4XZQD

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqD00
1P3AA 3AV1D 5B24A 4WZSB 2AROB 4R8PA 4J8XA 3B6FA 3TU4B 3AZHA 4LD9C 3LJAC 1P3GB 4G92B 5AV6D 1M1AD 5C3IC 3LZ0A 3AFAA 3KWQB 1KX3C 5B1MA 3AN2C 3KXBC 1ID3B 5CPJC 1WWSA 3W96D 2NQBB 4H9SA 3REIC 4YM6B 3AN2B 2CV5A 1F66D 5CPIA 3UTAD 3W99B 4KGCB 4H9RB 5B2IB 2PYOA 3AZFC 4J8UB 1KX4A 4QLCB 5DNMD 1P3OB 3AZMD 4YS3B 2BYKB 3MNND 3AZID 3AZFB 5F99D 3AV1C 3C1BB 1P3AD 5B24D 4XZQB 5BNXA 4J8XD 3AZHD 4KUDC 3B6GA 2NZDB 4H9NB 4H9OA 5B0YA 1AOIA 4KUDB 5B0ZA 3AFAD 5B1MD 5AV8A 3W96C 3MGRC 3LZ1B 3MGPA 5B40A 3UTAC 3MGRB 1P3LC 2CV5D 5AV5C 1H3OA 2F8NH 5CPKA 5GSUB 2PYOD 2AROA 1P3LB 3TU4A 2YFVB 1KX4D 3AZIC 1P3GA 3AZNB 3REJC 3LJAA 3B0DB 1ZLAC 2F8NB 1B6WA 3UTBB 3REJB 2NQBA 5GT3B 1TZYC 1ZLAB 3B6GD 3AN2A 5B0YD 1HQ3B 5BS7C 1AOID 4H9RA 1U35C 5B2IA 5B0ZD 4WNNB 5B32C 4J8UA 5AV8D 1JFIA 4QLCA 2RVQD 1P3OA 4H9SC 2FJ7C 4YS3A 2BYKA 5FUGB 3AZFA 2CV5C 3MGPD 5B32B 3WTPC 5B40D 3AZKB 2FJ7B 5E5AB 5DNNB 3X1TD 1KX4C 1ULYA 3WKJB 2AROD 1BH8B 3A6NB 3TU4D 4H9NA 3UT9B 1P3GD 3X1UB 4Z66B 5B1LB 4KUDA 5AVBC 3REKC 5AY8C 4J8VC 5B31G 1ID3D 2NQBD 3LZ1A 4WV4B 3LELB 5AY8B 4YM6D 3MGRA 3AN2D 4J8VB 5B33B 4H9PB 3W99D 4KGCD 5AV8C 3O62B 5B2ID 3AZLB 3UTAA 1M18B 1P3LA 5AV5A 4Z2MH 4J8UD 1TAFB 1A7WA 4QLCD 1P3OD 4YS3D 5B40C 4J8WB 3AZFD 3AZJB 3AZNA 1KX5B 3X1TC 2F8NA 3VH6A 2AROC 4NE5A 5AVCB 3C1BD 4XUJB 3TU4C 3UTBA 3REJA 1P3PC 1P3GC 1WWIA 4NFTA 5GT3A 1P3MC 5BNVB 1ZLAA 3REHB 4G92C 2NZDD 3AYWC 4NE3A 1P34B 3KWQC 1P3PB 1P3MB 4DRAA 1TZYA 4KUDD 3AYWB 1BH9B 4WNNA 1ID3C 4CAYB 2YFWB 5BS7A 2NQBC 4UUZB 5BT1C 1U35A 4YM6C 5FUGA 5BO0B 4Z2MG 3LZ1D 5B32A 4ZBJC 3W99C 3MGRD 4KGCC 2FJ7A 5B2IC 4HGAB 4J8UC 4X23C 4QLCC 3WTPA 3WKJA 4ZBJB 1BH8A 1P3OC 1P3BB 1P3LD 5AV5D 4YS3C 3W98B 3UT9A 3C1CB 4X23B 3X1UA 4WU8B 4Z66A 5B1LA 3AZND 3C1BC 5AV9B 2F8ND 4XZQC 3MVDB 3UTBD 2NZDC 3REJD 5GT3D 5AVBA 3LELA 1ZLAD 3REKA 5AY8A 3KSYA 4J8VA 4KHAB 1N1JB 3O62A 1TZYD 3MGQC 2F8NK 1TAFA 3LZ1C 3MGQB 1U35D 1EQZB 1S32B 4J8WA 3VH5A 1P3IC 3AZJA 5B32D 1KX5A 3AZKD 3NQJB 2FJ7D 5GSUC 5E5AD 4XUJA 1P3IB 3WTPD 3WKJD 1BFMA 3X1TA 5BNVA 3RELC 3REHA 3UT9D 3AZNC 3X1UD 4Z66D 1P3PA 1P3MA 5JRGB 3B0DC 5B1LD 4H9QB 3RELB 3AYWA 3UTBC 2YFWA 5JA4B 5AV6B 4UUZA 5GT3C 3KWQA 4Z5TC 2JSSA 5BO0A 2L5AA 5AVBD 3LELD 1ID3A 1HQ3C 3REKD 5AY8D 4J8VD 5B33D 4Z5TB 4YM6A 3AZGB 3O62D 3X1SC 3W99A 4KGCA 1P3BA 3W98A 4X23A 3AZKC 3X1SB 4J8WD 3AZJD 1Q9CA 5E5AC 1KX5D 5DNNC 5AV9A 3WKJC 5AVCD 3A6NC 4XUJD 3MVDA 3UT9C 5F99B 3C1BA 5B31B 3X1UC 5GXQB 4XZQA 5CP6B 4Z66C 3REHD 2IO5B 5B1LC 5B24B 2NZDA 4R8PB 3B6FB 3VH6T 1P3PD 1P3MD 3AZHB 1N1JA 2BYMB 3AYWD 4ZUXB 3WAAC 3KWQD 3LZ0B 3LELC 3MGQA 1P3FB 5B33C 3NQJA 3WAAB 3O62C 5BT1D 3AZLC 1M18C 1P3IA 5CPIB 1P3BD 3W98D 5GSUA 4J8WC 3AZJC 2YFVA 4X23D 1KX5C 3RELA 5AVCC 4XUJC 5B2JB 5AV9D 4G91B 5KDMB 5JA4A 2HIOC 3MVDD 3REHC 2HUEB 4XZQD 1P34C 1P3KB 2HIOB 4Z5TA 3AZGA 3W97B 4DRBA 4JJNC 1HQ3A 4WU9B 4H9OB 5B0YB 4M6BA 5GT0B 3MGQD 5B0ZB 4JJNB 3X1SA 4HGAC 3AZKA 4E44A 1P3BC 3W98C 1P3ID 5E5AA 5DNNA 5B31A 3KUYC 3C1CC 3VH5T 5GXQA 5GSUD 5CP6A 4WU8C 5CPKB 1M19C 3A6NA 3MGSB 3AZEB 5JRGD 5AV9C 3KUYB 3RELD 4CSRB 2BYMA 3WA9C 4AWLB 1M19B 3MVDC 3VH6W 4ZUXA 4LD9B 3WA9B 3X1VC 3LJAB 1P3FA 3NQUB 3WAAA 5C3IB 4Z5TD 3AZGD 3X1VB 1KX3B 4E45A 5B33A 1HQ3D 4H9PA 3KXBB 3AZLA 5CPJB 1EQZC 1S32C 1M18A 3REIB 3X1SD 1JFIB 3AV2C 5B2JA 5KDMA 1F1EA 4NE6A 3AV2B 5AVCA 5DNND 5B31D 1B67A 5GXQD 5CP6D 5JRGC 1P3KA 2HIOA 3A6ND 4R8PD 5G49B 3B6FD 3AV1B 3W97A 5AV6C 1P34A 4WU9A 1M1AC 3R45B 1BH9A 5GT0A 4ZUXD 4CAYA 3LZ0D 4JJNA 1M1AB 1P3FD 3AZGC 3WAAD 1F66C 3X1TB 3W96B 5CPID 3B0CT 4EO5C 3AZLD 1F66B 1M18D 3MGSA 3AZEA 5DNMC 3UTAB 3VH5W 5AV5B 3KUYA 3C1CA 3AZMC 4WU8A 4CSRA 4EO5B 3MNNC 1M19A 5B2JD 5DNMB 5F99C 5B31C 3AZMB 5GXQC 4LD9A 5CP6C 2IO5C 3MNNB 3AZIB 1P3AC 3WA9A 3V9RB 5B24C 2CWEA 4R8PC 4J8XC 3B6FC 3NQUA 3WTPE 3AZHC 2HIOD 1P3KD 3X1VA 1P3AB 1KX3A 3W97D 4KHAA 4J8XB 1P34D 4ZUXC 4WU9D 3LZ0C 3KXBA 5CPJA 3AFAC 1P3FC 5B1MC 5GT0D 1TZYB 4JJND 3REIA 2F8NG 3AFAB 1EQZA 1S32A 5B1MB 1U35B 5CPIC 3AV2A 2PYOC 5CPKD 2CV5B 3MGSD 3WTPB 3AZED 5G49A 3B0BA 5CHLB 5B2JC 3AV1A 3KUYD 3C1CD 4G91C 2PYOB 4WU8D 5JRGA 1M19D 4H9QA 1KX4B 2HUEC 3R45A 4LD9D 5B32G 5AV6A 1P3KC 3LJAD 1M1AA 3WA9D 1KU5A 3W97C 3B6GC 4WU9C 3X1VD 1KX3D 5AVBB 5B0YC 2LY8A 3REKB 3W96A 5BNXB 1AOIC 5GT0C 3KXBD 3B6GB 5B0ZC 5CPJD 1F66A 2RVQC 3B0CW 3REID 1AOIB 1EQZD 1S32D 3MGPC 5AV8B 1HTAA 5DNMA 3AZMA 3AV2D 5CPKC 3MNNA 3AZIA 3MGPB 3V9RA 3MGSC 3AZEC 5B40B 5F99A 1R4VA 1H3OB 4AWLC
