4XZQD

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqD00
5C3IB 3UT9C 3W96D 4H9RA 3W97A 3C1CA 3AZFA 1M19C 4KUDD 3W96A 5DNNB 4EO5C 3X1SB 4AWLC 3UTAD 2F8NB 2LY8A 3LZ0C 5B24C 5CPIB 3UTAA 5F99C 1KX5D 3REKB 1M1AC 5B1MA 3B0CW 4JJNA 1P3KC 1P3FD 4DRAA 5B40B 5AY8B 1P3OC 1KX5A 1ID3C 5CHLB 3B0DB 5AV5C 3LZ1A 4WU9B 1HTAA 5B2JD 2AROD 2CV5A 1P3AD 4J8XC 3AZKB 3REIB 5BS7A 5GSUB 3RELD 5B31A 1P3AA 4ZUXC 5E5AB 4ZBJB 1A7WA 4NE3A 5B0YB 3RELA 4DRBA 3MNND 3UTBB 1P3GA 4J8VB 3WKJC 4KHAA 5CPKD 3AZLC 1AOIB 2HIOB 5BNVB 5JRGC 4YM6C 3KXBB 4H9OA 4J8WD 3NQJA 5AVCA 4KGCD 5GXQD 3C1BA 1BFMA 5AVBD 5DNMB 2YFVB 1KX4B 5GXQA 1TZYB 5AV9A 2NQBB 5B2IC 3WAAD 3AZHA 4H9PB 2RVQC 5AV5A 3MGQD 3TU4D 4H9RB 3AZFB 3C1CB 1P3ID 3W97B 3W96B 1P3IA 4WU8A 3WTPB 4X23D 2PYOD 4XZQD 5B1MB 1P3PA 4E45A 5G49A 3LELC 4JJNB 4UUZB 5FUGA 4XZQA 4G92C 5BO0A 3LZ1B 3X1UB 5BNXA 4YM6A 3REJB 2CV5B 3X1SD 1ZLAC 5B32A 2F8ND 3AZNC 5CPID 5GT3C 3W99C 3X1SA 5B31B 2F8NA 1P3LC 3REKD 3X1TC 3RELB 5B40D 1P3GB 3O62C 4KHAB 4WZSB 4R8PC 3UT9B 3AV1C 3MGSC 2FJ7C 3AZKD 3REID 5GSUD 4YS3C 3AFAC 4AWLB 3X1VC 3NQJB 5AVCB 5E5AD 3LZ0B 3C1BB 3AZKA 5CPJC 5JA4A 5B0YD 5F99B 5E5AA 1P3BC 1EQZA 1M1AB 4J8VD 1F66C 5AV9B 1AOID 3WA9D 3AZHB 5AV6C 5AV5B 5CP6C 3AN2C 3WA9A 3KXBD 1U35A 3AZJA 2IO5C 3KXBA 1TAFA 5AV8C 3AZNA 2NZDC 4WV4B 5B33A 5B1LC 4WU8B 1KX4D 1HQ3D 1TZYD 3AZEC 2NQBD 3KUYC 2YFVA 2F8NG 4KUDC 1P3PB 5G49B 1HQ3A 5FUGB 5B0ZA 2NQBA 2HUEC 5BO0B 4Z66A 3VH5A 3C1CD 3AZFD 1S32C 1M18C 3AZGC 1P34C 4YM6B 3AV2D 2FJ7A 5B32B 1P3FC 3WTPD 4NFTA 3LJAC 3AV2A 3AZIA 4G91C 5B2JC 5B1MD 1B6WA 1P3BA 4JJND 3WTPA 2AROC 3LZ1D 4UUZA 3X1UD 5CP6A 4XUJD 3REJD 3AYWA 2CV5D 3B6GA 3X1UA 3MNNC 4XUJA 4LD9C 3REJA 5B31D 3REHD 2BYKB 1JFIB 3MGRC 5JA4B 2YFWA 3REHA 1EQZB 1P3GD 4Z5TA 1P3MA 3A6NC 3LELB 4J8WC 3WTPE 3UT9D 4KGCC 1F1EA 4G92B 1S32A 1M18A 1M19D 5AVBC 3WA9B 3UT9A 4H9QA 1P34A 1U35B 1M19A 3AZJB 5AVCD 1TAFB 3WAAC 3VH5T 5B24D 3LZ0D 3C1BD 3AZNB 1KX3C 5B33B 5F99D 1P3LB 3TU4C 1M1AD 3LZ0A 5B24A 1P3KD 5AV9D 5F99A 4H9SC 1HQ3B 1ID3D 3AZHD 1M1AA 5AV5D 5B0ZB 1P3KA 1P3OA 4Z66B 4R8PB 1ID3A 4J8UC 3W98C 4X23C 2PYOC 4LD9A 2FJ7B 3AFAB 3X1VB 4J8XA 4ZUXD 4WU8D 3MGRA 3AV2B 3AZIB 4HGAC 4CAYA 4ZUXA 1P3BB 1P3PD 3KWQC 3WKJD 3A6NA 1F66B 5DNNC 5B31G 3MVDC 3AZMC 3WKJA 5CPIC 5AV6B 5CP6B 3AZLA 4YM6D 3REKC 3AYWB 3B6GB 5B32D 4XUJB 5AY8C 3VH6A 5JRGA 5B40C 3B0DC 5AV8B 4WU9C 3B6FC 4Z2MH 3VH5W 1KU5A 2YFWB 3MGPC 3REHB 1N1JA 3AZEB 4Z5TB 1P3MB 3REIC 5GSUC 2HUEB 4NE5A 5B2IA 4ZBJC 3V9RB 1S32B 1M18B 4J8UA 3AZGB 3UTBC 4H9QB 1P34B 1M19B 2HIOC 3LJAB 4EO5B 1JFIA 2BYKA 1EQZD 4QLCC 5B24B 3LELD 3KWQA 3MVDA 3LELA 3AZMA 1P3KB 1P3OB 5DNMC 1ID3B 1KX4C 1U35D 3AZJD 1TZYC 4LD9B 3AZND 5GT3D 5B33D 4J8XB 1ZLAA 5BT1D 5GT0C 1P3LD 3MGRB 1BH8B 1BH9A 3AZFC 5GT3A 3C1CC 3W97C 3W99A 4CAYB 3VH6T 5B32G 4ZUXB 1P3LA 3W96C 3X1TA 3A6NB 5B0ZD 4Z66D 4R8PD 3O62A 3WKJB 3AZLB 3UTAC 4R8PA 3AV1A 2FJ7D 3AFAD 3X1VD 