5DNNA

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnA00
3REJB 1KX3A 3AV2C 5B1MD 2CWEA 1ID3B 2YFWB 5GT0C 5GXQB 4WNNA 5AV6A 4Z66A 3KXBD 5B33D 3B0DB 3AZLD 3MVDA 5AV5B 5F99C 4J8WA 5F99B 1P3KA 5B33B 5BO0B 1P3GD 1ID3A 1HTAA 5B0ZD 1AOIB 3W99D 5GXQA 3W98C 3AZHD 5B0YB 4G92C 3W98B 1BH9B 4G92B 5AV9A 5G49B 2AROC 5GSUA 4KUDC 3AYWC 1EQZB 5AV5A 4Z2MH 5B1MA 1P3GB 1P3PC 1F1EA 4J8XC 1P3PB 2F8NH 3A6NC 4H9PB 4J8XB 2IO5C 3A6NB 3AZJC 3NQJA 3AFAD 1M19D 3KXBA 5B33A 3LJAC 5BO0A 3AZLA 2CV5B 1P3FC 4X23C 3AZKD 5B40D 5B1LC 4H9RA 5FUGB 5B24C 5AV8C 3NQUB 5B32B 3X1VD 1KX4C 1BH9A 3WA9C 3AZEC 4ZBJB 3WA9B 3MGSC 4NE5A 5E5AC 5JRGD 1P3GA 5AVBD 1KU5A 1M18D 5B40B 5B0ZA 4H9PA 4WU9C 3W96C 3AZHA 3X1VB 5BT1D 3MGRC 3UTAD 3KUYC 4WU9B 1P34D 1P3ID 4HGAB 3KUYB 2CV5A 5DNNC 2BYKB 3X1SD 1TAFA 2YFVA 5BNXA 3LZ1C 5AVBB 1N1JB 4QLCB 3LZ1B 2BYMB 1R4VA 3X1UD 5CPID 3AFAA 1M19A 5CP6D 2NZDB 3O62C 3VH6W 4H9QB 5B40A 3X1TD 3X1VA 3MGQB 4Z2MG 3WTPD 1S32C 5CPIB 4LD9B 1S32B 5CP6B 2F8NG 3WKJD 5JRGA 5AVBA 1P3OC 3AZMC 1N1JA 1KX5C 3REID 5GT3C 4AWLC 4WU8C 5GT3B 4AWLB 5CPJC 3UTAA 1P34A 1P3IA 3AZFD 3REHC 5B31G 3X1SA 4H9QA 3KWQD 1U35B 2FJ7D 4Z5TD 4XUJB 3UT9D 5DNMC 2NQBC 1ULYA 2NQBB 5B2JD 3X1UA 1HQ3C 4YM6C 5CPIA 2L5AA 5CP6A 3AZFB 5B2IC 1H3OA 3AZND 3KWQB 3REJD 5B2IB 3LELC 4UUZA 1Q9CA 4Z5TB 3UT9B 5GXQD 3WTPA 5GT0D 5B2JB 1U35A 4CAYB 3WKJA 4E44A 1KX3C 5AV5D 3WAAB 3REIA 3AZGC 5F99D 3AV2B 4Z66C 3AZFA 3TU4C 5GT0B 3KWQA 2FJ7A 5BS7C 4Z5TA 3UT9A 5CHLB 3B6GC 1AOID 4KHAB 1P3LC 4R8PC 5B0YD 3MGPC 5B2JA 4R8PB 3W98D 3REKC 1P3KC 3C1BC 4H9NB 1P3BC 3AZNA 1EQZD 3REJA 2AROD 5AY8C 1P3BB 3WAAA 4KUDD 5AY8B 3AN2C 1P3PD 2YFWA 3AN2B 4J8XD 3A6ND 5GT0A 1ZLAC 3B0CT 3AZJD 4J8UC 1TZYC 2CV5D 5CPKC 3AV1C 2F8NB 2AROB 4KUDB 3AYWB 4KHAA 4X23D 3VH5A 3AV1B 5B1LD 5B32D 5F99A 5B24D 4NE3A 1KX4D 3WA9D 3AZED 5B31C 1BH8B 2IO5B 3AZJB 3AZIC 3LJAB 3B0BA 1P3FB 1AOIA 4X23B 4DRBA 5B1LB 5B0YA 4WU9D 5B24B 3W96D 3VH5T 5AV8B 3W98A 3KUYD 1F66C 5G49A 1KX4B 3AZEB 1EQZA 2AROA 4KUDA 3MNNC 3MGSB 5E5AB 3MNNB 3W99C 3V9RB 4QLCD 3LZ1D 1P3PA 4J8XA 3LZ0C 5C3IC 3A6NA 4J8VC 3LZ0B 3W96B 1P3MC 2NZDD 3AZJA 3MGRB 4J8VB 1P3MB 3B6FC 5DNNB 5FUGA 4X23A 3B6FB 5B1LA 3NQUA 5B32A 4XZQC 3MGQD 5B24A 5AV8A 3C1CC 4XZQB 3AFAC 1M19C 2PYOC 1KX4A 3C1CB 3WA9A 3AZEA 4LD9D 1S32D 3AZKC 4YS3C 4JJNC 3O62B 3V9RA 1BFMA 4JJNB 3AZMD 5KDMB 1KX5D 5GT3D 4WU9A 3W96A 2RVQC 5CPJD 3KUYA 4H9SC 2BYKA 1U35D 3REHD 1M18C 4XUJD 1P3AC 4QLCA 5AVCC 3LZ1A 3UTBC 5BT1C 2BYMA 5DNMD 3AZMB 1P34C 1P3AB 1P3IC 1P3OB 2NQBD 1KX5B 4KGCC 3WTPE 4ZUXC 4KGCB 4WU8B 2NZDA 5CPJB 4ZUXB 4YM6D 1M1AC 3W97C 3REHB 5B2ID 3W97B 3MGQA 5DNMB 3RELC 4LD9A 4M6BA 3RELB 1S32A 1HQ3B 4H9OB 4YM6B 2HIOC 3WAAD 3X1TC 3AZMA 2HIOB 3AV2D 1KX5A 5GT3A 3LELB 3AZGD 5CPJA 1JFIB 3R45B 3REHA 3TU4D 4XUJA 1KX3B 2HUEC 5DNMA 2F8NK 3B6GD 2NQBA 2HUEB 4WZSB 4G91C 1P3LD 4R8PD 3AZGB 5AV6C 4WNNB 1HQ3A 4YM6A 2FJ7C 3REKD 4Z66B 3C1BD 3TU4B 5B2IA 3MVDC 1P3BD 5AY8D 4J8WC 3AN2D 3B6GB 3R45A 1P3LB 5BNVB 1ZLAD 4CAYA 3MGPB 3REJC 3REKB 4J8UD 1TZYD 3C1BB 1P3KB 2F8ND 5CPKD 3AYWD 3AV1D 1ID3C 3AV2A 5GXQC 1B6WA 3AZGA 5JA4B 3B0CW 3B0DC 5AV9C 5GSUC 3TU4A 1ZLAB 5AV9B 5AV5C 5B31D 5GSUB 3LJAD 5B1MC 4J8UB 1TZYB 5BS7A 3AZID 1P3FD 5B1MB 5CPKB 3B6GA 1P3LA 5BNVA 5AV8D 4R8PA 3MGPA 3KXBC 5B33C 4H9NA 3AZLC 3REKA 3NQJB 3C1BA 3KXBB 1F66D 3AZLB 1P3BA 3MGSD 5B31B 5AY8A 5E5AD 1AOIC 3AZIB 3MNND 4H9RB 5B0YC 3VH5W 3AN2A 5JA4A 4NFTA 3LZ0D 3MGRD 1EQZC 4J8VD 1ZLAA 1P3MD 4E45A 1P3GC 4J8UA 1TZYA 1F66B 2F8NA 1B67A 5DNND 5CPKA 3AYWA 3AV1A 3B6FD 5B0ZC 3AZHC 5B0ZB 4XZQD 3W99B 3AZHB 3C1CD 2CV5C 2PYOD 5C3IB 1BH8A 5B31A 2JSSA 1TAFB 3LJAA 3AZIA 4YS3D 3O62D 2YFVB 5B32C 4JJND 1P3FA 5BNXB 4ZBJC 4NE6A 2RVQD 3AFAB 1M19B 1F66A 2PYOB 3MGSA 1WWIA 5B40C 5E5AA 3AZKB 3MNNA 4YS3B 3X1VC 1P3AD 1P3OD 5AVCD 3W99A 4HGAC 3UTBD 4KGCD 3LZ0A 4WU8D 3MGRA 4ZUXD 4J8VA 5JRGC 1P3MA 3VH6A 5AVBC 1M1AD 5DNNA 3W97D 5JRGB 4QLCC 3B6FA 1M18B 3UTAC 4XZQA 5AVCB 2NZDC 3UTBB 1P34B 3C1CA 1A7WA 4DRAA 3UTAB 1P3IB 2PYOA 3RELD 3X1SC 1HQ3D 3X1SB 3AZKA 3O62A 4YS3A 1M1AB 4JJNA 3MGQC 2HIOD 3VH6T 5KDMA 4EO5C 4CSRB 3LELD 3X1UC 4EO5B 5CPIC 4LD9C 5CP6C 3X1UB 2LY8A 4H9SA 1H3OB 1M18A 1KX3D 1WWSA 4UUZB 1P3AA 1P3OA 5AVCA 3X1TB 3UTBA 3WTPC 4KGCA 4WU8A 1U35C 3WTPB 4ZUXA 3WKJC 5AV6D 4Z66D 4XUJC 1M1AA 3WKJB 3W97A 3MVDD 3REIC 3KSYA 4CSRA 5B32G 4J8WD 3REIB 4WV4B 3AZFC 3RELA 3KWQC 3MGPD 4G91B 4H9OA 5AV6B 1P3KD 4Z5TC 2FJ7B 3UT9C 2HIOA 3MVDB 3X1TA 1ID3D 3LELA 4J8WB 5B2JC 1JFIA 3AZNC 5AV9D 3WAAC 5GSUD 3AZNB