chains in the Genus database with same CATH superfamily
1P3AA 3AV1D 5B24A 4WZSB 2AROB 4R8PA 4J8XA 3B6FA 3TU4B 3AZHA 4LD9C 3LJAC 1P3GB 4G92B 5AV6D 1M1AD 5C3IC 3LZ0A 3AFAA 3KWQB 1KX3C 2DF4C 5B1MA 3AN2C 3KXBC 1ID3B 5CPJC 1WWSA 3W96D 2NQBB 4H9SA 3REIC 3P5JB 4YM6B 3AN2B 2CV5A 1F66D 5CPIA 2Y2KA 3UTAD 3W99B 4KGCB 4H9RB 5B2IB 2PYOA 3AZFC 4J8UB 2Y2NA 1KX4A 4QLCB 5DNMD 1P3OB 3AZMD 4YS3B 2BYKB 2XD1A 3MNND 3AZID 3AZFB 2Y2IA 5F99D 3AV1C 3C1BB 1P3AD 5B24D 4XZQB 5BNXA 4J8XD 2Y2PA 3AZHD 3B6GA 4KUDC 2NZDB 4H9NB 4H9OA 5B0YA 1AOIA 4KUDB 4WJ3C 5B0ZA 3AFAD 5B1MD 5AV8A 3W96C 3MGRC 3LZ1B 3MGPA 2Y2HA 5B40A 3UTAC 3MGRB 1P3LC 2CV5D 2W8SA 1W2EA 1H3OA 5AV5C 2F8NH 5CPKA 5GSUB 2PYOD 2AROA 1P3LB 3TU4A 2YFVB 1KX4D 3F6TA 3AZIC 1P3GA 3H0MC 2J8PA 3AZNB 3REJC 2F2AC 3LJAA 3B0DB 1ZLAC 2F8NB 1B6WA 3UTBB 3REJB 2NQBA 2JCHA 5GT3B 1TZYC 1ZLAB 3B6GD 3AN2A 5B0YD 1HQ3B 5BS7C 1AOID 4H9RA 1U35C 5B2IA 1PZRA 5B0ZD 3IP4C 4WNNB 5B32C 4J8UA 5AV8D 1JFIA 4QLCA 2RVQD 1P3OA 4H9SC 2FJ7C 2ZY3A 4YS3A 2BYKA 5FUGB 3AZFA 2CV5C 3MGPD 5B32B 3WTPC 5B40D 3AZKB 2FJ7B 5E5AB 2FFFB 5DNNB 3X1TD 1KX4C 1ULYA 3WKJB 2AROD 1BH8B 3A6NB 3TU4D 4H9NA 3UT9B 1P3GD 3EG5B 3X1UB 4Z66B 3EPKA 5B1LB 4KUDA 5AVBC 3REKC 5AY8C 4J8VC 5B31G 1ID3D 2Y2GA 2NQBD 3LZ1A 4WV4B 3LELB 5AY8B 4YM6D 3MGRA 3AN2D 4J8VB 5B33B 4H9PB 3W99D 4KGCD 5AV8C 3O62B 5B2ID 3AZLB 3UTAA 1M18B 1P3LA 5AV5A 4Z2MH 4J8UD 1TAFB 1A7WA 4QLCD 1P3OD 1T3UA 4YS3D 5B40C 4J8WB 3AZFD 3AZJB 3AZNA 1KX5B 3X1TC 2RIQA 2F8NA 3VH6A 2AROC 4NE5A 5AVCB 3C1BD 1Z2CB 4XUJB 3UTBA 3TU4C 2JE5A 3REJA 1P3PC 1P3GC 1WWIA 4NFTA 5GT3A 1P3MC 5BNVB 1ZLAA 3REHB 4G92C 2NZDD 3AYWC 2Y2MA 4NE3A 1P34B 3KWQC 1P3PB 1P3MB 4DRAA 1TZYA 4KUDD 3AYWB 1BH9B 4WNNA 1ID3C 4CAYB 2YFWB 3AL0C 5BS7A 2NQBC 4UUZB 5BT1C 1U35A 4YM6C 5FUGA 3EPHA 5BO0B 4Z2MG 3LZ1D 5B32A 4ZBJC 3W99C 3MGRD 4KGCC 2FJ7A 5B2IC 4HGAB 4J8UC 4X23C 4QLCC 3WTPA 3WKJA 4ZBJB 1BH8A 1P3OC 1P3BB 1P3LD 5AV5D 4YS3C 3W98B 3UT9A 3C1CB 4X23B 3X1UA 4WU8B 4Z66A 5B1LA 2Y2LA 3AZND 3C1BC 5AV9B 2F8ND 3FDDA 4XZQC 3MVDB 3UTBD 2NZDC 3REJD 5GT3D 5AVBA 3LELA 1ZLAD 3REKA 5AY8A 3KSYA 4J8VA 4KHAB 1N1JB 3O62A 1TZYD 3MGQC 2F8NK 1TAFA 3LZ1C 3MGQB 1U35D 1EQZB 1S32B 4J8WA 3VH5A 3H0RC 1P3IC 3AZJA 5B32D 1KX5A 2ZY2A 3AZKD 3NQJB 2FJ7D 5GSUC 5E5AD 4XUJA 1P3IB 2XD5A 3WTPD 3WKJD 1BFMA 3X1TA 5BNVA 3RELC 3REHA 3UT9D 3AZNC 3X1UD 4Z66D 1P3PA 1P3MA 5JRGB 3B0DC 5B1LD 4H9QB 3RELB 3AYWA 3UTBC 2YFWA 5JA4B 5AV6B 4UUZA 5GT3C 3KWQA 4Z5TC 2JSSA 5BO0A 2L5AA 5AVBD 3LELD 1ID3A 1HQ3C 3REKD 5AY8D 4J8VD 5B33D 4Z5TB 4YM6A 3AZGB 3O62D 3X1SC 3W99A 4KGCA 1P3BA 3W98A 4X23A 3AZKC 3X1SB 4J8WD 3AZJD 1Q9CA 5E5AC 1KX5D 5DNNC 5AV9A 3WKJC 2BG1A 5AVCD 3A6NC 4XUJD 3MVDA 3H0LC 3UT9C 5F99B 3C1BA 5B31B 3X1UC 5GXQB 4XZQA 5CP6B 4Z66C 3REHD 2IO5B 3KFUG 5B1LC 5B24B 2NZDA 3A1IA 4R8PB 3B6FB 3VH6T 1P3PD 1P3MD 3AZHB 1N1JA 2BYMB 3AYWD 4ZUXB 3WAAC 3KWQD 3LZ0B 3LELC 3MGQA 1P3FB 5B33C 3NQJA 3WAAB 3O62C 5BT1D 3AZLC 1M18C 1P3IA 5CPIB 1P3BD 3W98D 5GSUA 4J8WC 3AZJC 2YFVA 4X23D 1KX5C 3RELA 5AVCC 4XUJC 5B2JB 5AV9D 4G91B 5KDMB 5JA4A 2HIOC 3MVDD 3EPJA 3REHC 2HUEB 4XZQD 1P34C 1P3KB 2HIOB 4Z5TA 3AZGA 3W97B 4DRBA 4JJNC 1HQ3A 4WU9B 4H9OB 2Y2OA 5B0YB 4M6BA 5GT0B 3MGQD 4UPKA 5B0ZB 4JJNB 3X1SA 4HGAC 3AZKA 4E44A 1P3BC 3W98C 1P3ID 5E5AA 5DNNA 5B31A 3KUYC 3C1CC 3VH5T 5GXQA 5GSUD 5CP6A 4WU8C 5CPKB 1M19C 2G5IC 3A6NA 3MGSB 3AZEB 5JRGD 5AV9C 3KUYB 3RELD 4CSRB 2BYMA 3WA9C 2UWXA 4AWLB 1M19B 3MVDC 3VH6W 4ZUXA 4LD9B 3WA9B 3X1VC 3LJAB 1P3FA 3NQUB 3WAAA 5C3IB 4Z5TD 3AZGD 3X1VB 1KX3B 4E45A 5B33A 1HQ3D 4H9PA 3KXBB 3AZLA 5CPJB 1EQZC 1S32C 1M18A 3REIB 3X1SD 1JFIB 3AV2C 5B2JA 5KDMA 1F1EA 4NE6A 3AV2B 5AVCA 5DNND 5B31D 1B67A 5GXQD 2Y2QA 5CP6D 5JRGC 1P3KA 2HIOA 3A6ND 4DQYB 4R8PD 5G49B 3B6FD 3AV1B 3W97A 5AV6C 1P34A 4WU9A 1M1AC 2G5HC 3R45B 1BH9A 5GT0A 4ZUXD 4CAYA 3LZ0D 4JJNA 1M1AB 1P3FD 3AZGC 3WAAD 1F66C 3X1TB 3W96B 2ZY4A 5CPID 3B0CT 4EO5C 3AZLD 1F66B 1M18D 3MGSA 3AZEA 5DNMC 3UTAB 3VH5W 5AV5B 3KUYA 3C1CA 3AZMC 4WU8A 4CSRA 4EO5B 3MNNC 1M19A 5B2JD 2VQRA 5DNMB 5F99C 3EPLA 5B31C 3AZMB 5GXQC 4LD9A 5CP6C 2IO5C 3MNNB 3AZIB 1P3AC 3WA9A 3V9RB 5B24C 2CWEA 4R8PC 4J8XC 3B6FC 3NQUA 3WTPE 3AZHC 2HIOD 1P3KD 3X1VA 1P3AB 1KX3A 3W97D 4KHAA 4J8XB 1P34D 4ZUXC 4WU9D 3LZ0C 3KXBA 5CPJA 3AFAC 2Y2JA 1P3FC 5B1MC 5GT0D 1TZYB 4JJND 3REIA 2ZY5A 2F8NG 3AFAB 1EQZA 1S32A 5B1MB 1U35B 5CPIC 3AV2A 2PYOC 2ZM5A 5CPKD 2CV5B 3A1KA 3MGSD 3WTPB 3AZED 5G49A 3B0BA 5CHLB 5B2JC 3AV1A 3KUYD 3C1CD 4G91C 2PYOB 4WU8D 5JRGA 1M19D 2DQNC 4H9QA 1KX4B 2HUEC 3R45A 4LD9D 5B32G 5AV6A 1P3KC 3LJAD 1M1AA 3WA9D 1KU5A 3W97C 3B6GC 4WU9C 3X1VD 1KX3D 5AVBB 5B0YC 2LY8A 3REKB 3W96A 5BNXB 1AOIC 5GT0C 3KXBD 3B6GB 5B0ZC 5CPJD 1F66A 2RVQC 3B0CW 3REID 1AOIB 1EQZD 1S32D 3MGPC 5AV8B 1HTAA 5DNMA 3AZMA 3AV2D 5CPKC 3MNNA 3AZIA 3MGPB 3V9RA 3MGSC 3AZEC 5B40B 5F99A 1R4VA 1H3OB 4AWLC
