3AZNC

Crystal structure of human nucleosome core particle containing h4k91q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aznC00
3X1VB 3B6GA 4CSRB 2NQBC 3NQUA 3REJD 3X1TB 2HIOA 5DNNB 3AZNB 2F8NG 1BH9A 4ZUXC 5B0YB 2AROD 1EQZA 1U35B 2HUEC 4Z66B 3W99A 3AZKA 5B1MC 3LZ0A 1S32A 3VH5W 5CPJB 3MVDA 1P34C 5F99A 1M1AA 5B24C 5G49B 5AV5D 1P3MC 4J8VA 3MGPD 3X1SB 4M6BA 3B0DB 2RVQD 3AZJB 4HGAB 3AV1C 3REKA 5CPKC 1P3PA 1P3FA 4KHAA 4J8WA 3X1VC 4NE5A 4CAYB 5GT3D 3W96D 3NQJA 3AZHA 1WWSA 1P3GB 3AZLA 5B33A 4G91B 5BNVA 4WZSB 3C1BA 5B0YC 5AV8D 5B40C 4WU8C 3MGQB 5BS7A 2PYOB 2CV5B 3WA9D 3B0CT 4YM6C 2BYMA 3KUYA 3R45A 3AZFC 1P3LB 3C1CA 3W99D 3KWQA 3O62D 1HTAA 3TU4C 5CPJC 5AVCC 1M19C 3AZIB 5B32G 4J8UD 4LD9B 2F8NA 3V9RB 1P3AB 4H9SA 1KX3A 3B6GB 2JSSA 5E5AD 3AZED 4DRAA 4HGAC 2HIOB 2AROC 3AN2D 5B31D 1M1AD 1BH9B 3W97B 3UTBC 4KGCA 4NE3A 1EQZB 1P3PD 1P3GC 3AZKB 3LZ0B 4G91C 2YFWA 3LJAC 5AV5C 1AOIA 2CV5C 3MVDB 3MGSC 4X23A 5JRGB 3A6NA 3W98A 5F99B 5B2IB 3AFAD 4J8VB 3RELD 1P3LC 1HQ3A 3X1UA 4H9RA 5CP6A 4UUZA 4Z5TD 5GT0A 3AZIC 4LD9C 3LZ1B 1P3AC 4KHAB 3KWQD 4J8WB 3REIC 1P3FB 3B6GC 4NFTA 3LELA 5DNNA 5B2JA 1P3KB 3AZHB 2F8ND 3AZLB 2NQBD 2HIOC 5B33B 4JJNA 5B0ZB 1BH8A 3C1BB 3WAAA 4Z66A 4WU9A 2IO5B 1KX4B 1EQZC 3W99C 5B32A 2BYMB 3KUYB 3R45B 3WTPB 3C1CB 1S32C 4WV4B 3B6FA 5G49A 3MVDC 4XZQD 3KXBA 5F99C 1M1AC 1KX3B 3X1SA 3AV2B 1P34D 3AZJA 1Q9CA 5B24D 4J8VC 1P3MD 4J8XA 4E45A 1KX5B 3REKC 1P3PC 1P3FC 1HQ3D 3X1UD 4J8WC 5AV9A 3X1VD 1WWIA 3AZHC 3AZLC 1P3IA 2F8NK 5B33C 1ZLAB 5DNMB 3X1TD 2YFWB 1M18A 3AZND 2PYOA 3C1BC 5B0YD 5BS7C 3W98B 4X23B 3A6NB 3KUYC 1U35D 4Z66D 4YM6D 3AZGA 3C1CC 5AV6B 3KWQC 5CP6B 3V9RA 3WKJA 5GT0B 5BO0B 5CPJD 5AVCD 1M19D 4H9SC 3LELB 5B2JB 3W97A 3UT9A 3KSYA 3X1SD 3AZJD 4JJNB 5B1LA 3VH6W 1BH8B 4H9QA 3WAAB 4WU9B 4KGCC 3UTBD 5B32B 1P3GD 1P3BA 4XZQC 3LJAD 5JRGA 5AVBA 1AOIC 3B6FB 1B6WA 1F66A 5B2IA 3W98C 3KXBB 3MGQD 2PYOD 2CV5D 3MGSD 1ID3A 4YS3A 3REHB 4J8XB 1HQ3C 3X1UC 1P3LD 3LZ1A 5CP6C 5GT0C 4R8PA 3AZID 4LD9D 1P3KA 1TAFA 1P3AD 5AV9B 3X1TC 3REID 1P3OB 3B6GD 3LELC 5DNNC 5B2JC 5GSUA 3UTAA 3AZNC 5B0ZA 1P3IB 4H9OA 5AY8A 4JJNC 2HIOD 1M18B 1U35C 1KX4A 3WAAC 4Z66C 4WU9C 4Z2MH 3W97D 5GXQA 5B32C 3WTPA 1EQZD 3AZKD 3AZGB 3LZ0D 1S32D 5JA4B 3WKJB 3MGRB 3B6FC 3AV2A 4KUDA 3MVDD 3X1SC 3B0DC 3AZJC 5F99D 1KX5A 4J8VD 4XUJA 3UT9B 1JFIA 5B1LB 4H9QB 3REKD 3AZMA 1P3FD 5AV9C 4J8WD 1ZLAA 5DNMA 1P3IC 1P3KD 3AZHD 3AZLD 1TZYA 1P3BB 5B33D 1M18C 3MGQC 2PYOC 5AVBB 3C1BD 1KU5A 1F66B 2NZDA 1KX4D 5CPIA 3MNNA 5AV6A 4AWLB 1ID3B 3KUYD 4YS3B 5AV8B 2FJ7A 4ZUXA 5BO0A 3C1CD 3WKJC 4R8PB 5B1MA 4NE6A 1TAFB 1KX3D 5GSUB 3UTAB 1F1EA 4J8UB 3AYWA 3UT9C 3W97C 4H9OB 5AY8B 4QLCA 1KX5D 5E5AB 3AZEB 3AZKC 2BYKB 3VH6T 3LZ0C 4KGCD 5GXQB 5CPKA 1P3BC 4Z2MG 5JRGC 4KUDB 3VH5T 5B2IC 1AOID 1H3OA 3REHA 3W98D 4X23D 3A6ND 1ID3C 4YS3C 2LY8A 3B0CW 4XUJB 4EO5B 3LZ1C 4WNNB 2YFVB 1JFIB 5CP6D 1P3OA 4R8PC 3AFAB 5GT0D 3AZMB 1P3KC 1A7WA 5FUGA 3AZFA 5GSUC 4Z5TB 3UTAC 3TU4A 3LELD 5DNND 5B2JD 5B0ZC 5AY8C 1TZYB 3REJA 4DRBA 4JJND 2IO5C 1KX4C 3WAAD 4WU9D 2NZDB 2AROA 3WTPC 5CPIB 3MNNB 2L5AA 2FJ7B 5B32D 5CHLB 5JA4A 4ZUXB 3MGRA 4KUDC 1KX3C 2HUEB 3AV2C 3B6FD 5B1MB 3KXBD 1KX5C 3AYWB 4XUJC 4EO5C 4J8XD 3MGPA 4QLCB 1P34B 4H9NA 5B24B 3AZMC 1P3MB 1ZLAC 5DNMC 5AV9D 1P3OD 5GT3A 3W96A 3AV1B 5CPKB 1TZYC 1P3ID 1M18D 4X23C 3A6NC 2NZDC 5AV8A 1H3OB 5CPIC 3MNNC 5AV6C 2FJ7C 3WA9A 4H9PA 5B40B 4WU8B 3AZGD 4YM6B 3O62A 3WKJD 2CWEA 3MGRD 1B67A 5BNXB 4J8UA 5FUGB 3AZFB 3TU4B 3AYWC 5AVCB 1M19B 5E5AA 3UT9D 4QLCC 3REJB 3AZEA 2BYKA 5B1LD 3AN2A 5B31A 5KDMA 2AROB 3VH6A 3UTBB 1P3BD 3KXBC 5JRGD 5AVBD 3VH5A 3REHC 5B2ID 1F66D 4J8XC 3LJAB 4WNNA 5BT1C 2YFVA 1ID3D 4YS3D 5AV5B 3AFAA 3RELA 3MGPB 3LZ1D 3MGSB 4H9NB 1P3OC 4R8PD 4Z5TA 4ZBJB 5GT3B 3W96B 5GSUD 1R4VA 3B0BA 3UTAD 5B0ZD 5C3IB 3REJC 2NQBA 5AY8D 3REIB 3NQUB 3AZGC 5GXQD 3WTPD 3WA9B 4H9PB 3MGRC 3W99B 3O62B 4KUDD 3AV2D 4XZQA 1S32B 5B1LC 1P34A 5B24A 4XUJD 3MGPC 4G92B 1P3MA 2RVQC 1M1AB 3AN2B 5B31B 1N1JA 3AZMD 3AV1A 4ZBJC 2F8NH 5KDMB 5GT3C 5DNMD 1ZLAD 3W96C 3X1VA 3REKB 1P3PB 4CSRA 5AVBC 5C3IC 1TZYD 1F66C 3X1TA 3AZNA 3NQJB 4AWLC 5AV8C 4E44A 5B40A 4WU8A 5B0YA 2NZDD 3WTPE 3WA9C 5CPID 3MNND 5AV6D 5BNVB 1U35A 2FJ7D 4YM6A 3TU4D 4ZUXD 3RELB 5BNXA 3O62C 4J8UC 5B1MD 5AVCA 5CPJA 1M19A 1BFMA 3KWQB 3AYWD 5E5AC 4G92C 2F8NB 3AZEC 2NQBB 4QLCD 3AN2C 5B31C 5GXQC 5B31G 3UTBA 4CAYA 1ULYA 3AV1D 5CPKD 1P3GA 4KGCB 3LJAA 3REHD 5AV5A 4XZQB 3MGQA 2CV5A 3MGSA 5BT1D 5B40D 3AFAC 4WU8D 1AOIB 3RELC 1P3LA 4Z5TC 1N1JB 3AZIA 1HQ3B 3X1UB 4LD9A 3AZFD 4H9RB 1P3AA 3REIA 4UUZB
