5DNNA

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnA00
3MGPB 5DNNC 1KX5C 1P3AA 4KUDA 5BNVA 3WKJC 1R4VA 5B1LC 5CHLB 3X1SA 4X23D 1BH9B 1P3KD 4Z66D 5DNNA 4DRAA 4H9SA 2YFWA 3WTPE 4E45A 5CPKA 1WWIA 3WKJA 3W98A 1P3AD 4J8WB 1P3FA 3C1BC 3X1TC 3AFAC 4KUDD 5KDMA 3KXBC 4JJNA 1H3OA 4XZQA 3X1SD 1S32C 5AV9C 5DNND 1M19C 1KX4B 5DNMB 4XUJB 5B31B 2CV5C 3X1VC 3LELC 5CPKD 5BO0B 1P3OB 3WKJD 3W98D 1M18B 4H9RA 5AV6B 4J8UC 2LY8A 3V9RA 4CSRA 1P3FD 1M1AC 5AV9A 4AWLB 5B2JC 1M19A 5B31G 3WAAA 2CV5A 3W99B 3AV2A 4JJND 4R8PC 5JA4B 4XZQD 3REHC 3MNNA 1P3KB 4Z66B 3REIA 1ID3A 3AZNA 2FJ7A 3B0CW 3MGQC 4KGCC 1B6WA 3NQUA 1TAFA 4LD9C 5GT0A 5AVCC 4NE3A 5AV9D 3AZGC 1M19D 1P3AB 3KUYC 2F8NA 2CV5D 1P34C 3AV2D 5BNVB 3WA9C 4KUDB 1P3MA 4G91B 3AZEC 3MGRC 5F99C 3X1SB 3R45B 4KGCA 2AROA 4LD9A 5CPJC 3REID 1ID3D 5DNNB 3AZND 3UT9C 3AZGA 5B33C 2YFVA 5B2JD 2FJ7D 2YFWB 5CPKB 2L5AA 1A7WA 1P34A 5GT0D 3AN2A 5B24C 3B6GC 3W98B 5AY8C 1F66C 2F8ND 1P3FB 5CP6A 5FUGA 4WNNA 2NZDC 5GXQA 5KDMB 3C1CA 4WU9A 3B6FC 2NQBA 4JJNB 1H3OB 4XZQB 1P3GC 4KGCD 2AROD 4LD9D 5AVCD 4QLCA 5BT1D 5B24A 5AY8A 3AZGD 5B2IA 3X1UA 1P34D 3AN2D 4YM6A 3REJC 1HQ3C 3MGRD 4H9RB 4YS3C 1TZYA 3AZJC 3AV1C 3V9RB 4CSRB 1P3GA 5CP6D 5AV9B 4WU8A 2IO5B 1M19B 2RVQD 5GXQD 4Z5TA 3C1CD 4WU9D 3WAAB 2NQBD 3UTBC 2CV5B 3AV2B 3REKC 5AV8A 2HIOC 5C3IC 1ZLAC 4QLCD 5B24D 5AY8D 3LZ0A 4J8XC 5B2ID 4ZBJB 3AZJA 3AV1A 3MNNB 3X1UD 3REIB 1ID3B 3AZNB 2FJ7B 2NZDD 4YM6D 2JSSA 3LJAC 3AZLA 1TZYD 3NQUB 1TAFB 3UTBA 3REKA 5GT0B 3AZIA 1P3GD 2HUEC 4Z5TD 4J8XA 2F8NB 5CPIC 1P3MB 1EQZA 4HGAB 1P3IC 3REJD 4X23A 3W97C 3LZ0D 3AZJD 4KGCB 2AROB 3AV1D 4LD9B 3AZGB 2YFVB 2F8NG 3AZHA 3AZLD 3UTBD 3AZID 1P34B 3REKD 4CAYA 3AN2B 4H9OA 1ZLAD 4J8XD 5CP6B 5FUGB 4WNNB 5GXQB 1EQZD 3C1CB 4WU9B 2NQBB 5BNXA 4H9PA 3AZMA 3WTPC 4QLCB 5B24B 1KX5A 5B2IB 3X1UB 4J8VC 3AZHD 4EO5C 5CPID 1U35C 4YM6B 3B0CT 5B1LA 5GSUC 1TZYB 1P3GB 4WU8B 4Z5TB 1JFIA 3AZMD 3AZKC 5AV8B 5B0YC 3W96C 1U35A 1KX5D 3KSYA 3LZ0B 5GSUA 3AZJB 3AV1B 3C1BA 3X1TA 3AFAA 3KXBA 1KX3C 5B1LD 3AZLB 1S32A 3UTBB 3AZIB 3VH6A 3REKB 5B40C 4ZUXC 1N1JA 3W96A 5C3IB 4J8XB 3LELA 3X1VA 3KWQC 4NE6A 1EQZB 1U35D 5B1MC 4X23B 4J8UA 3AZFC 5GSUD 1M1AA 3B0BA 4H9NA 3X1TD 3C1BD 5B2JA 3AFAD 2HUEB 3KXBD 4WV4B 3AZHB 4R8PA 1S32D 4CAYB 3REHA 4H9OB 5B0YD 3W96D 5B1MA 1P3LC 3LELD 3X1VD 5E5AC 3TU4C 3RELC 5BS7C 3MGQA 5BNXB 4H9PB 4J8UD 3AZMB 5AVCA 1M1AD 4G92C 5B40D 1KX5B 3KUYA 3B0DC 1P3LA 3WA9A 3WKJB 4R8PD 3AZEA 3REHD 3MGRA 3RELA 5B1LB 5B1MD 5F99A 5BS7A 5AV5C 5CPJA 2BYKA 4KHAA 3UT9A 5B33A 3MGPC 3VH6T 3UTAC 3MGQD 1JFIB 3B6GA 1F66A 1U35B 4Z2MH 5GSUB 3KUYD 3C1BB 3X1TB 1P3LD 3AFAB 3WA9D 2NZDA 3KXBB 3AZED 3B6FA 3MGPA 3RELD 3UTAA 5F99D 1S32B 5CPJD 1N1JB 3UT9D 3W96B 5B33D 2CWEA 5B0ZC 2BYMA 1WWSA 3LELB 3X1VB 3B6GD 1Q9CA 3REJA 1F66D 1HQ3A 4YS3A 4J8UB 1M1AB 4H9NB 5B2JB 3B6FD 5B0ZA 3MGPD 3UTAD 3A6NC 1KX4C 5DNMC 4R8PB 2HIOA 2PYOC 1ZLAA 3REHB 3VH6W 1P3PC 5B1MB 1AOIC 1P3OC 3NQJA 1M18C 3LJAA 1HQ3D 3MGQB 4AWLC 4YS3D 3A6NA 5AVCB 2PYOA 3W99C 1P3PA 4E44A 3KUYB 1AOIA 5B0ZD 4M6BA 3MGSC 5G49A 5CPIA 1P3LB 3WA9B 2HIOD 3AZEB 1P3IA 1P3KC 3MGRB 3W97A 4Z66C 3RELB 5F99B 5CPJB 2BYKB 4KHAB 3UT9B 5B33B 3LJAD 1F1EA 5B32C 3A6ND 3MGSA 3B6GB 1P3AC 5AY8B 1F66B 2PYOD 4KUDC 1P3PD 1AOID 1P3OD 2NZDB 1M18D 5AVBC 1P3ID 3B6FB 3UTAB 3W97D 5B32A 4H9SC 3WTPA 4NFTA 5JRGC 5GT3C 5CPKC 3VH5A 3W99D 2BYMB 3W98C 4J8VA 3LZ1C 3MGSD 3REJB 5AVBA 3R45A 1KU5A 1P3BC 1P3FC 1HQ3B 1ULYA 4YS3B 5JRGA 5GT3A 4JJNC 4XZQC 5B0ZB 3LZ1A 5B32D 3AZKA 2HIOB 3WTPD 5B0YA 3O62C 1ZLAB 1P3BA 3NQJB 4J8VD 1KX3A 3LJAB 5AVBD 2IO5C 3A6NB 3MVDC 5B40A 4ZUXA 3WAAC 3O62A 2PYOB 5JRGD 3AV2C 5GT3D 1P3PB 1AOIB 5G49B 3LZ1D 3KWQA 3AZKD 5CPIB 4ZBJC 1P3IB 3MNNC 3REIC 1P3BD 1ID3C 3AZNC 3AZFA 3W97B 2FJ7C 3MVDA 1KX3D 5GT0C 2F8NK 4H9QA 3VH5T 3MGSB 4UUZA 4ZUXD 3O62D 1P3MC 4HGAC 3KWQD 5E5AA 3TU4A 2AROC 5BT1C 3AZFD 5B32B 4DRBA 3WTPB 3AYWC 3MVDD 3WAAD 1BH8A 3AN2C 4J8VB 4EO5B 5AVBB 5CP6C 3MNND 5AV5A 2RVQC 5GXQC 5B32G 3C1CC 4WU9C 3AYWA 2NQBC 5JRGB 5E5AD 5GT3B 3TU4D 4QLCC 3LZ1B 3AZKB 5B2IC 5B0YB 1HTAA 3X1UC 1P3BB 4Z2MG 3VH5W 4YM6C 1P3MD 4J8WC 1TZYC 1BH9A 1KX3B 5AV5D 4WU8C 4Z5TC 5B40B 4ZUXB 3O62B 3AYWD 5AV8C 4XUJC 5B31C 3KWQB 4WZSB 3LZ0C 4J8WA 3AZFB 5AV6C 3MVDB 3AZLC 3AZIC 1KX4A 4H9QB 5DNMA 4XUJA 4UUZB 5B31A 5BO0A 1P3OA 1EQZC 1M18A 4X23C 5AV6A 5E5AB 3TU4B 4J8WD 1B67A 4WU8D 4G92B 3W99A 3AZHC 4NE5A 5JA4A 2F8NH 1BH8B 3B0DB 5AV8D 1KX4D 5DNMD 4XUJD 5B31D 1BFMA 1P3KA 4Z66A 4G91C 5AV5B 3AYWB 3X1SC 5AV6D 3AZMC