chains in the Genus database with same CATH topology
1P3AA 3AV1D 5B24A 4WZSB 2AROB 4R8PA 4J8XA 3B6FA 3TU4B 3AZHA 4LD9C 3LJAC 1P3GB 4G92B 5AV6D 1M1AD 5C3IC 3LZ0A 3AFAA 3KWQB 1KX3C 2DF4C 5B1MA 3AN2C 3KXBC 1ID3B 5CPJC 1WWSA 3W96D 2NQBB 4H9SA 3REIC 3P5JB 4YM6B 3AN2B 2CV5A 1F66D 5CPIA 2Y2KA 3UTAD 3W99B 4KGCB 4H9RB 5B2IB 2PYOA 3AZFC 4J8UB 2Y2NA 1KX4A 4QLCB 5DNMD 1P3OB 3AZMD 4YS3B 2BYKB 2XD1A 3MNND 3AZID 3AZFB 2Y2IA 5F99D 3AV1C 3C1BB 1P3AD 5B24D 4XZQB 5BNXA 4J8XD 2Y2PA 3AZHD 3B6GA 4KUDC 2NZDB 4H9NB 4H9OA 5B0YA 1AOIA 4KUDB 4WJ3C 5B0ZA 3AFAD 5B1MD 5AV8A 3W96C 3MGRC 3LZ1B 3MGPA 2Y2HA 5B40A 3UTAC 3MGRB 1P3LC 2CV5D 2W8SA 1W2EA 1H3OA 5AV5C 2F8NH 5CPKA 5GSUB 2PYOD 2AROA 1P3LB 3TU4A 2YFVB 1KX4D 3F6TA 3AZIC 1P3GA 3H0MC 2J8PA 3AZNB 3REJC 2F2AC 3LJAA 3B0DB 1ZLAC 2F8NB 1B6WA 3UTBB 3REJB 2NQBA 2JCHA 5GT3B 1TZYC 1ZLAB 3B6GD 3AN2A 5B0YD 1HQ3B 5BS7C 1AOID 4H9RA 1U35C 5B2IA 1PZRA 5B0ZD 3IP4C 4WNNB 5B32C 4J8UA 5AV8D 1JFIA 4QLCA 2RVQD 1P3OA 4H9SC 2FJ7C 2ZY3A 4YS3A 2BYKA 5FUGB 3AZFA 2CV5C 3MGPD 5B32B 3WTPC 5B40D 3AZKB 2FJ7B 5E5AB 2FFFB 5DNNB 3X1TD 1KX4C 1ULYA 3WKJB 2AROD 1BH8B 3A6NB 3TU4D 4H9NA 3UT9B 1P3GD 3EG5B 3X1UB 4Z66B 3EPKA 5B1LB 4KUDA 5AVBC 3REKC 5AY8C 4J8VC 5B31G 1ID3D 2Y2GA 2NQBD 3LZ1A 4WV4B 3LELB 5AY8B 4YM6D 3MGRA 3AN2D 4J8VB 5B33B 4H9PB 3W99D 4KGCD 5AV8C 3O62B 5B2ID 3AZLB 3UTAA 1M18B 1P3LA 5AV5A 4Z2MH 4J8UD 1TAFB 1A7WA 4QLCD 1P3OD 1T3UA 4YS3D 5B40C 4J8WB 3AZFD 3AZJB 3AZNA 1KX5B 3X1TC 2RIQA 2F8NA 3VH6A 2AROC 4NE5A 5AVCB 3C1BD 1Z2CB 4XUJB 3UTBA 3TU4C 2JE5A 3REJA 1P3PC 1P3GC 1WWIA 4NFTA 5GT3A 1P3MC 5BNVB 1ZLAA 3REHB 4G92C 2NZDD 3AYWC 2Y2MA 4NE3A 1P34B 3KWQC 1P3PB 1P3MB 4DRAA 1TZYA 4KUDD 3AYWB 1BH9B 4WNNA 1ID3C 4CAYB 2YFWB 3AL0C 5BS7A 2NQBC 4UUZB 5BT1C 1U35A 4YM6C 5FUGA 3EPHA 5BO0B 4Z2MG 3LZ1D 5B32A 4ZBJC 3W99C 3MGRD 4KGCC 2FJ7A 5B2IC 4HGAB 4J8UC 4X23C 4QLCC 3WTPA 3WKJA 4ZBJB 1BH8A 1P3OC 1P3BB 1P3LD 5AV5D 4YS3C 3W98B 3UT9A 3C1CB 4X23B 3X1UA 4WU8B 4Z66A 5B1LA 2Y2LA 3AZND 3C1BC 5AV9B 2F8ND 3FDDA 4XZQC 3MVDB 3UTBD 2NZDC 3REJD 5GT3D 5AVBA 3LELA 1ZLAD 3REKA 5AY8A 3KSYA 4J8VA 4KHAB 1N1JB 3O62A 1TZYD 3MGQC 2F8NK 1TAFA 3LZ1C 3MGQB 1U35D 1EQZB 1S32B 4J8WA 3VH5A 3H0RC 1P3IC 3AZJA 5B32D 1KX5A 2ZY2A 3AZKD 3NQJB 2FJ7D 5GSUC 5E5AD 4XUJA 1P3IB 2XD5A 3WTPD 3WKJD 1BFMA 3X1TA 5BNVA 3RELC 3REHA 3UT9D 3AZNC 3X1UD 4Z66D 1P3PA 1P3MA 5JRGB 3B0DC 5B1LD 4H9QB 3RELB 3AYWA 3UTBC 2YFWA 5JA4B 5AV6B 4UUZA 5GT3C 3KWQA 4Z5TC 2JSSA 5BO0A 2L5AA 5AVBD 3LELD 1ID3A 1HQ3C 3REKD 5AY8D 4J8VD 5B33D 4Z5TB 4YM6A 3AZGB 3O62D 3X1SC 3W99A 4KGCA 1P3BA 3W98A 4X23A 3AZKC 3X1SB 4J8WD 3AZJD 1Q9CA 5E5AC 1KX5D 5DNNC 5AV9A 3WKJC 2BG1A 5AVCD 3A6NC 4XUJD 3MVDA 3H0LC 3UT9C 5F99B 3C1BA 5B31B 3X1UC 5GXQB 4XZQA 5CP6B 4Z66C 3REHD 2IO5B 3KFUG 5B1LC 5B24B 2NZDA 3A1IA 4R8PB 3B6FB 3VH6T 1P3PD 1P3MD 3AZHB 1N1JA 2BYMB 3AYWD 4ZUXB 3WAAC 3KWQD 3LZ0B 3LELC 3MGQA 1P3FB 5B33C 3NQJA 3WAAB 3O62C 5BT1D 3AZLC 1M18C 1P3IA 5CPIB 1P3BD 3W98D 5GSUA 4J8WC 3AZJC 2YFVA 4X23D 1KX5C 3RELA 5AVCC 4XUJC 5B2JB 5AV9D 4G91B 5KDMB 5JA4A 2HIOC 3MVDD 3EPJA 3REHC 2HUEB 4XZQD 1P34C 1P3KB 2HIOB 4Z5TA 3AZGA 3W97B 4DRBA 4JJNC 1HQ3A 4WU9B 4H9OB 2Y2OA 5B0YB 4M6BA 5GT0B 3MGQD 4UPKA 5B0ZB 4JJNB 3X1SA 4HGAC 3AZKA 4E44A 1P3BC 3W98C 1P3ID 5E5AA 5DNNA 5B31A 3KUYC 3C1CC 3VH5T 5GXQA 5GSUD 5CP6A 4WU8C 5CPKB 1M19C 2G5IC 3A6NA 3MGSB 3AZEB 5JRGD 5AV9C 3KUYB 3RELD 4CSRB 2BYMA 3WA9C 2UWXA 4AWLB 1M19B 3MVDC 3VH6W 4ZUXA 4LD9B 3WA9B 3X1VC 3LJAB 1P3FA 3NQUB 3WAAA 5C3IB 4Z5TD 3AZGD 3X1VB 1KX3B 4E45A 5B33A 1HQ3D 4H9PA 3KXBB 3AZLA 5CPJB 1EQZC 1S32C 1M18A 3REIB 3X1SD 1JFIB 3AV2C 5B2JA 5KDMA 1F1EA 4NE6A 3AV2B 5AVCA 5DNND 5B31D 1B67A 5GXQD 2Y2QA 5CP6D 5JRGC 1P3KA 2HIOA 3A6ND 4DQYB 4R8PD 5G49B 3B6FD 3AV1B 3W97A 5AV6C 1P34A 4WU9A 1M1AC 2G5HC 3R45B 1BH9A 5GT0A 4ZUXD 4CAYA 3LZ0D 4JJNA 1M1AB 1P3FD 3AZGC 3WAAD 1F66C 3X1TB 3W96B 2ZY4A 5CPID 3B0CT 4EO5C 3AZLD 1F66B 1M18D 3MGSA 