2L5AA 5JRGB 1KX5C 3MGSA 3AFAA 3LZ1C 3AZID 4YS3A 3X1VA 1KX3B 1P3BD 5CPJA 1F66D 1N1JB 5BS7C 1F66A 4NE6A 5AV6D 5CP6D 5KDMB 1P3AC 5B2IB 3AYWD 4J8UB 3RELC 3B6GD 5AV6A 3W98B 3AN2A 1P3GC 5AV8D 3B0BA 1H3OA 5AV8A 5CPKC 4HGAB 3AZED 2NZDA 3KUYD 5B1LA 1ULYA 4Z5TD 1P3MD 3KWQB 2JSSA 3AZEA 3VH6W 5AVCC 3KUYA 4KUDA 3MVDB 1S32D 3AZMB 3C1BC 1M18D 1WWIA 4CSRB 1Q9CA 3AZGD 3V9RA 1P34D 5GXQC 5AV9C 3AZGA 3AZHC 3LJAD 1ZLAB 1P3FA 3B6FB 1BH9B 3NQUA 5GT3B 3LJAA 3W99B 3MGPB 3MGQC 3X1TB 5B2JA 4M6BA 1P3IC 1P3OD 2AROA 3R45A 3O62B 4WNNA 4WU8C 1R4VA 2BYMA 4LD9D 3AV1B 1P3PC 4J8XD 1B67A 4XZQC 3MNNA 3MGRD 3MGSB 4YS3B 5CPKA 3KSYA 1BH8A 5C3IC 4QLCB 5CPJB 3A6ND 2F8NK 5B32C 4J8WA 3AZLD 3X1SC 4KGCA 5AVBA 5JRGD 3AN2B 1KX3D 2IO5B 5GT0B 3WAAA 1H3OB 2NZDB 1KX3A 5B1LB 3MGQA 3TU4A 4E44A 3KUYB 4KUDB 5B2ID 4H9SA 3AZKC 2RVQD 4J8UD 3W98D 5KDMA 3UTAB 5E5AC 1EQZC 4H9NA 5B0YC 3W98A 4X23A 1KX5B 2PYOA 4J8VC 1P3FB 1AOIC 3WA9C 3NQUB 3KWQD 4G91B 1U35C 5DNND 3AZJC 5B2JB 3KXBC 3MVDD 3AZMD 2AROB 3R45B 5DNNA 5B33C 1P3AB 4WNNB 5BT1C 2F8NH 5CPIA 2BYMB 4CSRA 5AY8D 1HQ3C 3REKA 5B0ZC 4WU9D 3MNNB 1ZLAD 3B6FD 5AY8A 5B40A 2NQBC 4Z66C 3W99D 3MGPD 5CPKB 4WU9A 3B6FA 3X1TD 1WWSA 4H9OB 3MGPA 4Z2MG 3O62D 4J8WB 3AV2C 3REIA 5GSUA 3AZIC 3UTBD 3AV1D 4KGCB 3B0CT 3WTPC 5GXQB 5AVBB 5B0YA 5B1MC 3MGSD 2HIOD 3UTBA 4JJNC 4YS3D 4J8VA 1AOIA 3WAAB 2HIOA 5CPJD 4QLCD 5BNVA 3AYWC 3B6GC 3X1UC 3MGQB 4XUJC 3TU4B 4QLCA 3REJC 2CV5C 1P3IB 5DNMD 5B31C 3REHC 3AN2D 4H9NB 5DNMA 4Z5TC 1P3MC 2CWEA 1KX4A 1TZYA 4X23B 5GT0D 4XZQB 2PYOB 3W97D 2NZDD 4H9PA 5B1LD 5GT0A 5BNXB
chains in the Genus database with same CATH superfamily
5C3IB 3UT9C 3W96D 4H9RA 3W97A 3C1CA 3AZFA 1M19C 4KUDD 3W96A 5DNNB 4EO5C 3X1SB 4AWLC 3UTAD 2F8NB 2LY8A 3LZ0C 5B24C 5CPIB 3UTAA 5F99C 3H0RC 1KX5D 3REKB 1M1AC 5B1MA 3B0CW 4JJNA 1P3KC 1P3FD 4DRAA 5B40B 5AY8B 1P3OC 1KX5A 1ID3C 5CHLB 2Y2NA 3B0DB 5AV5C 3LZ1A 4WU9B 1HTAA 5B2JD 3A1IA 2AROD 2CV5A 1P3AD 4J8XC 3AZKB 3REIB 5BS7A 5GSUB 3RELD 5B31A 1P3AA 4ZUXC 5E5AB 4ZBJB 1A7WA 4NE3A 5B0YB 3RELA 4DRBA 3MNND 3UTBB 1P3GA 4J8VB 3WKJC 4KHAA 5CPKD 3AZLC 1AOIB 2HIOB 5BNVB 5JRGC 4YM6C 3KXBB 4H9OA 4J8WD 3NQJA 5AVCA 4KGCD 5GXQD 3C1BA 1BFMA 5AVBD 5DNMB 2YFVB 1KX4B 2ZY5A 5GXQA 1T3UA 1TZYB 5AV9A 2NQBB 5B2IC 3WAAD 2JE5A 3AZHA 4H9PB 2RVQC 5AV5A 3MGQD 2Y2IA 3TU4D 4H9RB 3AZFB 3C1CB 1P3ID 3W97B 3W96B 1P3IA 4WU8A 3WTPB 4X23D 2PYOD 4XZQD 5B1MB 1P3PA 4E45A 5G49A 3LELC 4JJNB 4UUZB 5FUGA 4XZQA 3AL0C 4G92C 5BO0A 3LZ1B 3X1UB 5BNXA 4YM6A 2W8SA 3REJB 2CV5B 3X1SD 1ZLAC 5B32A 2F8ND 3AZNC 5CPID 5GT3C 3W99C 3X1SA 5B31B 2F8NA 1P3LC 3REKD 3X1TC 3RELB 5B40D 1P3GB 1W2EA 3O62C 2ZM5A 4KHAB 4WZSB 4R8PC 3UT9B 3AV1C 3MGSC 2FJ7C 3AZKD 3REID 5GSUD 4YS3C 3AFAC 4AWLB 3X1VC 3NQJB 5AVCB 5E5AD 3LZ0B 3C1BB 3AZKA 5CPJC 5JA4A 5B0YD 5F99B 5E5AA 1P3BC 1EQZA 1M1AB 4J8VD 1F66C 5AV9B 1AOID 3WA9D 3AZHB 5AV6C 5AV5B 5CP6C 3EPHA 3AN2C 3WA9A 3KXBD 1U35A 3AZJA 