chains in the Genus database with same CATH superfamily
3X1VB 3B6GA 4CSRB 2NQBC 3NQUA 3REJD 3X1TB 2HIOA 5DNNB 3AZNB 2F8NG 1BH9A 4ZUXC 5B0YB 2AROD 1EQZA 1U35B 2HUEC 4Z66B 3W99A 3AZKA 5B1MC 2Y2HA 3LZ0A 1S32A 2DF4C 4WJ3C 3VH5W 2XD1A 5CPJB 3MVDA 1P34C 2VQRA 5F99A 1M1AA 5B24C 5G49B 5AV5D 1P3MC 4J8VA 3MGPD 3X1SB 4M6BA 2RVQD 3B0DB 3AZJB 4HGAB 3AV1C 3A1IA 3REKA 5CPKC 1P3PA 1P3FA 4KHAA 4J8WA 3X1VC 4NE5A 4CAYB 5GT3D 3W96D 3NQJA 3AZHA 1WWSA 2FFFB 3AZLA 1P3GB 2Y2JA 5B33A 2RIQA 4G91B 2Y2MA 5BNVA 4WZSB 5B0YC 5AV8D 3C1BA 5B40C 4WU8C 3MGQB 5BS7A 2PYOB 2CV5B 3WA9D 3B0CT 4YM6C 2BYMA 3KUYA 3R45A 3AZFC 1P3LB 3C1CA 3W99D 3KWQA 3O62D 1HTAA 3TU4C 5CPJC 5AVCC 1M19C 3AZIB 5B32G 4J8UD 4LD9B 2F8NA 3V9RB 1P3AB 4H9SA 1KX3A 3B6GB 2JSSA 5E5AD 3AZED 2G5IC 4DRAA 4HGAC 2HIOB 2AROC 3AN2D 5B31D 1M1AD 1BH9B 3W97B 3UTBC 4KGCA 4NE3A 1EQZB 1P3PD 1P3GC 3AZKB 2J8PA 3LZ0B 4G91C 2YFWA 3LJAC 5AV5C 1AOIA 2CV5C 3MVDB 3MGSC 4X23A 5JRGB 3A6NA 3W98A 5F99B 5B2IB 3AFAD 4J8VB 3RELD 1P3LC 1HQ3A 3X1UA 4H9RA 5CP6A 4UUZA 4Z5TD 5GT0A 3AZIC 4LD9C 3LZ1B 1P3AC 4KHAB 1W2EA 3KWQD 4J8WB 3REIC 1P3FB 3B6GC 4NFTA 3LELA 5DNNA 5B2JA 1P3KB 3AZHB 2F8ND 3AZLB 2NQBD 2HIOC 5B33B 4JJNA 5B0ZB 1BH8A 3C1BB 3WAAA 4Z66A 4WU9A 2BG1A 2IO5B 1KX4B 1EQZC 3W99C 5B32A 2BYMB 2Y2GA 3KUYB 1Z2CB 2JCHA 3R45B 3WTPB 3C1CB 1S32C 4WV4B 3B6FA 5G49A 3MVDC 4XZQD 3KXBA 5F99C 1M1AC 1KX3B 3X1SA 3AV2B 1P34D 3AZJA 1Q9CA 5B24D 4J8VC 1P3MD 4J8XA 1PZRA 4E45A 1KX5B 3F6TA 3REKC 1P3PC 1P3FC 1HQ3D 3X1UD 4J8WC 3H0RC 5AV9A 2ZY3A 3X1VD 1WWIA 3AZHC 3AZLC 1P3IA 2F8NK 5B33C 1ZLAB 2Y2NA 5DNMB 3X1TD 2YFWB 1M18A 3AZND 2PYOA 3C1BC 5B0YD 5BS7C 3W98B 4X23B 3A6NB 3KUYC 1U35D 4Z66D 4YM6D 3AZGA 2Y2OA 3C1CC 5AV6B 3KWQC 5CP6B 3V9RA 3WKJA 5GT0B 5BO0B 5CPJD 5AVCD 1M19D 4H9SC 3LELB 5B2JB 3W97A 3UT9A 3KSYA 3X1SD 3AZJD 4JJNB 5B1LA 3VH6W 1BH8B 4H9QA 3H0MC 3WAAB 4WU9B 2Y2KA 2Y2IA 4KGCC 3UTBD 2JE5A 5B32B 1P3GD 1P3BA 4XZQC 3LJAD 5JRGA 5AVBA 1AOIC 3B6FB 1B6WA 1F66A 5B2IA 3W98C 3KXBB 3MGQD 2PYOD 2CV5D 3MGSD 1ID3A 4YS3A 2Y2LA 3REHB 4J8XB 1HQ3C 3X1UC 1P3LD 3LZ1A 5CP6C 5GT0C 4R8PA 3AZID 4LD9D 1P3KA 1TAFA 1P3AD 5AV9B 3X1TC 3REID 1P3OB 3B6GD 3LELC 5DNNC 5B2JC 5GSUA 3UTAA 3AZNC 5B0ZA 1P3IB 4H9OA 5AY8A 4JJNC 2HIOD 1M18B 1U35C 1KX4A 3WAAC 4Z66C 4WU9C 4Z2MH 3W97D 5GXQA 5B32C 3WTPA 1EQZD 3AZKD 3AZGB 3LZ0D 1S32D 5JA4B 3WKJB 3MGRB 3B6FC 3AV2A 4KUDA 3MVDD 3X1SC 3B0DC 3AZJC 5F99D 1KX5A 4J8VD 4XUJA 3UT9B 1JFIA 5B1LB 4DQYB 4H9QB 3REKD 3AZMA 1P3FD 5AV9C 4J8WD 1ZLAA 5DNMA 1P3IC 1P3KD 3AZHD 3AZLD 1TZYA 1P3BB 5B33D 1M18C 3MGQC 2PYOC 3AL0C 5AVBB 3C1BD 1KU5A 1F66B 2NZDA 1KX4D 5CPIA 3MNNA 5AV6A 4AWLB 1ID3B 3KUYD 4YS3B 5AV8B 2FJ7A 4ZUXA 5BO0A 3C1CD 3WKJC 4R8PB 5B1MA 4NE6A 1TAFB 1KX3D 5GSUB 3UTAB 1F1EA 4J8UB 3AYWA 3UT9C 3W97C 4H9OB 5AY8B 4QLCA 1KX5D 5E5AB 3AZEB 3EPJA 2BYKB 3VH6T 3LZ0C 3AZKC 4KGCD 5GXQB 5CPKA 1P3BC 4Z2MG 5JRGC 4KUDB 3VH5T 5B2IC 1AOID 3EPHA 1H3OA 3REHA 3W98D 4X23D 3A6ND 1ID3C 4YS3C 2LY8A 3B0CW 4XUJB 4EO5B 3LZ1C 4WNNB 2YFVB 1JFIB 5CP6D 1P3OA 4R8PC 3AFAB 5GT0D 3AZMB 2Y2QA 1P3KC 1A7WA 5FUGA 3AZFA 5GSUC 4Z5TB 3UTAC 3TU4A 3LELD 5DNND 5B2JD 5B0ZC 5AY8C 1TZYB 3REJA 4DRBA 4JJND 2IO5C 1KX4C 2Y2PA 3WAAD 4WU9D 2NZDB 2AROA 3WTPC 5CPIB 3MNNB 2L5AA 3KFUG 2FJ7B 5B32D 5CHLB 3P5JB 5JA4A 4ZUXB 3MGRA 2ZM5A 4KUDC 1KX3C 2HUEB 3AV2C 3B6FD 5B1MB 3KXBD 1KX5C 3AYWB 4XUJC 4EO5C 4J8XD 3MGPA 4QLCB 1P34B 4H9NA 5B24B 3AZMC 1P3MB 1ZLAC 5DNMC 2ZY2A 5AV9D 1P3OD 5GT3A 3W96A 3AV1B 5CPKB 1TZYC 1P3ID 1M18D 4X23C 3A6NC 2W8SA 2NZDC 5AV8A 1H3OB 5CPIC 3MNNC 5AV6C 2FJ7C 3WA9A 4H9PA 5B40B 4WU8B 3AZGD 4YM6B 3O62A 2XD5A 2CWEA 3MGRD 3WKJD 3EG5B 1B67A 5BNXB 4J8UA 5FUGB 3AZFB 1T3UA 3TU4B 3AYWC 5AVCB 1M19B 5E5AA 3UT9D 4QLCC 3REJB 3AZEA 2BYKA 5B1LD 3AN2A 5B31A 5KDMA 2AROB 3VH6A 2ZY5A 3UTBB 1P3BD 3KXBC 5JRGD 5AVBD 3EPKA 3VH5A 3REHC 5B2ID 1F66D 4J8XC 3LJAB 4WNNA 5BT1C 2YFVA 1ID3D 4YS3D 5AV5B 3AFAA 3RELA 3MGPB 3LZ1D 3MGSB 4H9NB 1P3OC 4R8PD 4Z5TA 4ZBJB 5GT3B 3W96B 5GSUD 1R4VA 3B0BA 3UTAD 4UPKA 5B0ZD 5C3IB 3REJC 2NQBA 5AY8D 3REIB 3NQUB 2UWXA 3AZGC 5GXQD 3WTPD 3WA9B 4H9PB 3MGRC 3W99B 3O62B 4KUDD 2DQNC 3AV2D 2G5HC 4XZQA 1S32B 5B1LC 1P34A 5B24A 4XUJD 3MGPC 4G92B 1P3MA 2RVQC 1M1AB 3AN2B 5B31B 1N1JA 3A1KA 3AZMD 3AV1A 4ZBJC 2F8NH 5KDMB 5GT3C 5DNMD 1ZLAD 3W96C 3X1VA 3REKB 1P3PB 4CSRA 5AVBC 5C3IC 1TZYD 1F66C 3IP4C 3X1TA 3AZNA 3NQJB 4AWLC 5AV8C 4E44A 5B40A 4WU8A 5B0YA 3EPLA 2NZDD 3WTPE 3WA9C 5CPID 3MNND 5AV6D 2ZY4A 5BNVB 1U35A 2FJ7D 4YM6A 3TU4D 4ZUXD 3RELB 3H0LC 5BNXA 3O62C 2F2AC 4J8UC 5B1MD 5AVCA 5CPJA 1M19A 1BFMA 3KWQB 3AYWD 5E5AC 4G92C 2F8NB 3AZEC 2NQBB 4QLCD 3AN2C 5B31C 5GXQC 5B31G 3UTBA 4CAYA 1ULYA 3AV1D 5CPKD 1P3GA 4KGCB 3LJAA 3REHD 5AV5A 4XZQB 3MGQA 2CV5A 3MGSA 5BT1D 3FDDA 5B40D 3AFAC 4WU8D 1AOIB 3RELC 1P3LA 4Z5TC 1N1JB 3AZIA 1HQ3B 3X1UB 4LD9A 3AZFD 4H9RB 1P3AA 3REIA 4UUZB