3AZEA 5DNMC 3UTAB 3VH5W 5AV5B 3KUYA 3C1CA 3AZMC 4WU8A 4CSRA 4EO5B 3MNNC 1M19A 5B2JD 2VQRA 5DNMB 5F99C 3EPLA 5B31C 3AZMB 5GXQC 4LD9A 5CP6C 2IO5C 3MNNB 3AZIB 1P3AC 3WA9A 3V9RB 5B24C 2CWEA 4R8PC 4J8XC 3B6FC 3NQUA 3WTPE 3AZHC 2HIOD 1P3KD 3X1VA 1P3AB 1KX3A 3W97D 4KHAA 4J8XB 1P34D 4ZUXC 4WU9D 3LZ0C 3KXBA 5CPJA 3AFAC 2Y2JA 1P3FC 5B1MC 5GT0D 1TZYB 4JJND 3REIA 2ZY5A 2F8NG 3AFAB 1EQZA 1S32A 5B1MB 1U35B 5CPIC 3AV2A 2PYOC 2ZM5A 5CPKD 2CV5B 3A1KA 3MGSD 3WTPB 3AZED 5G49A 3B0BA 5CHLB 5B2JC 3AV1A 3KUYD 3C1CD 4G91C 2PYOB 4WU8D 5JRGA 1M19D 2DQNC 4H9QA 1KX4B 2HUEC 3R45A 4LD9D 5B32G 5AV6A 1P3KC 3LJAD 1M1AA 3WA9D 1KU5A 3W97C 3B6GC 4WU9C 3X1VD 1KX3D 5AVBB 5B0YC 2LY8A 3REKB 3W96A 5BNXB 1AOIC 5GT0C 3KXBD 3B6GB 5B0ZC 5CPJD 1F66A 2RVQC 3B0CW 3REID 1AOIB 1EQZD 1S32D 3MGPC 5AV8B 1HTAA 5DNMA 3AZMA 3AV2D 5CPKC 3MNNA 3AZIA 3MGPB 3V9RA 3MGSC 3AZEC 5B40B 5F99A 1R4VA 1H3OB 4AWLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  3AV1 D;  5B24 A;  4WZS B;  2ARO B;  4R8P A;  4J8X A;  3B6F A;  3TU4 B;  3AZH A;  4LD9 C;  3LJA C;  1P3G B;  4G92 B;  5AV6 D;  1M1A D;  5C3I C;  3LZ0 A;  3AFA A;  3KWQ B;  1KX3 C;  5B1M A;  3AN2 C;  3KXB C;  1ID3 B;  5CPJ C;  1WWS A;  3W96 D;  2NQB B;  4H9S A;  3REI C;  4YM6 B;  3AN2 B;  2CV5 A;  1F66 D;  5CPI A;  3UTA D;  3W99 B;  4KGC B;  4H9R B;  5B2I B;  2PYO A;  3AZF C;  4J8U B;  1KX4 A;  4QLC B;  5DNM D;  1P3O B;  3AZM D;  4YS3 B;  2BYK B;  3MNN D;  3AZI D;  3AZF B;  5F99 D;  3AV1 C;  3C1B B;  1P3A D;  5B24 D;  4XZQ B;  5BNX A;  4J8X D;  3AZH D;  4KUD C;  3B6G A;  2NZD B;  4H9N B;  4H9O A;  5B0Y A;  1AOI A;  4KUD B;  5B0Z A;  3AFA D;  5B1M D;  5AV8 A;  3W96 C;  3MGR C;  3LZ1 B;  3MGP A;  5B40 A;  3UTA C;  3MGR B;  1P3L C;  2CV5 D;  5AV5 C;  1H3O A;  2F8N H;  5CPK A;  5GSU B;  2PYO D;  2ARO A;  1P3L B;  3TU4 A;  2YFV B;  1KX4 D;  3AZI C;  1P3G A;  3AZN B;  3REJ C;  3LJA A;  3B0D B;  1ZLA C;  2F8N B;  1B6W A;  3UTB B;  3REJ B;  2NQB A;  5GT3 B;  1TZY C;  1ZLA B;  3B6G D;  3AN2 A;  5B0Y D;  1HQ3 B;  5BS7 C;  1AOI D;  4H9R A;  1U35 C;  5B2I A;  5B0Z D;  4WNN B;  5B32 C;  4J8U A;  5AV8 D;  1JFI A;  4QLC A;  2RVQ D;  1P3O A;  4H9S C;  2FJ7 C;  4YS3 A;  2BYK A;  5FUG B;  3AZF A;  2CV5 C;  3MGP D;  5B32 B;  3WTP C;  5B40 D;  3AZK B;  2FJ7 B;  5E5A B;  5DNN B;  3X1T D;  1KX4 C;  1ULY A;  3WKJ B;  2ARO D;  1BH8 B;  3A6N B;  3TU4 D;  4H9N A;  3UT9 B;  1P3G D;  3X1U B;  4Z66 B;  5B1L B;  4KUD A;  5AVB C;  3REK C;  5AY8 C;  4J8V C;  5B31 G;  1ID3 D;  2NQB D;  3LZ1 A;  4WV4 B;  3LEL B;  5AY8 B;  4YM6 D;  3MGR A;  3AN2 D;  4J8V B;  5B33 B;  4H9P B;  3W99 D;  4KGC D;  5AV8 C;  3O62 B;  5B2I D;  3AZL B;  3UTA A;  1M18 B;  1P3L A;  5AV5 A;  4Z2M H;  4J8U D;  1TAF B;  1A7W A;  4QLC D;  1P3O D;  4YS3 D;  5B40 C;  4J8W B;  3AZF D;  3AZJ B;  3AZN A;  1KX5 B;  3X1T C;  2F8N A;  3VH6 A;  2ARO C;  4NE5 A;  5AVC B;  3C1B D;  4XUJ B;  3TU4 C;  3UTB A;  3REJ A;  1P3P C;  1P3G C;  1WWI A;  4NFT A;  5GT3 A;  1P3M C;  5BNV B;  1ZLA A;  3REH B;  4G92 C;  2NZD D;  3AYW C;  4NE3 A;  1P34 B;  3KWQ C;  1P3P B;  1P3M B;  4DRA A;  1TZY A;  4KUD D;  3AYW B;  1BH9 B;  4WNN A;  1ID3 C;  4CAY B;  2YFW B;  5BS7 A;  2NQB C;  4UUZ B;  5BT1 C;  1U35 A;  4YM6 C;  5FUG A;  5BO0 B;  4Z2M G;  3LZ1 D;  5B32 A;  4ZBJ C;  3W99 C;  3MGR D;  4KGC C;  2FJ7 A;  5B2I C;  4HGA B;  4J8U C;  4X23 C;  4QLC C;  3WTP A;  3WKJ A;  4ZBJ B;  1BH8 A;  1P3O C;  1P3B B;  1P3L D;  5AV5 D;  4YS3 C;  3W98 B;  3UT9 A;  3C1C B;  4X23 B;  3X1U A;  4WU8 B;  4Z66 A;  5B1L A;  3AZN D;  3C1B C;  5AV9 B;  2F8N D;  4XZQ C;  3MVD B;  3UTB D;  2NZD C;  3REJ D;  5GT3 D;  5AVB A;  3LEL A;  1ZLA D;  3REK A;  5AY8 A;  3KSY A;  4J8V A;  4KHA B;  1N1J B;  3O62 A;  1TZY D;  3MGQ C;  2F8N K;  1TAF A;  3LZ1 C;  3MGQ B;  1U35 D;  1EQZ B;  1S32 B;  4J8W A;  3VH5 A;  1P3I C;  3AZJ A;  5B32 D;  1KX5 A;  3AZK D;  3NQJ B;  2FJ7 D;  5GSU C;  5E5A D;  4XUJ A;  1P3I B;  3WTP D;  3WKJ D;  1BFM A;  3X1T A;  5BNV A;  3REL C;  3REH A;  3UT9 D;  3AZN C;  3X1U D;  4Z66 D;  1P3P A;  1P3M A;  5JRG B;  3B0D C;  5B1L D;  4H9Q B;  3REL B;  3AYW A;  3UTB C;  2YFW A;  5JA4 B;  5AV6 B;  4UUZ A;  5GT3 C;  3KWQ A;  4Z5T C;  2JSS A;  5BO0 A;  2L5A A;  5AVB D;  3LEL D;  1ID3 A;  1HQ3 C;  3REK D;  5AY8 D;  4J8V D;  5B33 D;  4Z5T B;  4YM6 A;  3AZG B;  3O62 D;  3X1S C;  3W99 A;  4KGC A;  1P3B A;  3W98 A;  4X23 