5DNNA

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnA00
5GT0A 4KGCC 3WTPB 4J8VD 4JJNC 5GT0C 5F99D 5DNMD 4NFTA 1F66A 3B6GA 3MGPA 3AZIA 2F8NA 3WKJA 4H9NA 3NQJB 3MGPC 3AZIC 3VH6A 3WKJC 5B1LD 1P3GD 4LD9C 4KUDD 5AV8B 3UT9D 3UTBB 3KUYA 3AZMB 3WA9D 4ZUXB 5JA4A 1P3FA 3NQUB 4J8XA 3W96D 5F99B 2F8NH 4HGAB 3A6ND 1U35D 1ID3D 1P3LA 4E45A 1JFIB 5GXQA 1P3GB 1P3IC 5BS7A 3AYWA 1KX4D 1P3LC 4G91B 3C1CD 4WU9B 2NQBB 3X1SA 5GSUD 5GXQC 5BNVB 5BS7C 3AYWC 3MGSC 3REIB 3WAAD 3X1SC 1TZYB 1P3AA 3REKA 5B1MA 3AZFA 3REKC 5B1MC 3MGQA 1BH8B 3TU4D 3W97D 1U35B 3B0DB 3MGQC 1H3OA 5B0YC 2IO5C 1HQ3C 4KHAA 5B31G 2AROD 3X1UC 3AV1B 5E5AD 5B2IB 5JRGB 3AZJD 5DNMC 3TU4B 3AZGD 3REJD 3WTPE 3KXBA 5AV9D 1F1EA 3LJAD 4R8PC 3AZLA 3B6FD 1TAFB 3X1TA 5C3IC 4KUDC 3AZLC 3UT9C 5B31D 1M1AA 3AZHA 3X1TC 1AOID 1P3KB 3WA9C 1P3PB 1M1AC 3AZJB 4QLCA 1S32B 1P3BA 5GT3A 4UUZB 5AV9B 5CPJB 3LJAB 1P3BC 2PYOD 2HUEB 5GT3C 4ZBJC 4CSRB 1KU5A 3AN2A 1KX4C 1EQZA 5B32G 1P3OD 1AOIB 3AN2C 5B2JA 5BNXA 3KWQD 3LZ1B 5AVBD 5DNNC 5B2JC 5G49B 1KX3D 4J8WB 4G92C 2PYOB 2BYKA 5CP6A 5CPIA 2HIOA 1KX5A 4J8UA 5CP6C 5CPIC 2HIOC 4X23B 5B32D 2AROC 4CAYA 1P34A 3C1BA 5AY8A 2F8NG 4WU8A 2FJ7A 4NE6A 1ZLAB 1P34C 5BT1C 3C1BC 3REJC 4Z5TB 3REHA 5AV5A 1M19B 5AV6B 4YS3A 3O62A 3X1VC 1B6WA 5B33A 5AV5C 3MGRD 4AWLB 3AZNA 5B24A 1F66D 3B6GD 1B67A 5B24C 3AZKA 4H9PB 4XUJB 3LELD 5AVCB 3AZEB 2F8ND 2NZDA 3RELA 3WTPD 3AZKC 1P3MB 3W99B 2NZDC 5GT0B 4Z66D 3AV2A 3W98C 4J8XD 4Z2MG 4YM6D 1F66B 3B6GB 3MGPB 3AZIB 5AV8D 3UTBD 2F8NB 4JJNA 3WKJB 3AZMD 4H9NB 3V9RA 4XZQA 4ZUXD 3AFAD 2CWEA 3B0BA 4XZQC 3LZ0A 4DRAA 3KUYB 4EO5B 3UTAC 4LD9A 4Z66B 3LZ0C 2CV5A 5KDMA 5JA4B 1P3FB 4J8XB 1P3AD 4YM6B 1BFMA 2CV5C 4WU9D 2JSSA 2NQBD 1ULYA 1P3LB 3REID 3VH5A 3AFAB 1TZYD 3AYWB 1BH9A 4H9OA 1P3IA 1M18A 1P3AB 3MVDA 3REKB 3AZFB 3MGSA 5CPKA 1M18C 3MVDC 3MGQB 2LY8A 5CPKC 2IO5B 3KXBD 3AV1D 5B2ID 1H3OB 4WNNA 5JRGD 3NQJA 4H9RA 5B0YA 1HQ3A 5B40A 3X1UA 5B0ZD 3B0CW 5AV8C 4J8VA 3KXBB 5B40C 3R45A 5DNMA 3AZLB 1P3KD 4J8VC 1P3PD 5BO0B 3X1TB 5F99C 1S32D 1WWSA 4R8PA 1M1AB 3AZHB 5B1LA 5CPJD 4KUDA 3UT9A 4QLCB 5B1LC 1P3GC 5B0ZB 1P3BB 3WA9A 4WU9C 2NQBC 3W96A 4ZBJB 3A6NA 1KX5D 3W96C 3LZ1D 1BH8A 3AN2B 1EQZB 3A6NC 4J8UD 1ID3A 4J8WD 5B2JB 1U35C 1ID3C 1KX4A 3C1CA 3MNND 5BNXB 5GSUA 5AY8D 4WU8D 4G92B 3C1CC 3WAAA 4X23D 5GSUC 4M6BA 5DNNA 3WAAC 2BYKB 3REHD 5CP6B 5CPIB 1KX5B 3W97A 3TU4A 5B2IC 2YFVA 4J8UB 1ZLAD 5B33D 3AZND 3TU4C 1N1JA 3W97C 4Z5TD 4CAYB 3MNNB 1P34B 3C1BB 5AY8B 5AV6D 4WZSB 4WU8B 1M19D 2FJ7B 2AROA 5E5AA 3REHB 4YS3B 4XUJD 5E5AC 5AVCD 3O62B 3REJA 3AZGA 3AZED 3AV2D 3AZJC 5B33B 3AZNB 1P3MD 1R4VA 5B24B 3AZGC 3W99D 3B6FA 4KGCD 4NE3A 3X1VA 5AV9C 3AZKB 5CPJC 3LJAC 3B6FC 5GT0D 5B31A 2NZDB 4WV4B 3RELB 1AOIA 5B31C 3MGPD 5FUGA 3AZID 1AOIC 5G49A 3WKJD 3AV2B 4KGCB 2YFWA 3W98A 3KUYD 4JJNB 2PYOC 3V9RB 1P3OA 1P3FD 3B0CT 3LZ0B 1P3OC 3KWQA 5AVBA 1KX3A 1P3ID 4LD9B 3KWQC 2CV5B 5KDMB 1P3LD 5AVBC 5GXQD 1KX3C 3UTAA 3AYWD 3MGSD 3X1SD 5B32A 5AV6C 3REKD 5B1MD 3AZFD 5B32C 2BYMA 1BH9B 4H9OB 3MGQD 1P3IB 3AZEC 1M18B 3MVDB 5GXQB 3MGSB 5CPKB 3X1UD 3X1SB 1WWIA 3MGRA 4H9QA 5B1MB 3MGRC 4WNNB 3LELA 1F66C 3B6GC 4R8PD 4H9RB 3WTPA 5B0YB 3KSYA 3LELC 1Q9CA 1HQ3B 3AZLD 3WTPC 5B40B 3X1UB 3X1TD 4KHAB 4Z66A 4J8VB 3KUYC 1M1AD 3AZHD 4EO5C 3R45B 2L5AA 4YM6A 5DNMB 4Z66C 5AV8A 3UTBA 1P3FC 4J8XC 4QLCD 4YM6C 3AZMA 4R8PB 1P3BD 5GT3D 4ZUXA 3UTBC 3AFAA 5B1LB 3NQUA 5C3IB 5F99A 3AZMC 4KUDB 3UT9B 4ZUXC 3AFAC 3AN2D 1EQZD 4HGAC 3WA9B 2RVQD 3W96B 1JFIA 4H9SA 1P3GA 5DNND 5B2JD 3A6NB 4WU9A 2NQBA 3VH6T 1P3AC 3AZFC 4H9SC 1A7WA 5BNVA 1ID3B 4G91C 3REIA 5GT3B 1TZYA 1KX4B 3C1CB 3REIC 3VH5T 5CP6D 2HIOD 5CPID 5GSUB 1TZYC 1U35A 3WAAB 4Z2MH 4DRBA 5DNNB 3B0DC 1P34D 5BT1D 3C1BD 3W97B 2FJ7D 2YFVB 4E44A 3AV1A 1N1JB 5B2IA 3X1VD 3KXBC 5BO0A 5AV5D 2HIOB 5JRGA 3AV1C 2F8NK 4YS3D 2AROB 3O62D 5JRGC 5B24D 5E5AB 3AZHC 1TAFA 5CHLB 3AZKD 5B0ZA 3AZGB 3REJB 2NZDD 4QLCC 3RELD 5B0ZC 3B6FB 1P3KA 1P3PA 3X1VB 1HTAA 3AZJA 5AV5B 3W98D 1S32A 1P3KC 5B31B 1P3PC 4UUZA 5AV9A 1S32C 5CPJA 3LJAA 1EQZC 2RVQC 5FUGB 4CSRA 4JJND 2HUEC 4XZQD 3VH6W 3UTAD 3LZ0D 2YFWB 3LZ1A 3W98B 1KX5C 4LD9D 1P3OB 4J8WA 2CV5D 3VH5W 3LZ1C 4J8UC 2PYOA 3MNNA 3KWQB 4J8WC 5AVBB 1KX3B 3MNNC 4XZQB 4X23A 5AY8C 4WU8C 2FJ7C 3UTAB 4X23C 3REHC 1ZLAA 5B32B 4YS3C 3O62C 1M18D 3MVDD 4Z5TA 1ZLAC 5B33C 3AZNC 2BYMB 5AV6A 5CPKD 1M19A 4Z5TC 1M19C 4NE5A 3RELC 4AWLC 4H9PA 4XUJA 5AVCA 3AZEA 3MGRB 1P3MA 5B0YD 4XUJC 4H9QB 5AVCC 3W99A 1HQ3D 3AV2C 4KGCA 1P3MC 3LELB 5B40D 3W99C