chains in the Genus database with same CATH topology
3X1VB 3B6GA 4CSRB 2NQBC 3NQUA 3REJD 3X1TB 2HIOA 5DNNB 3AZNB 2F8NG 1BH9A 4ZUXC 5B0YB 2AROD 1EQZA 1U35B 2HUEC 4Z66B 3W99A 3AZKA 5B1MC 2Y2HA 3LZ0A 1S32A 2DF4C 4WJ3C 3VH5W 2XD1A 5CPJB 3MVDA 1P34C 2VQRA 5F99A 1M1AA 5B24C 5G49B 5AV5D 1P3MC 4J8VA 3MGPD 3X1SB 4M6BA 2RVQD 3B0DB 3AZJB 4HGAB 3AV1C 3A1IA 3REKA 5CPKC 1P3PA 1P3FA 4KHAA 4J8WA 3X1VC 4NE5A 4CAYB 5GT3D 3W96D 3NQJA 3AZHA 1WWSA 2FFFB 3AZLA 1P3GB 2Y2JA 5B33A 2RIQA 4G91B 2Y2MA 5BNVA 4WZSB 5B0YC 5AV8D 3C1BA 5B40C 4WU8C 3MGQB 5BS7A 2PYOB 2CV5B 3WA9D 3B0CT 4YM6C 2BYMA 3KUYA 3R45A 3AZFC 1P3LB 3C1CA 3W99D 3KWQA 3O62D 1HTAA 3TU4C 5CPJC 5AVCC 1M19C 3AZIB 5B32G 4J8UD 4LD9B 2F8NA 3V9RB 1P3AB 4H9SA 1KX3A 3B6GB 2JSSA 5E5AD 3AZED 2G5IC 4DRAA 4HGAC 2HIOB 2AROC 3AN2D 5B31D 1M1AD 1BH9B 3W97B 3UTBC 4KGCA 4NE3A 1EQZB 1P3PD 1P3GC 3AZKB 2J8PA 3LZ0B 4G91C 2YFWA 3LJAC 5AV5C 1AOIA 2CV5C 3MVDB 3MGSC 4X23A 5JRGB 3A6NA 3W98A 5F99B 5B2IB 3AFAD 4J8VB 3RELD 1P3LC 1HQ3A 3X1UA 4H9RA 5CP6A 4UUZA 4Z5TD 5GT0A 3AZIC 4LD9C 3LZ1B 1P3AC 4KHAB 1W2EA 3KWQD 4J8WB 3REIC 1P3FB 3B6GC 4NFTA 3LELA 5DNNA 5B2JA 1P3KB 3AZHB 2F8ND 3AZLB 2NQBD 2HIOC 5B33B 4JJNA 5B0ZB 1BH8A 3C1BB 3WAAA 4Z66A 4WU9A 2BG1A 2IO5B 1KX4B 1EQZC 3W99C 5B32A 2BYMB 2Y2GA 3KUYB 1Z2CB 2JCHA 3R45B 3WTPB 3C1CB 1S32C 4WV4B 3B6FA 5G49A 3MVDC 4XZQD 3KXBA 5F99C 1M1AC 1KX3B 3X1SA 3AV2B 1P34D 3AZJA 1Q9CA 5B24D 4J8VC 1P3MD 4J8XA 1PZRA 4E45A 1KX5B 3F6TA 3REKC 1P3PC 1P3FC 1HQ3D 3X1UD 4J8WC 3H0RC 5AV9A 2ZY3A 3X1VD 1WWIA 3AZHC 3AZLC 1P3IA 2F8NK 5B33C 1ZLAB 2Y2NA 5DNMB 3X1TD 2YFWB 1M18A 3AZND 2PYOA 3C1BC 5B0YD 5BS7C 3W98B 4X23B 3A6NB 3KUYC 1U35D 4Z66D 4YM6D 3AZGA 2Y2OA 3C1CC 5AV6B 3KWQC 5CP6B 3V9RA 3WKJA 5GT0B 5BO0B 5CPJD 5AVCD 1M19D 4H9SC 3LELB 5B2JB 3W97A 3UT9A 3KSYA 3X1SD 3AZJD 4JJNB 5B1LA 3VH6W 1BH8B 4H9QA 3H0MC 3WAAB 4WU9B 2Y2KA 2Y2IA 4KGCC 3UTBD 2JE5A 5B32B 1P3GD 1P3BA 4XZQC 3LJAD 5JRGA 5AVBA 1AOIC 3B6FB 1B6WA 1F66A 5B2IA 3W98C 3KXBB 3MGQD 2PYOD 2CV5D 3MGSD 1ID3A 4YS3A 2Y2LA 3REHB 4J8XB 1HQ3C 3X1UC 1P3LD 3LZ1A 5CP6C 5GT0C 4R8PA 3AZID 4LD9D 1P3KA 1TAFA 1P3AD 5AV9B 3X1TC 3REID 1P3OB 3B6GD 3LELC 5DNNC 5B2JC 5GSUA 3UTAA 3AZNC 5B0ZA 1P3IB 4H9OA 5AY8A 4JJNC 2HIOD 1M18B 1U35C 1KX4A 3WAAC 4Z66C 4WU9C 4Z2MH 3W97D 5GXQA 5B32C 3WTPA 1EQZD 3AZKD 3AZGB 3LZ0D 1S32D 5JA4B 3WKJB 3MGRB 3B6FC 3AV2A 4KUDA 3MVDD 3X1SC 3B0DC 3AZJC 5F99D 1KX5A 4J8VD 4XUJA 3UT9B 1JFIA 5B1LB 4DQYB 4H9QB 3REKD 3AZMA 1P3FD 5AV9C 4J8WD 1ZLAA 5DNMA 1P3IC 1P3KD 3AZHD 3AZLD 1TZYA 1P3BB 5B33D 1M18C 3MGQC 2PYOC 3AL0C 5AVBB 3C1BD 1KU5A 1F66B 2NZDA 1KX4D 5CPIA 3MNNA 5AV6A 4AWLB 1ID3B 3KUYD 4YS3B 5AV8B 2FJ7A 4ZUXA 5BO0A 3C1CD 3WKJC 4R8PB 5B1MA 4NE6A 1TAFB 1KX3D 5GSUB 3UTAB 1F1EA 4J8UB 3AYWA 3UT9C 3W97C 4H9OB 5AY8B 4QLCA 1KX5D 5E5AB 3AZEB 3EPJA 2BYKB 3VH6T 3LZ0C 3AZKC 4KGCD 5GXQB 5CPKA 1P3BC 4Z2MG 5JRGC 4KUDB 3VH5T 5B2IC 1AOID 3EPHA 1H3OA 3REHA 3W98D 4X23D 3A6ND 1ID3C 4YS3C 2LY8A 3B0CW 4XUJB 4EO5B 3LZ1C 4WNNB 2YFVB 1JFIB 5CP6D 1P3OA 4R8PC 3AFAB 5GT0D 3AZMB 2Y2QA 1P3KC 1A7WA 5FUGA 3AZFA 5GSUC 4Z5TB 3UTAC 3TU4A 3LELD 5DNND 5B2JD 5B0ZC 5AY8C 1TZYB 3REJA 4DRBA 4JJND 2IO5C 1KX4C 2Y2PA 3WAAD 4WU9D 2NZDB 2AROA 3WTPC 5CPIB 3MNNB 2L5AA 3KFUG 2FJ7B 5B32D 5CHLB 3P5JB 5JA4A 4ZUXB 3MGRA 2ZM5A 4KUDC 1KX3C 2HUEB 3AV2C 3B6FD 5B1MB 3KXBD 1KX5C 3AYWB 4XUJC 4EO5C 4J8XD 3MGPA 4QLCB 1P34B 4H9NA 5B24B 3AZMC 1P3MB 1ZLAC 5DNMC 2ZY2A 5AV9D 1P3OD 5GT3A 3W96A 3AV1B 5CPKB 1TZYC 1P3ID 1M18D 4X23C 3A6NC 2W8SA 2NZDC 5AV8A 1H3OB 5CPIC 3MNNC 5AV6C 2FJ7C 3WA9A 4H9PA 5B40B 4WU8B 3AZGD 4YM6B 3O62A 2XD5A 2CWEA 3MGRD 3WKJD 3EG5B 1B67A 5BNXB 4J8UA 5FUGB 3AZFB 1T3UA 3TU4B 3AYWC 5AVCB 1M19B 5E5AA 3UT9D 4QLCC 3REJB 3AZEA 2BYKA 5B1LD 3AN2A 5B31A 5KDMA 2AROB 3VH6A 2ZY5A 3UTBB 1P3BD 3KXBC 5JRGD 5AVBD 3EPKA 3VH5A 3REHC 5B2ID 1F66D 4J8XC 3LJAB 4WNNA 5BT1C 2YFVA 1ID3D 4YS3D 