2Y2HA 2IO5C 2ZY2A 3KXBA 1TAFA 5AV8C 3AZNA 2NZDC 4WV4B 5B33A 5B1LC 4WU8B 1KX4D 1HQ3D 1TZYD 3AZEC 3A1KA 2NQBD 3KUYC 2YFVA 2F8NG 2G5HC 1P3PB 4KUDC 5G49B 1HQ3A 5FUGB 5B0ZA 2NQBA 2HUEC 4UPKA 5BO0B 4Z66A 3VH5A 2UWXA 3C1CD 3AZFD 1S32C 1M18C 3AZGC 1P34C 4YM6B 3AV2D 2FJ7A 5B32B 1P3FC 3WTPD 4NFTA 3LJAC 3AV2A 3AZIA 3FDDA 4G91C 5B2JC 5B1MD 1B6WA 1P3BA 4JJND 3WTPA 2AROC 3LZ1D 4UUZA 3X1UD 5CP6A 4XUJD 2JCHA 3REJD 3AYWA 2CV5D 3B6GA 3X1UA 3MNNC 4XUJA 4LD9C 3REJA 5B31D 3REHD 2BYKB 1JFIB 3MGRC 5JA4B 2YFWA 3REHA 1EQZB 1P3GD 4Z5TA 1P3MA 3A6NC 3LELB 4J8WC 3WTPE 3UT9D 4KGCC 1F1EA 4G92B 1S32A 1M18A 1M19D 3IP4C 5AVBC 3WA9B 3UT9A 4H9QA 1P34A 1U35B 1M19A 3AZJB 5AVCD 1TAFB 2Y2JA 3WAAC 3VH5T 5B24D 3LZ0D 3EPKA 3C1BD 3AZNB 1KX3C 5B33B 5F99D 1P3LB 3TU4C 1M1AD 3LZ0A 5B24A 1P3KD 5AV9D 5F99A 4H9SC 1HQ3B 1ID3D 3AZHD 1M1AA 5AV5D 5B0ZB 1P3KA 1P3OA 4Z66B 4R8PB 1ID3A 3EG5B 4J8UC 3W98C 4X23C 2PYOC 4LD9A 2FJ7B 3AFAB 3X1VB 3H0LC 4J8XA 4ZUXD 4WU8D 2Y2MA 2RIQA 3MGRA 3AV2B 3AZIB 4HGAC 4CAYA 4ZUXA 1P3BB 1P3PD 3KWQC 3WKJD 3A6NA 1F66B 5DNNC 5B31G 3MVDC 3AZMC 3WKJA 5CPIC 5AV6B 5CP6B 3AZLA 2Y2OA 4YM6D 3REKC 3AYWB 3B6GB 5B32D 4XUJB 5AY8C 3VH6A 5JRGA 5B40C 3B0DC 5AV8B 4WU9C 3B6FC 2Y2KA 4Z2MH 3VH5W 1KU5A 2YFWB 3MGPC 3REHB 1N1JA 3AZEB 4Z5TB 1P3MB 3REIC 5GSUC 2HUEB 4NE5A 5B2IA 4ZBJC 3V9RB 1S32B 1M18B 4J8UA 3AZGB 3UTBC 4H9QB 1P34B 3F6TA 1M19B 2HIOC 3LJAB 4EO5B 1JFIA 2BYKA 1EQZD 4QLCC 5B24B 3LELD 3KWQA 1Z2CB 3MVDA 3LELA 3AZMA 1P3KB 1P3OB 5DNMC 1ID3B 1KX4C 1U35D 3AZJD 1TZYC 4LD9B 3AZND 1PZRA 5GT3D 2VQRA 5B33D 4J8XB 1ZLAA 5BT1D 5GT0C 1P3LD 3MGRB 1BH8B 1BH9A 3AZFC 5GT3A 3C1CC 3W97C 3W99A 4CAYB 3VH6T 5B32G 4ZUXB 2Y2QA 1P3LA 3W96C 3X1TA 3A6NB 5B0ZD 4Z66D 4R8PD 3O62A 3WKJB 3AZLB 3UTAC 4R8PA 3AV1A 2FJ7D 3AFAD 3X1VD 2L5AA 5JRGB 1KX5C 3MGSA 3AFAA 3LZ1C 3AZID 4YS3A 3X1VA 1KX3B 1P3BD 5CPJA 1F66D 1N1JB 5BS7C 1F66A 4NE6A 5AV6D 5CP6D 5KDMB 1P3AC 5B2IB 3AYWD 4J8UB 3RELC 3B6GD 5AV6A 3W98B 4DQYB 3AN2A 1P3GC 5AV8D 3B0BA 1H3OA 5AV8A 5CPKC 4HGAB 3AZED 2NZDA 2Y2GA 5B1LA 1ULYA 4Z5TD 3KUYD 1P3MD 3EPJA 3KWQB 2DQNC 2JSSA 3AZEA 3VH6W 5AVCC 2Y2LA 3KUYA 2F2AC 3MVDB 4KUDA 1S32D 3AZMB 3C1BC 1M18D 1WWIA 4CSRB 1Q9CA 3AZGD 3V9RA 1P34D 5GXQC 3H0MC 5AV9C 3AZGA 3AZHC 3LJAD 1ZLAB 1P3FA 3B6FB 1BH9B 2XD5A 3NQUA 5GT3B 3LJAA 3W99B 3MGPB 3MGQC 3X1TB 5B2JA 4M6BA 1P3IC 1P3OD 2AROA 3R45A 3O62B 4WNNA 4WU8C 1R4VA 3KFUG 2G5IC 2BYMA 4LD9D 3AV1B 1P3PC 4J8XD 1B67A 4XZQC 3MNNA 3MGRD 3MGSB 4YS3B 4WJ3C 5CPKA 3KSYA 3EPLA 1BH8A 5C3IC 4QLCB 5CPJB 3A6ND 2F8NK 5B32C 4J8WA 3AZLD 3X1SC 2FFFB 4KGCA 2J8PA 5AVBA 5JRGD 3AN2B 2DF4C 1KX3D 2IO5B 5GT0B 3WAAA 1H3OB 2ZY3A 2XD1A 2NZDB 1KX3A 5B1LB 3MGQA 3TU4A 4E44A 3KUYB 4KUDB 5B2ID 4H9SA 3AZKC 2RVQD 4J8UD 3W98D 5KDMA 3UTAB 5E5AC 1EQZC 4H9NA 5B0YC 3W98A 4X23A 1KX5B 2PYOA 4J8VC 1P3FB 1AOIC 3WA9C 3NQUB 3KWQD 4G91B 1U35C 5DNND 3AZJC 5B2JB 3KXBC 3MVDD 3AZMD 2AROB 2BG1A 3R45B 5DNNA 