chains in the Genus database with same CATH superfamily
3MGPB 5DNNC 1KX5C 1P3AA 2Y2PA 4KUDA 5BNVA 3WKJC 1R4VA 2Y2OA 2ZY2A 5B1LC 5CHLB 3X1SA 4X23D 2W8SA 1BH9B 3AL0C 1P3KD 4Z66D 5DNNA 4DRAA 2F2AC 4H9SA 2YFWA 3WTPE 4E45A 2Y2JA 5CPKA 1WWIA 3WKJA 3W98A 1T3UA 1P3AD 3H0RC 4J8WB 1P3FA 3C1BC 3X1TC 2ZM5A 3AFAC 4KUDD 2RIQA 5KDMA 3KXBC 4JJNA 1H3OA 4XZQA 3X1SD 1S32C 4WJ3C 5AV9C 5DNND 1M19C 1KX4B 5DNMB 4UPKA 4XUJB 5B31B 2CV5C 3X1VC 3LELC 5CPKD 5BO0B 1P3OB 3WKJD 3EPLA 3W98D 3A1KA 1M18B 4H9RA 5AV6B 4J8UC 2LY8A 3V9RA 4CSRA 1P3FD 1M1AC 5AV9A 4AWLB 5B2JC 1M19A 5B31G 3WAAA 2CV5A 1W2EA 3W99B 3AV2A 4JJND 4R8PC 5JA4B 4XZQD 3REHC 3MNNA 1P3KB 4Z66B 3REIA 1ID3A 3AZNA 2FJ7A 3B0CW 3MGQC 4KGCC 1B6WA 3NQUA 1TAFA 4LD9C 5GT0A 5AVCC 4NE3A 5AV9D 3AZGC 1M19D 1P3AB 3KUYC 2F8NA 2CV5D 1P34C 3AV2D 5BNVB 3WA9C 4KUDB 1P3MA 4G91B 3AZEC 3MGRC 5F99C 3X1SB 3R45B 4KGCA 2AROA 4LD9A 5CPJC 3REID 1ID3D 5DNNB 3AZND 3UT9C 3AZGA 5B33C 2YFVA 5B2JD 2FJ7D 2YFWB 5CPKB 2L5AA 1A7WA 1P34A 5GT0D 3AN2A 5B24C 3B6GC 3W98B 5AY8C 1F66C 2F8ND 1P3FB 5CP6A 5FUGA 4WNNA 2NZDC 2DF4C 5GXQA 5KDMB 3C1CA 4WU9A 3B6FC 2NQBA 2G5HC 4JJNB 1H3OB 4XZQB 1P3GC 1PZRA 2AROD 4KGCD 4LD9D 4QLCA 5BT1D 5AVCD 2VQRA 5AY8A 5B24A 3AZGD 5B2IA 3X1UA 1P34D 2XD1A 3AN2D 4YM6A 3REJC 1HQ3C 3MGRD 4H9RB 4YS3C 1TZYA 3AZJC 3AV1C 3V9RB 4CSRB 1P3GA 5CP6D 5AV9B 4WU8A 2IO5B 1M19B 2RVQD 5GXQD 4Z5TA 3C1CD 4WU9D 3WAAB 2NQBD 3UTBC 2CV5B 3AV2B 3REKC 5AV8A 2HIOC 5C3IC 1ZLAC 4QLCD 5B24D 5AY8D 3LZ0A 4J8XC 4DQYB 5B2ID 4ZBJB 3AZJA 3AV1A 3MNNB 3X1UD 2ZY3A 3REIB 1ID3B 3AZNB 2FJ7B 2NZDD 1Z2CB 4YM6D 2JSSA 3LJAC 3AZLA 1TZYD 3NQUB 1TAFB 3UTBA 3REKA 5GT0B 3AZIA 1P3GD 2HUEC 4Z5TD 3F6TA 4J8XA 2F8NB 5CPIC 1P3MB 1EQZA 4HGAB 1P3IC 3REJD 4X23A 3W97C 2Y2LA 3LZ0D 3FDDA 3AZJD 4KGCB 2AROB 3AV1D 4LD9B 3AZGB 2YFVB 2F8NG 3AZHA 3AZLD 3UTBD 3AZID 1P34B 3REKD 4CAYA 3AN2B 4H9OA 1ZLAD 4J8XD 5CP6B 5FUGB 4WNNB 5GXQB 1EQZD 3C1CB 4WU9B 2NQBB 5BNXA 4H9PA 3AZMA 3WTPC 4QLCB 5B24B 1KX5A 5B2IB 3X1UB 4J8VC 3AZHD 4EO5C 5CPID 1U35C 4YM6B 3B0CT 5B1LA 5GSUC 2G5IC 1TZYB 2J8PA 1P3GB 4WU8B 4Z5TB 1JFIA 3AZMD 3AZKC 5AV8B 5B0YC 3W96C 1U35A 1KX5D 3KSYA 3LZ0B 5GSUA 3AZJB 3AV1B 3C1BA 3X1TA 3AFAA 3KXBA 1KX3C 5B1LD 3AZLB 1S32A 3UTBB 3AZIB 3VH6A 3REKB 5B40C 4ZUXC 1N1JA 3W96A 5C3IB 4J8XB 3LELA 3X1VA 3KWQC 3EPKA 4NE6A 1EQZB 1U35D 5B1MC 4X23B 4J8UA 3AZFC 5GSUD 1M1AA 3B0BA 4H9NA 3X1TD 3C1BD 5B2JA 3AFAD 2HUEB 3KXBD 4WV4B 3AZHB 4R8PA 1S32D 2BG1A 4CAYB 3REHA 4H9OB 5B0YD 3W96D 5B1MA 1P3LC 3LELD 3X1VD 5E5AC 3TU4C 3RELC 5BS7C 3MGQA 5BNXB 4H9PB 4J8UD 3AZMB 5AVCA 1M1AD 4G92C 5B40D 1KX5B 3KUYA 3B0DC 1P3LA 3WA9A 3WKJB 4R8PD 3AZEA 3A1IA 3REHD 3MGRA 3RELA 5B1LB 5B1MD 5F99A 5BS7A 5AV5C 5CPJA 2BYKA 4KHAA 3UT9A 5B33A 3MGPC 3VH6T 3UTAC 3MGQD 3H0MC 1JFIB 3B6GA 1F66A 1U35B 4Z2MH 2Y2IA 5GSUB 3KUYD 3C1BB 3X1TB 1P3LD 3AFAB 3WA9D 2NZDA 3KXBB 3AZED 3B6FA 2ZY5A 3MGPA 3RELD 3UTAA 5F99D 1S32B 5CPJD 1N1JB 3UT9D 3W96B 5B33D 2CWEA 5B0ZC 2BYMA 1WWSA 3LELB 3X1VB 3B6GD 1Q9CA 3REJA 1F66D 1HQ3A 2ZY4A 4YS3A 4J8UB 1M1AB 4H9NB 5B2JB 3B6FD 5B0ZA 3MGPD 3UTAD 3A6NC 1KX4C 5DNMC 4R8PB 2HIOA 2PYOC 1ZLAA 3REHB 3EPHA 3VH6W 1P3PC 5B1MB 1AOIC 1P3OC 3NQJA 1M18C 3LJAA 1HQ3D 3MGQB 4AWLC 4YS3D 3A6NA 5AVCB 2PYOA 3IP4C 3W99C 1P3PA 4E44A 3KUYB 1AOIA 5B0ZD 4M6BA 3MGSC 5G49A 5CPIA 1P3LB 3WA9B 2HIOD 3AZEB 1P3IA 1P3KC 3MGRB 3W97A 4Z66C 3RELB 5F99B 5CPJB 2BYKB 4KHAB 3UT9B 5B33B 3LJAD 1F1EA 5B32C 3A6ND 3MGSA 3B6GB 1P3AC 5AY8B 1F66B 2PYOD 4KUDC 1P3PD 1AOID 1P3OD 2NZDB 1M18D 5AVBC 1P3ID 3B6FB 3UTAB 3W97D 5B32A 4H9SC 3WTPA 4NFTA 5JRGC 5GT3C 5CPKC 3VH5A 3W99D 2UWXA 2BYMB 3W98C 4J8VA 3LZ1C 3MGSD 2Y2NA 2FFFB 3REJB 5AVBA 3R45A 1KU5A 1P3BC 1P3FC 1HQ3B 1ULYA 4YS3B 5JRGA 5GT3A 4JJNC 4XZQC 2JCHA 5B0ZB 3LZ1A 2JE5A 5B32D 3AZKA 2HIOB 3WTPD 5B0YA 3O62C 1ZLAB 1P3BA 3NQJB 4J8VD 2Y2GA 1KX3A 3LJAB 5AVBD 2IO5C 3A6NB 2Y2MA 3MVDC 5B40A 4ZUXA 3WAAC 3O62A 2PYOB 5JRGD 3AV2C 5GT3D 1P3PB 1AOIB 5G49B 3LZ1D 3KWQA 3AZKD 5CPIB 4ZBJC 1P3IB 3MNNC 3REIC 1P3BD 1ID3C 3AZNC 3AZFA 3W97B 2FJ7C 3MVDA 3P5JB 1KX3D 5GT0C 2F8NK 4H9QA 3VH5T 3MGSB 4UUZA 2DQNC 4ZUXD 3O62D 1P3MC 4HGAC 3KWQD 5E5AA 2XD5A 3TU4A 2AROC 5BT1C 3AZFD 5B32B 4DRBA 3WTPB 3AYWC 3MVDD 3WAAD 1BH8A 3AN2C 4J8VB 4EO5B 5AVBB 5CP6C 3MNND 5AV5A 2RVQC 5GXQC 5B32G 3C1CC 4WU9C 3AYWA 2NQBC 5JRGB 5E5AD 5GT3B 3TU4D 4QLCC 3EPJA 3LZ1B 3AZKB 5B2IC 5B0YB 1HTAA 3X1UC 1P3BB 4Z2MG 3VH5W 4YM6C 1P3MD 4J8WC 1TZYC 1BH9A 1KX3B 3KFUG 5AV5D 3H0LC 4WU8C 4Z5TC 5B40B 4ZUXB 3O62B 3AYWD 5AV8C 4XUJC 5B31C 3KWQB 4WZSB 3LZ0C 4J8WA 3AZFB 2Y2KA 5AV6C 3MVDB 3AZLC 3AZIC 1KX4A 4H9QB 5DNMA 2Y2HA 3EG5B 4XUJA 4UUZB 5B31A 5BO0A 1P3OA 1EQZC 1M18A 4X23C 5AV6A 5E5AB 3TU4B 4J8WD 1B67A 4WU8D 4G92B 3W99A 3AZHC 4NE5A 5JA4A 2F8NH 1BH8B 3B0DB 5AV8D 1KX4D 5DNMD 2Y2QA 4XUJD 5B31D 1BFMA 1P3KA 4Z66A 4G91C 5AV5B 3AYWB 3X1SC 5AV6D 3AZMC
