P5J B;  5GT0 D;  3TU4 C;  3KWQ A;  1P34 D;  2JE5 A;  5B24 B;  1F66 A;  3KXB A;  3VH5 W;  1U35 C;  1ZLA A;  5B32 G;  4Z2M H;  5JA4 B;  2BYM B;  5AVC B;  3X1T C;  4WU9 A;  3AZG A;  2J8P A;  3KUY D;  1HTA A;  3B0D B;  4J8U D;  2YFV A;  4CSR A;  3W96 A;  2YFV B;  1WWI A;  3NQU A;  1M1A D;  3KUY C;  2ARO C;  4UUZ A;  3WA9 C;  2ZY2 A;  1P3K C;  2ARO D;  2IO5 B;  3AZJ C;  3AZL C;  4UPK A;  3AZK D;  3R45 A;  5B32 B;  3MNN C;  5B1L C;  3AZL D;  3AZK C;  3AN2 A;  1P3L D;  1ID3 A;  1AOI B;  1F66 C;  3WKJ A;  1M1A B;  2Y2M A;  4E44 A;  3O62 D;  3V9R A;  3MGS D;  3AZN B;  1TZY D;  5BNV A;  3UTB C;  5GT3 A;  2W8S A;  1TZY C;  3AZF A;  3W96 C;  5B32 D;  3AFA A;  4WU8 B;  1KX4 B;  3MGR C;  1P3F C;  2Y2J A;  3MGR D;  1BH9 A;  3O62 A;  5CPJ C;  3AZM D;  4ZBJ B;  3UTB B;  3UT9 D;  5CP6 A;  3MVD A;  3AZN C;  5C3I C;  2Y2G A;  4WNN A;  3WAA D;  5B1M D;  1P3P A;  2Y2P A;  5AVB A;  1P3A D;  5B40 A;  3AV1 C;  3X1V D;  2BG1 A;  2FFF B;  2FJ7 A;  2Y2I A;  5C3I B;  3AZJ B;  5DNN B;  4LD9 B;  3X1V C;  2BYK A;  4J8V C;  3WA9 B;  2HIO A;  4H9S A;  3WKJ B;  1AOI A;  5AV6 B;  5BO0 B;  1EQZ C;  4ZUX B;  4J8V D;  5BNX A;  3KXB D;  3AYW A;  3VH6 A;  2ZY3 A;  5F99 A;  3NQJ A;  1P3B D;  1KX3 A;  3W97 C;  4J8X D;  5AV9 C;  5B1L A;  3AV2 B;  5AV8 D;  1P3B C;  3X1S A;  2G5H C;  3X1S B;  4H9O B;  4YS3 D;  2PYO D;  5AV8 C;  3B6G C;  2CWE A;  4H9P A;  1KX5 D;  3LEL D;  1P3M B;  1KX3 B;  5B33 B;  1M18 B;  3B6G D;  4Z66 A;  5F99 B;  1KX5 C;  3A1I A;  1A7W A;  3REL D;  4WU9 C;  1P3I B;  4XUJ B;  5KDM A;  3REH D;  3A6N A;  4H9Q B;  3KWQ B;  1T3U A;  4CAY B;  3C1B D;  2F8N H;  4LD9 A;  5CPK B;  3WA9 A;  1BFM A;  2RVQ D;  3LEL B;  1P3M D;  2JCH A;  3MGR B;  5CPI D;  2RVQ C;  3X1S D;  5AVB B;  1P3M C;  5FUG A;  5B40 B;  3REJ D;  3X1S C;  2YFW B;  4YM6 B;  5B31 G;  4EO5 C;  1BH8 B;  3MVD B;  4J8X A;  4XZQ B;  2CV5 A;  3KWQ C;  3F6T A;  1AOI C;  3MGS A;  4XUJ C;  3REK C;  3VH5 A;  5DNN D;  1AOI D;  2FJ7 D;  4G91 C;  4JJN B;  2FJ7 C;  1BH8 A;  3W99 B;  3LJA C;  3REI A;  3AZI A;  3UTA B;  2ARO A;  3EPL A;  5GT3 B;  1P3P D;  3KUY A;  5E5A D;  1M19 D;  