5B33C 1P3AB 4WNNB 5BT1C 2F8NH 5CPIA 2BYMB 4CSRA 5AY8D 1HQ3C 3REKA 5B0ZC 4WU9D 3MNNB 1ZLAD 3B6FD 5AY8A 5B40A 2NQBC 4Z66C 3P5JB 3W99D 3MGPD 5CPKB 4WU9A 3B6FA 3X1TD 1WWSA 4H9OB 3MGPA 4Z2MG 3O62D 4J8WB 3AV2C 3REIA 5GSUA 3AZIC 3UTBD 3AV1D 4KGCB 3B0CT 3WTPC 5GXQB 5AVBB 5B0YA 5B1MC 3MGSD 2HIOD 3UTBA 4JJNC 4YS3D 4J8VA 1AOIA 3WAAB 2HIOA 5CPJD 4QLCD 5BNVA 3AYWC 3B6GC 3X1UC 3MGQB 4XUJC 3TU4B 4QLCA 3REJC 2CV5C 1P3IB 2ZY4A 5DNMD 5B31C 3REHC 3AN2D 4H9NB 5DNMA 2Y2PA 4Z5TC 1P3MC 2CWEA 1KX4A 1TZYA 4X23B 5GT0D 4XZQB 2PYOB 3W97D 2NZDD 4H9PA 5B1LD 5GT0A 5BNXB
chains in the Genus database with same CATH topology
5C3IB 3UT9C 3W96D 4H9RA 3W97A 3C1CA 3AZFA 1M19C 4KUDD 3W96A 5DNNB 4EO5C 3X1SB 4AWLC 3UTAD 2F8NB 2LY8A 3LZ0C 5B24C 5CPIB 3UTAA 5F99C 3H0RC 1KX5D 3REKB 1M1AC 5B1MA 3B0CW 4JJNA 1P3KC 1P3FD 4DRAA 5B40B 5AY8B 1P3OC 1KX5A 1ID3C 5CHLB 2Y2NA 3B0DB 5AV5C 3LZ1A 4WU9B 1HTAA 5B2JD 3A1IA 2AROD 2CV5A 1P3AD 4J8XC 3AZKB 3REIB 5BS7A 5GSUB 3RELD 5B31A 1P3AA 4ZUXC 5E5AB 4ZBJB 1A7WA 4NE3A 5B0YB 3RELA 4DRBA 3MNND 3UTBB 1P3GA 4J8VB 3WKJC 4KHAA 5CPKD 3AZLC 1AOIB 2HIOB 5BNVB 5JRGC 4YM6C 3KXBB 4H9OA 4J8WD 3NQJA 5AVCA 4KGCD 5GXQD 3C1BA 1BFMA 5AVBD 5DNMB 2YFVB 1KX4B 2ZY5A 5GXQA 1T3UA 1TZYB 5AV9A 2NQBB 5B2IC 3WAAD 2JE5A 3AZHA 4H9PB 2RVQC 5AV5A 3MGQD 2Y2IA 3TU4D 4H9RB 3AZFB 3C1CB 1P3ID 3W97B 3W96B 1P3IA 4WU8A 3WTPB 4X23D 2PYOD 4XZQD 5B1MB 1P3PA 4E45A 5G49A 3LELC 4JJNB 4UUZB 5FUGA 4XZQA 3AL0C 4G92C 5BO0A 3LZ1B 3X1UB 5BNXA 4YM6A 2W8SA 3REJB 2CV5B 3X1SD 1ZLAC 5B32A 2F8ND 3AZNC 5CPID 5GT3C 3W99C 3X1SA 5B31B 2F8NA 1P3LC 3REKD 3X1TC 3RELB 5B40D 1P3GB 1W2EA 3O62C 2ZM5A 4KHAB 4WZSB 4R8PC 3UT9B 3AV1C 3MGSC 2FJ7C 3AZKD 3REID 5GSUD 4YS3C 3AFAC 4AWLB 3X1VC 3NQJB 5AVCB 5E5AD 3LZ0B 3C1BB 3AZKA 5CPJC 5JA4A 5B0YD 5F99B 5E5AA 1P3BC 1EQZA 1M1AB 4J8VD 1F66C 5AV9B 1AOID 3WA9D 3AZHB 5AV6C 5AV5B 5CP6C 3EPHA 3AN2C 3WA9A 3KXBD 1U35A 3AZJA 2Y2HA 2IO5C 2ZY2A 3KXBA 1TAFA 5AV8C 3AZNA 2NZDC 4WV4B 5B33A 5B1LC 4WU8B 1KX4D 1HQ3D 1TZYD 3AZEC 3A1KA 2NQBD 3KUYC 2YFVA 2F8NG 2G5HC 1P3PB 4KUDC 5G49B 1HQ3A 5FUGB 5B0ZA 2NQBA 2HUEC 4UPKA 5BO0B 4Z66A 3VH5A 2UWXA 3C1CD 3AZFD 1S32C 1M18C 3AZGC 1P34C 4YM6B 3AV2D 2FJ7A 5B32B 1P3FC 3WTPD 4NFTA 3LJAC 3AV2A 3AZIA 3FDDA 4G91C 5B2JC 5B1MD 1B6WA 1P3BA 4JJND 3WTPA 2AROC 3LZ1D 4UUZA 3X1UD 5CP6A 4XUJD 2JCHA 3REJD 3AYWA 2CV5D 3B6GA 3X1UA 3MNNC 4XUJA 4LD9C 3REJA 5B31D 3REHD 2BYKB 1JFIB 3MGRC 5JA4B 2YFWA 3REHA 1EQZB 1P3GD 4Z5TA 1P3MA 3A6NC 3LELB 4J8WC 3WTPE 3UT9D 4KGCC 1F1EA 4G92B 1S32A 1M18A 1M19D 3IP4C 5AVBC 3WA9B 3UT9A 4H9QA 1P34A 1U35B 1M19A 3AZJB 5AVCD 1TAFB 2Y2JA 3WAAC 3VH5T 5B24D 3LZ0D 3EPKA 3C1BD 3AZNB 1KX3C 5B33B 5F99D 1P3LB 3TU4C 1M1AD 3LZ0A 5B24A 1P3KD 5AV9D 5F99A 4H9SC 1HQ3B 1ID3D 3AZHD 1M1AA 5AV5D 5B0ZB 1P3KA 1P3OA 4Z66B 4R8PB 1ID3A 3EG5B 4J8UC 3W98C 4X23C 2PYOC 4LD9A 2FJ7B 3AFAB 3X1VB 3H0LC 4J8XA 4ZUXD 4WU8D 2Y2MA 2RIQA 3MGRA 3AV2B 