chains in the Genus database with same CATH topology
3MGPB 5DNNC 1KX5C 1P3AA 2Y2PA 4KUDA 5BNVA 3WKJC 1R4VA 2Y2OA 2ZY2A 5B1LC 5CHLB 3X1SA 4X23D 2W8SA 1BH9B 3AL0C 1P3KD 4Z66D 5DNNA 4DRAA 2F2AC 4H9SA 2YFWA 3WTPE 4E45A 2Y2JA 5CPKA 1WWIA 3WKJA 3W98A 1T3UA 1P3AD 3H0RC 4J8WB 1P3FA 3C1BC 3X1TC 2ZM5A 3AFAC 4KUDD 2RIQA 5KDMA 3KXBC 4JJNA 1H3OA 4XZQA 3X1SD 1S32C 4WJ3C 5AV9C 5DNND 1M19C 1KX4B 5DNMB 4UPKA 4XUJB 5B31B 2CV5C 3X1VC 3LELC 5CPKD 5BO0B 1P3OB 3WKJD 3EPLA 3W98D 3A1KA 1M18B 4H9RA 5AV6B 4J8UC 2LY8A 3V9RA 4CSRA 1P3FD 1M1AC 5AV9A 4AWLB 5B2JC 1M19A 5B31G 3WAAA 2CV5A 1W2EA 3W99B 3AV2A 4JJND 4R8PC 5JA4B 4XZQD 3REHC 3MNNA 1P3KB 4Z66B 3REIA 1ID3A 3AZNA 2FJ7A 3B0CW 3MGQC 4KGCC 1B6WA 3NQUA 1TAFA 4LD9C 5GT0A 5AVCC 4NE3A 5AV9D 3AZGC 1M19D 1P3AB 3KUYC 2F8NA 2CV5D 1P34C 3AV2D 5BNVB 3WA9C 4KUDB 1P3MA 4G91B 3AZEC 3MGRC 5F99C 3X1SB 3R45B 4KGCA 2AROA 4LD9A 5CPJC 3REID 1ID3D 5DNNB 3AZND 3UT9C 3AZGA 5B33C 2YFVA 5B2JD 2FJ7D 2YFWB 5CPKB 2L5AA 1A7WA 1P34A 5GT0D 3AN2A 5B24C 3B6GC 3W98B 5AY8C 1F66C 2F8ND 1P3FB 5CP6A 5FUGA 4WNNA 2NZDC 2DF4C 5GXQA 5KDMB 3C1CA 4WU9A 3B6FC 2NQBA 2G5HC 4JJNB 1H3OB 4XZQB 1P3GC 1PZRA 2AROD 4KGCD 4LD9D 4QLCA 5BT1D 5AVCD 2VQRA 5AY8A 5B24A 3AZGD 5B2IA 3X1UA 1P34D 2XD1A 3AN2D 4YM6A 3REJC 1HQ3C 3MGRD 4H9RB 4YS3C 1TZYA 3AZJC 3AV1C 3V9RB 4CSRB 1P3GA 5CP6D 5AV9B 4WU8A 2IO5B 1M19B 2RVQD 5GXQD 4Z5TA 3C1CD 4WU9D 3WAAB 2NQBD 3UTBC 2CV5B 3AV2B 3REKC 5AV8A 2HIOC 5C3IC 1ZLAC 4QLCD 5B24D 5AY8D 3LZ0A 4J8XC 4DQYB 5B2ID 4ZBJB 3AZJA 3AV1A 3MNNB 3X1UD 2ZY3A 3REIB 1ID3B 3AZNB 2FJ7B 2NZDD 1Z2CB 4YM6D 2JSSA 3LJAC 3AZLA 1TZYD 3NQUB 1TAFB 3UTBA 3REKA 5GT0B 3AZIA 1P3GD 2HUEC 4Z5TD 3F6TA 4J8XA 2F8NB 5CPIC 1P3MB 1EQZA 4HGAB 1P3IC 3REJD 4X23A 3W97C 2Y2LA 3LZ0D 3FDDA 3AZJD 4KGCB 2AROB 3AV1D 4LD9B 3AZGB 2YFVB 2F8NG 3AZHA 3AZLD 3UTBD 3AZID 1P34B 3REKD 4CAYA 3AN2B 4H9OA 1ZLAD 4J8XD 5CP6B 5FUGB 4WNNB 5GXQB 1EQZD 3C1CB 4WU9B 2NQBB 5BNXA 4H9PA 3AZMA 3WTPC 4QLCB 5B24B 1KX5A 5B2IB 3X1UB 4J8VC 3AZHD 4EO5C 5CPID 1U35C 4YM6B 3B0CT 5B1LA 5GSUC 2G5IC 1TZYB 2J8PA 1P3GB 4WU8B 4Z5TB 1JFIA 3AZMD 3AZKC 5AV8B 5B0YC 3W96C 1U35A 1KX5D 3KSYA 3LZ0B 5GSUA 3AZJB 3AV1B 3C1BA 3X1TA 3AFAA 3KXBA 1KX3C 5B1LD 3AZLB 1S32A 3UTBB 3AZIB 3VH6A 3REKB 5B40C 4ZUXC 1N1JA 3W96A 5C3IB 4J8XB 3LELA 3X1VA 3KWQC 3EPKA 4NE6A 1EQZB 1U35D 5B1MC 4X23B 4J8UA 3AZFC 5GSUD 1M1AA 3B0BA 4H9NA 3X1TD 3C1BD 5B2JA 3AFAD 2HUEB 3KXBD 4WV4B 3AZHB 4R8PA 1S32D 2BG1A 4CAYB 3REHA 4H9OB 5B0YD 3W96D 5B1MA 1P3LC 3LELD 3X1VD 5E5AC 3TU4C 3RELC 5BS7C 3MGQA 5BNXB 4H9PB 4J8UD 3AZMB 5AVCA 1M1AD 4G92C 5B40D 1KX5B 3KUYA 3B0DC 1P3LA 3WA9A 3WKJB 4R8PD 3AZEA 3A1IA 3REHD 3MGRA 3RELA 5B1LB 5B1MD 5F99A 5BS7A 5AV5C 5CPJA 2BYKA 4KHAA 3UT9A 5B33A 3MGPC 3VH6T 3UTAC 3MGQD 3H0MC 1JFIB 3B6GA 1F66A 1U35B 4Z2MH 2Y2IA 5GSUB 3KUYD 3C1BB 3X1TB 1P3LD 3AFAB 3WA9D 2NZDA 3KXBB 3AZED 3B6FA 2ZY5A 3MGPA 3RELD 3UTAA 5F99D 1S32B 5CPJD 1N1JB 3UT9D 3W96B 5B33D 2CWEA 5B0ZC 2BYMA 1WWSA 3LELB 3X1VB 3B6GD 1Q9CA 3REJA 1F66D 1HQ3A 2ZY4A 4YS3A 4J8UB 1M1AB 4H9NB 5B2JB 3B6FD 5B0ZA 3MGPD 3UTAD 3A6NC 1KX4C 5DNMC 4R8PB 2HIOA 2PYOC 1ZLAA 3REHB 3EPHA 3VH6W 1P3PC 5B1MB 1AOIC 1P3OC 3NQJA 1M18C 3LJAA 1HQ3D 3MGQB 4AWLC 4YS3D 3A6NA 5AVCB 2PYOA 3IP4C 3W99C 1P3PA 4E44A 3KUYB 1AOIA 5B0ZD 4M6BA 3MGSC 5G49A 5CPIA 1P3LB 3WA9B 2HIOD 3AZEB 1P3IA 1P3KC 3MGRB 3W97A 4Z66C 3RELB 5F99B 5CPJB 2BYKB 4KHAB 3UT9B 5B33B 3LJAD 1F1EA 5B32C 3A6ND 3MGSA 3B6GB 1P3AC 5AY8B 1F66B 2PYOD 4KUDC 1P3PD 1AOID 1P3OD 2NZDB 1M18D 5AVBC 1P3ID 3B6FB 3UTAB 3W97D 5B32A 4H9SC 3WTPA 4NFTA 5JRGC 5GT3C 5CPKC 3VH5A 3W99D 2UWXA 2BYMB 3W98C 4J8VA 3LZ1C 3MGSD 2Y2NA 2FFFB 3REJB 5AVBA 3R45A 1KU5A 1P3BC 1P3FC 1HQ3B 1ULYA 4YS3B 5JRGA 5GT3A 4JJNC 4XZQC 2JCHA 5B0ZB 3LZ1A 2JE5A 5B32D 3AZKA 2HIOB 3WTPD 5B0YA 3O62C 1ZLAB 1P3BA 3NQJB 4J8VD 2Y2GA 1KX3A 3LJAB 5AVBD 2IO5C 3A6NB 2Y2MA 3MVDC 5B40A 4ZUXA 3WAAC 3O62A 2PYOB 5JRGD 3AV2C 5GT3D 1P3PB 