A;  3AZK C;  3X1S B;  4J8W D;  3AZJ D;  1Q9C A;  5E5A C;  1KX5 D;  5DNN C;  5AV9 A;  3WKJ C;  5AVC D;  3A6N C;  4XUJ D;  3MVD A;  3UT9 C;  5F99 B;  3C1B A;  5B31 B;  3X1U C;  5GXQ B;  4XZQ A;  5CP6 B;  4Z66 C;  3REH D;  2IO5 B;  5B1L C;  5B24 B;  2NZD A;  4R8P B;  3B6F B;  3VH6 T;  1P3P D;  1P3M D;  3AZH B;  1N1J A;  2BYM B;  3AYW D;  4ZUX B;  3WAA C;  3KWQ D;  3LZ0 B;  3LEL C;  3MGQ A;  1P3F B;  5B33 C;  3NQJ A;  3WAA B;  3O62 C;  5BT1 D;  3AZL C;  1M18 C;  1P3I A;  5CPI B;  1P3B D;  3W98 D;  5GSU A;  4J8W C;  3AZJ C;  2YFV A;  4X23 D;  1KX5 C;  3REL A;  5AVC C;  4XUJ C;  5B2J B;  5AV9 D;  4G91 B;  5KDM B;  5JA4 A;  2HIO C;  3MVD D;  3REH C;  2HUE B;  4XZQ D;  1P34 C;  1P3K B;  2HIO B;  4Z5T A;  3AZG A;  3W97 B;  4DRB A;  4JJN C;  1HQ3 A;  4WU9 B;  4H9O B;  5B0Y B;  4M6B A;  5GT0 B;  3MGQ D;  5B0Z B;  4JJN B;  3X1S A;  4HGA C;  3AZK A;  4E44 A;  1P3B C;  3W98 C;  1P3I D;  5E5A A;  5DNN A;  5B31 A;  3KUY C;  3C1C C;  3VH5 T;  5GXQ A;  5GSU D;  5CP6 A;  4WU8 C;  5CPK B;  1M19 C;  3A6N A;  3MGS B;  3AZE B;  5JRG D;  5AV9 C;  3KUY B;  3REL D;  4CSR B;  2BYM A;  3WA9 C;  4AWL B;  1M19 B;  3MVD C;  3VH6 W;  4ZUX A;  4LD9 B;  3WA9 B;  3X1V C;  3LJA B;  1P3F A;  3NQU B;  3WAA A;  5C3I B;  4Z5T D;  3AZG D;  3X1V B;  1KX3 B;  4E45 A;  5B33 A;  1HQ3 D;  4H9P A;  3KXB B;  3AZL A;  5CPJ B;  1EQZ C;  1S32 C;  1M18 A;  3REI B;  3X1S D;  1JFI B;  3AV2 C;  5B2J A;  5KDM A;  1F1E A;  4NE6 A;  3AV2 B;  5AVC A;  5DNN D;  5B31 D;  1B67 A;  5GXQ D;  5CP6 D;  5JRG C;  1P3K A;  2HIO A;  3A6N D;  4R8P D;  5G49 B;  3B6F D;  3AV1 B;  3W97 A;  5AV6 C;  1P34 A;  4WU9 A;  1M1A C;  3R45 B;  1BH9 A;  5GT0 A;  4ZUX D;  4CAY A;  3LZ0 D;  4JJN A;  1M1A B;  1P3F D;  3AZG C;  3WAA D;  1F66 C;  3X1T B;  3W96 B;  5CPI D;  3B0C T;  4EO5 C;  3AZL D;  1F66 B;  1M18 D;  3MGS A;  3AZE A;  5DNM C;  3UTA B;  3VH5 W;  5AV5 B;  3KUY A;  3C1C A;  3AZM C;  4WU8 A;  4CSR A;  4EO5 B;  3MNN C;  1M19 A;  5B2J D;  5DNM B;  5F99 C;  5B31 C;  3AZM B;  5GXQ C;  4LD9 A;  5CP6 C;  2IO5 C;  3MNN B;  3AZI B;  1P3A C;  3WA9 A;  3V9R B;  5B24 C;  2CWE A;  4R8P C;  4J8X C;  3B6F C;  3NQU A;  3WTP E;  3AZH C;  2HIO D;  1P3K D;  3X1V A;  1P3A B;  1KX3 A;  3W97 D;  4KHA A;  4J8X B;  1P34 D;  4ZUX C;  4WU9 D;  3LZ0 C;  3KXB A;  5CPJ A;  3AFA C;  1P3F C;  5B1M C;  5GT0 D;  1TZY B;  4JJN D;  3REI A;  2F8N G;  3AFA B;  1EQZ A;  1S32 A;  5B1M B;  1U35 B;  5CPI C;  3AV2 A;  2PYO C;  5CPK D;  2CV5 B;  3MGS D;  3WTP B;  3AZE D;  5G49 A;  3B0B A;  5CHL B;  5B2J C;  3AV1 A;  3KUY D;  3C1C D;  4G91 C;  2PYO B;  4WU8 D;  5JRG A;  1M19 D;  4H9Q A;  1KX4 B;  2HUE C;  3R45 A;  4LD9 D;  5B32 G;  5AV6 A;  1P3K C;  3LJA D;  1M1A A;  3WA9 D;  1KU5 A;  3W97 C;  3B6G C;  4WU9 C;  3X1V D;  1KX3 D;  5AVB B;  5B0Y C;  2LY8 A;  3REK B;  3W96 A;  5BNX B;  1AOI C;  5GT0 C;  3KXB D;  3B6G B;  5B0Z C;  5CPJ D;  1F66 A;  2RVQ C;  3B0C W;  3REI D;  1AOI B;  1EQZ D;  1S32 D;  3MGP C;  5AV8 B;  1HTA A;  5DNM A;  3AZM A;  3AV2 D;  5CPK C;  3MNN A;  3AZI A;  3MGP B;  3V9R A;  3MGS C;  3AZE C;  5B40 B;  5F99 A;  1R4V A;  1H3O B;  4AWL C; 
#chains in the Genus database with same CATH topology
 1P3A A;  3AV1 D;  5B24 A;  4WZS B;  2ARO B;  4R8P A;  4J8X A;  3B6F A;  3TU4 B;  3AZH A;  4LD9 C;  3LJA C;  1P3G B;  4G92 B;  5AV6 D;  1M1A D;  5C3I C;  3LZ0 A;  3AFA A;  3KWQ B;  1KX3 C;  2DF4 C;  5B1M A;  3AN2 C;  3KXB C;  1ID3 B;  5CPJ C;  1WWS A;  3W96 D;  2NQB B;  4H9S A;  3REI C;  3P5J B;  4YM6 B;  3AN2 B;  2CV5 A;  1F66 D;  5CPI A;  2Y2K A;  3UTA D;  3W99 B;  4KGC B;  4H9R B;  5B2I B;  2PYO A;  3AZF C;  4J8U B;  2Y2N A;  1KX4 A;  4QLC B;  5DNM D;  1P3O B;  3AZM D;  4YS3 B;  2BYK B;  2XD1 A;  3MNN D;  3AZI D;  3AZF B;  2Y2I A;  5F99 D;  3AV1 C;  3C1B B;  1P3A D;  5B24 D;  4XZQ B;  5BNX A;  4J8X D;  2Y2P A;  3AZH D;  3B6G A;  4KUD C;  2NZD B;  4H9N B;  4H9O A;  5B0Y A;  1AOI A;  4KUD B;  4WJ3 C;  5B0Z A;  3AFA D;  5B1M D;  5AV8 A;  3W96 C;  3MGR C;  3LZ1 B;  3MGP A;  2Y2H A;  5B40 A;  3UTA C;  3MGR B;  1P3L C;  2CV5 D;  2W8S A;  1W2E A;  1H3O A;  5AV5 C;  2F8N H;  5CPK A;  5GSU B;  2PYO D;  2ARO A;  1P3L B;  3TU4 A;  2YFV B;  1KX4 D;  3F6T A;  3AZI C;  1P3G A;  3H0M C;  2J8P A;  3AZN B;  3REJ C;  2F2A C;  3LJA A;  3B0D B;  1ZLA C;  2F8N B;  1B6W A;  3UTB B;  3REJ B;  2NQB A;  2JCH A;  5GT3 B;  