chains in the Genus database with same CATH superfamily
3REJB 1KX3A 3AV2C 5B1MD 2CWEA 1ID3B 2YFWB 3H0LC 5GT0C 5GXQB 4WNNA 5AV6A 4Z66A 3KXBD 5B33D 3B0DB 3AZLD 3MVDA 5AV5B 5F99C 4J8WA 5F99B 1P3KA 2F2AC 5B33B 5BO0B 1P3GD 2RIQA 1ID3A 1HTAA 5B0ZD 1AOIB 3W99D 5GXQA 3W98C 3AZHD 5B0YB 4G92C 2VQRA 3W98B 1BH9B 4G92B 5AV9A 5G49B 2AROC 5GSUA 4KUDC 1PZRA 3AYWC 1EQZB 5AV5A 4Z2MH 5B1MA 1P3GB 1P3PC 1F1EA 4J8XC 1P3PB 2F8NH 3A6NC 4H9PB 4J8XB 2IO5C 3A6NB 3AZJC 3NQJA 3AFAD 1M19D 3KXBA 5B33A 3LJAC 5BO0A 3AZLA 2CV5B 1T3UA 1P3FC 4X23C 3AZKD 5B40D 5B1LC 4H9RA 5FUGB 5B24C 5AV8C 3NQUB 5B32B 3X1VD 1KX4C 1BH9A 3WA9C 3AZEC 4ZBJB 3WA9B 3MGSC 4NE5A 5E5AC 5JRGD 1P3GA 5AVBD 1KU5A 1M18D 3H0MC 5B40B 5B0ZA 4H9PA 4WU9C 3W96C 3AZHA 3X1VB 5BT1D 3MGRC 3UTAD 3KUYC 4WU9B 1P34D 1P3ID 4HGAB 3KUYB 2CV5A 5DNNC 2BYKB 3X1SD 1TAFA 2YFVA 5BNXA 3LZ1C 5AVBB 1N1JB 4QLCB 3LZ1B 2BYMB 1R4VA 3X1UD 5CPID 3AFAA 1M19A 5CP6D 2NZDB 3O62C 3VH6W 4H9QB 2Y2OA 5B40A 3X1TD 3X1VA 3MGQB 2Y2HA 4Z2MG 3WTPD 1S32C 5CPIB 4LD9B 1S32B 5CP6B 2F8NG 3WKJD 2XD5A 5JRGA 5AVBA 1P3OC 3AZMC 1N1JA 3AL0C 1KX5C 3REID 5GT3C 4AWLC 4WU8C 5GT3B 4AWLB 5CPJC 3UTAA 1P34A 1P3IA 2G5IC 3AZFD 3REHC 5B31G 3X1SA 4H9QA 3KWQD 1U35B 2FJ7D 4Z5TD 4XUJB 3UT9D 5DNMC 2NQBC 1ULYA 2NQBB 5B2JD 3X1UA 1HQ3C 4YM6C 5CPIA 2L5AA 5CP6A 3AZFB 5B2IC 1H3OA 3AZND 3KWQB 3REJD 5B2IB 3LELC 4UUZA 1Q9CA 4Z5TB 3UT9B 3F6TA 5GXQD 3WTPA 5GT0D 5B2JB 1U35A 4CAYB 3WKJA 4E44A 1KX3C 5AV5D 3WAAB 3REIA 2Y2PA 3AZGC 2ZY5A 5F99D 3AV2B 4Z66C 3AZFA 3TU4C 5GT0B 3KWQA 2FJ7A 5BS7C 3A1KA 4Z5TA 2ZY2A 3UT9A 5CHLB 3B6GC 1AOID 4KHAB 1P3LC 4R8PC 5B0YD 3MGPC 5B2JA 4R8PB 3W98D 3REKC 1P3KC 3C1BC 4H9NB 1P3BC 3AZNA 1EQZD 3REJA 2AROD 5AY8C 1P3BB 3WAAA 4KUDD 5AY8B 3AN2C 1P3PD 2YFWA 2Y2IA 3AN2B 4J8XD 3A6ND 5GT0A 1ZLAC 3B0CT 3AZJD 4J8UC 1TZYC 2ZM5A 2CV5D 5CPKC 3AV1C 2F8NB 2AROB 4KUDB 3AYWB 4KHAA 4X23D 3VH5A 3AV1B 5B1LD 5B32D 5F99A 5B24D 4NE3A 1KX4D 3WA9D 3AZED 5B31C 1BH8B 2IO5B 3AZJB 3AZIC 3A1IA 3LJAB 3B0BA 1P3FB 1AOIA 4X23B 4DRBA 5B1LB 5B0YA 4WU9D 5B24B 3W96D 3VH5T 5AV8B 3W98A 3KUYD 1F66C 5G49A 1KX4B 3AZEB 1EQZA 2AROA 4KUDA 3MNNC 3MGSB 5E5AB 3MNNB 3W99C 3V9RB 4QLCD 2BG1A 3LZ1D 1P3PA 4J8XA 3LZ0C 5C3IC 3A6NA 4J8VC 3LZ0B 3W96B 1P3MC 2NZDD 3AZJA 3MGRB 4J8VB 1P3MB 3B6FC 5DNNB 5FUGA 4X23A 3B6FB 5B1LA 3NQUA 5B32A 4XZQC 3MGQD 5B24A 5AV8A 3C1CC 4XZQB 3AFAC 1M19C 2PYOC 1KX4A 3C1CB 3WA9A 3AZEA 4LD9D 1S32D 3AZKC 4YS3C 4JJNC 3O62B 3V9RA 2J8PA 1BFMA 4JJNB 3AZMD 5KDMB 3EPLA 1KX5D 5GT3D 4WU9A 3W96A 2RVQC 5CPJD 2Y2QA 3KUYA 4H9SC 2BYKA 1U35D 3REHD 1M18C 4XUJD 1P3AC 4QLCA 5AVCC 3LZ1A 3UTBC 5BT1C 2BYMA 5DNMD 3AZMB 1P34C 1P3AB 1P3IC 1P3OB 2NQBD 1KX5B 4KGCC 3WTPE 4ZUXC 4KGCB 4WU8B 2NZDA 5CPJB 4ZUXB 4YM6D 1M1AC 3W97C 3REHB 5B2ID 3W97B 4WJ3C 3MGQA 5DNMB 3RELC 4LD9A 2DQNC 4M6BA 3RELB 1S32A 1HQ3B 4H9OB 4YM6B 2HIOC 3WAAD 3X1TC 3AZMA 2HIOB 3AV2D 1KX5A 5GT3A 3LELB 3AZGD 5CPJA 1JFIB 3R45B 3REHA 3TU4D 4XUJA 1KX3B 2HUEC 5DNMA 2F8NK 3B6GD 2NQBA 2HUEB 4WZSB 4G91C 1P3LD 4R8PD 3AZGB 5AV6C 4WNNB 1HQ3A 4YM6A 2FJ7C 3REKD 4Z66B 3C1BD 3TU4B 5B2IA 3MVDC 1P3BD 5AY8D 4J8WC 2Y2NA 3AN2D 3B6GB 4UPKA 3R45A 1P3LB 5BNVB 1ZLAD 4CAYA 3MGPB 3REJC 3EPHA 3REKB 4J8UD 1TZYD 3C1BB 1P3KB 2F8ND 2Y2JA 5CPKD 3AYWD 3AV1D 1ID3C 3AV2A 5GXQC 1B6WA 3AZGA 5JA4B 3B0CW 3EG5B 3B0DC 2JE5A 5AV9C 5GSUC 3TU4A 1ZLAB 5AV9B 5AV5C 5B31D 2FFFB 5GSUB 3LJAD 5B1MC 4J8UB 1TZYB 5BS7A 3AZID 1P3FD 5B1MB 5CPKB 3B6GA 2W8SA 1P3LA 5BNVA 5AV8D 4R8PA 3MGPA 3KXBC 5B33C 4H9NA 3AZLC 3REKA 3NQJB 3C1BA 3KXBB 1F66D 3AZLB 1P3BA 3MGSD 5B31B 5AY8A 5E5AD 1AOIC 3AZIB 3MNND 3KFUG 4H9RB 5B0YC 3VH5W 3AN2A 5JA4A 4NFTA 3LZ0D 3MGRD 1EQZC 4J8VD 1ZLAA 3P5JB 1P3MD 4E45A 1P3GC 4J8UA 1TZYA 1F66B 2F8NA 1B67A 5DNND 5CPKA 3AYWA 3AV1A 3B6FD 5B0ZC 3AZHC 5B0ZB 4XZQD 3W99B 3AZHB 3C1CD 3EPJA 2CV5C 2PYOD 5C3IB 1BH8A 5B31A 2JSSA 1TAFB 3LJAA 3AZIA 4YS3D 3O62D 2YFVB 5B32C 4JJND 1P3FA 5BNXB 2Y2MA 4ZBJC 4NE6A 2RVQD 3FDDA 3AFAB 1M19B 1F66A 2Y2GA 2PYOB 3MGSA 1WWIA 5B40C 5E5AA 3AZKB 3MNNA 4YS3B 3X1VC 1P3AD 1P3OD 5AVCD 3W99A 3H0RC 4HGAC 3UTBD 4KGCD 3LZ0A 4WU8D 3MGRA 4ZUXD 4J8VA 5JRGC 1P3MA 3VH6A 5AVBC 1M1AD 5DNNA 3W97D 5JRGB 2ZY3A 4QLCC 3B6FA 1M18B 3UTAC 4XZQA 5AVCB 2NZDC 3UTBB 1P34B 3C1CA 1A7WA 4DRAA 3UTAB 1P3IB 2PYOA 3RELD 3X1SC 1HQ3D 3X1SB 3AZKA 3O62A 4YS3A 1M1AB 4JJNA 3MGQC 2HIOD 3VH6T 5KDMA 4EO5C 4CSRB 3LELD 4EO5B 5CPIC 3X1UC 4LD9C 5CP6C 4DQYB 2ZY4A 3X1UB 2LY8A 4H9SA 1H3OB 1M18A 1KX3D 1WWSA 4UUZB 1P3AA 3EPKA 1P3OA 5AVCA 3X1TB 3UTBA 3WTPC 4KGCA 2DF4C 4WU8A 2Y2KA 1U35C 3WTPB 4ZUXA 3WKJC 5AV6D 4Z66D 1W2EA 4XUJC 1M1AA 3WKJB 3W97A 3MVDD 3REIC 3KSYA 4CSRA 5B32G 4J8WD 2XD1A 3REIB 4WV4B 3AZFC 2Y2LA 3RELA 3KWQC 3MGPD 4G91B 4H9OA 5AV6B 1P3KD 2G5HC 4Z5TC 2FJ7B 3UT9C 2HIOA 3MVDB 3X1TA 1ID3D 2UWXA 3LELA 3IP4C 4J8WB 5B2JC 1JFIA 2JCHA 3AZNC 5AV9D 3WAAC 5GSUD 1Z2CB 3AZNB