1AOIB 5G49B 3LZ1D 3KWQA 3AZKD 5CPIB 4ZBJC 1P3IB 3MNNC 3REIC 1P3BD 1ID3C 3AZNC 3AZFA 3W97B 2FJ7C 3MVDA 3P5JB 1KX3D 5GT0C 2F8NK 4H9QA 3VH5T 3MGSB 4UUZA 2DQNC 4ZUXD 3O62D 1P3MC 4HGAC 3KWQD 5E5AA 2XD5A 3TU4A 2AROC 5BT1C 3AZFD 5B32B 4DRBA 3WTPB 3AYWC 3MVDD 3WAAD 1BH8A 3AN2C 4J8VB 4EO5B 5AVBB 5CP6C 3MNND 5AV5A 2RVQC 5GXQC 5B32G 3C1CC 4WU9C 3AYWA 2NQBC 5JRGB 5E5AD 5GT3B 3TU4D 4QLCC 3EPJA 3LZ1B 3AZKB 5B2IC 5B0YB 1HTAA 3X1UC 1P3BB 4Z2MG 3VH5W 4YM6C 1P3MD 4J8WC 1TZYC 1BH9A 1KX3B 3KFUG 5AV5D 3H0LC 4WU8C 4Z5TC 5B40B 4ZUXB 3O62B 3AYWD 5AV8C 4XUJC 5B31C 3KWQB 4WZSB 3LZ0C 4J8WA 3AZFB 2Y2KA 5AV6C 3MVDB 3AZLC 3AZIC 1KX4A 4H9QB 5DNMA 2Y2HA 3EG5B 4XUJA 4UUZB 5B31A 5BO0A 1P3OA 1EQZC 1M18A 4X23C 5AV6A 5E5AB 3TU4B 4J8WD 1B67A 4WU8D 4G92B 3W99A 3AZHC 4NE5A 5JA4A 2F8NH 1BH8B 3B0DB 5AV8D 1KX4D 5DNMD 2Y2QA 4XUJD 5B31D 1BFMA 1P3KA 4Z66A 4G91C 5AV5B 3AYWB 3X1SC 5AV6D 3AZMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  5DNN C;  1KX5 C;  1P3A A;  4KUD A;  5BNV A;  3WKJ C;  1R4V A;  5B1L C;  5CHL B;  3X1S A;  4X23 D;  1BH9 B;  1P3K D;  4Z66 D;  5DNN A;  4DRA A;  4H9S A;  2YFW A;  3WTP E;  4E45 A;  5CPK A;  1WWI A;  3WKJ A;  3W98 A;  1P3A D;  4J8W B;  1P3F A;  3C1B C;  3X1T C;  3AFA C;  4KUD D;  5KDM A;  3KXB C;  4JJN A;  1H3O A;  4XZQ A;  3X1S D;  1S32 C;  5AV9 C;  5DNN D;  1M19 C;  1KX4 B;  5DNM B;  4XUJ B;  5B31 B;  2CV5 C;  3X1V C;  3LEL C;  5CPK D;  5BO0 B;  1P3O B;  3WKJ D;  3W98 D;  1M18 B;  4H9R A;  5AV6 B;  4J8U C;  2LY8 A;  3V9R A;  4CSR A;  1P3F D;  1M1A C;  5AV9 A;  4AWL B;  5B2J C;  1M19 A;  5B31 G;  3WAA A;  2CV5 A;  3W99 B;  3AV2 A;  4JJN D;  4R8P C;  5JA4 B;  4XZQ D;  3REH C;  3MNN A;  1P3K B;  4Z66 B;  3REI A;  1ID3 A;  3AZN A;  2FJ7 A;  3B0C W;  3MGQ C;  4KGC C;  1B6W A;  3NQU A;  1TAF A;  4LD9 C;  5GT0 A;  5AVC C;  4NE3 A;  5AV9 D;  3AZG C;  1M19 D;  1P3A B;  3KUY C;  2F8N A;  2CV5 D;  1P34 C;  3AV2 D;  5BNV B;  3WA9 C;  4KUD B;  1P3M A;  4G91 B;  3AZE C;  3MGR C;  5F99 C;  3X1S B;  3R45 B;  4KGC A;  2ARO A;  4LD9 A;  5CPJ C;  3REI D;  1ID3 D;  5DNN B;  3AZN D;  3UT9 C;  3AZG A;  5B33 C;  2YFV A;  5B2J D;  2FJ7 D;  2YFW B;  5CPK B;  2L5A A;  1A7W A;  1P34 A;  5GT0 D;  3AN2 A;  5B24 C;  3B6G C;  3W98 B;  5AY8 C;  1F66 C;  2F8N D;  1P3F B;  5CP6 A;  5FUG A;  4WNN A;  2NZD C;  5GXQ A;  5KDM B;  3C1C A;  4WU9 A;  3B6F C;  2NQB A;  4JJN B;  1H3O B;  4XZQ B;  1P3G C;  4KGC D;  2ARO D;  4LD9 D;  5AVC D;  4QLC A;  5BT1 D;  5B24 A;  5AY8 A;  3AZG D;  5B2I A;  3X1U A;  1P34 D;  3AN2 D;  4YM6 A;  3REJ C;  1HQ3 C;  3MGR D;  4H9R B;  4YS3 C;  1TZY A;  3AZJ C;  3AV1 C;  3V9R B;  4CSR B;  1P3G A;  5CP6 D;  5AV9 B;  4WU8 A;  2IO5 B;  1M19 B;  2RVQ D;  5GXQ D;  4Z5T A;  3C1C D;  4WU9 D;  3WAA B;  2NQB D;  3UTB C;  2CV5 B;  3AV2 B;  3REK C;  5AV8 A;  2HIO C;  5C3I C;  1ZLA C;  4QLC D;  5B24 D;  5AY8 D;  3LZ0 A;  4J8X C;  5B2I D;  4ZBJ B;  3AZJ A;  3AV1 A;  3MNN B;  3X1U D;  3REI B;  1ID3 B;  3AZN B;  2FJ7 B;  2NZD D;  4YM6 D;  2JSS A;  3LJA C;  3AZL A;  1TZY D;  3NQU B;  1TAF B;  3UTB A;  3REK A;  5GT0 B;  3AZI A;  1P3G D;  2HUE C;  4Z5T D;  4J8X A;  2F8N B;  5CPI C;  1P3M B;  1EQZ A;  4HGA B;  1P3I C;  3REJ D;  4X23 A;  3W97 C;  3LZ0 D;  3AZJ D;  4KGC B;  2ARO B;  3AV1 D;  4LD9 B;  3AZG B;  2YFV B;  2F8N G;  3AZH A;  3AZL D;  3UTB D;  3AZI D;  1P34 B;  3REK D;  4CAY A;  3AN2 B;  4H9O A;  1ZLA D;  4J8X D;  5CP6 B;  5FUG B;  4WNN B;  5GXQ B;  1EQZ D;  3C1C B;  4WU9 B;  2NQB B;  5BNX A;  4H9P A;  3AZM A;  3WTP C;  4QLC B;  5B24 B;  1KX5 A;  5B2I B;  3X1U B;  4J8V C;  3AZH D;  4EO5 C;  5CPI D;  1U35 C;  4YM6 B;  3B0C T;  5B1L A;  5GSU C;  1TZY B;  1P3G B;  4WU8 B;  4Z5T B;  1JFI A;  3AZM D;  3AZK C;  5AV8 B;  5B0Y C;  3W96 C;  1U35 A;  1KX5 D;  3KSY A;  3LZ0 B;  5GSU A;  3AZJ B;  3AV1 B;  3C1B A;  3X1T A;  3AFA A;  3KXB A;  1KX3 C;  5B1L D;  3AZL B;  1S32 A;  3UTB B;  3AZI B;  3VH6 A;  3REK B;  5B40 C;  4ZUX C;  1N1J A;  3W96 A;  5C3I B;  4J8X B;  3LEL A;  3X1V A;  3KWQ C;  4NE6 A;  1EQZ B;  1U35 D;  5B1M C;  4X23 B;  4J8U A;  3AZF C;  5GSU D;  1M1A A;  3B0B A;  4H9N A;  3X1T D;  3C1B D;  5B2J A;  3AFA D;  2HUE B;  3KXB D;  4WV4 B;  3AZH B;  4R8P A;  1S32 D;  4CAY B;  3REH A;  4H9O B;  5B0Y D;  3W96 D;  5B1M A;  1P3L C;  3LEL D;  3X1V D;  5E5A C;  3TU4 C;  3REL C;  5BS7 C;  3MGQ A;  5BNX B;  4H9P B;  4J8U D;  3AZM