1TZY C;  1ZLA B;  3B6G D;  3AN2 A;  5B0Y D;  1HQ3 B;  5BS7 C;  1AOI D;  4H9R A;  1U35 C;  5B2I A;  1PZR A;  5B0Z D;  3IP4 C;  4WNN B;  5B32 C;  4J8U A;  5AV8 D;  1JFI A;  4QLC A;  2RVQ D;  1P3O A;  4H9S C;  2FJ7 C;  2ZY3 A;  4YS3 A;  2BYK A;  5FUG B;  3AZF A;  2CV5 C;  3MGP D;  5B32 B;  3WTP C;  5B40 D;  3AZK B;  2FJ7 B;  5E5A B;  2FFF B;  5DNN B;  3X1T D;  1KX4 C;  1ULY A;  3WKJ B;  2ARO D;  1BH8 B;  3A6N B;  3TU4 D;  4H9N A;  3UT9 B;  1P3G D;  3EG5 B;  3X1U B;  4Z66 B;  3EPK A;  5B1L B;  4KUD A;  5AVB C;  3REK C;  5AY8 C;  4J8V C;  5B31 G;  1ID3 D;  2Y2G A;  2NQB D;  3LZ1 A;  4WV4 B;  3LEL B;  5AY8 B;  4YM6 D;  3MGR A;  3AN2 D;  4J8V B;  5B33 B;  4H9P B;  3W99 D;  4KGC D;  5AV8 C;  3O62 B;  5B2I D;  3AZL B;  3UTA A;  1M18 B;  1P3L A;  5AV5 A;  4Z2M H;  4J8U D;  1TAF B;  1A7W A;  4QLC D;  1P3O D;  1T3U A;  4YS3 D;  5B40 C;  4J8W B;  3AZF D;  3AZJ B;  3AZN A;  1KX5 B;  3X1T C;  2RIQ A;  2F8N A;  3VH6 A;  2ARO C;  4NE5 A;  5AVC B;  3C1B D;  1Z2C B;  4XUJ B;  3UTB A;  3TU4 C;  2JE5 A;  3REJ A;  1P3P C;  1P3G C;  1WWI A;  4NFT A;  5GT3 A;  1P3M C;  5BNV B;  1ZLA A;  3REH B;  4G92 C;  2NZD D;  3AYW C;  2Y2M A;  4NE3 A;  1P34 B;  3KWQ C;  1P3P B;  1P3M B;  4DRA A;  1TZY A;  4KUD D;  3AYW B;  1BH9 B;  4WNN A;  1ID3 C;  4CAY B;  2YFW B;  3AL0 C;  5BS7 A;  2NQB C;  4UUZ B;  5BT1 C;  1U35 A;  4YM6 C;  5FUG A;  3EPH A;  5BO0 B;  4Z2M G;  3LZ1 D;  5B32 A;  4ZBJ C;  3W99 C;  3MGR D;  4KGC C;  2FJ7 A;  5B2I C;  4HGA B;  4J8U C;  4X23 C;  4QLC C;  3WTP A;  3WKJ A;  4ZBJ B;  1BH8 A;  1P3O C;  1P3B B;  1P3L D;  5AV5 D;  4YS3 C;  3W98 B;  3UT9 A;  3C1C B;  4X23 B;  3X1U A;  4WU8 B;  4Z66 A;  5B1L A;  2Y2L A;  3AZN D;  3C1B C;  5AV9 B;  2F8N D;  3FDD A;  4XZQ C;  3MVD B;  3UTB D;  2NZD C;  3REJ D;  5GT3 D;  5AVB A;  3LEL A;  1ZLA D;  3REK A;  5AY8 A;  3KSY A;  4J8V A;  4KHA B;  1N1J B;  3O62 A;  1TZY D;  3MGQ C;  2F8N K;  1TAF A;  3LZ1 C;  3MGQ B;  1U35 D;  1EQZ B;  1S32 B;  4J8W A;  3VH5 A;  3H0R C;  1P3I C;  3AZJ A;  5B32 D;  1KX5 A;  2ZY2 A;  3AZK D;  3NQJ B;  2FJ7 D;  5GSU C;  5E5A D;  4XUJ A;  1P3I B;  2XD5 A;  3WTP D;  3WKJ D;  1BFM A;  3X1T A;  5BNV A;  3REL C;  3REH A;  3UT9 D;  3AZN C;  3X1U D;  4Z66 D;  1P3P A;  1P3M A;  5JRG B;  3B0D C;  5B1L D;  4H9Q B;  3REL B;  3AYW A;  3UTB C;  2YFW A;  5JA4 B;  5AV6 B;  4UUZ A;  5GT3 C;  3KWQ A;  4Z5T C;  2JSS A;  5BO0 A;  2L5A A;  5AVB D;  3LEL D;  1ID3 A;  1HQ3 C;  3REK D;  5AY8 D;  4J8V D;  5B33 D;  4Z5T B;  4YM6 A;  3AZG B;  3O62 D;  3X1S C;  3W99 A;  4KGC A;  1P3B A;  3W98 A;  4X23 A;  3AZK C;  3X1S B;  4J8W D;  3AZJ D;  1Q9C A;  5E5A C;  1KX5 D;  5DNN C;  5AV9 A;  3WKJ C;  2BG1 A;  5AVC D;  3A6N C;  4XUJ D;  3MVD A;  3H0L C;  3UT9 C;  5F99 B;  3C1B A;  5B31 B;  3X1U C;  5GXQ B;  4XZQ A;  5CP6 B;  4Z66 C;  3REH D;  2IO5 B;  3KFU G;  5B1L C;  5B24 B;  2NZD A;  3A1I A;  4R8P B;  3B6F B;  3VH6 T;  1P3P D;  1P3M D;  3AZH B;  1N1J A;  2BYM B;  3AYW D;  4ZUX B;  3WAA C;  3KWQ D;  3LZ0 B;  3LEL C;  3MGQ A;  1P3F B;  5B33 C;  3NQJ A;  3WAA B;  3O62 C;  5BT1 D;  3AZL C;  1M18 C;  1P3I A;  5CPI B;  1P3B D;  3W98 D;  5GSU A;  4J8W C;  3AZJ C;  2YFV A;  4X23 D;  1KX5 C;  3REL A;  5AVC C;  4XUJ C;  5B2J B;  5AV9 D;  4G91 B;  5KDM B;  5JA4 A;  2HIO C;  3MVD D;  3EPJ A;  3REH C;  2HUE B;  4XZQ D;  1P34 C;  1P3K B;  2HIO B;  4Z5T A;  3AZG A;  3W97 B;  4DRB A;  4JJN C;  1HQ3 A;  4WU9 B;  4H9O B;  2Y2O A;  5B0Y B;  4M6B A;  5GT0 B;  3MGQ D;  4UPK A;  5B0Z B;  4JJN B;  3X1S A;  4HGA C;  3AZK A;  4E44 A;  1P3B C;  3W98 C;  1P3I D;  5E5A A;  5DNN A;  5B31 A;  3KUY C;  3C1C C;  3VH5 T;  5GXQ A;  5GSU D;  5CP6 A;  4WU8 C;  5CPK B;  1M19 C;  2G5I C;  3A6N A;  3MGS B;  3AZE B;  5JRG D;  5AV9 C;  3KUY B;  3REL D;  4CSR B;  2BYM A;  3WA9 C;  2UWX A;  4AWL B;  1M19 B;  3MVD C;  3VH6 W;  4ZUX A;  4LD9 B;  3WA9 B;  3X1V C;  3LJA B;  1P3F A;  3NQU B;  3WAA A;  5C3I B;  4Z5T D;  3AZG D;  3X1V B;  1KX3 B;  4E45 A;  5B33 A;  1HQ3 D;  4H9P A;  3KXB B;  3AZL A;  5CPJ B;  1EQZ C;  1S32 C;  1M18 A;  3REI B;  3X1S D;  1JFI B;  3AV2 C;  5B2J A;  5KDM A;  1F1E A;  4NE6 A;  3AV2 B;  5AVC A;  5DNN D;  5B31 D;  1B67 A;  5GXQ D;  2Y2Q A;  5CP6 D;  5JRG C;  1P3K A;  2HIO A;  3A6N D;  4DQY B;  4R8P D;  5G49 B;  3B6F D;  3AV1 B;  3W97 A;  5AV6 C;  1P34 A;  4WU9 A;  1M1A C;  2G5H C;  3R45 B;  1BH9 