chains in the Genus database with same CATH superfamily
5GT0A 4KGCC 3WTPB 4J8VD 4JJNC 5GT0C 5F99D 5DNMD 4NFTA 2J8PA 1F66A 3B6GA 3MGPA 3AZIA 2ZM5A 2F8NA 3WKJA 4H9NA 3NQJB 3MGPC 3AZIC 2Y2HA 2BG1A 3VH6A 3WKJC 5B1LD 1P3GD 4LD9C 2G5HC 4KUDD 5AV8B 3UT9D 3UTBB 3KUYA 3AZMB 2ZY3A 3WA9D 4ZUXB 5JA4A 1P3FA 3NQUB 4J8XA 3W96D 5F99B 2XD1A 2Y2OA 4HGAB 3A6ND 2F8NH 1U35D 1ID3D 1P3LA 4E45A 1JFIB 5GXQA 1P3GB 1P3IC 5BS7A 3AYWA 1KX4D 1P3LC 4G91B 3H0LC 3C1CD 4WU9B 2NQBB 3X1SA 5GSUD 5GXQC 5BNVB 5BS7C 3AYWC 3MGSC 3REIB 3WAAD 3X1SC 1TZYB 1P3AA 3REKA 5B1MA 3AZFA 2XD5A 3REKC 5B1MC 3MGQA 1BH8B 3TU4D 3W97D 1U35B 2RIQA 3B0DB 3MGQC 3F6TA 1H3OA 5B0YC 2IO5C 1HQ3C 4KHAA 5B31G 2AROD 3X1UC 3AV1B 5E5AD 5B2IB 5JRGB 3AZJD 5DNMC 3TU4B 3AZGD 3REJD 3WTPE 3A1IA 3KXBA 5AV9D 1F1EA 3LJAD 4R8PC 3AZLA 3B6FD 1TAFB 3X1TA 5C3IC 4KUDC 3AZLC 3UT9C 5B31D 1M1AA 3AZHA 3X1TC 1AOID 1P3KB 3WA9C 1P3PB 1M1AC 3AZJB 4QLCA 1S32B 1P3BA 5GT3A 4UUZB 5AV9B 2JE5A 5CPJB 3LJAB 2Y2KA 1P3BC 2PYOD 2HUEB 5GT3C 4ZBJC 4CSRB 1KU5A 3AN2A 1KX4C 1EQZA 5B32G 1P3OD 1AOIB 3AN2C 5B2JA 5BNXA 3KWQD 3LZ1B 5AVBD 5DNNC 5B2JC 5G49B 1KX3D 4J8WB 4G92C 2PYOB 2BYKA 5CP6A 5CPIA 2HIOA 1KX5A 4J8UA 5CP6C 5CPIC 2HIOC 4X23B 5B32D 2AROC 4CAYA 1P34A 3C1BA 5AY8A 2F8NG 4WU8A 2FJ7A 4NE6A 1ZLAB 1P34C 5BT1C 3C1BC 3REJC 2Y2MA 4Z5TB 2Y2GA 3REHA 5AV5A 1M19B 5AV6B 4YS3A 3O62A 3X1VC 1B6WA 5B33A 5AV5C 3MGRD 4AWLB 3AZNA 5B24A 3EG5B 1F66D 3B6GD 1B67A 5B24C 3AZKA 4H9PB 4XUJB 3LELD 5AVCB 3AZEB 2F8ND 2NZDA 3RELA 3WTPD 3AZKC 1P3MB 3W99B 2NZDC 5GT0B 2Y2QA 4Z66D 3AV2A 3W98C 4J8XD 4Z2MG 4YM6D 1F66B 3B6GB 3MGPB 3AZIB 5AV8D 3UTBD 2F8NB 4JJNA 3WKJB 3AZMD 4H9NB 3V9RA 4XZQA 4ZUXD 3AFAD 2CWEA 3B0BA 4XZQC 3LZ0A 4DRAA 3KUYB 4EO5B 3UTAC 4LD9A 4Z66B 3LZ0C 2CV5A 5KDMA 2UWXA 5JA4B 1P3FB 4J8XB 1P3AD 4YM6B 1BFMA 3H0RC 4UPKA 2CV5C 4WU9D 2JSSA 2NQBD 1ULYA 1P3LB 2Y2IA 3REID 3VH5A 3AFAB 1TZYD 3AYWB 1BH9A 4H9OA 1P3IA 1M18A 1P3AB 3MVDA 3REKB 3AZFB 3MGSA 5CPKA 1M18C 3MVDC 3MGQB 2LY8A 3FDDA 5CPKC 2IO5B 3KXBD 3AV1D 5B2ID 1H3OB 4WNNA 5JRGD 3NQJA 4H9RA 5B0YA 1HQ3A 2Y2LA 3KFUG 5B40A 3X1UA 5B0ZD 3B0CW 5AV8C 4J8VA 3KXBB 5B40C 3R45A 5DNMA 3AZLB 1P3KD 2DF4C 4J8VC 1P3PD 5BO0B 3X1TB 5F99C 1S32D 1WWSA 4R8PA 1M1AB 3AZHB 5B1LA 5CPJD 4KUDA 2Y2JA 2ZY4A 3UT9A 4QLCB 5B1LC 1P3GC 5B0ZB 1P3BB 3WA9A 4WU9C 2NQBC 2F2AC 3W96A 4ZBJB 3A6NA 1KX5D 3W96C 3LZ1D 1BH8A 3AN2B 1EQZB 3A6NC 4J8UD 1ID3A 4J8WD 3EPKA 5B2JB 1U35C 1ID3C 1KX4A 3C1CA 3MNND 5BNXB 5GSUA 5AY8D 4WU8D 4G92B 3C1CC 3WAAA 4X23D 5GSUC 4M6BA 5DNNA 3WAAC 2BYKB 3REHD 5CP6B 5CPIB 1KX5B 3W97A 3TU4A 5B2IC 2YFVA 2Y2NA 4J8UB 1ZLAD 5B33D 3AZND 3TU4C 1N1JA 3W97C 4Z5TD 4CAYB 3MNNB 1P34B 3C1BB 5AY8B 5AV6D 4WZSB 4WU8B 1M19D 2FJ7B 2AROA 5E5AA 3REHB 2Y2PA 4YS3B 4XUJD 5E5AC 5AVCD 3O62B 3REJA 3AZGA 3AZED 3AV2D 3AZJC 5B33B 2ZY5A 3AZNB 1R4VA 5B24B 1P3MD 3AZGC 3W99D 3B6FA 4KGCD 4NE3A 3X1VA 5AV9C 3AZKB 5CPJC 3LJAC 3B6FC 5B31A 5GT0D 2NZDB 4WV4B 3RELB 1AOIA 5B31C 2W8SA 3MGPD 5FUGA 3AZID 3P5JB 1AOIC 5G49A 2G5IC 3WKJD 3AV2B 4DQYB 2FFFB 4KGCB 1W2EA 2YFWA 3W98A 3AL0C 3KUYD 4JJNB 2PYOC 3V9RB 1P3OA 1P3FD 3B0CT 3LZ0B 1P3OC 3KWQA 5AVBA 1KX3A 1P3ID 4LD9B 3KWQC 2CV5B 5KDMB 1P3LD 5AVBC 5GXQD 1KX3C 3UTAA 3AYWD 3MGSD 3X1SD 5B32A 5AV6C 2ZY2A 3REKD 5B1MD 3AZFD 5B32C 2BYMA 1BH9B 4H9OB 3MGQD 1P3IB 3AZEC 1M18B 3MVDB 5GXQB 3MGSB 5CPKB 3X1UD 3X1SB 1WWIA 3MGRA 4H9QA 5B1MB 3MGRC 4WNNB 3LELA 1F66C 3B6GC 4R8PD 4H9RB 3WTPA 5B0YB 3KSYA 3LELC 1Q9CA 1HQ3B 3AZLD 3WTPC 3EPJA 5B40B 3X1UB 3X1TD 4KHAB 4Z66A 4J8VB 3KUYC 1M1AD 3AZHD 4EO5C 3R45B 2L5AA 4YM6A 5DNMB 4Z66C 5AV8A 3UTBA 1P3FC 4J8XC 4QLCD 4YM6C 3AZMA 4R8PB 1P3BD 5GT3D 4ZUXA 3UTBC 3AFAA 5B1LB 3NQUA 5C3IB 5F99A 3AZMC 4KUDB 3UT9B 4ZUXC 3AFAC 3AN2D 1EQZD 4HGAC 3WA9B 2RVQD 3W96B 1JFIA 4H9SA 1P3GA 5DNND 5B2JD 3A6NB 4WU9A 2NQBA 2VQRA 3VH6T 1P3AC 3AZFC 4H9SC 1A7WA 5BNVA 1ID3B 4G91C 3REIA 5GT3B 1TZYA 1KX4B 3C1CB 3REIC 3VH5T 5CP6D 2HIOD 3EPLA 5GSUB 1TZYC 5CPID 1U35A 3WAAB 4Z2MH 4DRBA 5DNNB 3B0DC 1P34D 5BT1D 3C1BD 3W97B 2FJ7D 2DQNC 2YFVB 4E44A 3AV1A 1N1JB 5B2IA 3X1VD 3KXBC 5BO0A 5AV5D 2HIOB 5JRGA 3AV1C 2F8NK 4YS3D 2AROB 3O62D 5JRGC 5B24D 5E5AB 3AZHC 1TAFA 5CHLB 3AZKD 5B0ZA 3AZGB 3REJB 2NZDD 4QLCC 3RELD 5B0ZC 3EPHA 2JCHA 1P3KA 3B6FB 1P3PA 3X1VB 1HTAA 3AZJA 5AV5B 3W98D 1S32A 1P3KC 5B31B 1P3PC 1T3UA 4UUZA 5AV9A 1S32C 5CPJA 3LJAA 1EQZC 2RVQC 5FUGB 4CSRA 4JJND 2HUEC 4XZQD 3A1KA 3VH6W 3H0MC 3UTAD 3LZ0D 2YFWB 3LZ1A 3W98B 3IP4C 1KX5C 4LD9D 1P3OB 4J8WA 2CV5D 1PZRA 3VH5W 3LZ1C 4J8UC 2PYOA 3MNNA 3KWQB 4J8WC 5AVBB 1KX3B 3MNNC 4XZQB 4X23A 5AY8C 4WU8C 2FJ7C 3UTAB 4X23C 1Z2CB 3REHC 1ZLAA 5B32B 4YS3C 3O62C 1M18D 3MVDD 4Z5TA 1ZLAC 5B33C 3AZNC 2BYMB 5AV6A 5CPKD 1M19A 4Z5TC 1M19C 4NE5A 3RELC 4AWLC 4WJ3C 4H9PA 4XUJA 5AVCA 3AZEA 3MGRB 1P3MA 5B0YD 4XUJC 4H9QB 5AVCC 3W99A 1HQ3D 3AV2C 4KGCA 1P3MC 3LELB 5B40D 3W99C