B;  5AVC A;  1M1A D;  4G92 C;  5B40 D;  1KX5 B;  3KUY A;  3B0D C;  1P3L A;  3WA9 A;  3WKJ B;  4R8P D;  3AZE A;  3REH D;  3MGR A;  3REL A;  5B1L B;  5B1M D;  5F99 A;  5BS7 A;  5AV5 C;  5CPJ A;  2BYK A;  4KHA A;  3UT9 A;  5B33 A;  3MGP C;  3VH6 T;  3UTA C;  3MGQ D;  1JFI B;  3B6G A;  1F66 A;  1U35 B;  4Z2M H;  5GSU B;  3KUY D;  3C1B B;  3X1T B;  1P3L D;  3AFA B;  3WA9 D;  2NZD A;  3KXB B;  3AZE D;  3B6F A;  3MGP A;  3REL D;  3UTA A;  5F99 D;  1S32 B;  5CPJ D;  1N1J B;  3UT9 D;  3W96 B;  5B33 D;  2CWE A;  5B0Z C;  2BYM A;  1WWS A;  3LEL B;  3X1V B;  3B6G D;  1Q9C A;  3REJ A;  1F66 D;  1HQ3 A;  4YS3 A;  4J8U B;  1M1A B;  4H9N B;  5B2J B;  3B6F D;  5B0Z A;  3MGP D;  3UTA D;  3A6N C;  1KX4 C;  5DNM C;  4R8P B;  2HIO A;  2PYO C;  1ZLA A;  3REH B;  3VH6 W;  1P3P C;  5B1M B;  1AOI C;  1P3O C;  3NQJ A;  1M18 C;  3LJA A;  1HQ3 D;  3MGQ B;  4AWL C;  4YS3 D;  3A6N A;  5AVC B;  2PYO A;  3W99 C;  1P3P A;  4E44 A;  3KUY B;  1AOI A;  5B0Z D;  4M6B A;  3MGS C;  5G49 A;  5CPI A;  1P3L B;  3WA9 B;  2HIO D;  3AZE B;  1P3I A;  1P3K C;  3MGR B;  3W97 A;  4Z66 C;  3REL B;  5F99 B;  5CPJ B;  2BYK B;  4KHA B;  3UT9 B;  5B33 B;  3LJA D;  1F1E A;  5B32 C;  3A6N D;  3MGS A;  3B6G B;  1P3A C;  5AY8 B;  1F66 B;  2PYO D;  4KUD C;  1P3P D;  1AOI D;  1P3O D;  2NZD B;  1M18 D;  5AVB C;  1P3I D;  3B6F B;  3UTA B;  3W97 D;  5B32 A;  4H9S C;  3WTP A;  4NFT A;  5JRG C;  5GT3 C;  5CPK C;  3VH5 A;  3W99 D;  2BYM B;  3W98 C;  4J8V A;  3LZ1 C;  3MGS D;  3REJ B;  5AVB A;  3R45 A;  1KU5 A;  1P3B C;  1P3F C;  1HQ3 B;  1ULY A;  4YS3 B;  5JRG A;  5GT3 A;  4JJN C;  4XZQ C;  5B0Z B;  3LZ1 A;  5B32 D;  3AZK A;  2HIO B;  3WTP D;  5B0Y A;  3O62 C;  1ZLA B;  1P3B A;  3NQJ B;  4J8V D;  1KX3 A;  3LJA B;  5AVB D;  2IO5 C;  3A6N B;  3MVD C;  5B40 A;  4ZUX A;  3WAA C;  3O62 A;  2PYO B;  5JRG D;  3AV2 C;  5GT3 D;  1P3P B;  1AOI B;  5G49 B;  3LZ1 D;  3KWQ A;  3AZK D;  5CPI B;  4ZBJ C;  1P3I B;  3MNN C;  3REI C;  1P3B D;  1ID3 C;  3AZN C;  3AZF A;  3W97 B;  2FJ7 C;  3MVD A;  1KX3 D;  5GT0 C;  2F8N K;  4H9Q A;  3VH5 T;  3MGS B;  4UUZ A;  4ZUX D;  3O62 D;  1P3M C;  4HGA C;  3KWQ D;  5E5A A;  3TU4 A;  2ARO C;  5BT1 C;  3AZF D;  5B32 B;  4DRB A;  3WTP B;  3AYW C;  3MVD D;  3WAA D;  1BH8 A;  3AN2 C;  4J8V B;  4EO5 B;  5AVB B;  5CP6 C;  3MNN D;  5AV5 A;  2RVQ C;  5GXQ C;  5B32 G;  3C1C C;  4WU9 C;  3AYW A;  2NQB C;  5JRG B;  5E5A D;  5GT3 B;  3TU4 D;  4QLC C;  3LZ1 B;  3AZK B;  5B2I C;  5B0Y B;  1HTA A;  3X1U C;  1P3B B;  4Z2M G;  3VH5 W;  4YM6 C;  1P3M D;  4J8W C;  1TZY C;  1BH9 A;  1KX3 B;  5AV5 D;  4WU8 C;  4Z5T C;  5B40 B;  4ZUX B;  3O62 B;  3AYW D;  5AV8 C;  4XUJ C;  5B31 C;  3KWQ B;  4WZS B;  3LZ0 C;  4J8W A;  3AZF B;  5AV6 C;  3MVD B;  3AZL C;  3AZI C;  1KX4 A;  4H9Q B;  5DNM A;  4XUJ A;  4UUZ B;  5B31 A;  5BO0 A;  1P3O A;  1EQZ C;  1M18 A;  4X23 C;  5AV6 A;  5E5A B;  3TU4 B;  4J8W D;  1B67 A;  4WU8 D;  4G92 B;  3W99 A;  3AZH C;  4NE5 A;  5JA4 A;  2F8N H;  1BH8 B;  3B0D B;  5AV8 D;  1KX4 D;  5DNM D;  4XUJ D;  5B31 D;  1BFM A;  1P3K A;  4Z66 A;  4G91 C;  5AV5 B;  3AYW B;  3X1S C;  5AV6 D;  3AZM C; 
#chains in the Genus database with same CATH topology
 3MGP B;  5DNN C;  1KX5 C;  1P3A A;  2Y2P A;  4KUD A;  5BNV A;  3WKJ C;  1R4V A;  2Y2O A;  2ZY2 A;  5B1L C;  5CHL B;  3X1S A;  4X23 D;  2W8S A;  1BH9 B;  3AL0 C;  1P3K D;  4Z66 D;  5DNN A;  4DRA A;  2F2A C;  4H9S A;  2YFW A;  3WTP E;  4E45 A;  2Y2J A;  5CPK A;  1WWI A;  3WKJ A;  3W98 A;  1T3U A;  1P3A D;  3H0R C;  4J8W B;  1P3F A;  3C1B C;  3X1T C;  2ZM5 A;  3AFA C;  4KUD D;  2RIQ A;  5KDM A;  3KXB C;  4JJN A;  1H3O A;  4XZQ A;  3X1S D;  1S32 C;  4WJ3 C;  5AV9 C;  5DNN D;  1M19 C;  1KX4 B;  5DNM B;  4UPK A;  4XUJ B;  5B31 B;  2CV5 C;  3X1V C;  3LEL C;  5CPK D;  5BO0 B;  1P3O B;  3WKJ D;  3EPL A;  3W98 D;  3A1K A;  1M18 B;  4H9R A;  5AV6 B;  4J8U C;  2LY8 A;  3V9R A;  4CSR A;  1P3F D;  1M1A C;  5AV9 A;  4AWL B;  5B2J C;  1M19 A;  5B31 G;  3WAA A;  2CV5 A;  1W2E A;  3W99 B;  3AV2 A;  4JJN D;  4R8P C;  5JA4 B;  4XZQ D;  3REH C;  3MNN A;  1P3K B;  4Z66 B;  3REI A;  1ID3 A;  3AZN A;  2FJ7 A;  3B0C W;  3MGQ C;  4KGC C;  1B6W A;  3NQU A;  1TAF A;  4LD9 C;  5GT0 A;  5AVC C;  4NE3 A;  5AV9 D;  3AZG C;  1M19 D;  1P3A B;  3KUY C;  2F8N A;  2CV5 D;  1P34 C;  3AV2 D;  5BNV B;  3WA9 C;  4KUD B;  1P3M A;  4G91 B;  