chains in the Genus database with same CATH topology
3REJB 1KX3A 3AV2C 5B1MD 2CWEA 1ID3B 2YFWB 3H0LC 5GT0C 5GXQB 4WNNA 5AV6A 4Z66A 3KXBD 5B33D 3B0DB 3AZLD 3MVDA 5AV5B 5F99C 4J8WA 5F99B 1P3KA 2F2AC 5B33B 5BO0B 1P3GD 2RIQA 1ID3A 1HTAA 5B0ZD 1AOIB 3W99D 5GXQA 3W98C 3AZHD 5B0YB 4G92C 2VQRA 3W98B 1BH9B 4G92B 5AV9A 5G49B 2AROC 5GSUA 4KUDC 1PZRA 3AYWC 1EQZB 5AV5A 4Z2MH 5B1MA 1P3GB 1P3PC 1F1EA 4J8XC 1P3PB 2F8NH 3A6NC 4H9PB 4J8XB 2IO5C 3A6NB 3AZJC 3NQJA 3AFAD 1M19D 3KXBA 5B33A 3LJAC 5BO0A 3AZLA 2CV5B 1T3UA 1P3FC 4X23C 3AZKD 5B40D 5B1LC 4H9RA 5FUGB 5B24C 5AV8C 3NQUB 5B32B 3X1VD 1KX4C 1BH9A 3WA9C 3AZEC 4ZBJB 3WA9B 3MGSC 4NE5A 5E5AC 5JRGD 1P3GA 5AVBD 1KU5A 1M18D 3H0MC 5B40B 5B0ZA 4H9PA 4WU9C 3W96C 3AZHA 3X1VB 5BT1D 3MGRC 3UTAD 3KUYC 4WU9B 1P34D 1P3ID 4HGAB 3KUYB 2CV5A 5DNNC 2BYKB 3X1SD 1TAFA 2YFVA 5BNXA 3LZ1C 5AVBB 1N1JB 4QLCB 3LZ1B 2BYMB 1R4VA 3X1UD 5CPID 3AFAA 1M19A 5CP6D 2NZDB 3O62C 3VH6W 4H9QB 2Y2OA 5B40A 3X1TD 3X1VA 3MGQB 2Y2HA 4Z2MG 3WTPD 1S32C 5CPIB 4LD9B 1S32B 5CP6B 2F8NG 3WKJD 2XD5A 5JRGA 5AVBA 1P3OC 3AZMC 1N1JA 3AL0C 1KX5C 3REID 5GT3C 4AWLC 4WU8C 5GT3B 4AWLB 5CPJC 3UTAA 1P34A 1P3IA 2G5IC 3AZFD 3REHC 5B31G 3X1SA 4H9QA 3KWQD 1U35B 2FJ7D 4Z5TD 4XUJB 3UT9D 5DNMC 2NQBC 1ULYA 2NQBB 5B2JD 3X1UA 1HQ3C 4YM6C 5CPIA 2L5AA 5CP6A 3AZFB 5B2IC 1H3OA 3AZND 3KWQB 3REJD 5B2IB 3LELC 4UUZA 1Q9CA 4Z5TB 3UT9B 3F6TA 5GXQD 3WTPA 5GT0D 5B2JB 1U35A 4CAYB 3WKJA 4E44A 1KX3C 5AV5D 3WAAB 3REIA 2Y2PA 3AZGC 2ZY5A 5F99D 3AV2B 4Z66C 3AZFA 3TU4C 5GT0B 3KWQA 2FJ7A 5BS7C 3A1KA 4Z5TA 2ZY2A 3UT9A 5CHLB 3B6GC 1AOID 4KHAB 1P3LC 4R8PC 5B0YD 3MGPC 5B2JA 4R8PB 3W98D 3REKC 1P3KC 3C1BC 4H9NB 1P3BC 3AZNA 1EQZD 3REJA 2AROD 5AY8C 1P3BB 3WAAA 4KUDD 5AY8B 3AN2C 1P3PD 2YFWA 2Y2IA 3AN2B 4J8XD 3A6ND 5GT0A 1ZLAC 3B0CT 3AZJD 4J8UC 1TZYC 2ZM5A 2CV5D 5CPKC 3AV1C 2F8NB 2AROB 4KUDB 3AYWB 4KHAA 4X23D 3VH5A 3AV1B 5B1LD 5B32D 5F99A 5B24D 4NE3A 1KX4D 3WA9D 3AZED 5B31C 1BH8B 2IO5B 3AZJB 3AZIC 3A1IA 3LJAB 3B0BA 1P3FB 1AOIA 4X23B 4DRBA 5B1LB 5B0YA 4WU9D 5B24B 3W96D 3VH5T 5AV8B 3W98A 3KUYD 1F66C 5G49A 1KX4B 3AZEB 1EQZA 2AROA 4KUDA 3MNNC 3MGSB 5E5AB 3MNNB 3W99C 3V9RB 4QLCD 2BG1A 3LZ1D 1P3PA 4J8XA 3LZ0C 5C3IC 3A6NA 4J8VC 3LZ0B 3W96B 1P3MC 2NZDD 3AZJA 3MGRB 4J8VB 1P3MB 3B6FC 5DNNB 5FUGA 4X23A 3B6FB 5B1LA 3NQUA 5B32A 4XZQC 3MGQD 5B24A 5AV8A 3C1CC 4XZQB 3AFAC 1M19C 2PYOC 1KX4A 3C1CB 3WA9A 3AZEA 4LD9D 1S32D 3AZKC 4YS3C 4JJNC 3O62B 3V9RA 2J8PA 1BFMA 4JJNB 3AZMD 5KDMB 3EPLA 1KX5D 5GT3D 4WU9A 3W96A 2RVQC 5CPJD 2Y2QA 3KUYA 4H9SC 2BYKA 1U35D 3REHD 1M18C 4XUJD 1P3AC 4QLCA 5AVCC 3LZ1A 3UTBC 5BT1C 2BYMA 5DNMD 3AZMB 1P34C 1P3AB 1P3IC 1P3OB 2NQBD 1KX5B 4KGCC 3WTPE 4ZUXC 4KGCB 4WU8B 2NZDA 5CPJB 4ZUXB 4YM6D 1M1AC 3W97C 3REHB 5B2ID 3W97B 4WJ3C 3MGQA 5DNMB 3RELC 4LD9A 2DQNC 4M6BA 3RELB 1S32A 1HQ3B 4H9OB 4YM6B 2HIOC 3WAAD 3X1TC 3AZMA 2HIOB 3AV2D 1KX5A 5GT3A 3LELB 3AZGD 5CPJA 1JFIB 3R45B 3REHA 3TU4D 4XUJA 1KX3B 2HUEC 5DNMA 2F8NK 3B6GD 2NQBA 2HUEB 4WZSB 4G91C 1P3LD 4R8PD 3AZGB 5AV6C 4WNNB 1HQ3A 4YM6A 2FJ7C 3REKD 4Z66B 3C1BD 3TU4B 5B2IA 3MVDC 1P3BD 5AY8D 4J8WC 2Y2NA 3AN2D 3B6GB 4UPKA 3R45A 1P3LB 5BNVB 1ZLAD 4CAYA 3MGPB 3REJC 3EPHA 3REKB 4J8UD 1TZYD 3C1BB 1P3KB 2F8ND 2Y2JA 5CPKD 3AYWD 3AV1D 1ID3C 3AV2A 5GXQC 1B6WA 3AZGA 5JA4B 3B0CW 3EG5B 3B0DC 2JE5A 5AV9C 5GSUC 3TU4A 1ZLAB 5AV9B 5AV5C 5B31D 2FFFB 5GSUB 3LJAD 5B1MC 4J8UB 1TZYB 5BS7A 3AZID 1P3FD 5B1MB 5CPKB 3B6GA 2W8SA 1P3LA 5BNVA 5AV8D 4R8PA 3MGPA 3KXBC 5B33C 4H9NA 3AZLC 3REKA 3NQJB 3C1BA 3KXBB 1F66D 3AZLB 1P3BA 3MGSD 5B31B 5AY8A 5E5AD 1AOIC 3AZIB 3MNND 3KFUG 4H9RB 5B0YC 3VH5W 3AN2A 5JA4A 4NFTA 3LZ0D 3MGRD 1EQZC 4J8VD 1ZLAA 3P5JB 1P3MD 4E45A 1P3GC 4J8UA 1TZYA 1F66B 2F8NA 1B67A 5DNND 5CPKA 3AYWA 3AV1A 3B6FD 5B0ZC 3AZHC 5B0ZB 4XZQD 3W99B 3AZHB 3C1CD 3EPJA 2CV5C 2PYOD 5C3IB 1BH8A 5B31A 2JSSA 1TAFB 3LJAA 3AZIA 4YS3D 3O62D 2YFVB 5B32C 4JJND 1P3FA 5BNXB 2Y2MA 4ZBJC 4NE6A 2RVQD 3FDDA 