chains in the Genus database with same CATH topology
5GT0A 4KGCC 3WTPB 4J8VD 4JJNC 5GT0C 5F99D 5DNMD 4NFTA 2J8PA 1F66A 3B6GA 3MGPA 3AZIA 2ZM5A 2F8NA 3WKJA 4H9NA 3NQJB 3MGPC 3AZIC 2Y2HA 2BG1A 3VH6A 3WKJC 5B1LD 1P3GD 4LD9C 2G5HC 4KUDD 5AV8B 3UT9D 3UTBB 3KUYA 3AZMB 2ZY3A 3WA9D 4ZUXB 5JA4A 1P3FA 3NQUB 4J8XA 3W96D 5F99B 2XD1A 2Y2OA 4HGAB 3A6ND 2F8NH 1U35D 1ID3D 1P3LA 4E45A 1JFIB 5GXQA 1P3GB 1P3IC 5BS7A 3AYWA 1KX4D 1P3LC 4G91B 3H0LC 3C1CD 4WU9B 2NQBB 3X1SA 5GSUD 5GXQC 5BNVB 5BS7C 3AYWC 3MGSC 3REIB 3WAAD 3X1SC 1TZYB 1P3AA 3REKA 5B1MA 3AZFA 2XD5A 3REKC 5B1MC 3MGQA 1BH8B 3TU4D 3W97D 1U35B 2RIQA 3B0DB 3MGQC 3F6TA 1H3OA 5B0YC 2IO5C 1HQ3C 4KHAA 5B31G 2AROD 3X1UC 3AV1B 5E5AD 5B2IB 5JRGB 3AZJD 5DNMC 3TU4B 3AZGD 3REJD 3WTPE 3A1IA 3KXBA 5AV9D 1F1EA 3LJAD 4R8PC 3AZLA 3B6FD 1TAFB 3X1TA 5C3IC 4KUDC 3AZLC 3UT9C 5B31D 1M1AA 3AZHA 3X1TC 1AOID 1P3KB 3WA9C 1P3PB 1M1AC 3AZJB 4QLCA 1S32B 1P3BA 5GT3A 4UUZB 5AV9B 2JE5A 5CPJB 3LJAB 2Y2KA 1P3BC 2PYOD 2HUEB 5GT3C 4ZBJC 4CSRB 1KU5A 3AN2A 1KX4C 1EQZA 5B32G 1P3OD 1AOIB 3AN2C 5B2JA 5BNXA 3KWQD 3LZ1B 5AVBD 5DNNC 5B2JC 5G49B 1KX3D 4J8WB 4G92C 2PYOB 2BYKA 5CP6A 5CPIA 2HIOA 1KX5A 4J8UA 5CP6C 5CPIC 2HIOC 4X23B 5B32D 2AROC 4CAYA 1P34A 3C1BA 5AY8A 2F8NG 4WU8A 2FJ7A 4NE6A 1ZLAB 1P34C 5BT1C 3C1BC 3REJC 2Y2MA 4Z5TB 2Y2GA 3REHA 5AV5A 1M19B 5AV6B 4YS3A 3O62A 3X1VC 1B6WA 5B33A 5AV5C 3MGRD 4AWLB 3AZNA 5B24A 3EG5B 1F66D 3B6GD 1B67A 5B24C 3AZKA 4H9PB 4XUJB 3LELD 5AVCB 3AZEB 2F8ND 2NZDA 3RELA 3WTPD 3AZKC 1P3MB 3W99B 2NZDC 5GT0B 2Y2QA 4Z66D 3AV2A 3W98C 4J8XD 4Z2MG 4YM6D 1F66B 3B6GB 3MGPB 3AZIB 5AV8D 3UTBD 2F8NB 4JJNA 3WKJB 3AZMD 4H9NB 3V9RA 4XZQA 4ZUXD 3AFAD 2CWEA 3B0BA 4XZQC 3LZ0A 4DRAA 3KUYB 4EO5B 3UTAC 4LD9A 4Z66B 3LZ0C 2CV5A 5KDMA 2UWXA 5JA4B 1P3FB 4J8XB 1P3AD 4YM6B 1BFMA 3H0RC 4UPKA 2CV5C 4WU9D 2JSSA 2NQBD 1ULYA 1P3LB 2Y2IA 3REID 3VH5A 3AFAB 1TZYD 3AYWB 1BH9A 4H9OA 1P3IA 1M18A 1P3AB 3MVDA 3REKB 3AZFB 3MGSA 5CPKA 1M18C 3MVDC 3MGQB 2LY8A 3FDDA 5CPKC 2IO5B 3KXBD 3AV1D 5B2ID 1H3OB 4WNNA 5JRGD 3NQJA 4H9RA 5B0YA 1HQ3A 2Y2LA 3KFUG 5B40A 3X1UA 5B0ZD 3B0CW 5AV8C 4J8VA 3KXBB 5B40C 3R45A 5DNMA 3AZLB 1P3KD 2DF4C 4J8VC 1P3PD 5BO0B 3X1TB 5F99C 1S32D 1WWSA 4R8PA 1M1AB 3AZHB 5B1LA 5CPJD 4KUDA 2Y2JA 2ZY4A 3UT9A 4QLCB 5B1LC 1P3GC 5B0ZB 1P3BB 3WA9A 4WU9C 2NQBC 2F2AC 3W96A 4ZBJB 3A6NA 1KX5D 3W96C 3LZ1D 1BH8A 3AN2B 1EQZB 3A6NC 4J8UD 1ID3A 4J8WD 3EPKA 5B2JB 1U35C 1ID3C 1KX4A 3C1CA 3MNND 5BNXB 5GSUA 5AY8D 4WU8D 4G92B 3C1CC 3WAAA 4X23D 5GSUC 4M6BA 5DNNA 3WAAC 2BYKB 3REHD 5CP6B 5CPIB 1KX5B 3W97A 3TU4A 5B2IC 2YFVA 2Y2NA 4J8UB 1ZLAD 5B33D 3AZND 3TU4C 1N1JA 3W97C 4Z5TD 4CAYB 3MNNB 1P34B 3C1BB 5AY8B 5AV6D 4WZSB 4WU8B 1M19D 2FJ7B 2AROA 5E5AA 3REHB 2Y2PA 4YS3B 4XUJD 5E5AC 5AVCD 3O62B 3REJA 3AZGA 3AZED 3AV2D 3AZJC 5B33B 2ZY5A 3AZNB 1R4VA 5B24B 1P3MD 3AZGC 3W99D 3B6FA 4KGCD 4NE3A 3X1VA 5AV9C 3AZKB 5CPJC 3LJAC 3B6FC 5B31A 5GT0D 2NZDB 4WV4B 3RELB 1AOIA 5B31C 2W8SA 3MGPD 5FUGA 3AZID 3P5JB 1AOIC 5G49A 2G5IC 3WKJD 3AV2B 4DQYB 2FFFB 4KGCB 1W2EA 2YFWA 3W98A 3AL0C 3KUYD 4JJNB 2PYOC 3V9RB 1P3OA 1P3FD 3B0CT 3LZ0B 1P3OC 3KWQA 5AVBA 1KX3A 1P3ID 4LD9B 3KWQC 2CV5B 5KDMB 1P3LD 5AVBC 5GXQD 1KX3C 3UTAA 3AYWD 3MGSD 3X1SD 5B32A 5AV6C 2ZY2A 3REKD 5B1MD 3AZFD 5B32C 2BYMA 1BH9B 4H9OB 3MGQD 1P3IB 3AZEC 1M18B 3MVDB 5GXQB 3MGSB 5CPKB 3X1UD 3X1SB 1WWIA 3MGRA 4H9QA 5B1MB 3MGRC 4WNNB 3LELA 1F66C 3B6GC 4R8PD 4H9RB 3WTPA 5B0YB 3KSYA 3LELC 1Q9CA 1HQ3B 3AZLD 3WTPC 3EPJA 5B40B 3X1UB 3X1TD 4KHAB 4Z66A 4J8VB 3KUYC 1M1AD 3AZHD 4EO5C 3R45B 2L5AA 4YM6A 5DNMB 4Z66C 5AV8A 3UTBA 1P3FC 4J8XC 4QLCD 4YM6C 3AZMA 4R8PB 1P3BD 5GT3D 4ZUXA 3UTBC 3AFAA 5B1LB 3NQUA 5C3IB 5F99A 3AZMC 4KUDB 3UT9B 4ZUXC 3AFAC 3AN2D 1EQZD 4HGAC 3WA9B 2RVQD 3W96B 1JFIA 4H9SA 1P3GA 5DNND 5B2JD 3A6NB 4WU9A 2NQBA 2VQRA 3VH6T 1P3AC 3AZFC 4H9SC 1A7WA 5BNVA 1ID3B 4G91C 3REIA 5GT3B 1TZYA 1KX4B 3C1CB 3REIC 3VH5T 5CP6D 2HIOD 3EPLA 5GSUB 1TZYC 