3AZE C;  3MGR C;  5F99 C;  3X1S B;  3R45 B;  4KGC A;  2ARO A;  4LD9 A;  5CPJ C;  3REI D;  1ID3 D;  5DNN B;  3AZN D;  3UT9 C;  3AZG A;  5B33 C;  2YFV A;  5B2J D;  2FJ7 D;  2YFW B;  5CPK B;  2L5A A;  1A7W A;  1P34 A;  5GT0 D;  3AN2 A;  5B24 C;  3B6G C;  3W98 B;  5AY8 C;  1F66 C;  2F8N D;  1P3F B;  5CP6 A;  5FUG A;  4WNN A;  2NZD C;  2DF4 C;  5GXQ A;  5KDM B;  3C1C A;  4WU9 A;  3B6F C;  2NQB A;  2G5H C;  4JJN B;  1H3O B;  4XZQ B;  1P3G C;  1PZR A;  2ARO D;  4KGC D;  4LD9 D;  4QLC A;  5BT1 D;  5AVC D;  2VQR A;  5AY8 A;  5B24 A;  3AZG D;  5B2I A;  3X1U A;  1P34 D;  2XD1 A;  3AN2 D;  4YM6 A;  3REJ C;  1HQ3 C;  3MGR D;  4H9R B;  4YS3 C;  1TZY A;  3AZJ C;  3AV1 C;  3V9R B;  4CSR B;  1P3G A;  5CP6 D;  5AV9 B;  4WU8 A;  2IO5 B;  1M19 B;  2RVQ D;  5GXQ D;  4Z5T A;  3C1C D;  4WU9 D;  3WAA B;  2NQB D;  3UTB C;  2CV5 B;  3AV2 B;  3REK C;  5AV8 A;  2HIO C;  5C3I C;  1ZLA C;  4QLC D;  5B24 D;  5AY8 D;  3LZ0 A;  4J8X C;  4DQY B;  5B2I D;  4ZBJ B;  3AZJ A;  3AV1 A;  3MNN B;  3X1U D;  2ZY3 A;  3REI B;  1ID3 B;  3AZN B;  2FJ7 B;  2NZD D;  1Z2C B;  4YM6 D;  2JSS A;  3LJA C;  3AZL A;  1TZY D;  3NQU B;  1TAF B;  3UTB A;  3REK A;  5GT0 B;  3AZI A;  1P3G D;  2HUE C;  4Z5T D;  3F6T A;  4J8X A;  2F8N B;  5CPI C;  1P3M B;  1EQZ A;  4HGA B;  1P3I C;  3REJ D;  4X23 A;  3W97 C;  2Y2L A;  3LZ0 D;  3FDD A;  3AZJ D;  4KGC B;  2ARO B;  3AV1 D;  4LD9 B;  3AZG B;  2YFV B;  2F8N G;  3AZH A;  3AZL D;  3UTB D;  3AZI D;  1P34 B;  3REK D;  4CAY A;  3AN2 B;  4H9O A;  1ZLA D;  4J8X D;  5CP6 B;  5FUG B;  4WNN B;  5GXQ B;  1EQZ D;  3C1C B;  4WU9 B;  2NQB B;  5BNX A;  4H9P A;  3AZM A;  3WTP C;  4QLC B;  5B24 B;  1KX5 A;  5B2I B;  3X1U B;  4J8V C;  3AZH D;  4EO5 C;  5CPI D;  1U35 C;  4YM6 B;  3B0C T;  5B1L A;  5GSU C;  2G5I C;  1TZY B;  2J8P A;  1P3G B;  4WU8 B;  4Z5T B;  1JFI A;  3AZM D;  3AZK C;  5AV8 B;  5B0Y C;  3W96 C;  1U35 A;  1KX5 D;  3KSY A;  3LZ0 B;  5GSU A;  3AZJ B;  3AV1 B;  3C1B A;  3X1T A;  3AFA A;  3KXB A;  1KX3 C;  5B1L D;  3AZL B;  1S32 A;  3UTB B;  3AZI B;  3VH6 A;  3REK B;  5B40 C;  4ZUX C;  1N1J A;  3W96 A;  5C3I B;  4J8X B;  3LEL A;  3X1V A;  3KWQ C;  3EPK A;  4NE6 A;  1EQZ B;  1U35 D;  5B1M C;  4X23 B;  4J8U A;  3AZF C;  5GSU D;  1M1A A;  3B0B A;  4H9N A;  3X1T D;  3C1B D;  5B2J A;  3AFA D;  2HUE B;  3KXB D;  4WV4 B;  3AZH B;  4R8P A;  1S32 D;  2BG1 A;  4CAY B;  3REH A;  4H9O B;  5B0Y D;  3W96 D;  5B1M A;  1P3L C;  3LEL D;  3X1V D;  5E5A C;  3TU4 C;  3REL C;  5BS7 C;  3MGQ A;  5BNX B;  4H9P B;  4J8U D;  3AZM B;  5AVC A;  1M1A D;  4G92 C;  5B40 D;  1KX5 B;  3KUY A;  3B0D C;  1P3L A;  3WA9 A;  3WKJ B;  4R8P D;  3AZE A;  3A1I A;  3REH D;  3MGR A;  3REL A;  5B1L B;  5B1M D;  5F99 A;  5BS7 A;  5AV5 C;  5CPJ A;  2BYK A;  4KHA A;  3UT9 A;  5B33 A;  3MGP C;  3VH6 T;  3UTA C;  3MGQ D;  3H0M C;  1JFI B;  3B6G A;  1F66 A;  1U35 B;  4Z2M H;  2Y2I A;  5GSU B;  3KUY D;  3C1B B;  3X1T B;  1P3L D;  3AFA B;  3WA9 D;  2NZD A;  3KXB B;  3AZE D;  3B6F A;  2ZY5 A;  3MGP A;  3REL D;  3UTA A;  5F99 D;  1S32 B;  5CPJ D;  1N1J B;  3UT9 D;  3W96 B;  5B33 D;  2CWE A;  5B0Z C;  2BYM A;  1WWS A;  3LEL B;  3X1V B;  3B6G D;  1Q9C A;  3REJ A;  1F66 D;  1HQ3 A;  2ZY4 A;  4YS3 A;  4J8U B;  1M1A B;  4H9N B;  5B2J B;  3B6F D;  5B0Z A;  3MGP D;  3UTA D;  3A6N C;  1KX4 C;  5DNM C;  4R8P B;  2HIO A;  2PYO C;  1ZLA A;  3REH B;  3EPH A;  3VH6 W;  1P3P C;  5B1M B;  1AOI C;  1P3O C;  3NQJ A;  1M18 C;  3LJA A;  1HQ3 D;  3MGQ B;  4AWL C;  4YS3 D;  3A6N A;  5AVC B;  2PYO A;  3IP4 C;  3W99 C;  1P3P A;  4E44 A;  3KUY B;  1AOI A;  5B0Z D;  4M6B A;  3MGS C;  5G49 A;  5CPI A;  1P3L B;  3WA9 B;  2HIO D;  3AZE B;  1P3I A;  1P3K C;  3MGR B;  3W97 A;  4Z66 C;  3REL B;  5F99 B;  5CPJ B;  2BYK B;  4KHA B;  3UT9 B;  5B33 B;  3LJA D;  1F1E A;  5B32 C;  3A6N D;  3MGS A;  3B6G B;  1P3A C;  5AY8 B;  1F66 B;  2PYO D;  4KUD C;  1P3P D;  1AOI D;  1P3O D;  2NZD B;  1M18 D;  5AVB C;  1P3I D;  3B6F B;  3UTA B;  3W97 D;  5B32 A;  4H9S C;  3WTP A;  4NFT A;  5JRG C;  5GT3 C;  5CPK C;  3VH5 A;  3W99 D;  2UWX A;  2BYM B;  3W98 C;  4J8V A;  3LZ1 C;  3MGS D;  2Y2N A;  2FFF B;  3REJ B;  5AVB A;  3R45 A;  1KU5 A;  1P3B C;  1P3F C;  1HQ3 B;  1ULY A;  4YS3 B;  5JRG A;  5GT3 A;  4JJN C;  4XZQ C;  2JCH A;  5B0Z B;  3LZ1 A;  2JE5 A;  5B32 D;  3AZK A;  2HIO B;  3WTP D;  5B0Y A;  3O62 C;  1ZLA