A;  5GT0 A;  4ZUX D;  4CAY A;  3LZ0 D;  4JJN A;  1M1A B;  1P3F D;  3AZG C;  3WAA D;  1F66 C;  3X1T B;  3W96 B;  2ZY4 A;  5CPI D;  3B0C T;  4EO5 C;  3AZL D;  1F66 B;  1M18 D;  3MGS A;  3AZE A;  5DNM C;  3UTA B;  3VH5 W;  5AV5 B;  3KUY A;  3C1C A;  3AZM C;  4WU8 A;  4CSR A;  4EO5 B;  3MNN C;  1M19 A;  5B2J D;  2VQR A;  5DNM B;  5F99 C;  3EPL A;  5B31 C;  3AZM B;  5GXQ C;  4LD9 A;  5CP6 C;  2IO5 C;  3MNN B;  3AZI B;  1P3A C;  3WA9 A;  3V9R B;  5B24 C;  2CWE A;  4R8P C;  4J8X C;  3B6F C;  3NQU A;  3WTP E;  3AZH C;  2HIO D;  1P3K D;  3X1V A;  1P3A B;  1KX3 A;  3W97 D;  4KHA A;  4J8X B;  1P34 D;  4ZUX C;  4WU9 D;  3LZ0 C;  3KXB A;  5CPJ A;  3AFA C;  2Y2J A;  1P3F C;  5B1M C;  5GT0 D;  1TZY B;  4JJN D;  3REI A;  2ZY5 A;  2F8N G;  3AFA B;  1EQZ A;  1S32 A;  5B1M B;  1U35 B;  5CPI C;  3AV2 A;  2PYO C;  2ZM5 A;  5CPK D;  2CV5 B;  3A1K A;  3MGS D;  3WTP B;  3AZE D;  5G49 A;  3B0B A;  5CHL B;  5B2J C;  3AV1 A;  3KUY D;  3C1C D;  4G91 C;  2PYO B;  4WU8 D;  5JRG A;  1M19 D;  2DQN C;  4H9Q A;  1KX4 B;  2HUE C;  3R45 A;  4LD9 D;  5B32 G;  5AV6 A;  1P3K C;  3LJA D;  1M1A A;  3WA9 D;  1KU5 A;  3W97 C;  3B6G C;  4WU9 C;  3X1V D;  1KX3 D;  5AVB B;  5B0Y C;  2LY8 A;  3REK B;  3W96 A;  5BNX B;  1AOI C;  5GT0 C;  3KXB D;  3B6G B;  5B0Z C;  5CPJ D;  1F66 A;  2RVQ C;  3B0C W;  3REI D;  1AOI B;  1EQZ D;  1S32 D;  3MGP C;  5AV8 B;  1HTA A;  5DNM A;  3AZM A;  3AV2 D;  5CPK C;  3MNN A;  3AZI A;  3MGP B;  3V9R A;  3MGS C;  3AZE C;  5B40 B;  5F99 A;  1R4V A;  1H3O B;  4AWL C; 
#chains in the Genus database with same CATH homology
 1P3A A;  3AV1 D;  5B24 A;  4WZS B;  2ARO B;  4R8P A;  4J8X A;  3B6F A;  3TU4 B;  3AZH A;  4LD9 C;  3LJA C;  1P3G B;  4G92 B;  5AV6 D;  1M1A D;  5C3I C;  3LZ0 A;  3AFA A;  3KWQ B;  1KX3 C;  2DF4 C;  5B1M A;  3AN2 C;  3KXB C;  1ID3 B;  5CPJ C;  1WWS A;  3W96 D;  2NQB B;  4H9S A;  3REI C;  3P5J B;  4YM6 B;  3AN2 B;  2CV5 A;  1F66 D;  5CPI A;  2Y2K A;  3UTA D;  3W99 B;  4KGC B;  4H9R B;  5B2I B;  2PYO A;  3AZF C;  4J8U B;  2Y2N A;  1KX4 A;  4QLC B;  5DNM D;  1P3O B;  3AZM D;  4YS3 B;  2BYK B;  2XD1 A;  3MNN D;  3AZI D;  3AZF B;  2Y2I A;  5F99 D;  3AV1 C;  3C1B B;  1P3A D;  5B24 D;  4XZQ B;  5BNX A;  4J8X D;  2Y2P A;  3AZH D;  3B6G A;  4KUD C;  2NZD B;  4H9N B;  4H9O A;  5B0Y A;  1AOI A;  4KUD B;  4WJ3 C;  5B0Z A;  3AFA D;  5B1M D;  5AV8 A;  3W96 C;  3MGR C;  3LZ1 B;  3MGP A;  2Y2H A;  5B40 A;  3UTA C;  3MGR B;  1P3L C;  2CV5 D;  2W8S A;  1W2E A;  1H3O A;  5AV5 C;  2F8N H;  5CPK A;  5GSU B;  2PYO D;  2ARO A;  1P3L B;  3TU4 A;  2YFV B;  1KX4 D;  3F6T A;  3AZI C;  1P3G A;  3H0M C;  2J8P A;  3AZN B;  3REJ C;  2F2A C;  3LJA A;  3B0D B;  1ZLA C;  2F8N B;  1B6W A;  3UTB B;  3REJ B;  2NQB A;  2JCH A;  5GT3 B;  1TZY C;  1ZLA B;  3B6G D;  3AN2 A;  5B0Y D;  1HQ3 B;  5BS7 C;  1AOI D;  4H9R A;  1U35 C;  5B2I A;  1PZR A;  5B0Z D;  3IP4 C;  4WNN B;  5B32 C;  4J8U A;  5AV8 D;  1JFI A;  4QLC A;  2RVQ D;  1P3O A;  4H9S C;  2FJ7 C;  2ZY3 A;  4YS3 A;  2BYK A;  5FUG B;  3AZF A;  2CV5 C;  3MGP D;  5B32 B;  3WTP C;  5B40 D;  3AZK B;  2FJ7 B;  5E5A B;  2FFF B;  5DNN B;  3X1T D;  1KX4 C;  1ULY A;  3WKJ B;  2ARO D;  1BH8 B;  3A6N B;  3TU4 D;  4H9N A;  3UT9 B;  1P3G D;  3EG5 B;  3X1U B;  4Z66 B;  3EPK A;  5B1L B;  4KUD A;  5AVB C;  3REK C;  5AY8 C;  4J8V C;  5B31 G;  1ID3 D;  2Y2G A;  2NQB D;  3LZ1 A;  4WV4 B;  3LEL B;  5AY8 B;  4YM6 D;  3MGR A;  3AN2 D;  4J8V B;  5B33 B;  4H9P B;  3W99 D;  4KGC D;  5AV8 C;  3O62 B;  5B2I D;  3AZL B;  3UTA A;  1M18 B;  1P3L A;  5AV5 A;  4Z2M H;  4J8U D;  1TAF B;  1A7W A;  4QLC D;  1P3O D;  1T3U A;  4YS3 D;  5B40 C;  4J8W B;  3AZF D;  3AZJ B;  3AZN A;  1KX5 B;  3X1T C;  2RIQ A;  2F8N A;  3VH6 A;  2ARO C;  4NE5 A;  5AVC B;  3C1B D;  1Z2C B;  4XUJ B;  3UTB A;  3TU4 C;  2JE5 A;  3REJ A;  1P3P C;  1P3G C;  1WWI A;  4NFT A;  5GT3 A;  1P3M C;  5BNV B;  1ZLA A;  3REH B;  4G92 C;  2NZD D;  3AYW C;  2Y2M A;  4NE3 A;  1P34 B;  3KWQ C;  1P3P B;  1P3M B;  4DRA A;  1TZY A;  4KUD D;  3AYW B;  1BH9 B;  4WNN A;  1ID3 C;  4CAY B;  2YFW B;  3AL0 C;  5BS7 A;  2NQB C;  4UUZ B;  5BT1 C;  1U35 A;  4YM6 C;  5FUG A;  3EPH A;  5BO0 B;  4Z2M G;  3LZ1 D;  5B32 A;  4ZBJ C;  3W99 C;  3MGR D;  4KGC C;  2FJ7 A;  5B2I C;  4HGA B;  4J8U C;  4X23 C;  4QLC C;  3WTP A;  3WKJ A;  4ZBJ B;  1BH8 A;  1P3O C;  1P3B B;  1P3L D;  