3AZIB 4HGAC 4CAYA 4ZUXA 1P3BB 1P3PD 3KWQC 3WKJD 3A6NA 1F66B 5DNNC 5B31G 3MVDC 3AZMC 3WKJA 5CPIC 5AV6B 5CP6B 3AZLA 2Y2OA 4YM6D 3REKC 3AYWB 3B6GB 5B32D 4XUJB 5AY8C 3VH6A 5JRGA 5B40C 3B0DC 5AV8B 4WU9C 3B6FC 2Y2KA 4Z2MH 3VH5W 1KU5A 2YFWB 3MGPC 3REHB 1N1JA 3AZEB 4Z5TB 1P3MB 3REIC 5GSUC 2HUEB 4NE5A 5B2IA 4ZBJC 3V9RB 1S32B 1M18B 4J8UA 3AZGB 3UTBC 4H9QB 1P34B 3F6TA 1M19B 2HIOC 3LJAB 4EO5B 1JFIA 2BYKA 1EQZD 4QLCC 5B24B 3LELD 3KWQA 1Z2CB 3MVDA 3LELA 3AZMA 1P3KB 1P3OB 5DNMC 1ID3B 1KX4C 1U35D 3AZJD 1TZYC 4LD9B 3AZND 1PZRA 5GT3D 2VQRA 5B33D 4J8XB 1ZLAA 5BT1D 5GT0C 1P3LD 3MGRB 1BH8B 1BH9A 3AZFC 5GT3A 3C1CC 3W97C 3W99A 4CAYB 3VH6T 5B32G 4ZUXB 2Y2QA 1P3LA 3W96C 3X1TA 3A6NB 5B0ZD 4Z66D 4R8PD 3O62A 3WKJB 3AZLB 3UTAC 4R8PA 3AV1A 2FJ7D 3AFAD 3X1VD 2L5AA 5JRGB 1KX5C 3MGSA 3AFAA 3LZ1C 3AZID 4YS3A 3X1VA 1KX3B 1P3BD 5CPJA 1F66D 1N1JB 5BS7C 1F66A 4NE6A 5AV6D 5CP6D 5KDMB 1P3AC 5B2IB 3AYWD 4J8UB 3RELC 3B6GD 5AV6A 3W98B 4DQYB 3AN2A 1P3GC 5AV8D 3B0BA 1H3OA 5AV8A 5CPKC 4HGAB 3AZED 2NZDA 2Y2GA 5B1LA 1ULYA 4Z5TD 3KUYD 1P3MD 3EPJA 3KWQB 2DQNC 2JSSA 3AZEA 3VH6W 5AVCC 2Y2LA 3KUYA 2F2AC 3MVDB 4KUDA 1S32D 3AZMB 3C1BC 1M18D 1WWIA 4CSRB 1Q9CA 3AZGD 3V9RA 1P34D 5GXQC 3H0MC 5AV9C 3AZGA 3AZHC 3LJAD 1ZLAB 1P3FA 3B6FB 1BH9B 2XD5A 3NQUA 5GT3B 3LJAA 3W99B 3MGPB 3MGQC 3X1TB 5B2JA 4M6BA 1P3IC 1P3OD 2AROA 3R45A 3O62B 4WNNA 4WU8C 1R4VA 3KFUG 2G5IC 2BYMA 4LD9D 3AV1B 1P3PC 4J8XD 1B67A 4XZQC 3MNNA 3MGRD 3MGSB 4YS3B 4WJ3C 5CPKA 3KSYA 3EPLA 1BH8A 5C3IC 4QLCB 5CPJB 3A6ND 2F8NK 5B32C 4J8WA 3AZLD 3X1SC 2FFFB 4KGCA 2J8PA 5AVBA 5JRGD 3AN2B 2DF4C 1KX3D 2IO5B 5GT0B 3WAAA 1H3OB 2ZY3A 2XD1A 2NZDB 1KX3A 5B1LB 3MGQA 3TU4A 4E44A 3KUYB 4KUDB 5B2ID 4H9SA 3AZKC 2RVQD 4J8UD 3W98D 5KDMA 3UTAB 5E5AC 1EQZC 4H9NA 5B0YC 3W98A 4X23A 1KX5B 2PYOA 4J8VC 1P3FB 1AOIC 3WA9C 3NQUB 3KWQD 4G91B 1U35C 5DNND 3AZJC 5B2JB 3KXBC 3MVDD 3AZMD 2AROB 2BG1A 3R45B 5DNNA 5B33C 1P3AB 4WNNB 5BT1C 2F8NH 5CPIA 2BYMB 4CSRA 5AY8D 1HQ3C 3REKA 5B0ZC 4WU9D 3MNNB 1ZLAD 3B6FD 5AY8A 5B40A 2NQBC 4Z66C 3P5JB 3W99D 3MGPD 5CPKB 4WU9A 3B6FA 3X1TD 1WWSA 4H9OB 3MGPA 4Z2MG 3O62D 4J8WB 3AV2C 3REIA 5GSUA 3AZIC 3UTBD 3AV1D 4KGCB 3B0CT 3WTPC 5GXQB 5AVBB 5B0YA 5B1MC 3MGSD 2HIOD 3UTBA 4JJNC 4YS3D 4J8VA 1AOIA 3WAAB 2HIOA 5CPJD 4QLCD 5BNVA 3AYWC 3B6GC 3X1UC 3MGQB 4XUJC 3TU4B 4QLCA 3REJC 2CV5C 1P3IB 2ZY4A 5DNMD 5B31C 3REHC 3AN2D 4H9NB 5DNMA 2Y2PA 4Z5TC 1P3MC 2CWEA 1KX4A 1TZYA 4X23B 5GT0D 4XZQB 2PYOB 3W97D 2NZDD 4H9PA 5B1LD 5GT0A 5BNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I B;  3UT9 C;  3W96 D;  4H9R A;  3W97 A;  3C1C A;  3AZF A;  1M19 C;  4KUD D;  3W96 A;  5DNN B;  4EO5 C;  3X1S B;  4AWL C;  3UTA D;  2F8N B;  2LY8 A;  3LZ0 C;  5B24 C;  5CPI B;  3UTA A;  5F99 C;  1KX5 D;  3REK B;  1M1A C;  5B1M A;  3B0C W;  4JJN A;  1P3K C;  1P3F D;  4DRA A;  5B40 B;  5AY8 B;  1P3O C;  1KX5 A;  1ID3 C;  5CHL B;  3B0D B;  5AV5 C;  