5CPID 1U35A 3WAAB 4Z2MH 4DRBA 5DNNB 3B0DC 1P34D 5BT1D 3C1BD 3W97B 2FJ7D 2DQNC 2YFVB 4E44A 3AV1A 1N1JB 5B2IA 3X1VD 3KXBC 5BO0A 5AV5D 2HIOB 5JRGA 3AV1C 2F8NK 4YS3D 2AROB 3O62D 5JRGC 5B24D 5E5AB 3AZHC 1TAFA 5CHLB 3AZKD 5B0ZA 3AZGB 3REJB 2NZDD 4QLCC 3RELD 5B0ZC 3EPHA 2JCHA 1P3KA 3B6FB 1P3PA 3X1VB 1HTAA 3AZJA 5AV5B 3W98D 1S32A 1P3KC 5B31B 1P3PC 1T3UA 4UUZA 5AV9A 1S32C 5CPJA 3LJAA 1EQZC 2RVQC 5FUGB 4CSRA 4JJND 2HUEC 4XZQD 3A1KA 3VH6W 3H0MC 3UTAD 3LZ0D 2YFWB 3LZ1A 3W98B 3IP4C 1KX5C 4LD9D 1P3OB 4J8WA 2CV5D 1PZRA 3VH5W 3LZ1C 4J8UC 2PYOA 3MNNA 3KWQB 4J8WC 5AVBB 1KX3B 3MNNC 4XZQB 4X23A 5AY8C 4WU8C 2FJ7C 3UTAB 4X23C 1Z2CB 3REHC 1ZLAA 5B32B 4YS3C 3O62C 1M18D 3MVDD 4Z5TA 1ZLAC 5B33C 3AZNC 2BYMB 5AV6A 5CPKD 1M19A 4Z5TC 1M19C 4NE5A 3RELC 4AWLC 4WJ3C 4H9PA 4XUJA 5AVCA 3AZEA 3MGRB 1P3MA 5B0YD 4XUJC 4H9QB 5AVCC 3W99A 1HQ3D 3AV2C 4KGCA 1P3MC 3LELB 5B40D 3W99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 A;  4KGC C;  3WTP B;  4J8V D;  4JJN C;  5GT0 C;  5F99 D;  5DNM D;  4NFT A;  1F66 A;  3B6G A;  3MGP A;  3AZI A;  2F8N A;  3WKJ A;  4H9N A;  3NQJ B;  3MGP C;  3AZI C;  3VH6 A;  3WKJ C;  5B1L D;  1P3G D;  4LD9 C;  4KUD D;  5AV8 B;  3UT9 D;  3UTB B;  3KUY A;  3AZM B;  3WA9 D;  4ZUX B;  5JA4 A;  1P3F A;  3NQU B;  4J8X A;  3W96 D;  5F99 B;  2F8N H;  4HGA B;  3A6N D;  1U35 D;  1ID3 D;  1P3L A;  4E45 A;  1JFI B;  5GXQ A;  1P3G B;  1P3I C;  5BS7 A;  3AYW A;  1KX4 D;  1P3L C;  4G91 B;  3C1C D;  4WU9 B;  2NQB B;  3X1S A;  5GSU D;  5GXQ C;  5BNV B;  5BS7 C;  3AYW C;  3MGS C;  3REI B;  3WAA D;  3X1S C;  1TZY B;  1P3A A;  3REK A;  5B1M A;  3AZF A;  3REK C;  5B1M C;  3MGQ A;  1BH8 B;  3TU4 D;  3W97 D;  1U35 B;  3B0D B;  3MGQ C;  1H3O A;  5B0Y C;  2IO5 C;  1HQ3 C;  4KHA A;  5B31 G;  2ARO D;  3X1U C;  3AV1 B;  5E5A D;  5B2I B;  5JRG B;  3AZJ D;  5DNM C;  3TU4 B;  3AZG D;  3REJ D;  3WTP E;  3KXB A;  5AV9 D;  1F1E A;  3LJA D;  4R8P C;  3AZL A;  3B6F D;  1TAF B;  3X1T A;  5C3I C;  4KUD C;  3AZL C;  3UT9 C;  5B31 D;  1M1A A;  3AZH A;  3X1T C;  1AOI D;  1P3K B;  3WA9 C;  1P3P B;  1M1A C;  3AZJ B;  4QLC A;  1S32 B;  1P3B A;  5GT3 A;  4UUZ B;  5AV9 B;  5CPJ B;  3LJA B;  1P3B C;  2PYO D;  2HUE B;  5GT3 C;  4ZBJ C;  4CSR B;  1KU5 A;  3AN2 A;  1KX4 C;  1EQZ A;  5B32 G;  1P3O D;  1AOI B;  3AN2 C;  5B2J A;  5BNX A;  3KWQ D;  3LZ1 B;  5AVB D;  5DNN C;  5B2J C;  5G49 B;  1KX3 D;  4J8W B;  4G92 C;  2PYO B;  2BYK A;  5CP6 A;  5CPI A;  2HIO A;  1KX5 A;  4J8U A;  5CP6 C;  5CPI C;  2HIO C;  4X23 B;  5B32 D;  2ARO C;  4CAY A;  1P34 A;  3C1B A;  5AY8 A;  2F8N G;  4WU8 A;  2FJ7 A;  4NE6 A;  1ZLA B;  1P34 C;  5BT1 C;  3C1B C;  3REJ C;  4Z5T B;  3REH A;  5AV5 A;  1M19 B;  5AV6 B;  4YS3 A;  3O62 A;  3X1V C;  1B6W A;  5B33 A;  5AV5 C;  3MGR D;  4AWL B;  3AZN A;  5B24 A;  1F66 D;  3B6G D;  1B67 A;  5B24 C;  3AZK A;  4H9P B;  4XUJ B;  3LEL D;  5AVC B;  3AZE B;  2F8N D;  2NZD A;  3REL A;  3WTP D;  3AZK C;  1P3M B;  3W99 B;  2NZD C;  5GT0 B;  4Z66 D;  3AV2 A;  3W98 C;  4J8X D;  4Z2M G;  4YM6 D;  1F66 B;  3B6G B;  3MGP B;  3AZI B;  5AV8 D;  3UTB D;  2F8N B;  4JJN A;  3WKJ B;  3AZM D;  4H9N B;  3V9R A;  4XZQ A;  4ZUX D;  3AFA D;  2CWE A;  3B0B A;  4XZQ C;  3LZ0 A;  4DRA A;  3KUY B;  4EO5 B;  3UTA C;  4LD9 A;  4Z66 B;  3LZ0 C;  2CV5 A;  5KDM A;  5JA4 B;  1P3F B;  4J8X B;  1P3A D;  4YM6 B;  1BFM A;  2CV5 C;  4WU9 D;  2JSS A;  2NQB D;  1ULY A;  1P3L B;  3REI D;  3VH5 A;  3AFA B;  1TZY D;  3AYW B;  1BH9 A;  4H9O A;  1P3I A;  1M18 A;  1P3A B;  3MVD A;  3REK B;  3AZF B;  3MGS A;  5CPK A;  1M18 C;  3MVD C;  3MGQ B;  2LY8 A;  5CPK C;  2IO5 B;  3KXB D;  3AV1 D;  5B2I D;  1H3O B;  4WNN A;  5JRG D;  3NQJ A;  4H9R A;  5B0Y A;  1HQ3 A;  5B40 A;  3X1U A;  5B0Z D;  3B0C W;  5AV8 C;  4J8V A;  3KXB B;  5B40 C;  3R45 A;  5DNM A;  3AZL B;  1P3K D;  4J8V C;  1P3P D;  5BO0 B;  3X1T B;  5F99 C;  1S32 D;  1WWS A;  4R8P A;  1M1A B;  3AZH B;  5B1L A;  5CPJ D;  4KUD A;  3UT9 A;  4QLC B;  5B1L C;  1P3G C;  5B0Z B;  1P3B B;  3WA9 A;  4WU9 C;  2NQB C;  3W96 A;  4ZBJ B;  3A6N A;  1KX5 D;  3W96 C;  3LZ1 D;  1BH8 A;  3AN2 B;  1EQZ B;  3A6N C;  4J8U D;  1ID3 A;  4J8W D;  5B2J B;  1U35 C;  1ID3 C;  1KX4 A;  3C1C A;  3MNN D;  5BNX B;  5GSU A;  5AY8 D;  4WU8 D;  4G92 B;  3C1C C;  3WAA A;  4X23 D;  5GSU C;  4M6B A;  5DNN A;  3WAA C;  2BYK B;  3REH D;  5CP6 B;  5CPI B;  1KX5 B;  3W97 A;  3TU4 A;  5B2I C;  2YFV A;  4J8U B;  1ZLA D;  5B33 D;  3AZN D;  3TU4 C;  1N1J A;  3W97 C;  4Z5T D;  4CAY B;  3MNN B;  1P34 B;  3C1B B;  5AY8 B;  5AV6 D;  4WZS B;  4WU8 B;  1M19 D;  2FJ7 B;  2ARO A;  5E5A A;  3REH B;  4YS3 B;  4XUJ D;  5E5A C;  5AVC D;  3O62 B;  3REJ A;  3AZG A;  3AZE D;  3AV2 D;  3AZJ C;  5B33 B;  3AZN B;  1P3M D;  1R4V A;  5B24 B;  3AZG C;  3W99 D;  3B6F A;  4KGC D;  4NE3 A;  3X1V A;  5AV9 C;  3AZK B;  5CPJ C;  3LJA C;  3B6F C;  5GT0 D;  5B31 A;  2NZD B;  4WV4 B;  3REL B;  1AOI A;  5B31 C;  3MGP D;  5FUG A;  3AZI D;  1AOI C;  5G49 A;  3WKJ D;  3AV2 B;  4KGC B;  2YFW A;  3W98 A;  3KUY D;  4JJN B;  2PYO C;  3V9R B;  1P3O A;  1P3F D;  3B0C T;  3LZ0 B;  1P3O C;  3KWQ A;  5AVB A;  1KX3 A;  1P3I D;  4LD9 B;  3KWQ C;  2CV5 B;  5KDM B;  1P3L D;  5AVB C;  5GXQ D;  1KX3 C;  3UTA A;  3AYW D;  3MGS D;  3X1S D;  5B32 A;  5AV6 C;  3REK D;  5B1M D;  3AZF D;  5B32 C;  2BYM A;  1BH9 B;  4H9O B;  3MGQ D;  1P3I B;  3AZE C;  1M18 B;  3MVD B;  5GXQ B;  3MGS B;  5CPK B;  3X1U D;  3X1S B;  1WWI A;  3MGR A;  4H9Q A;  5B1M B;  3MGR C;  4WNN B;  3LEL A;  1F66 C;  3B6G C;  4R8P D;  4H9R B;  3WTP A;  5B0Y B;  3KSY A;  3LEL C;  1Q9C A;  1HQ3 B;  3AZL D;  3WTP C;  5B40 B;  3X1U B;  3X1T D;  4KHA B;  4Z66 A;  4J8V B;  3KUY C;  1M1A D;  3AZH D;  4EO5 C;  3R45 B;  2L5A A;  4YM6 A;  5DNM B;  4Z66 C;  5AV8 A;  3UTB A;  1P3F C;  4J8X C;  4QLC D;  4YM6 C;  3AZM A;  4R8P B;  1P3B D;  5GT3 D;  4ZUX A;  3UTB C;  3AFA A;  5B1L B;  3NQU A;  5C3I B;  5F99 A;  3AZM C;  4KUD B;  3UT9 B;  4ZUX C;  3AFA C;  3AN2 D;  1EQZ D;  4HGA C;  3WA9 B;  2RVQ D;  3W96 B;  1JFI A;  4H9S A;  1P3G A;  5DNN D;  5B2J D;  3A6N B;  4WU9 A;  2NQB A;  3VH6 T;  1P3A C;  3AZF C;  4H9S C;  1A7W A;  5BNV A;  1ID3 B;  4G91 C;  3REI A;  5GT3 B;  1TZY A;  1KX4 B;  3C1C B;  3REI C;  3VH5 T;  5CP6 D;  2HIO D;  5CPI D;  5GSU B;  1TZY C;  1U35 A;  3WAA B;  4Z2M H;  4DRB A;  5DNN B;  3B0D C;  1P34 D;  5BT1 D;  3C1B D;  3W97 B;  2FJ7 D;  2YFV B;  4E44 A;  3AV1 A;  1N1J B;  5B2I A;  3X1V D;  3KXB C;  5BO0 A;  5AV5 D;  2HIO B;  5JRG A;  3AV1 C;  2F8N K;  4YS3 D;  2ARO B;  3O62 D;  5JRG C;  5B24 D;  5E5A B;  3AZH C;  1TAF A;  5CHL B;  3AZK D;  5B0Z A;  3AZG B;  3REJ B;  2NZD D;  4QLC C;  3REL D;  5B0Z C;  3B6F B;  1P3K A;  1P3P A;  3X1V B;  1HTA A;  3AZJ A;  5AV5 B;  3W98 D;  1S32 A;  1P3K C;  5B31 B;  1P3P C;  4UUZ A;  5AV9 A;  1S32 C;  5CPJ A;  3LJA A;  1EQZ C;  2RVQ C;  5FUG B;  4CSR A;  4JJN D;  2HUE C;  4XZQ D;  3VH6 W;  3UTA D;  3LZ0 D;  2YFW B;  3LZ1 A;  3W98 B;  1KX5 C;  4LD9 D;  1P3O B;  4J8W A;  2CV5 D;  3VH5 W;  3LZ1 C;  4J8U C;  2PYO A;  3MNN A;  3KWQ B;  4J8W C;  5AVB B;  1KX3 B;  3MNN C;  4XZQ B;  4X23 A;  5AY8 C;  4WU8 C;  2FJ7 C;  3UTA B;  4X23 C;  3REH C;  1ZLA A;  5B32 B;  4YS3 C;  3O62 C;  1M18 D;  3MVD D;  4Z5T A;  1ZLA C;  5B33 C;  3AZN C;  2BYM B;  5AV6 A;  5CPK D;  1M19 A;  4Z5T C;  1M19 C;  4NE5 A;  3REL C;  4AWL C;  4H9P A;  4XUJ A;  5AVC A;  3AZE A;  3MGR B;  1P3M A;  5B0Y D;  4XUJ C;  4H9Q B;  5AVC C;  3W99 A;  1HQ3 D;  3AV2 C;  4KGC A;  1P3M C;  3LEL B;  5B40 D;  3W99 C; 
#chains in the Genus database with same CATH topology
 5GT0 A;  4KGC C;  3WTP B;  4J8V D;  4JJN C;  5GT0 C;  5F99 D;  5DNM D;  4NFT A;  2J8P A;  1F66 A;  3B6G A;  3MGP A;  3AZI A;  2ZM5 A;  2F8N A;  3WKJ A;  4H9N A;  3NQJ B;  3MGP C;  3AZI C;  2Y2H A;  2BG1 A;  3VH6 A;  3WKJ C;  5B1L D;  1P3G D;  4LD9 C;  2G5H C;  4KUD D;  5AV8 B;  3UT9 D;  3UTB B;  3KUY A;  3AZM B;  2ZY3 A;  3WA9 D;  4ZUX B;  5JA4 A;  1P3F A;  3NQU B;  4J8X A;  3W96 D;  5F99 B;  2XD1 A;  2Y2O A;  4HGA B;  3A6N D;  2F8N H;  1U35 D;  1ID3 D;  1P3L A;  4E45 A;  1JFI B;  5GXQ A;  1P3G B;  1P3I C;  5BS7 A;  3AYW A;  1KX4 D;  1P3L C;  4G91 B;  3H0L C;  3C1C D;  4WU9 B;  2NQB B;  3X1S A;  5GSU D;  5GXQ C;  5BNV B;  5BS7 C;  3AYW C;  3MGS C;  3REI B;  3WAA D;  3X1S C;  1TZY B;  1P3A A;  3REK A;  5B1M A;  3AZF A;  2XD5 A;  3REK C;  5B1M C;  3MGQ A;  1BH8 B;  3TU4 D;  3W97 D;  1U35 B;  2RIQ A;  3B0D B;  3MGQ C;  3F6T A;  1H3O A;  5B0Y C;  2IO5 C;  1HQ3 C;  4KHA A;  5B31 G;  2ARO D;  3X1U C;  3AV1 B;  5E5A D;  5B2I B;  5JRG B;  3AZJ D;  5DNM C;  3TU4 B;  3AZG D;  3REJ D;  3WTP E;  3A1I A;  3KXB A;  5AV9 D;  1F1E A;  3LJA D;  4R8P C;  3AZL A;  3B6F D;  1TAF B;  3X1T A;  5C3I C;  4KUD C;  3AZL C;  