5AV5B 3AFAA 3RELA 3MGPB 3LZ1D 3MGSB 4H9NB 1P3OC 4R8PD 4Z5TA 4ZBJB 5GT3B 3W96B 5GSUD 1R4VA 3B0BA 3UTAD 4UPKA 5B0ZD 5C3IB 3REJC 2NQBA 5AY8D 3REIB 3NQUB 2UWXA 3AZGC 5GXQD 3WTPD 3WA9B 4H9PB 3MGRC 3W99B 3O62B 4KUDD 2DQNC 3AV2D 2G5HC 4XZQA 1S32B 5B1LC 1P34A 5B24A 4XUJD 3MGPC 4G92B 1P3MA 2RVQC 1M1AB 3AN2B 5B31B 1N1JA 3A1KA 3AZMD 3AV1A 4ZBJC 2F8NH 5KDMB 5GT3C 5DNMD 1ZLAD 3W96C 3X1VA 3REKB 1P3PB 4CSRA 5AVBC 5C3IC 1TZYD 1F66C 3IP4C 3X1TA 3AZNA 3NQJB 4AWLC 5AV8C 4E44A 5B40A 4WU8A 5B0YA 3EPLA 2NZDD 3WTPE 3WA9C 5CPID 3MNND 5AV6D 2ZY4A 5BNVB 1U35A 2FJ7D 4YM6A 3TU4D 4ZUXD 3RELB 3H0LC 5BNXA 3O62C 2F2AC 4J8UC 5B1MD 5AVCA 5CPJA 1M19A 1BFMA 3KWQB 3AYWD 5E5AC 4G92C 2F8NB 3AZEC 2NQBB 4QLCD 3AN2C 5B31C 5GXQC 5B31G 3UTBA 4CAYA 1ULYA 3AV1D 5CPKD 1P3GA 4KGCB 3LJAA 3REHD 5AV5A 4XZQB 3MGQA 2CV5A 3MGSA 5BT1D 3FDDA 5B40D 3AFAC 4WU8D 1AOIB 3RELC 1P3LA 4Z5TC 1N1JB 3AZIA 1HQ3B 3X1UB 4LD9A 3AZFD 4H9RB 1P3AA 3REIA 4UUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V B;  3B6G A;  4CSR B;  2NQB C;  3NQU A;  3REJ D;  3X1T B;  2HIO A;  5DNN B;  3AZN B;  2F8N G;  1BH9 A;  4ZUX C;  5B0Y B;  2ARO D;  1EQZ A;  1U35 B;  2HUE C;  4Z66 B;  3W99 A;  3AZK A;  5B1M C;  3LZ0 A;  1S32 A;  3VH5 W;  5CPJ B;  3MVD A;  1P34 C;  5F99 A;  1M1A A;  5B24 C;  5G49 B;  5AV5 D;  1P3M C;  4J8V A;  3MGP D;  3X1S B;  4M6B A;  3B0D B;  2RVQ D;  3AZJ B;  4HGA B;  3AV1 C;  3REK A;  5CPK C;  1P3P A;  1P3F A;  4KHA A;  4J8W A;  3X1V C;  4NE5 A;  4CAY B;  5GT3 D;  3W96 D;  3NQJ A;  3AZH A;  1WWS A;  1P3G B;  3AZL A;  5B33 A;  4G91 B;  5BNV A;  4WZS B;  3C1B A;  5B0Y C;  5AV8 D;  5B40 C;  4WU8 C;  3MGQ B;  5BS7 A;  2PYO B;  2CV5 B;  3WA9 D;  3B0C T;  4YM6 C;  2BYM A;  3KUY A;  3R45 A;  3AZF C;  1P3L B;  3C1C A;  3W99 D;  3KWQ A;  3O62 D;  1HTA A;  3TU4 C;  5CPJ C;  5AVC C;  1M19 C;  3AZI B;  5B32 G;  4J8U D;  4LD9 B;  2F8N A;  3V9R B;  1P3A B;  4H9S A;  1KX3 A;  3B6G B;  2JSS A;  5E5A D;  3AZE D;  4DRA A;  4HGA C;  2HIO B;  2ARO C;  3AN2 D;  5B31 D;  1M1A D;  1BH9 B;  3W97 B;  3UTB C;  4KGC A;  4NE3 A;  1EQZ B;  1P3P D;  1P3G C;  3AZK B;  3LZ0 B;  4G91 C;  2YFW A;  3LJA C;  5AV5 C;  1AOI A;  2CV5 C;  3MVD B;  3MGS C;  4X23 A;  5JRG B;  3A6N A;  3W98 A;  5F99 B;  5B2I B;  3AFA D;  4J8V B;  3REL D;  1P3L C;  1HQ3 A;  3X1U A;  4H9R A;  5CP6 A;  4UUZ A;  4Z5T D;  5GT0 A;  3AZI C;  4LD9 C;  3LZ1 B;  1P3A C;  4KHA B;  3KWQ D;  4J8W B;  3REI C;  1P3F B;  3B6G C;  4NFT A;  3LEL A;  5DNN A;  5B2J A;  1P3K B;  3AZH B;  2F8N D;  3AZL B;  2NQB D;  2HIO C;  5B33 B;  4JJN A;  5B0Z B;  1BH8 A;  3C1B B;  3WAA A;  4Z66 A;  4WU9 A;  2IO5 B;  1KX4 B;  1EQZ C;  3W99 C;  5B32 A;  2BYM B;  3KUY B;  3R45 B;  3WTP B;  3C1C B;  1S32 C;  4WV4 B;  3B6F A;  5G49 A;  3MVD C;  4XZQ D;  3KXB A;  5F99 C;  1M1A C;  1KX3 B;  3X1S A;  3AV2 B;  1P34 D;  3AZJ A;  1Q9C A;  5B24 D;  4J8V C;  1P3M D;  4J8X A;  4E45 A;  1KX5 B;  3REK C;  1P3P C;  1P3F C;  1HQ3 D;  3X1U D;  4J8W C;  5AV9 A;  3X1V D;  1WWI A;  3AZH C;  3AZL C;  1P3I A;  2F8N K;  5B33 C;  1ZLA B;  5DNM B;  3X1T D;  2YFW B;  1M18 A;  3AZN D;  2PYO A;  3C1B C;  5B0Y D;  5BS7 C;  3W98 B;  4X23 B;  3A6N B;  3KUY C;  1U35 D;  4Z66 D;  4YM6 D;  3AZG A;  3C1C C;  5AV6 B;  3KWQ C;  5CP6 B;  3V9R A;  3WKJ A;  5GT0 B;  5BO0 B;  5CPJ D;  5AVC D;  1M19 D;  4H9S C;  3LEL B;  5B2J B;  3W97 A;  3UT9 A;  3KSY A;  3X1S D;  3AZJ D;  4JJN B;  5B1L A;  3VH6 W;  1BH8 B;  4H9Q A;  3WAA B;  4WU9 B;  4KGC C;  3UTB D;  5B32 B;  1P3G D;  1P3B A;  4XZQ C;  3LJA D;  5JRG A;  5AVB A;  1AOI C;  3B6F B;  1B6W A;  1F66 A;  5B2I A;  3W98 C;  3KXB B;  3MGQ D;  2PYO D;  2CV5 D;  3MGS D;  1ID3 A;  4YS3 A;  3REH B;  4J8X B;  1HQ3 C;  3X1U C;  1P3L D;  3LZ1 A;  5CP6 C;  5GT0 C;  4R8P A;  3AZI D;  4LD9 D;  1P3K A;  1TAF A;  1P3A D;  5AV9 B;  3X1T C;  3REI D;  1P3O B;  3B6G D;  3LEL C;  5DNN C;  5B2J C;  5GSU A;  3UTA A;  3AZN C;  5B0Z A;  1P3I B;  4H9O A;  5AY8 A;  4JJN C;  2HIO D;  1M18 B;  1U35 C;  1KX4 A;  3WAA C;  4Z66 C;  4WU9 C;  4Z2M H;  3W97 D;  5GXQ A;  5B32 C;  3WTP A;  1EQZ D;  3AZK D;  3AZG B;  3LZ0 D;  1S32 D;  5JA4 B;  3WKJ B;  3MGR B;  3B6F C;  3AV2 A;  4KUD A;  3MVD D;  3X1S C;  3B0D C;  3AZJ C;  5F99 D;  1KX5 A;  4J8V D;  4XUJ A;  3UT9 B;  1JFI A;  5B1L B;  4H9Q B;  3REK D;  3AZM A;  1P3F D;  5AV9 C;  4J8W D;  1ZLA A;  5DNM A;  1P3I C;  1P3K D;  3AZH D;  3AZL D;  1TZY A;  1P3B B;  5B33 D;  1M18 C;  3MGQ C;  2PYO C;  5AVB B;  3C1B D;  1KU5 A;  1F66 B;  2NZD A;  1KX4 D;  5CPI A;  3MNN A;  5AV6 A;  4AWL B;  1ID3 B;  3KUY D;  4YS3 B;  5AV8 B;  2FJ7 A;  4ZUX A;  5BO0 A;  3C1C D;  3WKJ C;  4R8P B;  5B1M A;  4NE6 A;  1TAF B;  1KX3 D;  5GSU B;  3UTA B;  1F1E A;  4J8U B;  3AYW A;  3UT9 C;  3W97 C;  4H9O B;  5AY8 B;  4QLC A;  1KX5 D;  5E5A B;  3AZE B;  3AZK C;  2BYK B;  3VH6 T;  3LZ0 C;  4KGC D;  5GXQ B;  5CPK A;  1P3B C;  4Z2M G;  5JRG C;  4KUD B;  3VH5 T;  5B2I C;  1AOI D;  1H3O A;  3REH A;  3W98 D;  4X23 D;  3A6N D;  1ID3 C;  4YS3 C;  2LY8 A;  3B0C W;  4XUJ B;  4EO5 B;  3LZ1 C;  4WNN B;  2YFV B;  1JFI B;  5CP6 D;  1P3O A;  4R8P C;  3AFA B;  5GT0 D;  3AZM B;  1P3K C;  1A7W A;  5FUG A;  3AZF A;  5GSU C;  4Z5T B;  3UTA C;  3TU4 A;  3LEL D;  5DNN D;  5B2J D;  5B0Z C;  5AY8 C;  1TZY B;  3REJ A;  4DRB A;  4JJN D;  2IO5 C;  1KX4 C;  3WAA D;  4WU9 D;  2NZD B;  2ARO A;  3WTP C;  5CPI B;  3MNN B;  2L5A A;  2FJ7 B;  5B32 D;  5CHL B;  5JA4 A;  4ZUX B;  3MGR A;  4KUD C;  1KX3 C;  2HUE B;  3AV2 C;  3B6F D;  5B1M B;  3KXB D;  1KX5 C;  3AYW B;  4XUJ C;  4EO5 C;  4J8X D;  3MGP A;  4QLC B;  1P34 B;  4H9N A;  5B24 B;  3AZM C;  1P3M B;  1ZLA C;  5DNM C;  5AV9 D;  1P3O D;  5GT3 A;  3W96 A;  3AV1 B;  5CPK B;  1TZY C;  1P3I D;  1M18 D;  4X23 C;  3A6N C;  2NZD C;  5AV8 A;  1H3O B;  5CPI C;  3MNN C;  5AV6 C;  2FJ7 C;  3WA9 A;  4H9P A;  5B40 B;  4WU8 B;  3AZG D;  4YM6 B;  3O62 A;  3WKJ D;  2CWE A;  3MGR D;  1B67 A;  5BNX B;  4J8U A;  5FUG B;  3AZF B;  3TU4 B;  3AYW C;  5AVC B;  1M19 B;  5E5A A;  3UT9 D;  4QLC C;  3REJ B;  3AZE A;  2BYK A;  5B1L D;  3AN2 A;  5B31 A;  5KDM A;  2ARO B;  3VH6 A;  3UTB B;  1P3B D;  3KXB C;  5JRG D;  5AVB D;  3VH5 A;  3REH C;  5B2I D;  1F66 D;  4J8X C;  3LJA B;  4WNN A;  5BT1 C;  2YFV A;  1ID3 D;  4YS3 D;  5AV5 B;  3AFA A;  3REL A;  3MGP B;  3LZ1 D;  3MGS B;  4H9N B;  1P3O C;  4R8P D;  4Z5T A;  4ZBJ B;  5GT3 B;  3W96 B;  5GSU D;  1R4V A;  3B0B A;  3UTA D;  5B0Z D;  5C3I B;  3REJ C;  2NQB A;  5AY8 D;  3REI B;  3NQU B;  3AZG C;  5GXQ D;  3WTP D;  3WA9 B;  4H9P B;  3MGR C;  3W99 B;  3O62 B;  4KUD D;  3AV2 D;  4XZQ A;  1S32 B;  5B1L C;  1P34 A;  5B24 A;  4XUJ D;  3MGP C;  4G92 B;  1P3M A;  2RVQ C;  1M1A B;  3AN2 B;  5B31 B;  1N1J A;  3AZM D;  3AV1 A;  4ZBJ C;  2F8N H;  5KDM B;  5GT3 C;  5DNM D;  1ZLA D;  3W96 C;  3X1V A;  3REK B;  1P3P B;  4CSR A;  5AVB C;  5C3I C;  1TZY D;  1F66 C;  3X1T A;  3AZN A;  3NQJ B;  4AWL C;  5AV8 C;  4E44 A;  5B40 A;  4WU8 A;  5B0Y A;  2NZD D;  3WTP E;  3WA9 C;  5CPI D;  3MNN D;  5AV6 D;  5BNV B;  1U35 A;  2FJ7 D;  4YM6 A;  3TU4 D;  4ZUX D;  3REL B;  5BNX A;  3O62 C;  4J8U C;  5B1M D;  5AVC A;  5CPJ A;  1M19 A;  1BFM A;  3KWQ B;  3AYW D;  5E5A C;  4G92 C;  2F8N B;  3AZE C;  2NQB B;  4QLC D;  3AN2 C;  5B31 C;  5GXQ C;  5B31 G;  3UTB A;  4CAY A;  1ULY A;  3AV1 D;  5CPK D;  1P3G A;  4KGC B;  3LJA A;  3REH D;  5AV5 A;  4XZQ B;  3MGQ A;  2CV5 A;  3MGS A;  5BT1 D;  5B40 D;  3AFA C;  4WU8 D;  1AOI B;  3REL C;  1P3L A;  4Z5T C;  1N1J B;  3AZI A;  1HQ3 B;  3X1U B;  4LD9 A;  3AZF D;  4H9R B;  1P3A A;  3REI A;  4UUZ B; 
#chains in the Genus database with same CATH topology
 3X1V B;  3B6G A;  4CSR B;  2NQB C;  3NQU A;  3REJ D;  3X1T B;  2HIO A;  5DNN B;  3AZN B;  2F8N G;  1BH9 A;  4ZUX C;  5B0Y B;  2ARO D;  1EQZ A;  1U35 B;  2HUE C;  4Z66 B;  3W99 A;  3AZK A;  5B1M C;  2Y2H A;  3LZ0 A;  1S32 A;  2DF4 C;  4WJ3 C;  3VH5 W;  2XD1 A;  5CPJ B;  3MVD A;  1P34 C;  2VQR A;  5F99 A;  1M1A A;  5B24 C;  5G49 B;  5AV5 D;  1P3M C;  4J8V A;  3MGP D;  3X1S B;  4M6B A;  2RVQ D;  3B0D B;  3AZJ B;  4HGA B;  3AV1 C;  3A1I A;  3REK A;  5CPK C;  1P3P A;  1P3F A;  4KHA A;  4J8W A;  3X1V C;  4NE5 A;  4CAY B;  5GT3 D;  3W96 D;  3NQJ A;  3AZH A;  1WWS A;  2FFF B;  3AZL A;  1P3G B;  2Y2J A;  5B33 A;  2RIQ A;  4G91 B;  2Y2M A;  5BNV A;  4WZS B;  5B0Y C;  5AV8 D;  3C1B A;  5B40 C;  4WU8 C;  3MGQ B;  5BS7 A;  2PYO B;  2CV5 B;  3WA9 D;  3B0C T;  4YM6 C;  2BYM A;  3KUY A;  3R45 A;  3AZF C;  1P3L B;  3C1C A;  3W99 D;  3KWQ A;  3O62 D;  1HTA A;  3TU4 C;  5CPJ C;  5AVC C;  1M19 C;  3AZI B;  5B32 G;  4J8U D;  4LD9 B;  2F8N A;  3V9R B;  1P3A B;  4H9S A;  1KX3 A;  3B6G B;  2JSS A;  5E5A D;  3AZE D;  2G5I C;  4DRA A;  4HGA C;  2HIO B;  2ARO C;  3AN2 D;  5B31 D;  1M1A D;  1BH9 B;  