3LZ1 A;  4WU9 B;  1HTA A;  5B2J D;  2ARO D;  2CV5 A;  1P3A D;  4J8X C;  3AZK B;  3REI B;  5BS7 A;  5GSU B;  3REL D;  5B31 A;  1P3A A;  4ZUX C;  5E5A B;  4ZBJ B;  1A7W A;  4NE3 A;  5B0Y B;  3REL A;  4DRB A;  3MNN D;  3UTB B;  1P3G A;  4J8V B;  3WKJ C;  4KHA A;  5CPK D;  3AZL C;  1AOI B;  2HIO B;  5BNV B;  5JRG C;  4YM6 C;  3KXB B;  4H9O A;  4J8W D;  3NQJ A;  5AVC A;  4KGC D;  5GXQ D;  3C1B A;  1BFM A;  5AVB D;  5DNM B;  2YFV B;  1KX4 B;  5GXQ A;  1TZY B;  5AV9 A;  2NQB B;  5B2I C;  3WAA D;  3AZH A;  4H9P B;  2RVQ C;  5AV5 A;  3MGQ D;  3TU4 D;  4H9R B;  3AZF B;  3C1C B;  1P3I D;  3W97 B;  3W96 B;  1P3I A;  4WU8 A;  3WTP B;  4X23 D;  2PYO D;  4XZQ D;  5B1M B;  1P3P A;  4E45 A;  5G49 A;  3LEL C;  4JJN B;  4UUZ B;  5FUG A;  4XZQ A;  4G92 C;  5BO0 A;  3LZ1 B;  3X1U B;  5BNX A;  4YM6 A;  3REJ B;  2CV5 B;  3X1S D;  1ZLA C;  5B32 A;  2F8N D;  3AZN C;  5CPI D;  5GT3 C;  3W99 C;  3X1S A;  5B31 B;  2F8N A;  1P3L C;  3REK D;  3X1T C;  3REL B;  5B40 D;  1P3G B;  3O62 C;  4KHA B;  4WZS B;  4R8P C;  3UT9 B;  3AV1 C;  3MGS C;  2FJ7 C;  3AZK D;  3REI D;  5GSU D;  4YS3 C;  3AFA C;  4AWL B;  3X1V C;  3NQJ B;  5AVC B;  5E5A D;  3LZ0 B;  3C1B B;  3AZK A;  5CPJ C;  5JA4 A;  5B0Y D;  5F99 B;  5E5A A;  1P3B C;  1EQZ A;  1M1A B;  4J8V D;  1F66 C;  5AV9 B;  1AOI D;  3WA9 D;  3AZH B;  5AV6 C;  5AV5 B;  5CP6 C;  3AN2 C;  3WA9 A;  3KXB D;  1U35 A;  3AZJ A;  2IO5 C;  3KXB A;  1TAF A;  5AV8 C;  3AZN A;  2NZD C;  4WV4 B;  5B33 A;  5B1L C;  4WU8 B;  1KX4 D;  1HQ3 D;  1TZY D;  3AZE C;  2NQB D;  3KUY C;  2YFV A;  2F8N G;  4KUD C;  1P3P B;  5G49 B;  1HQ3 A;  5FUG B;  5B0Z A;  2NQB A;  2HUE C;  5BO0 B;  4Z66 A;  3VH5 A;  3C1C D;  3AZF D;  1S32 C;  1M18 C;  3AZG C;  1P34 C;  4YM6 B;  3AV2 D;  2FJ7 A;  5B32 B;  1P3F C;  3WTP D;  4NFT A;  3LJA C;  3AV2 A;  3AZI A;  4G91 C;  5B2J C;  5B1M D;  1B6W A;  1P3B A;  4JJN D;  3WTP A;  2ARO C;  3LZ1 D;  4UUZ A;  3X1U D;  5CP6 A;  4XUJ D;  3REJ D;  3AYW A;  2CV5 D;  3B6G A;  3X1U A;  3MNN C;  4XUJ A;  4LD9 C;  3REJ A;  5B31 D;  3REH D;  2BYK B;  1JFI B;  3MGR C;  5JA4 B;  2YFW A;  3REH A;  1EQZ B;  1P3G D;  4Z5T A;  1P3M A;  3A6N C;  3LEL B;  4J8W C;  3WTP E;  3UT9 D;  4KGC C;  1F1E A;  4G92 B;  1S32 A;  1M18 A;  1M19 D;  5AVB C;  3WA9 B;  3UT9 A;  4H9Q A;  1P34 A;  1U35 B;  1M19 A;  3AZJ B;  5AVC D;  1TAF B;  3WAA C;  3VH5 T;  5B24 D;  3LZ0 D;  3C1B D;  3AZN B;  1KX3 C;  5B33 B;  5F99 D;  1P3L B;  3TU4 C;  1M1A D;  3LZ0 A;  5B24 A;  1P3K D;  5AV9 D;  5F99 A;  4H9S C;  1HQ3 B;  1ID3 D;  3AZH D;  1M1A A;  5AV5 D;  5B0Z B;  1P3K A;  1P3O A;  4Z66 B;  4R8P B;  1ID3 A;  4J8U C;  3W98 C;  4X23 C;  2PYO C;  4LD9 A;  2FJ7 B;  3AFA B;  3X1V B;  4J8X A;  4ZUX D;  4WU8 D;  3MGR A;  3AV2 B;  3AZI B;  4HGA C;  4CAY A;  4ZUX A;  1P3B B;  1P3P D;  3KWQ C;  3WKJ D;  3A6N A;  1F66 B;  5DNN C;  5B31 G;  3MVD C;  3AZM