B;  1P3B A;  3NQJ B;  4J8V D;  2Y2G A;  1KX3 A;  3LJA B;  5AVB D;  2IO5 C;  3A6N B;  2Y2M A;  3MVD C;  5B40 A;  4ZUX A;  3WAA C;  3O62 A;  2PYO B;  5JRG D;  3AV2 C;  5GT3 D;  1P3P B;  1AOI B;  5G49 B;  3LZ1 D;  3KWQ A;  3AZK D;  5CPI B;  4ZBJ C;  1P3I B;  3MNN C;  3REI C;  1P3B D;  1ID3 C;  3AZN C;  3AZF A;  3W97 B;  2FJ7 C;  3MVD A;  3P5J B;  1KX3 D;  5GT0 C;  2F8N K;  4H9Q A;  3VH5 T;  3MGS B;  4UUZ A;  2DQN C;  4ZUX D;  3O62 D;  1P3M C;  4HGA C;  3KWQ D;  5E5A A;  2XD5 A;  3TU4 A;  2ARO C;  5BT1 C;  3AZF D;  5B32 B;  4DRB A;  3WTP B;  3AYW C;  3MVD D;  3WAA D;  1BH8 A;  3AN2 C;  4J8V B;  4EO5 B;  5AVB B;  5CP6 C;  3MNN D;  5AV5 A;  2RVQ C;  5GXQ C;  5B32 G;  3C1C C;  4WU9 C;  3AYW A;  2NQB C;  5JRG B;  5E5A D;  5GT3 B;  3TU4 D;  4QLC C;  3EPJ A;  3LZ1 B;  3AZK B;  5B2I C;  5B0Y B;  1HTA A;  3X1U C;  1P3B B;  4Z2M G;  3VH5 W;  4YM6 C;  1P3M D;  4J8W C;  1TZY C;  1BH9 A;  1KX3 B;  3KFU G;  5AV5 D;  3H0L C;  4WU8 C;  4Z5T C;  5B40 B;  4ZUX B;  3O62 B;  3AYW D;  5AV8 C;  4XUJ C;  5B31 C;  3KWQ B;  4WZS B;  3LZ0 C;  4J8W A;  3AZF B;  2Y2K A;  5AV6 C;  3MVD B;  3AZL C;  3AZI C;  1KX4 A;  4H9Q B;  5DNM A;  2Y2H A;  3EG5 B;  4XUJ A;  4UUZ B;  5B31 A;  5BO0 A;  1P3O A;  1EQZ C;  1M18 A;  4X23 C;  5AV6 A;  5E5A B;  3TU4 B;  4J8W D;  1B67 A;  4WU8 D;  4G92 B;  3W99 A;  3AZH C;  4NE5 A;  5JA4 A;  2F8N H;  1BH8 B;  3B0D B;  5AV8 D;  1KX4 D;  5DNM D;  2Y2Q A;  4XUJ D;  5B31 D;  1BFM A;  1P3K A;  4Z66 A;  4G91 C;  5AV5 B;  3AYW B;  3X1S C;  5AV6 D;  3AZM C; 
#chains in the Genus database with same CATH homology
 3MGP B;  5DNN C;  1KX5 C;  1P3A A;  2Y2P A;  4KUD A;  5BNV A;  3WKJ C;  1R4V A;  2Y2O A;  2ZY2 A;  5B1L C;  5CHL B;  3X1S A;  4X23 D;  2W8S A;  1BH9 B;  3AL0 C;  1P3K D;  4Z66 D;  5DNN A;  4DRA A;  2F2A C;  4H9S A;  2YFW A;  3WTP E;  4E45 A;  2Y2J A;  5CPK A;  1WWI A;  3WKJ A;  3W98 A;  1T3U A;  1P3A D;  3H0R C;  4J8W B;  1P3F A;  3C1B C;  3X1T C;  2ZM5 A;  3AFA C;  4KUD D;  2RIQ A;  5KDM A;  3KXB C;  4JJN A;  1H3O A;  4XZQ A;  3X1S D;  1S32 C;  4WJ3 C;  5AV9 C;  5DNN D;  1M19 C;  1KX4 B;  5DNM B;  4UPK A;  4XUJ B;  5B31 B;  2CV5 C;  3X1V C;  3LEL C;  5CPK D;  5BO0 B;  1P3O B;  3WKJ D;  3EPL A;  3W98 D;  3A1K A;  1M18 B;  4H9R A;  5AV6 B;  4J8U C;  2LY8 A;  3V9R A;  4CSR A;  1P3F D;  1M1A C;  5AV9 A;  4AWL B;  5B2J C;  1M19 A;  5B31 G;  3WAA A;  2CV5 A;  1W2E A;  3W99 B;  3AV2 A;  4JJN D;  4R8P C;  5JA4 B;  4XZQ D;  3REH C;  3MNN A;  1P3K B;  4Z66 B;  3REI A;  1ID3 A;  3AZN A;  2FJ7 A;  3B0C W;  3MGQ C;  4KGC C;  1B6W A;  3NQU A;  1TAF A;  4LD9 C;  5GT0 A;  5AVC C;  4NE3 A;  5AV9 D;  3AZG C;  1M19 D;  1P3A B;  3KUY C;  2F8N A;  2CV5 D;  1P34 C;  3AV2 D;  5BNV B;  3WA9 C;  4KUD B;  1P3M A;  4G91 B;  3AZE C;  3MGR C;  5F99 C;  3X1S B;  3R45 B;  4KGC A;  2ARO A;  4LD9 A;  5CPJ C;  3REI D;  1ID3 D;  5DNN B;  3AZN D;  3UT9 C;  3AZG A;  5B33 C;  2YFV A;  5B2J D;  2FJ7 D;  2YFW B;  5CPK B;  2L5A A;  1A7W A;  1P34 A;  5GT0 D;  3AN2 A;  5B24 C;  3B6G C;  3W98 B;  5AY8 C;  1F66 C;  2F8N D;  1P3F B;  5CP6 A;  5FUG A;  4WNN A;  2NZD C;  2DF4 C;  5GXQ A;  5KDM B;  3C1C A;  4WU9 A;  3B6F C;  2NQB A;  2G5H C;  4JJN B;  1H3O B;  4XZQ B;  1P3G C;  1PZR A;  2ARO D;  4KGC D;  4LD9 D;  4QLC A;  5BT1 D;  5AVC D;  2VQR A;  5AY8 A;  5B24 A;  3AZG D;  5B2I A;  3X1U A;  1P34 D;  2XD1 A;  3AN2 D;  4YM6 A;  3REJ C;  1HQ3 C;  3MGR D;  4H9R B;  4YS3 C;  1TZY A;  3AZJ C;  3AV1 C;  3V9R B;  4CSR B;  1P3G A;  5CP6 D;  5AV9 B;  4WU8 A;  2IO5 B;  1M19 B;  2RVQ D;  5GXQ D;  4Z5T A;  3C1C D;  4WU9 D;  3WAA B;  2NQB D;  3UTB C;  2CV5 B;  3AV2 B;  3REK C;  5AV8 A;  2HIO C;  5C3I C;  1ZLA C;  4QLC D;  5B24 D;  5AY8 D;  3LZ0 A;  4J8X C;  4DQY B;  5B2I D;  4ZBJ B;  3AZJ A;  3AV1 A;  3MNN B;  3X1U D;  2ZY3 A;  3REI B;  1ID3 B;  3AZN B;  2FJ7 B;  2NZD D;  1Z2C B;  4YM6 D;  2JSS A;  3LJA C;  3AZL A;  1TZY D;  3NQU B;  1TAF B;  3UTB A;  3REK A;  5GT0 B;  3AZI A;  1P3G D;  2HUE C;  4Z5T D;  3F6T A;  4J8X A;  2F8N B;  5CPI C;  1P3M B;  1EQZ A;  4HGA B;  1P3I C;  3REJ D;  4X23 A;  3W97 C;  2Y2L A;  3LZ0 D;  3FDD A;  3AZJ D;  4KGC B;  2ARO B;  3AV1 D;  4LD9 B;  3AZG B;  2YFV B;  2F8N G;  3AZH A;  3AZL D;  3UTB D;  3AZI D;  1P34 B;  3REK D;  4CAY A;  3AN2 B;  4H9O A;  1ZLA D;  4J8X D;  5CP6 B;  5FUG B;  4WNN B;  5GXQ B;  1EQZ D;  3C1C B;  