3W97 B;  3UTB C;  4KGC A;  4NE3 A;  1EQZ B;  1P3P D;  1P3G C;  3AZK B;  2J8P A;  3LZ0 B;  4G91 C;  2YFW A;  3LJA C;  5AV5 C;  1AOI A;  2CV5 C;  3MVD B;  3MGS C;  4X23 A;  5JRG B;  3A6N A;  3W98 A;  5F99 B;  5B2I B;  3AFA D;  4J8V B;  3REL D;  1P3L C;  1HQ3 A;  3X1U A;  4H9R A;  5CP6 A;  4UUZ A;  4Z5T D;  5GT0 A;  3AZI C;  4LD9 C;  3LZ1 B;  1P3A C;  4KHA B;  1W2E A;  3KWQ D;  4J8W B;  3REI C;  1P3F B;  3B6G C;  4NFT A;  3LEL A;  5DNN A;  5B2J A;  1P3K B;  3AZH B;  2F8N D;  3AZL B;  2NQB D;  2HIO C;  5B33 B;  4JJN A;  5B0Z B;  1BH8 A;  3C1B B;  3WAA A;  4Z66 A;  4WU9 A;  2BG1 A;  2IO5 B;  1KX4 B;  1EQZ C;  3W99 C;  5B32 A;  2BYM B;  2Y2G A;  3KUY B;  1Z2C B;  2JCH A;  3R45 B;  3WTP B;  3C1C B;  1S32 C;  4WV4 B;  3B6F A;  5G49 A;  3MVD C;  4XZQ D;  3KXB A;  5F99 C;  1M1A C;  1KX3 B;  3X1S A;  3AV2 B;  1P34 D;  3AZJ A;  1Q9C A;  5B24 D;  4J8V C;  1P3M D;  4J8X A;  1PZR A;  4E45 A;  1KX5 B;  3F6T A;  3REK C;  1P3P C;  1P3F C;  1HQ3 D;  3X1U D;  4J8W C;  3H0R C;  5AV9 A;  2ZY3 A;  3X1V D;  1WWI A;  3AZH C;  3AZL C;  1P3I A;  2F8N K;  5B33 C;  1ZLA B;  2Y2N A;  5DNM B;  3X1T D;  2YFW B;  1M18 A;  3AZN D;  2PYO A;  3C1B C;  5B0Y D;  5BS7 C;  3W98 B;  4X23 B;  3A6N B;  3KUY C;  1U35 D;  4Z66 D;  4YM6 D;  3AZG A;  2Y2O A;  3C1C C;  5AV6 B;  3KWQ C;  5CP6 B;  3V9R A;  3WKJ A;  5GT0 B;  5BO0 B;  5CPJ D;  5AVC D;  1M19 D;  4H9S C;  3LEL B;  5B2J B;  3W97 A;  3UT9 A;  3KSY A;  3X1S D;  3AZJ D;  4JJN B;  5B1L A;  3VH6 W;  1BH8 B;  4H9Q A;  3H0M C;  3WAA B;  4WU9 B;  2Y2K A;  2Y2I A;  4KGC C;  3UTB D;  2JE5 A;  5B32 B;  1P3G D;  1P3B A;  4XZQ C;  3LJA D;  5JRG A;  5AVB A;  1AOI C;  3B6F B;  1B6W A;  1F66 A;  5B2I A;  3W98 C;  3KXB B;  3MGQ D;  2PYO D;  2CV5 D;  3MGS D;  1ID3 A;  4YS3 A;  2Y2L A;  3REH B;  4J8X B;  1HQ3 C;  3X1U C;  1P3L D;  3LZ1 A;  5CP6 C;  5GT0 C;  4R8P A;  3AZI D;  4LD9 D;  1P3K A;  1TAF A;  1P3A D;  5AV9 B;  3X1T C;  3REI D;  1P3O B;  3B6G D;  3LEL C;  5DNN C;  5B2J C;  5GSU A;  3UTA A;  3AZN C;  5B0Z A;  1P3I B;  4H9O A;  5AY8 A;  4JJN C;  2HIO D;  1M18 B;  1U35 C;  1KX4 A;  3WAA C;  4Z66 C;  4WU9 C;  4Z2M H;  3W97 D;  5GXQ A;  5B32 C;  3WTP A;  1EQZ D;  3AZK D;  3AZG B;  3LZ0 D;  1S32 D;  5JA4 B;  3WKJ B;  3MGR B;  3B6F C;  3AV2 A;  4KUD A;  3MVD D;  3X1S C;  3B0D C;  3AZJ C;  5F99 D;  1KX5 A;  4J8V D;  4XUJ A;  3UT9 B;  1JFI A;  5B1L B;  4DQY B;  4H9Q B;  3REK D;  3AZM A;  1P3F D;  5AV9 C;  4J8W D;  1ZLA A;  5DNM A;  1P3I C;  1P3K D;  3AZH D;  3AZL D;  1TZY A;  1P3B B;  5B33 D;  1M18 C;  3MGQ C;  2PYO C;  3AL0 C;  5AVB B;  3C1B D;  1KU5 A;  1F66 B;  2NZD A;  1KX4 D;  5CPI A;  3MNN A;  5AV6 A;  4AWL B;  1ID3 B;  3KUY D;  4YS3 B;  5AV8 B;  2FJ7 A;  4ZUX A;  5BO0 A;  3C1C D;  3WKJ C;  4R8P B;  5B1M A;  4NE6 A;  1TAF B;  1KX3 D;  5GSU B;  3UTA B;  1F1E A;  4J8U B;  3AYW A;  3UT9 C;  3W97 C;  4H9O B;  5AY8 B;  4QLC A;  1KX5 D;  5E5A B;  3AZE B;  3EPJ A;  2BYK B;  3VH6 T;  3LZ0 C;  3AZK C;  4KGC D;  5GXQ B;  5CPK A;  1P3B C;  4Z2M G;  5JRG C;  4KUD B;  3VH5 T;  5B2I C;  1AOI D;  3EPH A;  1H3O A;  3REH A;  3W98 D;  4X23 D;  3A6N D;  1ID3 C;  4YS3 C;  2LY8 A;  3B0C W;  4XUJ B;  4EO5 B;  3LZ1 C;  4WNN B;  2YFV B;  1JFI B;  5CP6 D;  1P3O A;  4R8P C;  3AFA B;  5GT0 D;  3AZM B;  2Y2Q A;  1P3K C;  1A7W A;  5FUG A;  3AZF A;  5GSU C;  4Z5T B;  3UTA C;  3TU4 A;  3LEL D;  5DNN D;  5B2J D;  5B0Z C;  5AY8 C;  1TZY B;  3REJ A;  4DRB A;  4JJN D;  2IO5 C;  1KX4 C;  2Y2P A;  3WAA D;  4WU9 D;  2NZD B;  2ARO A;  3WTP C;  5CPI B;  3MNN B;  2L5A A;  3KFU G;  2FJ7 B;  5B32 D;  5CHL B;  3P5J B;  5JA4 A;  4ZUX B;  3MGR A;  2ZM5 A;  4KUD C;  1KX3 C;  2HUE B;  3AV2 C;  3B6F D;  5B1M B;  3KXB D;  1KX5 C;  3AYW B;  4XUJ C;  4EO5 C;  4J8X D;  3MGP A;  4QLC B;  1P34 B;  4H9N A;  5B24 B;  3AZM C;  1P3M B;  1ZLA C;  5DNM C;  2ZY2 A;  5AV9 D;  1P3O D;  5GT3 A;  3W96 A;  3AV1 B;  5CPK B;  1TZY C;  1P3I D;  1M18 D;  4X23 C;  3A6N C;  2W8S A;  2NZD C;  5AV8 A;  1H3O B;  5CPI C;  3MNN C;  5AV6 C;  2FJ7 C;  3WA9 A;  4H9P A;  5B40 B;  4WU8 B;  3AZG D;  4YM6 B;  3O62 A;  2XD5 A;  2CWE A;  3MGR D;  3WKJ D;  3EG5 B;  1B67 A;  5BNX B;  4J8U A;  5FUG B;  3AZF B;  1T3U A;  3TU4 B;  3AYW C;  5AVC B;  1M19 B;  5E5A A;  3UT9 D;  4QLC C;  3REJ B;  3AZE A;  2BYK A;  5B1L D;  3AN2 A;  5B31 A;  5KDM A;  2ARO B;  3VH6 A;  2ZY5 A;  3UTB B;  1P3B