C;  3WKJ A;  5CPI C;  5AV6 B;  5CP6 B;  3AZL A;  4YM6 D;  3REK C;  3AYW B;  3B6G B;  5B32 D;  4XUJ B;  5AY8 C;  3VH6 A;  5JRG A;  5B40 C;  3B0D C;  5AV8 B;  4WU9 C;  3B6F C;  4Z2M H;  3VH5 W;  1KU5 A;  2YFW B;  3MGP C;  3REH B;  1N1J A;  3AZE B;  4Z5T B;  1P3M B;  3REI C;  5GSU C;  2HUE B;  4NE5 A;  5B2I A;  4ZBJ C;  3V9R B;  1S32 B;  1M18 B;  4J8U A;  3AZG B;  3UTB C;  4H9Q B;  1P34 B;  1M19 B;  2HIO C;  3LJA B;  4EO5 B;  1JFI A;  2BYK A;  1EQZ D;  4QLC C;  5B24 B;  3LEL D;  3KWQ A;  3MVD A;  3LEL A;  3AZM A;  1P3K B;  1P3O B;  5DNM C;  1ID3 B;  1KX4 C;  1U35 D;  3AZJ D;  1TZY C;  4LD9 B;  3AZN D;  5GT3 D;  5B33 D;  4J8X B;  1ZLA A;  5BT1 D;  5GT0 C;  1P3L D;  3MGR B;  1BH8 B;  1BH9 A;  3AZF C;  5GT3 A;  3C1C C;  3W97 C;  3W99 A;  4CAY B;  3VH6 T;  5B32 G;  4ZUX B;  1P3L A;  3W96 C;  3X1T A;  3A6N B;  5B0Z D;  4Z66 D;  4R8P D;  3O62 A;  3WKJ B;  3AZL B;  3UTA C;  4R8P A;  3AV1 A;  2FJ7 D;  3AFA D;  3X1V D;  2L5A A;  5JRG B;  1KX5 C;  3MGS A;  3AFA A;  3LZ1 C;  3AZI D;  4YS3 A;  3X1V A;  1KX3 B;  1P3B D;  5CPJ A;  1F66 D;  1N1J B;  5BS7 C;  1F66 A;  4NE6 A;  5AV6 D;  5CP6 D;  5KDM B;  1P3A C;  5B2I B;  3AYW D;  4J8U B;  3REL C;  3B6G D;  5AV6 A;  3W98 B;  3AN2 A;  1P3G C;  5AV8 D;  3B0B A;  1H3O A;  5AV8 A;  5CPK C;  4HGA B;  3AZE D;  2NZD A;  3KUY D;  5B1L A;  1ULY A;  4Z5T D;  1P3M D;  3KWQ B;  2JSS A;  3AZE A;  3VH6 W;  5AVC C;  3KUY A;  4KUD A;  3MVD B;  1S32 D;  3AZM B;  3C1B C;  1M18 D;  1WWI A;  4CSR B;  1Q9C A;  3AZG D;  3V9R A;  1P34 D;  5GXQ C;  5AV9 C;  3AZG A;  3AZH C;  3LJA D;  1ZLA B;  1P3F A;  3B6F B;  1BH9 B;  3NQU A;  5GT3 B;  3LJA A;  3W99 B;  3MGP B;  3MGQ C;  3X1T B;  5B2J A;  4M6B A;  1P3I C;  1P3O D;  2ARO A;  3R45 A;  3O62 B;  4WNN A;  4WU8 C;  1R4V A;  2BYM A;  4LD9 D;  3AV1 B;  1P3P C;  4J8X D;  1B67 A;  4XZQ C;  3MNN A;  3MGR D;  3MGS B;  4YS3 B;  5CPK A;  3KSY A;  1BH8 A;  5C3I C;  4QLC B;  5CPJ B;  3A6N D;  2F8N K;  5B32 C;  4J8W A;  3AZL D;  3X1S C;  4KGC A;  5AVB A;  5JRG D;  3AN2 B;  1KX3 D;  2IO5 B;  5GT0 B;  3WAA A;  1H3O B;  2NZD B;  1KX3 A;  5B1L B;  3MGQ A;  3TU4 A;  4E44 A;  3KUY B;  4KUD B;  5B2I D;  4H9S A;  3AZK C;  2RVQ D;  4J8U D;  3W98 D;  5KDM A;  3UTA B;  5E5A C;  1EQZ C;  4H9N A;  5B0Y C;  3W98 A;  4X23 A;  1KX5 B;  2PYO A;  4J8V C;  1P3F B;  1AOI C;  3WA9 C;  3NQU B;  3KWQ D;  4G91 B;  1U35 C;  5DNN D;  3AZJ C;  5B2J B;  3KXB C;  3MVD D;  3AZM D;  2ARO B;  3R45 B;  5DNN A;  5B33 C;  1P3A B;  4WNN B;  5BT1 C;  2F8N H;  5CPI A;  2BYM B;  4CSR A;  5AY8 D;  1HQ3 C;  3REK A;  5B0Z C;  4WU9 D;  3MNN B;  1ZLA D;  3B6F D;  5AY8 A;  5B40 A;  2NQB C;  4Z66 C;  3W99 D;  3MGP D;  5CPK B;  4WU9 A;  3B6F A;  3X1T D;  1WWS A;  4H9O B;  3MGP A;  4Z2M G;  3O62 D;  4J8W B;  3AV2 C;  3REI A;  5GSU A;  3AZI C;  3UTB D;  3AV1 D;  4KGC B;  3B0C T;  3WTP C;  5GXQ B;  5AVB B;  5B0Y A;  5B1M C;  3MGS D;  2HIO D;  3UTB A;  4JJN C;  4YS3 D;  4J8V A;  1AOI A;  3WAA B;  2HIO A;  5CPJ D;  4QLC D;  5BNV A;  3AYW C;  3B6G C;  3X1U C;  3MGQ B;  4XUJ C;  3TU4 B;  4QLC A;  3REJ C;  2CV5 C;  1P3I B;  5DNM D;  5B31 C;  3REH C;  3AN2 D;  4H9N B;  5DNM A;  4Z5T C;  1P3M C;  2CWE A;  1KX4 A;  1TZY A;  4X23 B;  5GT0 D;  4XZQ B;  2PYO B;  3W97 D;  2NZD D;  4H9P A;  5B1L D;  5GT0 A;  5BNX B; 