3AFAB 1M19B 1F66A 2Y2GA 2PYOB 3MGSA 1WWIA 5B40C 5E5AA 3AZKB 3MNNA 4YS3B 3X1VC 1P3AD 1P3OD 5AVCD 3W99A 3H0RC 4HGAC 3UTBD 4KGCD 3LZ0A 4WU8D 3MGRA 4ZUXD 4J8VA 5JRGC 1P3MA 3VH6A 5AVBC 1M1AD 5DNNA 3W97D 5JRGB 2ZY3A 4QLCC 3B6FA 1M18B 3UTAC 4XZQA 5AVCB 2NZDC 3UTBB 1P34B 3C1CA 1A7WA 4DRAA 3UTAB 1P3IB 2PYOA 3RELD 3X1SC 1HQ3D 3X1SB 3AZKA 3O62A 4YS3A 1M1AB 4JJNA 3MGQC 2HIOD 3VH6T 5KDMA 4EO5C 4CSRB 3LELD 4EO5B 5CPIC 3X1UC 4LD9C 5CP6C 4DQYB 2ZY4A 3X1UB 2LY8A 4H9SA 1H3OB 1M18A 1KX3D 1WWSA 4UUZB 1P3AA 3EPKA 1P3OA 5AVCA 3X1TB 3UTBA 3WTPC 4KGCA 2DF4C 4WU8A 2Y2KA 1U35C 3WTPB 4ZUXA 3WKJC 5AV6D 4Z66D 1W2EA 4XUJC 1M1AA 3WKJB 3W97A 3MVDD 3REIC 3KSYA 4CSRA 5B32G 4J8WD 2XD1A 3REIB 4WV4B 3AZFC 2Y2LA 3RELA 3KWQC 3MGPD 4G91B 4H9OA 5AV6B 1P3KD 2G5HC 4Z5TC 2FJ7B 3UT9C 2HIOA 3MVDB 3X1TA 1ID3D 2UWXA 3LELA 3IP4C 4J8WB 5B2JC 1JFIA 2JCHA 3AZNC 5AV9D 3WAAC 5GSUD 1Z2CB 3AZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ B;  1KX3 A;  3AV2 C;  5B1M D;  2CWE A;  1ID3 B;  2YFW B;  5GT0 C;  5GXQ B;  4WNN A;  5AV6 A;  4Z66 A;  3KXB D;  5B33 D;  3B0D B;  3AZL D;  3MVD A;  5AV5 B;  5F99 C;  4J8W A;  5F99 B;  1P3K A;  5B33 B;  5BO0 B;  1P3G D;  1ID3 A;  1HTA A;  5B0Z D;  1AOI B;  3W99 D;  5GXQ A;  3W98 C;  3AZH D;  5B0Y B;  4G92 C;  3W98 B;  1BH9 B;  4G92 B;  5AV9 A;  5G49 B;  2ARO C;  5GSU A;  4KUD C;  3AYW C;  1EQZ B;  5AV5 A;  4Z2M H;  5B1M A;  1P3G B;  1P3P C;  1F1E A;  4J8X C;  1P3P B;  2F8N H;  3A6N C;  4H9P B;  4J8X B;  2IO5 C;  3A6N B;  3AZJ C;  3NQJ A;  3AFA D;  1M19 D;  3KXB A;  5B33 A;  3LJA C;  5BO0 A;  3AZL A;  2CV5 B;  1P3F C;  4X23 C;  3AZK D;  5B40 D;  5B1L C;  4H9R A;  5FUG B;  5B24 C;  5AV8 C;  3NQU B;  5B32 B;  3X1V D;  1KX4 C;  1BH9 A;  3WA9 C;  3AZE C;  4ZBJ B;  3WA9 B;  3MGS C;  4NE5 A;  5E5A C;  5JRG D;  1P3G A;  5AVB D;  1KU5 A;  1M18 D;  5B40 B;  5B0Z A;  4H9P A;  4WU9 C;  3W96 C;  3AZH A;  3X1V B;  5BT1 D;  3MGR C;  3UTA D;  3KUY C;  4WU9 B;  1P34 D;  1P3I D;  4HGA B;  3KUY B;  2CV5 A;  5DNN C;  2BYK B;  3X1S D;  1TAF A;  2YFV A;  5BNX A;  3LZ1 C;  5AVB B;  1N1J B;  4QLC B;  3LZ1 B;  2BYM B;  1R4V A;  3X1U D;  5CPI D;  3AFA A;  1M19 A;  5CP6 D;  2NZD B;  3O62 C;  3VH6 W;  4H9Q B;  5B40 A;  3X1T D;  3X1V A;  3MGQ B;  4Z2M G;  3WTP D;  1S32 C;  5CPI B;  4LD9 B;  1S32 B;  5CP6 B;  2F8N G;  3WKJ D;  5JRG A;  5AVB A;  1P3O C;  3AZM C;  1N1J A;  1KX5 C;  3REI D;  5GT3 C;  4AWL C;  4WU8 C;  5GT3 B;  4AWL B;  5CPJ C;  3UTA A;  1P34 A;  1P3I A;  3AZF D;  3REH C;  5B31 G;  3X1S A;  4H9Q A;  3KWQ D;  1U35 B;  2FJ7 D;  4Z5T D;  4XUJ B;  3UT9 D;  5DNM C;  2NQB C;  1ULY A;  2NQB B;  5B2J D;  3X1U A;  1HQ3 C;  4YM6 C;  5CPI A;  2L5A A;  5CP6 A;  3AZF B;  5B2I C;  1H3O A;  3AZN D;  3KWQ B;  3REJ D;  5B2I B;  3LEL C;  4UUZ A;  1Q9C A;  4Z5T B;  3UT9 B;  5GXQ D;  3WTP A;  5GT0 D;  5B2J B;  1U35 A;  4CAY B;  3WKJ A;  4E44 A;  1KX3 C;  5AV5 D;  3WAA B;  3REI A;  3AZG C;  5F99 D;  3AV2 B;  4Z66 C;  3AZF A;  3TU4 C;  5GT0 B;  3KWQ A;  2FJ7 A;  5BS7 C;  4Z5T A;  3UT9 A;  5CHL B;  3B6G C;  1AOI D;  4KHA B;  1P3L C;  4R8P C;  5B0Y D;  3MGP C;  5B2J A;  4R8P B;  3W98 D;  3REK C;  1P3K C;  3C1B C;  4H9N B;  1P3B C;  3AZN A;  1EQZ D;  3REJ A;  2ARO D;  5AY8 C;  1P3B B;  3WAA A;  4KUD D;  5AY8 B;  3AN2 C;  1P3P D;  2YFW A;  3AN2 B;  4J8X D;  3A6N D;  5GT0 A;  1ZLA C;  3B0C T;  3AZJ D;  4J8U C;  1TZY C;  2CV5 D;  5CPK C;  3AV1 C;  2F8N B;  2ARO B;  4KUD B;  3AYW B;  4KHA A;  4X23 D;  3VH5 A;  3AV1 B;  5B1L D;  5B32 D;  5F99 A;  5B24 D;  4NE3 A;  1KX4 D;  3WA9 D;  3AZE D;  5B31 C;  1BH8 B;  2IO5 B;  3AZJ B;  3AZI C;  3LJA B;  3B0B A;  1P3F B;  1AOI A;  4X23 B;  4DRB A;  5B1L B;  5B0Y A;  4WU9 D;  5B24 B;  3W96 D;  3VH5 T;  5AV8 B;  3W98 A;  3KUY D;  1F66 C;  5G49 A;  1KX4 B;  3AZE B;  1EQZ A;  2ARO A;  4KUD A;  3MNN C;  3MGS B;  5E5A B;  3MNN B;  3W99 C;  3V9R B;  4QLC D;  3LZ1 D;  1P3P A;  4J8X A;  3LZ0 C;  5C3I C;  3A6N A;  4J8V C;  3LZ0 B;  3W96 B;  1P3M C;  2NZD D;  3AZJ A;  3MGR B;  4J8V B;  1P3M B;  3B6F C;  5DNN B;  5FUG A;  4X23 A;  3B6F B;  5B1L A;  3NQU A;  5B32 A;  4XZQ C;  3MGQ D;  5B24 A;  5AV8 A;  3C1C C;  4XZQ B;  3AFA C;  1M19 C;  2PYO C;  1KX4 A;  3C1C B;  3WA9 A;  3AZE A;  4LD9 D;  1S32 D;  3AZK C;  4YS3 C;  4JJN C;  3O62 B;  3V9R A;  1BFM A;  4JJN B;  3AZM D;  5KDM B;  1KX5 D;  5GT3 D;  4WU9 A;  3W96 A;  2RVQ C;  5CPJ D;  3KUY A;  4H9S C;  2BYK A;  1U35 D;  3REH D;  1M18 C;  4XUJ D;  1P3A C;  4QLC A;  5AVC C;  3LZ1 A;  3UTB C;  5BT1 C;  2BYM A;  5DNM D;  3AZM B;  1P34 C;  1P3A B;  1P3I C;  1P3O B;  2NQB D;  1KX5 B;  4KGC C;  3WTP E;  4ZUX C;  4KGC B;  4WU8 B;  2NZD A;  5CPJ B;  4ZUX B;  4YM6 D;  1M1A C;  3W97 C;  3REH B;  5B2I D;  3W97 B;  3MGQ A;  5DNM B;  3REL C;  4LD9 A;  4M6B A;  3REL B;  1S32 A;  1HQ3 B;  4H9O B;  4YM6 B;  2HIO C;  3WAA D;  3X1T C;  3AZM A;  2HIO B;  3AV2 D;  1KX5 A;  5GT3 A;  3LEL B;  3AZG D;  5CPJ A;  1JFI B;  3R45 B;  3REH A;  3TU4 D;  4XUJ A;  1KX3 B;  2HUE C;  5DNM A;  2F8N K;  3B6G D;  2NQB A;  2HUE B;  4WZS B;  4G91 C;  1P3L D;  4R8P D;  3AZG B;  5AV6 C;  4WNN B;  1HQ3 A;  4YM6 A;  2FJ7 C;  3REK D;  4Z66 B;  3C1B D;  3TU4 B;  5B2I A;  3MVD C;  1P3B D;  5AY8 D;  4J8W C;  3AN2 D;  3B6G B;  3R45 A;  1P3L B;  5BNV B;  1ZLA D;  4CAY A;  3MGP B;  3REJ C;  3REK B;  4J8U D;  1TZY D;  3C1B B;  1P3K B;  2F8N D;  5CPK D;  3AYW D;  3AV1 D;  1ID3 C;  3AV2 A;  5GXQ C;  1B6W A;  3AZG A;  5JA4 B;  3B0C W;  3B0D C;  5AV9 C;  5GSU C;  3TU4 A;  1ZLA B;  5AV9 B;  5AV5 C;  5B31 D;  5GSU B;  3LJA D;  5B1M C;  4J8U B;  1TZY B;  5BS7 A;  3AZI D;  1P3F D;  5B1M B;  5CPK B;  3B6G A;  1P3L A;  5BNV A;  5AV8 D;  4R8P A;  3MGP A;  3KXB C;  5B33 C;  4H9N A;  3AZL C;  3REK A;  3NQJ B;  3C1B A;  3KXB B;  1F66 D;  3AZL B;  1P3B A;  3MGS D;  5B31 B;  5AY8 A;  5E5A D;  1AOI C;  3AZI B;  3MNN D;  4H9R B;  5B0Y C;  3VH5 W;  3AN2 A;  5JA4 A;  4NFT A;  3LZ0 D;  3MGR D;  1EQZ C;  4J8V D;  1ZLA A;  1P3M D;  4E45 A;  1P3G C;  4J8U A;  1TZY A;  1F66 B;  2F8N A;  1B67 A;  5DNN D;  5CPK A;  3AYW A;  3AV1 A;  3B6F D;  5B0Z C;  3AZH C;  5B0Z B;  4XZQ D;  3W99 B;  3AZH B;  3C1C D;  2CV5 C;  2PYO D;  5C3I B;  1BH8 A;  5B31 A;  2JSS A;  1TAF B;  3LJA A;  3AZI A;  4YS3 D;  3O62 D;  2YFV B;  5B32 C;  4JJN D;  1P3F A;  5BNX B;  4ZBJ C;  4NE6 A;  2RVQ D;  3AFA B;  1M19 B;  1F66 A;  2PYO B;  3MGS A;  1WWI A;  5B40 C;  5E5A A;  3AZK B;  3MNN A;  4YS3 B;  3X1V C;  1P3A D;  1P3O D;  5AVC D;  3W99 A;  4HGA C;  3UTB D;  4KGC D;  3LZ0 A;  4WU8 D;  3MGR A;  4ZUX D;  4J8V A;  5JRG C;  1P3M A;  3VH6 A;  5AVB C;  1M1A D;  5DNN A;  3W97 D;  5JRG B;  4QLC C;  3B6F A;  1M18 B;  3UTA C;  4XZQ A;  5AVC B;  2NZD C;  3UTB B;  1P34 B;  3C1C A;  1A7W A;  4DRA A;  3UTA B;  1P3I B;  2PYO A;  3REL D;  3X1S C;  1HQ3 D;  3X1S B;  3AZK A;  3O62 A;  4YS3 A;  1M1A B;  4JJN A;  3MGQ C;  2HIO D;  3VH6 T;  5KDM A;  4EO5 C;  4CSR B;  3LEL D;  3X1U C;  4EO5 B;  5CPI C;  4LD9 C;  5CP6 C;  3X1U B;  2LY8 A;  4H9S A;  1H3O B;  1M18 A;  1KX3 D;  1WWS A;  4UUZ B;  1P3A A;  1P3O A;  5AVC A;  3X1T B;  3UTB A;  3WTP C;  4KGC A;  4WU8 A;  1U35 C;  3WTP B;  4ZUX A;  3WKJ C;  5AV6 D;  4Z66 D;  4XUJ C;  1M1A A;  3WKJ B;  3W97 A;  3MVD D;  3REI C;  3KSY A;  4CSR A;  5B32 G;  4J8W D;  3REI B;  4WV4 B;  3AZF C;  3REL A;  3KWQ C;  3MGP D;  4G91 B;  4H9O A;  5AV6 B;  1P3K D;  4Z5T C;  2FJ7 B;  3UT9 C;  2HIO A;  3MVD B;  3X1T A;  1ID3 D;  3LEL A;  4J8W B;  5B2J C;  1JFI A;  3AZN C;  5AV9 D;  3WAA C;  5GSU D;  3AZN B; 
#chains in the Genus database with same CATH topology
 3REJ B;  1KX3 A;  3AV2 C;  5B1M D;  2CWE A;  1ID3 B;  2YFW B;  3H0L C;  5GT0 C;  5GXQ B;  4WNN A;  5AV6 A;  4Z66 A;  3KXB D;  5B33 D;  3B0D B;  3AZL D;  3MVD A;  5AV5 B;  5F99 C;  4J8W A;  5F99 B;  1P3K A;  2F2A C;  5B33 B;  5BO0 B;  1P3G D;  2RIQ A;  1ID3 A;  1HTA A;  5B0Z D;  1AOI B;  3W99 D;  5GXQ A;  3W98 C;  3AZH D;  5B0Y B;  4G92 C;  2VQR A;  3W98 B;  1BH9 B;  4G92 B;  5AV9 A;  5G49 B;  2ARO C;  5GSU A;  4KUD C;  1PZR A;  3AYW C;  1EQZ B;  5AV5 A;  4Z2M H;  5B1M A;  1P3G B;  1P3P C;  1F1E A;  4J8X C;  1P3P B;  2F8N H;  3A6N C;  4H9P B;  4J8X B;  2IO5 C;  3A6N B;  3AZJ C;  3NQJ A;  3AFA D;  1M19 D;  3KXB A;  5B33 A;  3LJA C;  5BO0 A;  3AZL A;  2CV5 B;  1T3U A;  1P3F C;  4X23 C;  3AZK D;  5B40 D;  5B1L C;  4H9R A;  5FUG B;  5B24 C;  5AV8 C;  3NQU B;  5B32 B;  3X1V D;  1KX4 C;  1BH9 A;  3WA9 C;  3AZE C;  4ZBJ B;  3WA9 B;  3MGS C;  4NE5 A;  5E5A C;  5JRG D;  1P3G A;  5AVB D;  1KU5 A;  1M18 D;  3H0M C;  5B40 B;  5B0Z A;  4H9P A;  4WU9 C;  3W96 C;  3AZH A;  3X1V B;  5BT1 D;  3MGR C;  3UTA D;  3KUY C;  4WU9 B;  1P34 D;  1P3I D;  4HGA B;  3KUY B;  2CV5 A;  5DNN C;  2BYK B;  3X1S D;  1TAF A;  2YFV A;  