3UT9 C;  5B31 D;  1M1A A;  3AZH A;  3X1T C;  1AOI D;  1P3K B;  3WA9 C;  1P3P B;  1M1A C;  3AZJ B;  4QLC A;  1S32 B;  1P3B A;  5GT3 A;  4UUZ B;  5AV9 B;  2JE5 A;  5CPJ B;  3LJA B;  2Y2K A;  1P3B C;  2PYO D;  2HUE B;  5GT3 C;  4ZBJ C;  4CSR B;  1KU5 A;  3AN2 A;  1KX4 C;  1EQZ A;  5B32 G;  1P3O D;  1AOI B;  3AN2 C;  5B2J A;  5BNX A;  3KWQ D;  3LZ1 B;  5AVB D;  5DNN C;  5B2J C;  5G49 B;  1KX3 D;  4J8W B;  4G92 C;  2PYO B;  2BYK A;  5CP6 A;  5CPI A;  2HIO A;  1KX5 A;  4J8U A;  5CP6 C;  5CPI C;  2HIO C;  4X23 B;  5B32 D;  2ARO C;  4CAY A;  1P34 A;  3C1B A;  5AY8 A;  2F8N G;  4WU8 A;  2FJ7 A;  4NE6 A;  1ZLA B;  1P34 C;  5BT1 C;  3C1B C;  3REJ C;  2Y2M A;  4Z5T B;  2Y2G A;  3REH A;  5AV5 A;  1M19 B;  5AV6 B;  4YS3 A;  3O62 A;  3X1V C;  1B6W A;  5B33 A;  5AV5 C;  3MGR D;  4AWL B;  3AZN A;  5B24 A;  3EG5 B;  1F66 D;  3B6G D;  1B67 A;  5B24 C;  3AZK A;  4H9P B;  4XUJ B;  3LEL D;  5AVC B;  3AZE B;  2F8N D;  2NZD A;  3REL A;  3WTP D;  3AZK C;  1P3M B;  3W99 B;  2NZD C;  5GT0 B;  2Y2Q A;  4Z66 D;  3AV2 A;  3W98 C;  4J8X D;  4Z2M G;  4YM6 D;  1F66 B;  3B6G B;  3MGP B;  3AZI B;  5AV8 D;  3UTB D;  2F8N B;  4JJN A;  3WKJ B;  3AZM D;  4H9N B;  3V9R A;  4XZQ A;  4ZUX D;  3AFA D;  2CWE A;  3B0B A;  4XZQ C;  3LZ0 A;  4DRA A;  3KUY B;  4EO5 B;  3UTA C;  4LD9 A;  4Z66 B;  3LZ0 C;  2CV5 A;  5KDM A;  2UWX A;  5JA4 B;  1P3F B;  4J8X B;  1P3A D;  4YM6 B;  1BFM A;  3H0R C;  4UPK A;  2CV5 C;  4WU9 D;  2JSS A;  2NQB D;  1ULY A;  1P3L B;  2Y2I A;  3REI D;  3VH5 A;  3AFA B;  1TZY D;  3AYW B;  1BH9 A;  4H9O A;  1P3I A;  1M18 A;  1P3A B;  3MVD A;  3REK B;  3AZF B;  3MGS A;  5CPK A;  1M18 C;  3MVD C;  3MGQ B;  2LY8 A;  3FDD A;  5CPK C;  2IO5 B;  3KXB D;  3AV1 D;  5B2I D;  1H3O B;  4WNN A;  5JRG D;  3NQJ A;  4H9R A;  5B0Y A;  1HQ3 A;  2Y2L A;  3KFU G;  5B40 A;  3X1U A;  5B0Z D;  3B0C W;  5AV8 C;  4J8V A;  3KXB B;  5B40 C;  3R45 A;  5DNM A;  3AZL B;  1P3K D;  2DF4 C;  4J8V C;  1P3P D;  5BO0 B;  3X1T B;  5F99 C;  1S32 D;  1WWS A;  4R8P A;  1M1A B;  3AZH B;  5B1L A;  5CPJ D;  4KUD A;  2Y2J A;  2ZY4 A;  3UT9 A;  4QLC B;  5B1L C;  1P3G C;  5B0Z B;  1P3B B;  3WA9 A;  4WU9 C;  2NQB C;  2F2A C;  3W96 A;  4ZBJ B;  3A6N A;  1KX5 D;  3W96 C;  3LZ1 D;  1BH8 A;  3AN2 B;  1EQZ B;  3A6N C;  4J8U D;  1ID3 A;  4J8W D;  3EPK A;  5B2J B;  1U35 C;  1ID3 C;  1KX4 A;  3C1C A;  3MNN D;  5BNX B;  5GSU A;  5AY8 D;  4WU8 D;  4G92 B;  3C1C C;  3WAA A;  4X23 D;  5GSU C;  4M6B A;  5DNN A;  3WAA C;  2BYK B;  3REH D;  5CP6 B;  5CPI B;  1KX5 B;  3W97 A;  3TU4 A;  5B2I C;  2YFV A;  2Y2N A;  4J8U B;  1ZLA D;  5B33 D;  3AZN D;  3TU4 C;  1N1J A;  3W97 C;  4Z5T D;  4CAY B;  3MNN B;  1P34 B;  3C1B B;  5AY8 B;  5AV6 D;  4WZS B;  4WU8 B;  1M19 D;  2FJ7 B;  2ARO A;  5E5A A;  3REH B;  2Y2P A;  4YS3 B;  4XUJ D;  5E5A C;  5AVC D;  3O62 B;  3REJ A;  3AZG A;  3AZE D;  3AV2 D;  3AZJ C;  5B33 B;  2ZY5 A;  3AZN B;  1R4V A;  5B24 B;  1P3M D;  3AZG C;  3W99 D;  3B6F A;  4KGC D;  4NE3 A;  3X1V A;  5AV9 C;  3AZK B;  5CPJ C;  3LJA C;  3B6F C;  5B31 A;  5GT0 D;  2NZD B;  4WV4 B;  3REL B;  1AOI A;  5B31 C;  2W8S A;  3MGP D;  5FUG A;  3AZI D;  3P5J B;  1AOI C;  5G49 A;  2G5I C;  3WKJ D;  3AV2 B;  4DQY B;  2FFF B;  4KGC B;  1W2E A;  2YFW A;  3W98 A;  3AL0 C;  3KUY D;  4JJN B;  2PYO C;  3V9R B;  1P3O A;  1P3F D;  3B0C T;  3LZ0 B;  1P3O C;  3KWQ A;  5AVB A;  1KX3 A;  1P3I D;  4LD9 B;  3KWQ C;  2CV5 B;  5KDM B;  1P3L D;  5AVB C;  5GXQ D;  1KX3 C;  3UTA A;  3AYW D;  3MGS D;  3X1S D;  5B32 A;  5AV6 C;  2ZY2 A;  3REK D;  5B1M D;  3AZF D;  5B32 C;  2BYM A;  1BH9 B;  4H9O B;  3MGQ D;  1P3I B;  3AZE C;  1M18 B;  3MVD B;  5GXQ B;  3MGS B;  5CPK B;  3X1U D;  3X1S B;  1WWI A;  3MGR A;  4H9Q A;  5B1M B;  3MGR C;  4WNN B;  3LEL A;  1F66 C;  3B6G C;  4R8P D;  4H9R B;  3WTP A;  5B0Y B;  3KSY A;  3LEL C;  1Q9C A;  1HQ3 B;  3AZL D;  3WTP C;  3EPJ A;  5B40 B;  3X1U B;  3X1T D;  4KHA B;  4Z66 A;  4J8V B;  3KUY C;  1M1A D;  3AZH D;  4EO5 C;  3R45 B;  2L5A A;  4YM6 A;  5DNM B;  4Z66 C;  5AV8 A;  3UTB A;  1P3F C;  4J8X C;  4QLC D;  4YM6 C;  3AZM A;  4R8P B;  1P3B D;  5GT3 D;  4ZUX A;  3UTB C;  3AFA A;  5B1L B;  3NQU A;  5C3I B;  5F99 A;  3AZM C;  4KUD B;  3UT9 B;  4ZUX C;  3AFA C;  3AN2 D;  1EQZ D;  4HGA C;  3WA9 B;  2RVQ D;  3W96 B;  1JFI A;  4H9S A;  1P3G A;  5DNN D;  5B2J D;  3A6N B;  4WU9 A;  2NQB