D;  3KXB C;  5JRG D;  5AVB D;  3EPK A;  3VH5 A;  3REH C;  5B2I D;  1F66 D;  4J8X C;  3LJA B;  4WNN A;  5BT1 C;  2YFV A;  1ID3 D;  4YS3 D;  5AV5 B;  3AFA A;  3REL A;  3MGP B;  3LZ1 D;  3MGS B;  4H9N B;  1P3O C;  4R8P D;  4Z5T A;  4ZBJ B;  5GT3 B;  3W96 B;  5GSU D;  1R4V A;  3B0B A;  3UTA D;  4UPK A;  5B0Z D;  5C3I B;  3REJ C;  2NQB A;  5AY8 D;  3REI B;  3NQU B;  2UWX A;  3AZG C;  5GXQ D;  3WTP D;  3WA9 B;  4H9P B;  3MGR C;  3W99 B;  3O62 B;  4KUD D;  2DQN C;  3AV2 D;  2G5H C;  4XZQ A;  1S32 B;  5B1L C;  1P34 A;  5B24 A;  4XUJ D;  3MGP C;  4G92 B;  1P3M A;  2RVQ C;  1M1A B;  3AN2 B;  5B31 B;  1N1J A;  3A1K A;  3AZM D;  3AV1 A;  4ZBJ C;  2F8N H;  5KDM B;  5GT3 C;  5DNM D;  1ZLA D;  3W96 C;  3X1V A;  3REK B;  1P3P B;  4CSR A;  5AVB C;  5C3I C;  1TZY D;  1F66 C;  3IP4 C;  3X1T A;  3AZN A;  3NQJ B;  4AWL C;  5AV8 C;  4E44 A;  5B40 A;  4WU8 A;  5B0Y A;  3EPL A;  2NZD D;  3WTP E;  3WA9 C;  5CPI D;  3MNN D;  5AV6 D;  2ZY4 A;  5BNV B;  1U35 A;  2FJ7 D;  4YM6 A;  3TU4 D;  4ZUX D;  3REL B;  3H0L C;  5BNX A;  3O62 C;  2F2A C;  4J8U C;  5B1M D;  5AVC A;  5CPJ A;  1M19 A;  1BFM A;  3KWQ B;  3AYW D;  5E5A C;  4G92 C;  2F8N B;  3AZE C;  2NQB B;  4QLC D;  3AN2 C;  5B31 C;  5GXQ C;  5B31 G;  3UTB A;  4CAY A;  1ULY A;  3AV1 D;  5CPK D;  1P3G A;  4KGC B;  3LJA A;  3REH D;  5AV5 A;  4XZQ B;  3MGQ A;  2CV5 A;  3MGS A;  5BT1 D;  3FDD A;  5B40 D;  3AFA C;  4WU8 D;  1AOI B;  3REL C;  1P3L A;  4Z5T C;  1N1J B;  3AZI A;  1HQ3 B;  3X1U B;  4LD9 A;  3AZF D;  4H9R B;  1P3A A;  3REI A;  4UUZ B; 
#chains in the Genus database with same CATH homology
 3X1V B;  3B6G A;  4CSR B;  2NQB C;  3NQU A;  3REJ D;  3X1T B;  2HIO A;  5DNN B;  3AZN B;  2F8N G;  1BH9 A;  4ZUX C;  5B0Y B;  2ARO D;  1EQZ A;  1U35 B;  2HUE C;  4Z66 B;  3W99 A;  3AZK A;  5B1M C;  2Y2H A;  3LZ0 A;  1S32 A;  2DF4 C;  4WJ3 C;  3VH5 W;  2XD1 A;  5CPJ B;  3MVD A;  1P34 C;  2VQR A;  5F99 A;  1M1A A;  5B24 C;  5G49 B;  5AV5 D;  1P3M C;  4J8V A;  3MGP D;  3X1S B;  4M6B A;  2RVQ D;  3B0D B;  3AZJ B;  4HGA B;  3AV1 C;  3A1I A;  3REK A;  5CPK C;  1P3P A;  1P3F A;  4KHA A;  4J8W A;  3X1V C;  4NE5 A;  4CAY B;  5GT3 D;  3W96 D;  3NQJ A;  3AZH A;  1WWS A;  2FFF B;  3AZL A;  1P3G B;  2Y2J A;  5B33 A;  2RIQ A;  4G91 B;  2Y2M A;  5BNV A;  4WZS B;  5B0Y C;  5AV8 D;  3C1B A;  5B40 C;  4WU8 C;  3MGQ B;  5BS7 A;  2PYO B;  2CV5 B;  3WA9 D;  3B0C T;  4YM6 C;  2BYM A;  3KUY A;  3R45 A;  3AZF C;  1P3L B;  3C1C A;  3W99 D;  3KWQ A;  3O62 D;  1HTA A;  3TU4 C;  5CPJ C;  5AVC C;  1M19 C;  3AZI B;  5B32 G;  4J8U D;  4LD9 B;  2F8N A;  3V9R B;  1P3A B;  4H9S A;  1KX3 A;  3B6G B;  2JSS A;  5E5A D;  3AZE D;  2G5I C;  4DRA A;  4HGA C;  2HIO B;  2ARO C;  3AN2 D;  5B31 D;  1M1A D;  1BH9 B;  3W97 B;  3UTB C;  4KGC A;  4NE3 A;  1EQZ B;  1P3P D;  1P3G C;  3AZK B;  2J8P A;  3LZ0 B;  4G91 C;  2YFW A;  3LJA C;  5AV5 C;  1AOI A;  2CV5 C;  3MVD B;  3MGS C;  4X23 A;  5JRG B;  3A6N A;  3W98 A;  5F99 B;  5B2I B;  3AFA D;  4J8V B;  3REL D;  1P3L C;  1HQ3 A;  3X1U A;  4H9R A;  5CP6 A;  4UUZ A;  4Z5T D;  5GT0 A;  3AZI C;  4LD9 C;  3LZ1 B;  1P3A C;  4KHA B;  1W2E A;  3KWQ D;  4J8W B;  3REI C;  1P3F B;  3B6G C;  4NFT A;  3LEL A;  5DNN A;  5B2J A;  1P3K B;  3AZH B;  2F8N D;  3AZL B;  2NQB D;  2HIO C;  5B33 B;  4JJN A;  5B0Z B;  1BH8 A;  3C1B B;  3WAA A;  4Z66 A;  4WU9 A;  2BG1 A;  2IO5 B;  1KX4 B;  1EQZ C;  3W99 C;  5B32 A;  2BYM B;  2Y2G A;  3KUY B;  1Z2C B;  2JCH A;  3R45 B;  3WTP B;  3C1C B;  1S32 C;  4WV4 B;  3B6F A;  5G49 A;  3MVD C;  4XZQ D;  3KXB A;  5F99 C;  1M1A C;  1KX3 B;  3X1S A;  3AV2 B;  1P34 D;  3AZJ A;  1Q9C A;  5B24 D;  4J8V C;  1P3M D;  4J8X A;  1PZR A;  4E45 A;  1KX5 B;  3F6T A;  3REK C;  1P3P C;  1P3F C;  1HQ3 D;  3X1U D;  4J8W C;  3H0R C;  5AV9 A;  2ZY3 A;  3X1V D;  1WWI A;  3AZH C;  3AZL C;  1P3I A;  2F8N K;  5B33 C;  1ZLA B;  2Y2N A;  5DNM B;  3X1T D;  2YFW B;  1M18 A;  3AZN D;  2PYO A;  3C1B C;  5B0Y D;  5BS7 C;  3W98 B;  4X23 B;  3A6N B;  3KUY C;  1U35 D;  4Z66 D;  4YM6 D;  3AZG A;  2Y2O A;  3C1C C;  5AV6 B;  3KWQ C;  5CP6 B;  3V9R A;  3WKJ A;  5GT0 B;  5BO0 B;  5CPJ D;  5AVC D;  1M19 D;  4H9S C;  3LEL B;  5B2J B;  3W97 A;  3UT9 A;  3KSY A;  3X1S D;  3AZJ D;  4JJN B;  5B1L A;  3VH6 W;  1BH8 B;  4H9Q A;  3H0M C;  3WAA B;  4WU9 B;  2Y2K A;  2Y2I A;  4KGC C;  3UTB D;  2JE5 A;  5B32 B;  1P3G D;  