4WU9 B;  2NQB B;  5BNX A;  4H9P A;  3AZM A;  3WTP C;  4QLC B;  5B24 B;  1KX5 A;  5B2I B;  3X1U B;  4J8V C;  3AZH D;  4EO5 C;  5CPI D;  1U35 C;  4YM6 B;  3B0C T;  5B1L A;  5GSU C;  2G5I C;  1TZY B;  2J8P A;  1P3G B;  4WU8 B;  4Z5T B;  1JFI A;  3AZM D;  3AZK C;  5AV8 B;  5B0Y C;  3W96 C;  1U35 A;  1KX5 D;  3KSY A;  3LZ0 B;  5GSU A;  3AZJ B;  3AV1 B;  3C1B A;  3X1T A;  3AFA A;  3KXB A;  1KX3 C;  5B1L D;  3AZL B;  1S32 A;  3UTB B;  3AZI B;  3VH6 A;  3REK B;  5B40 C;  4ZUX C;  1N1J A;  3W96 A;  5C3I B;  4J8X B;  3LEL A;  3X1V A;  3KWQ C;  3EPK A;  4NE6 A;  1EQZ B;  1U35 D;  5B1M C;  4X23 B;  4J8U A;  3AZF C;  5GSU D;  1M1A A;  3B0B A;  4H9N A;  3X1T D;  3C1B D;  5B2J A;  3AFA D;  2HUE B;  3KXB D;  4WV4 B;  3AZH B;  4R8P A;  1S32 D;  2BG1 A;  4CAY B;  3REH A;  4H9O B;  5B0Y D;  3W96 D;  5B1M A;  1P3L C;  3LEL D;  3X1V D;  5E5A C;  3TU4 C;  3REL C;  5BS7 C;  3MGQ A;  5BNX B;  4H9P B;  4J8U D;  3AZM B;  5AVC A;  1M1A D;  4G92 C;  5B40 D;  1KX5 B;  3KUY A;  3B0D C;  1P3L A;  3WA9 A;  3WKJ B;  4R8P D;  3AZE A;  3A1I A;  3REH D;  3MGR A;  3REL A;  5B1L B;  5B1M D;  5F99 A;  5BS7 A;  5AV5 C;  5CPJ A;  2BYK A;  4KHA A;  3UT9 A;  5B33 A;  3MGP C;  3VH6 T;  3UTA C;  3MGQ D;  3H0M C;  1JFI B;  3B6G A;  1F66 A;  1U35 B;  4Z2M H;  2Y2I A;  5GSU B;  3KUY D;  3C1B B;  3X1T B;  1P3L D;  3AFA B;  3WA9 D;  2NZD A;  3KXB B;  3AZE D;  3B6F A;  2ZY5 A;  3MGP A;  3REL D;  3UTA A;  5F99 D;  1S32 B;  5CPJ D;  1N1J B;  3UT9 D;  3W96 B;  5B33 D;  2CWE A;  5B0Z C;  2BYM A;  1WWS A;  3LEL B;  3X1V B;  3B6G D;  1Q9C A;  3REJ A;  1F66 D;  1HQ3 A;  2ZY4 A;  4YS3 A;  4J8U B;  1M1A B;  4H9N B;  5B2J B;  3B6F D;  5B0Z A;  3MGP D;  3UTA D;  3A6N C;  1KX4 C;  5DNM C;  4R8P B;  2HIO A;  2PYO C;  1ZLA A;  3REH B;  3EPH A;  3VH6 W;  1P3P C;  5B1M B;  1AOI C;  1P3O C;  3NQJ A;  1M18 C;  3LJA A;  1HQ3 D;  3MGQ B;  4AWL C;  4YS3 D;  3A6N A;  5AVC B;  2PYO A;  3IP4 C;  3W99 C;  1P3P A;  4E44 A;  3KUY B;  1AOI A;  5B0Z D;  4M6B A;  3MGS C;  5G49 A;  5CPI A;  1P3L B;  3WA9 B;  2HIO D;  3AZE B;  1P3I A;  1P3K C;  3MGR B;  3W97 A;  4Z66 C;  3REL B;  5F99 B;  5CPJ B;  2BYK B;  4KHA B;  3UT9 B;  5B33 B;  3LJA D;  1F1E A;  5B32 C;  3A6N D;  3MGS A;  3B6G B;  1P3A C;  5AY8 B;  1F66 B;  2PYO D;  4KUD C;  1P3P D;  1AOI D;  1P3O D;  2NZD B;  1M18 D;  5AVB C;  1P3I D;  3B6F B;  3UTA B;  3W97 D;  5B32 A;  4H9S C;  3WTP A;  4NFT A;  5JRG C;  5GT3 C;  5CPK C;  3VH5 A;  3W99 D;  2UWX A;  2BYM B;  3W98 C;  4J8V A;  3LZ1 C;  3MGS D;  2Y2N A;  2FFF B;  3REJ B;  5AVB A;  3R45 A;  1KU5 A;  1P3B C;  1P3F C;  1HQ3 B;  1ULY A;  4YS3 B;  5JRG A;  5GT3 A;  4JJN C;  4XZQ C;  2JCH A;  5B0Z B;  3LZ1 A;  2JE5 A;  5B32 D;  3AZK A;  2HIO B;  3WTP D;  5B0Y A;  3O62 C;  1ZLA B;  1P3B A;  3NQJ B;  4J8V D;  2Y2G A;  1KX3 A;  3LJA B;  5AVB D;  2IO5 C;  3A6N B;  2Y2M A;  3MVD C;  5B40 A;  4ZUX A;  3WAA C;  3O62 A;  2PYO B;  5JRG D;  3AV2 C;  5GT3 D;  1P3P B;  1AOI B;  5G49 B;  3LZ1 D;  3KWQ A;  3AZK D;  5CPI B;  4ZBJ C;  1P3I B;  3MNN C;  3REI C;  1P3B D;  1ID3 C;  3AZN C;  3AZF A;  3W97 B;  2FJ7 C;  3MVD A;  3P5J B;  1KX3 D;  5GT0 C;  2F8N K;  4H9Q A;  3VH5 T;  3MGS B;  4UUZ A;  2DQN C;  4ZUX D;  3O62 D;  1P3M C;  4HGA C;  3KWQ D;  5E5A A;  2XD5 A;  3TU4 A;  2ARO C;  5BT1 C;  3AZF D;  5B32 B;  4DRB A;  3WTP B;  3AYW C;  3MVD D;  3WAA D;  1BH8 A;  3AN2 C;  4J8V B;  4EO5 B;  5AVB B;  5CP6 C;  3MNN D;  5AV5 A;  2RVQ C;  5GXQ C;  5B32 G;  3C1C C;  4WU9 C;  3AYW A;  2NQB C;  5JRG B;  5E5A D;  5GT3 B;  3TU4 D;  4QLC C;  3EPJ A;  3LZ1 B;  3AZK B;  5B2I C;  5B0Y B;  1HTA A;  3X1U C;  1P3B B;  4Z2M G;  3VH5 W;  4YM6 C;  1P3M D;  4J8W C;  1TZY C;  1BH9 A;  1KX3 B;  3KFU G;  5AV5 D;  3H0L C;  4WU8 C;  4Z5T C;  5B40 B;  4ZUX B;  3O62 B;  3AYW D;  5AV8 C;  4XUJ C;  5B31 C;  3KWQ B;  4WZS B;  3LZ0 C;  4J8W A;  3AZF B;  2Y2K A;  5AV6 C;  3MVD B;  3AZL C;  3AZI C;  1KX4 A;  4H9Q B;  5DNM A;  2Y2H A;  3EG5 B;  4XUJ A;  4UUZ B;  5B31 A;  5BO0 A;  1P3O A;  1EQZ C;  1M18 A;  4X23 C;  5AV6 A;  5E5A B;  3TU4 B;  4J8W D;  1B67 A;  4WU8 D;  4G92 B;  3W99 A;  3AZH C;  4NE5 A;  5JA4 A;  2F8N H;  1BH8 B;  3B0D B;  5AV8 D;  1KX4 D;  5DNM D;  2Y2Q A;  4XUJ D;  5B31 D;  1BFM A;  1P3K A;  4Z66 A;  4G91 C;  5AV5 B;  3AYW B;  3X1S C;  5AV6 D;  3AZM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...