A;  2VQR A;  3VH6 T;  1P3A C;  3AZF C;  4H9S C;  1A7W A;  5BNV A;  1ID3 B;  4G91 C;  3REI A;  5GT3 B;  1TZY A;  1KX4 B;  3C1C B;  3REI C;  3VH5 T;  5CP6 D;  2HIO D;  3EPL A;  5GSU B;  1TZY C;  5CPI D;  1U35 A;  3WAA B;  4Z2M H;  4DRB A;  5DNN B;  3B0D C;  1P34 D;  5BT1 D;  3C1B D;  3W97 B;  2FJ7 D;  2DQN C;  2YFV B;  4E44 A;  3AV1 A;  1N1J B;  5B2I A;  3X1V D;  3KXB C;  5BO0 A;  5AV5 D;  2HIO B;  5JRG A;  3AV1 C;  2F8N K;  4YS3 D;  2ARO B;  3O62 D;  5JRG C;  5B24 D;  5E5A B;  3AZH C;  1TAF A;  5CHL B;  3AZK D;  5B0Z A;  3AZG B;  3REJ B;  2NZD D;  4QLC C;  3REL D;  5B0Z C;  3EPH A;  2JCH A;  1P3K A;  3B6F B;  1P3P A;  3X1V B;  1HTA A;  3AZJ A;  5AV5 B;  3W98 D;  1S32 A;  1P3K C;  5B31 B;  1P3P C;  1T3U A;  4UUZ A;  5AV9 A;  1S32 C;  5CPJ A;  3LJA A;  1EQZ C;  2RVQ C;  5FUG B;  4CSR A;  4JJN D;  2HUE C;  4XZQ D;  3A1K A;  3VH6 W;  3H0M C;  3UTA D;  3LZ0 D;  2YFW B;  3LZ1 A;  3W98 B;  3IP4 C;  1KX5 C;  4LD9 D;  1P3O B;  4J8W A;  2CV5 D;  1PZR A;  3VH5 W;  3LZ1 C;  4J8U C;  2PYO A;  3MNN A;  3KWQ B;  4J8W C;  5AVB B;  1KX3 B;  3MNN C;  4XZQ B;  4X23 A;  5AY8 C;  4WU8 C;  2FJ7 C;  3UTA B;  4X23 C;  1Z2C B;  3REH C;  1ZLA A;  5B32 B;  4YS3 C;  3O62 C;  1M18 D;  3MVD D;  4Z5T A;  1ZLA C;  5B33 C;  3AZN C;  2BYM B;  5AV6 A;  5CPK D;  1M19 A;  4Z5T C;  1M19 C;  4NE5 A;  3REL C;  4AWL C;  4WJ3 C;  4H9P A;  4XUJ A;  5AVC A;  3AZE A;  3MGR B;  1P3M A;  5B0Y D;  4XUJ C;  4H9Q B;  5AVC C;  3W99 A;  1HQ3 D;  3AV2 C;  4KGC A;  1P3M C;  3LEL B;  5B40 D;  3W99 C; 
#chains in the Genus database with same CATH homology
 5GT0 A;  4KGC C;  3WTP B;  4J8V D;  4JJN C;  5GT0 C;  5F99 D;  5DNM D;  4NFT A;  2J8P A;  1F66 A;  3B6G A;  3MGP A;  3AZI A;  2ZM5 A;  2F8N A;  3WKJ A;  4H9N A;  3NQJ B;  3MGP C;  3AZI C;  2Y2H A;  2BG1 A;  3VH6 A;  3WKJ C;  5B1L D;  1P3G D;  4LD9 C;  2G5H C;  4KUD D;  5AV8 B;  3UT9 D;  3UTB B;  3KUY A;  3AZM B;  2ZY3 A;  3WA9 D;  4ZUX B;  5JA4 A;  1P3F A;  3NQU B;  4J8X A;  3W96 D;  5F99 B;  2XD1 A;  2Y2O A;  4HGA B;  3A6N D;  2F8N H;  1U35 D;  1ID3 D;  1P3L A;  4E45 A;  1JFI B;  5GXQ A;  1P3G B;  1P3I C;  5BS7 A;  3AYW A;  1KX4 D;  1P3L C;  4G91 B;  3H0L C;  3C1C D;  4WU9 B;  2NQB B;  3X1S A;  5GSU D;  5GXQ C;  5BNV B;  5BS7 C;  3AYW C;  3MGS C;  3REI B;  3WAA D;  3X1S C;  1TZY B;  1P3A A;  3REK A;  5B1M A;  3AZF A;  2XD5 A;  3REK C;  5B1M C;  3MGQ A;  1BH8 B;  3TU4 D;  3W97 D;  1U35 B;  2RIQ A;  3B0D B;  3MGQ C;  3F6T A;  1H3O A;  5B0Y C;  2IO5 C;  1HQ3 C;  4KHA A;  5B31 G;  2ARO D;  3X1U C;  3AV1 B;  5E5A D;  5B2I B;  5JRG B;  3AZJ D;  5DNM C;  3TU4 B;  3AZG D;  3REJ D;  3WTP E;  3A1I A;  3KXB A;  5AV9 D;  1F1E A;  3LJA D;  4R8P C;  3AZL A;  3B6F D;  1TAF B;  3X1T A;  5C3I C;  4KUD C;  3AZL C;  3UT9 C;  5B31 D;  1M1A A;  3AZH A;  3X1T C;  1AOI D;  1P3K B;  3WA9 C;  1P3P B;  1M1A C;  3AZJ B;  4QLC A;  1S32 B;  1P3B A;  5GT3 A;  4UUZ B;  5AV9 B;  2JE5 A;  5CPJ B;  3LJA B;  2Y2K A;  1P3B C;  2PYO D;  2HUE B;  5GT3 C;  4ZBJ C;  4CSR B;  1KU5 A;  3AN2 A;  1KX4 C;  1EQZ A;  5B32 G;  1P3O D;  1AOI B;  3AN2 C;  5B2J A;  5BNX A;  3KWQ D;  3LZ1 B;  5AVB D;  5DNN C;  5B2J C;  5G49 B;  1KX3 D;  4J8W B;  4G92 C;  2PYO B;  2BYK A;  5CP6 A;  5CPI A;  2HIO A;  1KX5 A;  4J8U A;  5CP6 C;  5CPI C;  2HIO C;  4X23 B;  5B32 D;  2ARO C;  4CAY A;  1P34 A;  3C1B A;  5AY8 A;  2F8N G;  4WU8 A;  2FJ7 A;  4NE6 A;  1ZLA B;  1P34 C;  5BT1 C;  3C1B C;  3REJ C;  2Y2M A;  4Z5T B;  2Y2G A;  3REH A;  5AV5 A;  1M19 B;  5AV6 B;  4YS3 A;  3O62 A;  3X1V C;  1B6W A;  5B33 A;  5AV5 C;  3MGR D;  4AWL B;  3AZN A;  5B24 A;  3EG5 B;  1F66 D;  3B6G D;  1B67 A;  5B24 C;  3AZK A;  4H9P B;  4XUJ B;  3LEL D;  5AVC B;  3AZE B;  2F8N D;  2NZD A;  3REL A;  3WTP D;  3AZK C;  1P3M B;  3W99 B;  2NZD C;  5GT0 B;  2Y2Q A;  4Z66 D;  3AV2 A;  3W98 C;  4J8X D;  4Z2M G;  4YM6 D;  1F66 B;  3B6G B;  3MGP B;  3AZI B;  5AV8 D;  3UTB D;  2F8N B;  4JJN A;  3WKJ B;  3AZM D;  4H9N B;  3V9R A;  4XZQ A;  4ZUX D;  3AFA D;  2CWE A;  3B0B A;  4XZQ C;  3LZ0 A;  4DRA A;  3KUY B;  4EO5 B;  3UTA C;  4LD9 A;  4Z66 B;  3LZ0 C;  2CV5 A;  5KDM A;  2UWX A;  5JA4 B;  1P3F B;  4J8X B;  1P3A D;  4YM6 B;  1BFM A;  3H0R C;  4UPK A;  2CV5 C;  4WU9 D;  2JSS A;  2NQB D;  1ULY A;  1P3L B;  2Y2I A;  3REI D;  3VH5 A;  3AFA B;  1TZY D;  3AYW B;  1BH9 A;  4H9O A;  1P3I A;  1M18 A;  