1P3B A;  4XZQ C;  3LJA D;  5JRG A;  5AVB A;  1AOI C;  3B6F B;  1B6W A;  1F66 A;  5B2I A;  3W98 C;  3KXB B;  3MGQ D;  2PYO D;  2CV5 D;  3MGS D;  1ID3 A;  4YS3 A;  2Y2L A;  3REH B;  4J8X B;  1HQ3 C;  3X1U C;  1P3L D;  3LZ1 A;  5CP6 C;  5GT0 C;  4R8P A;  3AZI D;  4LD9 D;  1P3K A;  1TAF A;  1P3A D;  5AV9 B;  3X1T C;  3REI D;  1P3O B;  3B6G D;  3LEL C;  5DNN C;  5B2J C;  5GSU A;  3UTA A;  3AZN C;  5B0Z A;  1P3I B;  4H9O A;  5AY8 A;  4JJN C;  2HIO D;  1M18 B;  1U35 C;  1KX4 A;  3WAA C;  4Z66 C;  4WU9 C;  4Z2M H;  3W97 D;  5GXQ A;  5B32 C;  3WTP A;  1EQZ D;  3AZK D;  3AZG B;  3LZ0 D;  1S32 D;  5JA4 B;  3WKJ B;  3MGR B;  3B6F C;  3AV2 A;  4KUD A;  3MVD D;  3X1S C;  3B0D C;  3AZJ C;  5F99 D;  1KX5 A;  4J8V D;  4XUJ A;  3UT9 B;  1JFI A;  5B1L B;  4DQY B;  4H9Q B;  3REK D;  3AZM A;  1P3F D;  5AV9 C;  4J8W D;  1ZLA A;  5DNM A;  1P3I C;  1P3K D;  3AZH D;  3AZL D;  1TZY A;  1P3B B;  5B33 D;  1M18 C;  3MGQ C;  2PYO C;  3AL0 C;  5AVB B;  3C1B D;  1KU5 A;  1F66 B;  2NZD A;  1KX4 D;  5CPI A;  3MNN A;  5AV6 A;  4AWL B;  1ID3 B;  3KUY D;  4YS3 B;  5AV8 B;  2FJ7 A;  4ZUX A;  5BO0 A;  3C1C D;  3WKJ C;  4R8P B;  5B1M A;  4NE6 A;  1TAF B;  1KX3 D;  5GSU B;  3UTA B;  1F1E A;  4J8U B;  3AYW A;  3UT9 C;  3W97 C;  4H9O B;  5AY8 B;  4QLC A;  1KX5 D;  5E5A B;  3AZE B;  3EPJ A;  2BYK B;  3VH6 T;  3LZ0 C;  3AZK C;  4KGC D;  5GXQ B;  5CPK A;  1P3B C;  4Z2M G;  5JRG C;  4KUD B;  3VH5 T;  5B2I C;  1AOI D;  3EPH A;  1H3O A;  3REH A;  3W98 D;  4X23 D;  3A6N D;  1ID3 C;  4YS3 C;  2LY8 A;  3B0C W;  4XUJ B;  4EO5 B;  3LZ1 C;  4WNN B;  2YFV B;  1JFI B;  5CP6 D;  1P3O A;  4R8P C;  3AFA B;  5GT0 D;  3AZM B;  2Y2Q A;  1P3K C;  1A7W A;  5FUG A;  3AZF A;  5GSU C;  4Z5T B;  3UTA C;  3TU4 A;  3LEL D;  5DNN D;  5B2J D;  5B0Z C;  5AY8 C;  1TZY B;  3REJ A;  4DRB A;  4JJN D;  2IO5 C;  1KX4 C;  2Y2P A;  3WAA D;  4WU9 D;  2NZD B;  2ARO A;  3WTP C;  5CPI B;  3MNN B;  2L5A A;  3KFU G;  2FJ7 B;  5B32 D;  5CHL B;  3P5J B;  5JA4 A;  4ZUX B;  3MGR A;  2ZM5 A;  4KUD C;  1KX3 C;  2HUE B;  3AV2 C;  3B6F D;  5B1M B;  3KXB D;  1KX5 C;  3AYW B;  4XUJ C;  4EO5 C;  4J8X D;  3MGP A;  4QLC B;  1P34 B;  4H9N A;  5B24 B;  3AZM C;  1P3M B;  1ZLA C;  5DNM C;  2ZY2 A;  5AV9 D;  1P3O D;  5GT3 A;  3W96 A;  3AV1 B;  5CPK B;  1TZY C;  1P3I D;  1M18 D;  4X23 C;  3A6N C;  2W8S A;  2NZD C;  5AV8 A;  1H3O B;  5CPI C;  3MNN C;  5AV6 C;  2FJ7 C;  3WA9 A;  4H9P A;  5B40 B;  4WU8 B;  3AZG D;  4YM6 B;  3O62 A;  2XD5 A;  2CWE A;  3MGR D;  3WKJ D;  3EG5 B;  1B67 A;  5BNX B;  4J8U A;  5FUG B;  3AZF B;  1T3U A;  3TU4 B;  3AYW C;  5AVC B;  1M19 B;  5E5A A;  3UT9 D;  4QLC C;  3REJ B;  3AZE A;  2BYK A;  5B1L D;  3AN2 A;  5B31 A;  5KDM A;  2ARO B;  3VH6 A;  2ZY5 A;  3UTB B;  1P3B D;  3KXB C;  5JRG D;  5AVB D;  3EPK A;  3VH5 A;  3REH C;  5B2I D;  1F66 D;  4J8X C;  3LJA B;  4WNN A;  5BT1 C;  2YFV A;  1ID3 D;  4YS3 D;  5AV5 B;  3AFA A;  3REL A;  3MGP B;  3LZ1 D;  3MGS B;  4H9N B;  1P3O C;  4R8P D;  4Z5T A;  4ZBJ B;  5GT3 B;  3W96 B;  5GSU D;  1R4V A;  3B0B A;  3UTA D;  4UPK A;  5B0Z D;  5C3I B;  3REJ C;  2NQB A;  5AY8 D;  3REI B;  3NQU B;  2UWX A;  3AZG C;  5GXQ D;  3WTP D;  3WA9 B;  4H9P B;  3MGR C;  3W99 B;  3O62 B;  4KUD D;  2DQN C;  3AV2 D;  2G5H C;  4XZQ A;  1S32 B;  5B1L C;  1P34 A;  5B24 A;  4XUJ D;  3MGP C;  4G92 B;  1P3M A;  2RVQ C;  1M1A B;  3AN2 B;  5B31 B;  1N1J A;  3A1K A;  3AZM D;  3AV1 A;  4ZBJ C;  2F8N H;  5KDM B;  5GT3 C;  5DNM D;  1ZLA D;  3W96 C;  3X1V A;  3REK B;  1P3P B;  4CSR A;  5AVB C;  5C3I C;  1TZY D;  1F66 C;  3IP4 C;  3X1T A;  3AZN A;  3NQJ B;  4AWL C;  5AV8 C;  4E44 A;  5B40 A;  4WU8 A;  5B0Y A;  3EPL A;  2NZD D;  3WTP E;  3WA9 C;  5CPI D;  3MNN D;  5AV6 D;  2ZY4 A;  5BNV B;  1U35 A;  2FJ7 D;  4YM6 A;  3TU4 D;  4ZUX D;  3REL B;  3H0L C;  5BNX A;  3O62 C;  2F2A C;  4J8U C;  5B1M D;  5AVC A;  5CPJ A;  1M19 A;  1BFM A;  3KWQ B;  3AYW D;  5E5A C;  4G92 C;  2F8N B;  3AZE C;  2NQB B;  4QLC D;  3AN2 C;  5B31 C;  5GXQ C;  5B31 G;  3UTB A;  4CAY A;  1ULY A;  3AV1 D;  5CPK D;  1P3G A;  4KGC B;  3LJA A;  3REH D;  5AV5 A;  4XZQ B;  3MGQ A;  2CV5 A;  3MGS A;  5BT1 D;  3FDD A;  5B40 D;  3AFA C;  4WU8 D;  1AOI B;  3REL C;  1P3L A;  4Z5T C;  1N1J B;  3AZI A;  1HQ3 B;  3X1U B;  4LD9 A;  3AZF D;  4H9R B;  1P3A A;  3REI A;  4UUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...