5BNX A;  3LZ1 C;  5AVB B;  1N1J B;  4QLC B;  3LZ1 B;  2BYM B;  1R4V A;  3X1U D;  5CPI D;  3AFA A;  1M19 A;  5CP6 D;  2NZD B;  3O62 C;  3VH6 W;  4H9Q B;  2Y2O A;  5B40 A;  3X1T D;  3X1V A;  3MGQ B;  2Y2H A;  4Z2M G;  3WTP D;  1S32 C;  5CPI B;  4LD9 B;  1S32 B;  5CP6 B;  2F8N G;  3WKJ D;  2XD5 A;  5JRG A;  5AVB A;  1P3O C;  3AZM C;  1N1J A;  3AL0 C;  1KX5 C;  3REI D;  5GT3 C;  4AWL C;  4WU8 C;  5GT3 B;  4AWL B;  5CPJ C;  3UTA A;  1P34 A;  1P3I A;  2G5I C;  3AZF D;  3REH C;  5B31 G;  3X1S A;  4H9Q A;  3KWQ D;  1U35 B;  2FJ7 D;  4Z5T D;  4XUJ B;  3UT9 D;  5DNM C;  2NQB C;  1ULY A;  2NQB B;  5B2J D;  3X1U A;  1HQ3 C;  4YM6 C;  5CPI A;  2L5A A;  5CP6 A;  3AZF B;  5B2I C;  1H3O A;  3AZN D;  3KWQ B;  3REJ D;  5B2I B;  3LEL C;  4UUZ A;  1Q9C A;  4Z5T B;  3UT9 B;  3F6T A;  5GXQ D;  3WTP A;  5GT0 D;  5B2J B;  1U35 A;  4CAY B;  3WKJ A;  4E44 A;  1KX3 C;  5AV5 D;  3WAA B;  3REI A;  2Y2P A;  3AZG C;  2ZY5 A;  5F99 D;  3AV2 B;  4Z66 C;  3AZF A;  3TU4 C;  5GT0 B;  3KWQ A;  2FJ7 A;  5BS7 C;  3A1K A;  4Z5T A;  2ZY2 A;  3UT9 A;  5CHL B;  3B6G C;  1AOI D;  4KHA B;  1P3L C;  4R8P C;  5B0Y D;  3MGP C;  5B2J A;  4R8P B;  3W98 D;  3REK C;  1P3K C;  3C1B C;  4H9N B;  1P3B C;  3AZN A;  1EQZ D;  3REJ A;  2ARO D;  5AY8 C;  1P3B B;  3WAA A;  4KUD D;  5AY8 B;  3AN2 C;  1P3P D;  2YFW A;  2Y2I A;  3AN2 B;  4J8X D;  3A6N D;  5GT0 A;  1ZLA C;  3B0C T;  3AZJ D;  4J8U C;  1TZY C;  2ZM5 A;  2CV5 D;  5CPK C;  3AV1 C;  2F8N B;  2ARO B;  4KUD B;  3AYW B;  4KHA A;  4X23 D;  3VH5 A;  3AV1 B;  5B1L D;  5B32 D;  5F99 A;  5B24 D;  4NE3 A;  1KX4 D;  3WA9 D;  3AZE D;  5B31 C;  1BH8 B;  2IO5 B;  3AZJ B;  3AZI C;  3A1I A;  3LJA B;  3B0B A;  1P3F B;  1AOI A;  4X23 B;  4DRB A;  5B1L B;  5B0Y A;  4WU9 D;  5B24 B;  3W96 D;  3VH5 T;  5AV8 B;  3W98 A;  3KUY D;  1F66 C;  5G49 A;  1KX4 B;  3AZE B;  1EQZ A;  2ARO A;  4KUD A;  3MNN C;  3MGS B;  5E5A B;  3MNN B;  3W99 C;  3V9R B;  4QLC D;  2BG1 A;  3LZ1 D;  1P3P A;  4J8X A;  3LZ0 C;  5C3I C;  3A6N A;  4J8V C;  3LZ0 B;  3W96 B;  1P3M C;  2NZD D;  3AZJ A;  3MGR B;  4J8V B;  1P3M B;  3B6F C;  5DNN B;  5FUG A;  4X23 A;  3B6F B;  5B1L A;  3NQU A;  5B32 A;  4XZQ C;  3MGQ D;  5B24 A;  5AV8 A;  3C1C C;  4XZQ B;  3AFA C;  1M19 C;  2PYO C;  1KX4 A;  3C1C B;  3WA9 A;  3AZE A;  4LD9 D;  1S32 D;  3AZK C;  4YS3 C;  4JJN C;  3O62 B;  3V9R A;  2J8P A;  1BFM A;  4JJN B;  3AZM D;  5KDM B;  3EPL A;  1KX5 D;  5GT3 D;  4WU9 A;  3W96 A;  2RVQ C;  5CPJ D;  2Y2Q A;  3KUY A;  4H9S C;  2BYK A;  1U35 D;  3REH D;  1M18 C;  4XUJ D;  1P3A C;  4QLC A;  5AVC C;  3LZ1 A;  3UTB C;  5BT1 C;  2BYM A;  5DNM D;  3AZM B;  1P34 C;  1P3A B;  1P3I C;  1P3O B;  2NQB D;  1KX5 B;  4KGC C;  3WTP E;  4ZUX C;  4KGC B;  4WU8 B;  2NZD A;  5CPJ B;  4ZUX B;  4YM6 D;  1M1A C;  3W97 C;  3REH B;  5B2I D;  3W97 B;  4WJ3 C;  3MGQ A;  5DNM B;  3REL C;  4LD9 A;  2DQN C;  4M6B A;  3REL B;  1S32 A;  1HQ3 B;  4H9O B;  4YM6 B;  2HIO C;  3WAA D;  3X1T C;  3AZM A;  2HIO B;  3AV2 D;  1KX5 A;  5GT3 A;  3LEL B;  3AZG D;  5CPJ A;  1JFI B;  3R45 B;  3REH A;  3TU4 D;  4XUJ A;  1KX3 B;  2HUE C;  5DNM A;  2F8N K;  3B6G D;  2NQB A;  2HUE B;  4WZS B;  4G91 C;  1P3L D;  4R8P D;  3AZG B;  5AV6 C;  4WNN B;  1HQ3 A;  4YM6 A;  2FJ7 C;  3REK D;  4Z66 B;  3C1B D;  3TU4 B;  5B2I A;  3MVD C;  1P3B D;  5AY8 D;  4J8W C;  2Y2N A;  3AN2 D;  3B6G B;  4UPK A;  3R45 A;  1P3L B;  5BNV B;  1ZLA D;  4CAY A;  3MGP B;  3REJ C;  3EPH A;  3REK B;  4J8U D;  1TZY D;  3C1B B;  1P3K B;  2F8N D;  2Y2J A;  5CPK D;  3AYW D;  3AV1 D;  1ID3 C;  3AV2 A;  5GXQ C;  1B6W A;  3AZG A;  5JA4 B;  3B0C W;  3EG5 B;  3B0D C;  2JE5 A;  5AV9 C;  5GSU C;  3TU4 A;  1ZLA B;  5AV9 B;  5AV5 C;  5B31 D;  2FFF B;  5GSU B;  3LJA D;  5B1M C;  4J8U B;  1TZY B;  5BS7 A;  3AZI D;  1P3F D;  5B1M B;  5CPK B;  3B6G A;  2W8S A;  1P3L A;  5BNV A;  5AV8 D;  4R8P A;  3MGP A;  3KXB C;  5B33 C;  4H9N A;  3AZL C;  3REK A;  3NQJ B;  3C1B A;  3KXB B;  1F66 D;  3AZL B;  1P3B A;  3MGS D;  5B31 B;  5AY8 A;  5E5A D;  1AOI C;  3AZI B;  3MNN D;  3KFU G;  4H9R B;  5B0Y C;  3VH5 W;  3AN2 A;  5JA4 A;  4NFT A;  3LZ0 D;  3MGR D;  1EQZ C;  4J8V D;  1ZLA A;  3P5J B;  1P3M D;  4E45 A;  1P3G C;  4J8U A;  1TZY A;  1F66 B;  2F8N A;  1B67 A;  5DNN D;  5CPK A;  3AYW A;  3AV1 A;  3B6F D;  5B0Z C;  3AZH C;  5B0Z B;  4XZQ D;  3W99 B;  3AZH B;  3C1C D;  3EPJ A;  2CV5 C;  2PYO D;  5C3I B;  1BH8 A;  5B31 A;  2JSS A;  1TAF B;  3LJA A;  3AZI A;  4YS3 D;  3O62 D;  2YFV B;  5B32 C;  4JJN D;  1P3F A;  5BNX B;  2Y2M A;  4ZBJ C;  4NE6 A;  2RVQ D;  3FDD A;  3AFA B;  1M19 B;  1F66 A;  2Y2G A;  2PYO B;  3MGS A;  1WWI A;  5B40 C;  5E5A A;  3AZK B;  3MNN A;  4YS3 B;  3X1V C;  1P3A D;  1P3O D;  5AVC D;  3W99 A;  3H0R C;  4HGA C;  3UTB D;  4KGC D;  3LZ0 A;  4WU8 D;  3MGR A;  4ZUX D;  4J8V A;  5JRG C;  1P3M A;  3VH6 A;  5AVB C;  1M1A D;  5DNN A;  3W97 D;  5JRG B;  2ZY3 A;  4QLC C;  3B6F A;  1M18 B;  3UTA C;  4XZQ A;  5AVC B;  2NZD C;  3UTB B;  1P34 B;  3C1C A;  1A7W A;  4DRA A;  3UTA B;  1P3I B;  2PYO A;  3REL D;  3X1S C;  1HQ3 D;  3X1S B;  3AZK A;  3O62 A;  4YS3 A;  1M1A B;  4JJN A;  3MGQ C;  2HIO D;  3VH6 T;  5KDM A;  4EO5 C;  4CSR B;  3LEL D;  4EO5 B;  5CPI C;  3X1U C;  4LD9 C;  5CP6 C;  4DQY B;  2ZY4 A;  3X1U B;  2LY8 A;  4H9S A;  1H3O B;  1M18 A;  1KX3 D;  1WWS A;  4UUZ B;  1P3A A;  3EPK A;  1P3O A;  5AVC A;  3X1T B;  3UTB A;  3WTP C;  4KGC A;  2DF4 C;  4WU8 A;  2Y2K A;  1U35 C;  3WTP B;  4ZUX A;  3WKJ C;  5AV6 D;  4Z66 D;  1W2E A;  4XUJ C;  1M1A A;  3WKJ B;  3W97 A;  3MVD D;  3REI C;  3KSY A;  4CSR A;  5B32 G;  4J8W D;  2XD1 A;  3REI B;  4WV4 B;  3AZF C;  2Y2L A;  3REL A;  3KWQ C;  3MGP D;  4G91 B;  4H9O A;  5AV6 B;  1P3K D;  2G5H C;  4Z5T C;  2FJ7 B;  3UT9 C;  2HIO A;  3MVD B;  3X1T A;  1ID3 D;  2UWX A;  3LEL A;  3IP4 C;  4J8W B;  5B2J C;  1JFI A;  2JCH A;  3AZN C;  5AV9 D;  3WAA C;  5GSU D;  1Z2C B;  3AZN B; 
#chains in the Genus database with same CATH homology
 3REJ B;  1KX3 A;  3AV2 C;  5B1M D;  2CWE A;  1ID3 B;  2YFW B;  3H0L C;  5GT0 C;  5GXQ B;  4WNN A;  5AV6 A;  4Z66 A;  3KXB D;  5B33 D;  3B0D B;  3AZL D;  3MVD A;  5AV5 B;  5F99 C;  4J8W A;  5F99 B;  1P3K A;  2F2A C;  5B33 B;  5BO0 B;  1P3G D;  2RIQ A;  1ID3 A;  1HTA A;  5B0Z D;  1AOI B;  3W99 D;  5GXQ A;  3W98 C;  3AZH D;  5B0Y B;  4G92 C;  2VQR A;  3W98 B;  1BH9 B;  4G92 B;  5AV9 A;  5G49 B;  2ARO C;  5GSU A;  4KUD C;  1PZR A;  3AYW C;  1EQZ B;  5AV5 A;  4Z2M H;  5B1M A;  1P3G B;  1P3P C;  1F1E A;  4J8X C;  1P3P B;  2F8N H;  3A6N C;  4H9P B;  4J8X B;  2IO5 C;  3A6N B;  3AZJ C;  3NQJ A;  3AFA D;  1M19 D;  3KXB A;  5B33 A;  3LJA C;  5BO0 A;  3AZL A;  2CV5 B;  1T3U A;  1P3F C;  4X23 C;  3AZK D;  5B40 D;  5B1L C;  4H9R A;  5FUG B;  5B24 C;  5AV8 C;  3NQU B;  5B32 B;  3X1V D;  1KX4 C;  1BH9 A;  3WA9 C;  3AZE C;  4ZBJ B;  3WA9 B;  3MGS C;  4NE5 A;  5E5A C;  5JRG D;  1P3G A;  5AVB D;  1KU5 A;  1M18 D;  3H0M C;  5B40 B;  5B0Z A;  4H9P A;  4WU9 C;  3W96 C;  3AZH A;  3X1V B;  5BT1 D;  3MGR C;  3UTA D;  3KUY C;  4WU9 B;  1P34 D;  1P3I D;  4HGA B;  3KUY B;  2CV5 A;  5DNN C;  2BYK B;  3X1S D;  1TAF A;  2YFV A;  5BNX A;  3LZ1 C;  5AVB B;  1N1J B;  4QLC B;  3LZ1 B;  2BYM B;  1R4V A;  3X1U D;  5CPI D;  3AFA A;  1M19 A;  5CP6 D;  2NZD B;  3O62 C;  3VH6 W;  4H9Q B;  2Y2O A;  5B40 A;  3X1T D;  3X1V A;  3MGQ B;  2Y2H A;  4Z2M G;  3WTP D;  1S32 C;  5CPI B;  4LD9 B;  1S32 B;  5CP6 B;  2F8N G;  3WKJ D;  2XD5 A;  5JRG A;  5AVB A;  1P3O C;  3AZM C;  1N1J A;  3AL0 C;  1KX5 C;  3REI D;  5GT3 C;  4AWL C;  4WU8 C;  5GT3 B;  4AWL B;  5CPJ C;  3UTA A;  1P34 A;  1P3I A;  2G5I C;  3AZF D;  3REH C;  5B31 G;  3X1S A;  4H9Q A;  3KWQ D;  1U35 B;  2FJ7 D;  4Z5T D;  4XUJ B;  3UT9 D;  5DNM C;  2NQB C;  1ULY A;  2NQB B;  5B2J D;  3X1U A;  1HQ3 C;  4YM6 C;  5CPI A;  2L5A A;  5CP6 A;  3AZF B;  5B2I C;  1H3O A;  3AZN D;  3KWQ B;  3REJ D;  5B2I B;  3LEL C;  4UUZ A;  1Q9C A;  4Z5T B;  3UT9 B;  3F6T A;  5GXQ D;  3WTP A;  5GT0 D;  5B2J B;  1U35 A;  4CAY B;  3WKJ A;  4E44 A;  1KX3 C;  5AV5 D;  3WAA B;  3REI A;  2Y2P A;  3AZG C;  2ZY5 A;  5F99 D;  3AV2 B;  4Z66 C;  3AZF A;  3TU4 C;  5GT0 B;  3KWQ A;  2FJ7 A;  5BS7 C;  3A1K A;  4Z5T A;  2ZY2 A;  3UT9 A;  5CHL B;  3B6G C;  1AOI D;  4KHA B;  1P3L C;  4R8P C;  5B0Y D;  3MGP C;  5B2J A;  4R8P B;  3W98 D;  3REK C;  1P3K C;  3C1B C;  4H9N B;  1P3B C;  3AZN A;  1EQZ D;  3REJ A;  2ARO D;  5AY8 C;  1P3B B;  3WAA A;  4KUD D;  5AY8 B;  3AN2 C;  1P3P D;  2YFW A;  2Y2I A;  3AN2 B;  4J8X D;  3A6N D;  5GT0 A;  1ZLA C;  3B0C T;  3AZJ D;  4J8U C;  1TZY C;  2ZM5 A;  2CV5 D;  5CPK C;  3AV1 C;  2F8N B;  2ARO B;  4KUD B;  3AYW B;  4KHA A;  4X23 D;  3VH5 A;  3AV1 B;  5B1L D;  5B32 D;  5F99 A;  5B24 D;  4NE3 A;  