5AV5 D;  4YS3 C;  3W98 B;  3UT9 A;  3C1C B;  4X23 B;  3X1U A;  4WU8 B;  4Z66 A;  5B1L A;  2Y2L A;  3AZN D;  3C1B C;  5AV9 B;  2F8N D;  3FDD A;  4XZQ C;  3MVD B;  3UTB D;  2NZD C;  3REJ D;  5GT3 D;  5AVB A;  3LEL A;  1ZLA D;  3REK A;  5AY8 A;  3KSY A;  4J8V A;  4KHA B;  1N1J B;  3O62 A;  1TZY D;  3MGQ C;  2F8N K;  1TAF A;  3LZ1 C;  3MGQ B;  1U35 D;  1EQZ B;  1S32 B;  4J8W A;  3VH5 A;  3H0R C;  1P3I C;  3AZJ A;  5B32 D;  1KX5 A;  2ZY2 A;  3AZK D;  3NQJ B;  2FJ7 D;  5GSU C;  5E5A D;  4XUJ A;  1P3I B;  2XD5 A;  3WTP D;  3WKJ D;  1BFM A;  3X1T A;  5BNV A;  3REL C;  3REH A;  3UT9 D;  3AZN C;  3X1U D;  4Z66 D;  1P3P A;  1P3M A;  5JRG B;  3B0D C;  5B1L D;  4H9Q B;  3REL B;  3AYW A;  3UTB C;  2YFW A;  5JA4 B;  5AV6 B;  4UUZ A;  5GT3 C;  3KWQ A;  4Z5T C;  2JSS A;  5BO0 A;  2L5A A;  5AVB D;  3LEL D;  1ID3 A;  1HQ3 C;  3REK D;  5AY8 D;  4J8V D;  5B33 D;  4Z5T B;  4YM6 A;  3AZG B;  3O62 D;  3X1S C;  3W99 A;  4KGC A;  1P3B A;  3W98 A;  4X23 A;  3AZK C;  3X1S B;  4J8W D;  3AZJ D;  1Q9C A;  5E5A C;  1KX5 D;  5DNN C;  5AV9 A;  3WKJ C;  2BG1 A;  5AVC D;  3A6N C;  4XUJ D;  3MVD A;  3H0L C;  3UT9 C;  5F99 B;  3C1B A;  5B31 B;  3X1U C;  5GXQ B;  4XZQ A;  5CP6 B;  4Z66 C;  3REH D;  2IO5 B;  3KFU G;  5B1L C;  5B24 B;  2NZD A;  3A1I A;  4R8P B;  3B6F B;  3VH6 T;  1P3P D;  1P3M D;  3AZH B;  1N1J A;  2BYM B;  3AYW D;  4ZUX B;  3WAA C;  3KWQ D;  3LZ0 B;  3LEL C;  3MGQ A;  1P3F B;  5B33 C;  3NQJ A;  3WAA B;  3O62 C;  5BT1 D;  3AZL C;  1M18 C;  1P3I A;  5CPI B;  1P3B D;  3W98 D;  5GSU A;  4J8W C;  3AZJ C;  2YFV A;  4X23 D;  1KX5 C;  3REL A;  5AVC C;  4XUJ C;  5B2J B;  5AV9 D;  4G91 B;  5KDM B;  5JA4 A;  2HIO C;  3MVD D;  3EPJ A;  3REH C;  2HUE B;  4XZQ D;  1P34 C;  1P3K B;  2HIO B;  4Z5T A;  3AZG A;  3W97 B;  4DRB A;  4JJN C;  1HQ3 A;  4WU9 B;  4H9O B;  2Y2O A;  5B0Y B;  4M6B A;  5GT0 B;  3MGQ D;  4UPK A;  5B0Z B;  4JJN B;  3X1S A;  4HGA C;  3AZK A;  4E44 A;  1P3B C;  3W98 C;  1P3I D;  5E5A A;  5DNN A;  5B31 A;  3KUY C;  3C1C C;  3VH5 T;  5GXQ A;  5GSU D;  5CP6 A;  4WU8 C;  5CPK B;  1M19 C;  2G5I C;  3A6N A;  3MGS B;  3AZE B;  5JRG D;  5AV9 C;  3KUY B;  3REL D;  4CSR B;  2BYM A;  3WA9 C;  2UWX A;  4AWL B;  1M19 B;  3MVD C;  3VH6 W;  4ZUX A;  4LD9 B;  3WA9 B;  3X1V C;  3LJA B;  1P3F A;  3NQU B;  3WAA A;  5C3I B;  4Z5T D;  3AZG D;  3X1V B;  1KX3 B;  4E45 A;  5B33 A;  1HQ3 D;  4H9P A;  3KXB B;  3AZL A;  5CPJ B;  1EQZ C;  1S32 C;  1M18 A;  3REI B;  3X1S D;  1JFI B;  3AV2 C;  5B2J A;  5KDM A;  1F1E A;  4NE6 A;  3AV2 B;  5AVC A;  5DNN D;  5B31 D;  1B67 A;  5GXQ D;  2Y2Q A;  5CP6 D;  5JRG C;  1P3K A;  2HIO A;  3A6N D;  4DQY B;  4R8P D;  5G49 B;  3B6F D;  3AV1 B;  3W97 A;  5AV6 C;  1P34 A;  4WU9 A;  1M1A C;  2G5H C;  3R45 B;  1BH9 A;  5GT0 A;  4ZUX D;  4CAY A;  3LZ0 D;  4JJN A;  1M1A B;  1P3F D;  3AZG C;  3WAA D;  1F66 C;  3X1T B;  3W96 B;  2ZY4 A;  5CPI D;  3B0C T;  4EO5 C;  3AZL D;  1F66 B;  1M18 D;  3MGS A;  3AZE A;  5DNM C;  3UTA B;  3VH5 W;  5AV5 B;  3KUY A;  3C1C A;  3AZM C;  4WU8 A;  4CSR A;  4EO5 B;  3MNN C;  1M19 A;  5B2J D;  2VQR A;  5DNM B;  5F99 C;  3EPL A;  5B31 C;  3AZM B;  5GXQ C;  4LD9 A;  5CP6 C;  2IO5 C;  3MNN B;  3AZI B;  1P3A C;  3WA9 A;  3V9R B;  5B24 C;  2CWE A;  4R8P C;  4J8X C;  3B6F C;  3NQU A;  3WTP E;  3AZH C;  2HIO D;  1P3K D;  3X1V A;  1P3A B;  1KX3 A;  3W97 D;  4KHA A;  4J8X B;  1P34 D;  4ZUX C;  4WU9 D;  3LZ0 C;  3KXB A;  5CPJ A;  3AFA C;  2Y2J A;  1P3F C;  5B1M C;  5GT0 D;  1TZY B;  4JJN D;  3REI A;  2ZY5 A;  2F8N G;  3AFA B;  1EQZ A;  1S32 A;  5B1M B;  1U35 B;  5CPI C;  3AV2 A;  2PYO C;  2ZM5 A;  5CPK D;  2CV5 B;  3A1K A;  3MGS D;  3WTP B;  3AZE D;  5G49 A;  3B0B A;  5CHL B;  5B2J C;  3AV1 A;  3KUY D;  3C1C D;  4G91 C;  2PYO B;  4WU8 D;  5JRG A;  1M19 D;  2DQN C;  4H9Q A;  1KX4 B;  2HUE C;  3R45 A;  4LD9 D;  5B32 G;  5AV6 A;  1P3K C;  3LJA D;  1M1A A;  3WA9 D;  1KU5 A;  3W97 C;  3B6G C;  4WU9 C;  3X1V D;  1KX3 D;  5AVB B;  5B0Y C;  2LY8 A;  3REK B;  3W96 A;  5BNX B;  1AOI C;  5GT0 C;  3KXB D;  3B6G B;  5B0Z C;  5CPJ D;  1F66 A;  2RVQ C;  3B0C W;  3REI D;  1AOI B;  1EQZ D;  1S32 D;  3MGP C;  5AV8 B;  1HTA A;  5DNM A;  3AZM A;  3AV2 D;  5CPK C;  3MNN A;  3AZI A;  3MGP B;  3V9R A;  3MGS C;  3AZE C;  5B40 B;  5F99 A;  1R4V A;  1H3O B;  4AWL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...