1P3A B;  3MVD A;  3REK B;  3AZF B;  3MGS A;  5CPK A;  1M18 C;  3MVD C;  3MGQ B;  2LY8 A;  3FDD A;  5CPK C;  2IO5 B;  3KXB D;  3AV1 D;  5B2I D;  1H3O B;  4WNN A;  5JRG D;  3NQJ A;  4H9R A;  5B0Y A;  1HQ3 A;  2Y2L A;  3KFU G;  5B40 A;  3X1U A;  5B0Z D;  3B0C W;  5AV8 C;  4J8V A;  3KXB B;  5B40 C;  3R45 A;  5DNM A;  3AZL B;  1P3K D;  2DF4 C;  4J8V C;  1P3P D;  5BO0 B;  3X1T B;  5F99 C;  1S32 D;  1WWS A;  4R8P A;  1M1A B;  3AZH B;  5B1L A;  5CPJ D;  4KUD A;  2Y2J A;  2ZY4 A;  3UT9 A;  4QLC B;  5B1L C;  1P3G C;  5B0Z B;  1P3B B;  3WA9 A;  4WU9 C;  2NQB C;  2F2A C;  3W96 A;  4ZBJ B;  3A6N A;  1KX5 D;  3W96 C;  3LZ1 D;  1BH8 A;  3AN2 B;  1EQZ B;  3A6N C;  4J8U D;  1ID3 A;  4J8W D;  3EPK A;  5B2J B;  1U35 C;  1ID3 C;  1KX4 A;  3C1C A;  3MNN D;  5BNX B;  5GSU A;  5AY8 D;  4WU8 D;  4G92 B;  3C1C C;  3WAA A;  4X23 D;  5GSU C;  4M6B A;  5DNN A;  3WAA C;  2BYK B;  3REH D;  5CP6 B;  5CPI B;  1KX5 B;  3W97 A;  3TU4 A;  5B2I C;  2YFV A;  2Y2N A;  4J8U B;  1ZLA D;  5B33 D;  3AZN D;  3TU4 C;  1N1J A;  3W97 C;  4Z5T D;  4CAY B;  3MNN B;  1P34 B;  3C1B B;  5AY8 B;  5AV6 D;  4WZS B;  4WU8 B;  1M19 D;  2FJ7 B;  2ARO A;  5E5A A;  3REH B;  2Y2P A;  4YS3 B;  4XUJ D;  5E5A C;  5AVC D;  3O62 B;  3REJ A;  3AZG A;  3AZE D;  3AV2 D;  3AZJ C;  5B33 B;  2ZY5 A;  3AZN B;  1R4V A;  5B24 B;  1P3M D;  3AZG C;  3W99 D;  3B6F A;  4KGC D;  4NE3 A;  3X1V A;  5AV9 C;  3AZK B;  5CPJ C;  3LJA C;  3B6F C;  5B31 A;  5GT0 D;  2NZD B;  4WV4 B;  3REL B;  1AOI A;  5B31 C;  2W8S A;  3MGP D;  5FUG A;  3AZI D;  3P5J B;  1AOI C;  5G49 A;  2G5I C;  3WKJ D;  3AV2 B;  4DQY B;  2FFF B;  4KGC B;  1W2E A;  2YFW A;  3W98 A;  3AL0 C;  3KUY D;  4JJN B;  2PYO C;  3V9R B;  1P3O A;  1P3F D;  3B0C T;  3LZ0 B;  1P3O C;  3KWQ A;  5AVB A;  1KX3 A;  1P3I D;  4LD9 B;  3KWQ C;  2CV5 B;  5KDM B;  1P3L D;  5AVB C;  5GXQ D;  1KX3 C;  3UTA A;  3AYW D;  3MGS D;  3X1S D;  5B32 A;  5AV6 C;  2ZY2 A;  3REK D;  5B1M D;  3AZF D;  5B32 C;  2BYM A;  1BH9 B;  4H9O B;  3MGQ D;  1P3I B;  3AZE C;  1M18 B;  3MVD B;  5GXQ B;  3MGS B;  5CPK B;  3X1U D;  3X1S B;  1WWI A;  3MGR A;  4H9Q A;  5B1M B;  3MGR C;  4WNN B;  3LEL A;  1F66 C;  3B6G C;  4R8P D;  4H9R B;  3WTP A;  5B0Y B;  3KSY A;  3LEL C;  1Q9C A;  1HQ3 B;  3AZL D;  3WTP C;  3EPJ A;  5B40 B;  3X1U B;  3X1T D;  4KHA B;  4Z66 A;  4J8V B;  3KUY C;  1M1A D;  3AZH D;  4EO5 C;  3R45 B;  2L5A A;  4YM6 A;  5DNM B;  4Z66 C;  5AV8 A;  3UTB A;  1P3F C;  4J8X C;  4QLC D;  4YM6 C;  3AZM A;  4R8P B;  1P3B D;  5GT3 D;  4ZUX A;  3UTB C;  3AFA A;  5B1L B;  3NQU A;  5C3I B;  5F99 A;  3AZM C;  4KUD B;  3UT9 B;  4ZUX C;  3AFA C;  3AN2 D;  1EQZ D;  4HGA C;  3WA9 B;  2RVQ D;  3W96 B;  1JFI A;  4H9S A;  1P3G A;  5DNN D;  5B2J D;  3A6N B;  4WU9 A;  2NQB A;  2VQR A;  3VH6 T;  1P3A C;  3AZF C;  4H9S C;  1A7W A;  5BNV A;  1ID3 B;  4G91 C;  3REI A;  5GT3 B;  1TZY A;  1KX4 B;  3C1C B;  3REI C;  3VH5 T;  5CP6 D;  2HIO D;  3EPL A;  5GSU B;  1TZY C;  5CPI D;  1U35 A;  3WAA B;  4Z2M H;  4DRB A;  5DNN B;  3B0D C;  1P34 D;  5BT1 D;  3C1B D;  3W97 B;  2FJ7 D;  2DQN C;  2YFV B;  4E44 A;  3AV1 A;  1N1J B;  5B2I A;  3X1V D;  3KXB C;  5BO0 A;  5AV5 D;  2HIO B;  5JRG A;  3AV1 C;  2F8N K;  4YS3 D;  2ARO B;  3O62 D;  5JRG C;  5B24 D;  5E5A B;  3AZH C;  1TAF A;  5CHL B;  3AZK D;  5B0Z A;  3AZG B;  3REJ B;  2NZD D;  4QLC C;  3REL D;  5B0Z C;  3EPH A;  2JCH A;  1P3K A;  3B6F B;  1P3P A;  3X1V B;  1HTA A;  3AZJ A;  5AV5 B;  3W98 D;  1S32 A;  1P3K C;  5B31 B;  1P3P C;  1T3U A;  4UUZ A;  5AV9 A;  1S32 C;  5CPJ A;  3LJA A;  1EQZ C;  2RVQ C;  5FUG B;  4CSR A;  4JJN D;  2HUE C;  4XZQ D;  3A1K A;  3VH6 W;  3H0M C;  3UTA D;  3LZ0 D;  2YFW B;  3LZ1 A;  3W98 B;  3IP4 C;  1KX5 C;  4LD9 D;  1P3O B;  4J8W A;  2CV5 D;  1PZR A;  3VH5 W;  3LZ1 C;  4J8U C;  2PYO A;  3MNN A;  3KWQ B;  4J8W C;  5AVB B;  1KX3 B;  3MNN C;  4XZQ B;  4X23 A;  5AY8 C;  4WU8 C;  2FJ7 C;  3UTA B;  4X23 C;  1Z2C B;  3REH C;  1ZLA A;  5B32 B;  4YS3 C;  3O62 C;  1M18 D;  3MVD D;  4Z5T A;  1ZLA C;  5B33 C;  3AZN C;  2BYM B;  5AV6 A;  5CPK D;  1M19 A;  4Z5T C;  1M19 C;  4NE5 A;  3REL C;  4AWL C;  4WJ3 C;  4H9P A;  4XUJ A;  5AVC A;  3AZE A;  3MGR B;  1P3M A;  5B0Y D;  4XUJ C;  4H9Q B;  5AVC C;  3W99 A;  1HQ3 D;  3AV2 C;  4KGC A;  1P3M C;  3LEL B;  5B40 D;  3W99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...