1S32 B;  4E45 A;  1WWS A;  4J8U B;  5BNV B;  5CP6 C;  1S32 C;  3AZG D;  2Y2H A;  5CHL B;  5CP6 D;  4H9Q A;  1S32 D;  1EQZ B;  3AN2 B;  3A6N C;  1HQ3 B;  4KHA A;  5B31 A;  5B2I D;  4R8P A;  3W98 A;  3WTP C;  5B2I C;  1HQ3 D;  3AZH D;  4UUZ B;  5DNM D;  5DNM A;  4G92 B;  3LZ1 A;  1TZY A;  3AZF C;  1ZLA C;  1TZY B;  3NQU B;  3MGQ D;  3AZG B;  4WU9 B;  4Z5T A;  1P3I C;  2BYM A;  5B31 D;  4R8P D;  4XZQ D;  1KX3 C;  4YM6 C;  5JRG C;  3W98 B;  1ZLA B;  2JSS A;  4YM6 D;  2HIO B;  1ULY A;  3AZH A;  3REJ B;  3AZL A;  3LZ1 D;  5E5A A;  3X1U A;  3LEL C;  4JJN D;  2FJ7 B;  3WTP B;  5B2J D;  4WU8 C;  1KX4 C;  1KX5 A;  2Y2L A;  3KUY B;  3LZ0 C;  5GSU D;  3C1C B;  5G49 B;  4J8W C;  4J8U C;  3LZ0 D;  5GSU C;  4EO5 B;  3MVD C;  5AV5 C;  4J8W D;  3AYW D;  5B33 D;  1M18 D;  4KGC D;  5CPI C;  5GT0 B;  3TU4 A;  5AV5 D;  3AYW C;  5CPI B;  5B24 C;  3WTP E;  1P3F A;  3VH6 T;  1P3G C;  3MNN D;  5GT0 A;  3FDD A;  5CPK D;  4H9N B;  5B2J A;  4HGA B;  1P3L C;  4J8X B;  4QLC A;  2NQB C;  1KU5 A;  2XD5 A;  3LZ0 B;  3MGP A;  1R4V A;  2Y2K A;  4AWL C;  2CV5 C;  5B0Y C;  2YFW A;  3AZF B;  3B0D C;  4J8V B;  2CV5 D;  3VH5 T;  5F99 C;  5JRG A;  3REH A;  1KX5 B;  2PYO B;  3X1U B;  1ID3 B;  3REJ A;  3AV2 D;  3A6N B;  5B40 C;  1ID3 C;  3AV2 C;  2F8N D;  3W98 D;  5CPJ D;  4Z66 B;  1P3M A;  3WA9 D;  1P3O B;  3VH6 W;  3C1B A;  4LD9 D;  3AZJ D;  5B1L B;  3AV2 A;  3W97 A;  4LD9 C;  1P3F B;  5B1M C;  1HQ3 C;  3REI D;  3AYW B;  3AL0 C;  5B0Z D;  3REK A;  5G49 A;  2ZY4 A;  5AVC C;  3UT9 B;  5B0Z C;  3X1T B;  3MNN A;  3KSY A;  3LJA A;  5B1M A;  5B0Y A;  4H9S C;  5AV5 A;  3W96 D;  3UTA C;  3WKJ C;  1P3P B;  5BT1 D;  3W97 D;  2NQB B;  4NE6 A;  3UTA D;  3UT9 A;  3B0C W;  3AZL B;  2HIO D;  3W99 A;  3AV1 B;  4G91 B;  4JJN C;  3AZE C;  1Z2C B;  2HIO C;  4M6B A;  3AZE D;  1TAF B;  3MGS B;  3AZN D;  1U35 D;  1BH9 B;  3O62 B;  2VQR A;  2Y2N A;  3REH C;  3X1T D;  4ZBJ C;  1N1J B;  1P3O A;  3MVD D;  3C1B C;  5DNM B;  3REL A;  3B6F C;  4KUD A;  3AV1 D;  3B6G A;  3X1U C;  5B24 D;  4Z5T C;  5BS7 C;  2XD1 A;  4NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...