1KX4 D;  3WA9 D;  3AZE D;  5B31 C;  1BH8 B;  2IO5 B;  3AZJ B;  3AZI C;  3A1I A;  3LJA B;  3B0B A;  1P3F B;  1AOI A;  4X23 B;  4DRB A;  5B1L B;  5B0Y A;  4WU9 D;  5B24 B;  3W96 D;  3VH5 T;  5AV8 B;  3W98 A;  3KUY D;  1F66 C;  5G49 A;  1KX4 B;  3AZE B;  1EQZ A;  2ARO A;  4KUD A;  3MNN C;  3MGS B;  5E5A B;  3MNN B;  3W99 C;  3V9R B;  4QLC D;  2BG1 A;  3LZ1 D;  1P3P A;  4J8X A;  3LZ0 C;  5C3I C;  3A6N A;  4J8V C;  3LZ0 B;  3W96 B;  1P3M C;  2NZD D;  3AZJ A;  3MGR B;  4J8V B;  1P3M B;  3B6F C;  5DNN B;  5FUG A;  4X23 A;  3B6F B;  5B1L A;  3NQU A;  5B32 A;  4XZQ C;  3MGQ D;  5B24 A;  5AV8 A;  3C1C C;  4XZQ B;  3AFA C;  1M19 C;  2PYO C;  1KX4 A;  3C1C B;  3WA9 A;  3AZE A;  4LD9 D;  1S32 D;  3AZK C;  4YS3 C;  4JJN C;  3O62 B;  3V9R A;  2J8P A;  1BFM A;  4JJN B;  3AZM D;  5KDM B;  3EPL A;  1KX5 D;  5GT3 D;  4WU9 A;  3W96 A;  2RVQ C;  5CPJ D;  2Y2Q A;  3KUY A;  4H9S C;  2BYK A;  1U35 D;  3REH D;  1M18 C;  4XUJ D;  1P3A C;  4QLC A;  5AVC C;  3LZ1 A;  3UTB C;  5BT1 C;  2BYM A;  5DNM D;  3AZM B;  1P34 C;  1P3A B;  1P3I C;  1P3O B;  2NQB D;  1KX5 B;  4KGC C;  3WTP E;  4ZUX C;  4KGC B;  4WU8 B;  2NZD A;  5CPJ B;  4ZUX B;  4YM6 D;  1M1A C;  3W97 C;  3REH B;  5B2I D;  3W97 B;  4WJ3 C;  3MGQ A;  5DNM B;  3REL C;  4LD9 A;  2DQN C;  4M6B A;  3REL B;  1S32 A;  1HQ3 B;  4H9O B;  4YM6 B;  2HIO C;  3WAA D;  3X1T C;  3AZM A;  2HIO B;  3AV2 D;  1KX5 A;  5GT3 A;  3LEL B;  3AZG D;  5CPJ A;  1JFI B;  3R45 B;  3REH A;  3TU4 D;  4XUJ A;  1KX3 B;  2HUE C;  5DNM A;  2F8N K;  3B6G D;  2NQB A;  2HUE B;  4WZS B;  4G91 C;  1P3L D;  4R8P D;  3AZG B;  5AV6 C;  4WNN B;  1HQ3 A;  4YM6 A;  2FJ7 C;  3REK D;  4Z66 B;  3C1B D;  3TU4 B;  5B2I A;  3MVD C;  1P3B D;  5AY8 D;  4J8W C;  2Y2N A;  3AN2 D;  3B6G B;  4UPK A;  3R45 A;  1P3L B;  5BNV B;  1ZLA D;  4CAY A;  3MGP B;  3REJ C;  3EPH A;  3REK B;  4J8U D;  1TZY D;  3C1B B;  1P3K B;  2F8N D;  2Y2J A;  5CPK D;  3AYW D;  3AV1 D;  1ID3 C;  3AV2 A;  5GXQ C;  1B6W A;  3AZG A;  5JA4 B;  3B0C W;  3EG5 B;  3B0D C;  2JE5 A;  5AV9 C;  5GSU C;  3TU4 A;  1ZLA B;  5AV9 B;  5AV5 C;  5B31 D;  2FFF B;  5GSU B;  3LJA D;  5B1M C;  4J8U B;  1TZY B;  5BS7 A;  3AZI D;  1P3F D;  5B1M B;  5CPK B;  3B6G A;  2W8S A;  1P3L A;  5BNV A;  5AV8 D;  4R8P A;  3MGP A;  3KXB C;  5B33 C;  4H9N A;  3AZL C;  3REK A;  3NQJ B;  3C1B A;  3KXB B;  1F66 D;  3AZL B;  1P3B A;  3MGS D;  5B31 B;  5AY8 A;  5E5A D;  1AOI C;  3AZI B;  3MNN D;  3KFU G;  4H9R B;  5B0Y C;  3VH5 W;  3AN2 A;  5JA4 A;  4NFT A;  3LZ0 D;  3MGR D;  1EQZ C;  4J8V D;  1ZLA A;  3P5J B;  1P3M D;  4E45 A;  1P3G C;  4J8U A;  1TZY A;  1F66 B;  2F8N A;  1B67 A;  5DNN D;  5CPK A;  3AYW A;  3AV1 A;  3B6F D;  5B0Z C;  3AZH C;  5B0Z B;  4XZQ D;  3W99 B;  3AZH B;  3C1C D;  3EPJ A;  2CV5 C;  2PYO D;  5C3I B;  1BH8 A;  5B31 A;  2JSS A;  1TAF B;  3LJA A;  3AZI A;  4YS3 D;  3O62 D;  2YFV B;  5B32 C;  4JJN D;  1P3F A;  5BNX B;  2Y2M A;  4ZBJ C;  4NE6 A;  2RVQ D;  3FDD A;  3AFA B;  1M19 B;  1F66 A;  2Y2G A;  2PYO B;  3MGS A;  1WWI A;  5B40 C;  5E5A A;  3AZK B;  3MNN A;  4YS3 B;  3X1V C;  1P3A D;  1P3O D;  5AVC D;  3W99 A;  3H0R C;  4HGA C;  3UTB D;  4KGC D;  3LZ0 A;  4WU8 D;  3MGR A;  4ZUX D;  4J8V A;  5JRG C;  1P3M A;  3VH6 A;  5AVB C;  1M1A D;  5DNN A;  3W97 D;  5JRG B;  2ZY3 A;  4QLC C;  3B6F A;  1M18 B;  3UTA C;  4XZQ A;  5AVC B;  2NZD C;  3UTB B;  1P34 B;  3C1C A;  1A7W A;  4DRA A;  3UTA B;  1P3I B;  2PYO A;  3REL D;  3X1S C;  1HQ3 D;  3X1S B;  3AZK A;  3O62 A;  4YS3 A;  1M1A B;  4JJN A;  3MGQ C;  2HIO D;  3VH6 T;  5KDM A;  4EO5 C;  4CSR B;  3LEL D;  4EO5 B;  5CPI C;  3X1U C;  4LD9 C;  5CP6 C;  4DQY B;  2ZY4 A;  3X1U B;  2LY8 A;  4H9S A;  1H3O B;  1M18 A;  1KX3 D;  1WWS A;  4UUZ B;  1P3A A;  3EPK A;  1P3O A;  5AVC A;  3X1T B;  3UTB A;  3WTP C;  4KGC A;  2DF4 C;  4WU8 A;  2Y2K A;  1U35 C;  3WTP B;  4ZUX A;  3WKJ C;  5AV6 D;  4Z66 D;  1W2E A;  4XUJ C;  1M1A A;  3WKJ B;  3W97 A;  3MVD D;  3REI C;  3KSY A;  4CSR A;  5B32 G;  4J8W D;  2XD1 A;  3REI B;  4WV4 B;  3AZF C;  2Y2L A;  3REL A;  3KWQ C;  3MGP D;  4G91 B;  4H9O A;  5AV6 B;  1P3K D;  2G5H C;  4Z5T C;  2FJ7 B;  3UT9 C;  2HIO A;  3MVD B;  3X1T A;  1ID3 D;  2UWX A;  3LEL A;  3IP4 C;  4J8W B;  5B2J C;  1JFI A;  2JCH A;  3AZN C;  5AV9 D;  3WAA C;  5GSU D;  1Z2C B;  3AZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...