#chains in the Genus database with same CATH topology
 5C3I B;  3UT9 C;  3W96 D;  4H9R A;  3W97 A;  3C1C A;  3AZF A;  1M19 C;  4KUD D;  3W96 A;  5DNN B;  4EO5 C;  3X1S B;  4AWL C;  3UTA D;  2F8N B;  2LY8 A;  3LZ0 C;  5B24 C;  5CPI B;  3UTA A;  5F99 C;  3H0R C;  1KX5 D;  3REK B;  1M1A C;  5B1M A;  3B0C W;  4JJN A;  1P3K C;  1P3F D;  4DRA A;  5B40 B;  5AY8 B;  1P3O C;  1KX5 A;  1ID3 C;  5CHL B;  2Y2N A;  3B0D B;  5AV5 C;  3LZ1 A;  4WU9 B;  1HTA A;  5B2J D;  3A1I A;  2ARO D;  2CV5 A;  1P3A D;  4J8X C;  3AZK B;  3REI B;  5BS7 A;  5GSU B;  3REL D;  5B31 A;  1P3A A;  4ZUX C;  5E5A B;  4ZBJ B;  1A7W A;  4NE3 A;  5B0Y B;  3REL A;  4DRB A;  3MNN D;  3UTB B;  1P3G A;  4J8V B;  3WKJ C;  4KHA A;  5CPK D;  3AZL C;  1AOI B;  2HIO B;  5BNV B;  5JRG C;  4YM6 C;  3KXB B;  4H9O A;  4J8W D;  3NQJ A;  5AVC A;  4KGC D;  5GXQ D;  3C1B A;  1BFM A;  5AVB D;  5DNM B;  2YFV B;  1KX4 B;  2ZY5 A;  5GXQ A;  1T3U A;  1TZY B;  5AV9 A;  2NQB B;  5B2I C;  3WAA D;  2JE5 A;  3AZH A;  4H9P B;  2RVQ C;  5AV5 A;  3MGQ D;  2Y2I A;  3TU4 D;  4H9R B;  3AZF B;  3C1C B;  1P3I D;  3W97 B;  3W96 B;  1P3I A;  4WU8 A;  3WTP B;  4X23 D;  2PYO D;  4XZQ D;  5B1M B;  1P3P A;  4E45 A;  5G49 A;  3LEL C;  4JJN B;  4UUZ B;  5FUG A;  4XZQ A;  3AL0 C;  4G92 C;  5BO0 A;  3LZ1 B;  3X1U B;  5BNX A;  4YM6 A;  2W8S A;  3REJ B;  2CV5 B;  3X1S D;  1ZLA C;  5B32 A;  2F8N D;  3AZN C;  5CPI D;  5GT3 C;  3W99 C;  3X1S A;  5B31 B;  2F8N A;  1P3L C;  3REK D;  3X1T C;  3REL B;  5B40 D;  1P3G B;  1W2E A;  3O62 C;  2ZM5 A;  4KHA B;  4WZS B;  4R8P C;  3UT9 B;  3AV1 C;  3MGS C;  2FJ7 C;  3AZK D;  3REI D;  5GSU D;  4YS3 C;  3AFA C;  4AWL B;  3X1V C;  3NQJ B;  5AVC B;  5E5A D;  3LZ0 B;  3C1B B;  3AZK A;  5CPJ C;  5JA4 A;  5B0Y D;  5F99 B;  5E5A A;  1P3B C;  1EQZ A;  1M1A B;  4J8V D;  1F66 C;  5AV9 B;  1AOI D;  3WA9 D;  3AZH B;  5AV6 C;  5AV5 B;  5CP6 C;  3EPH A;  3AN2 C;  3WA9 A;  3KXB D;  1U35 A;  3AZJ A;  2Y2H A;  2IO5 C;  2ZY2 A;  3KXB A;  1TAF A;  5AV8 C;  3AZN A;  2NZD C;  4WV4 B;  5B33 A;  5B1L C;  4WU8 B;  1KX4 D;  1HQ3 D;  1TZY D;  3AZE C;  3A1K A;  2NQB D;  3KUY C;  2YFV A;  2F8N G;  2G5H C;  1P3P B;  4KUD C;  5G49 B;  1HQ3 A;  5FUG B;  5B0Z A;  2NQB A;  2HUE C;  4UPK A;  5BO0 B;  4Z66 A;  3VH5 A;  2UWX A;  3C1C D;  3AZF D;  1S32 C;  1M18 C;  3AZG C;  1P34 C;  4YM6 B;  3AV2 D;  2FJ7 A;  5B32 B;  1P3F C;  3WTP D;  4NFT A;  3LJA C;  3AV2 A;  3AZI A;  3FDD A;  4G91 C;  5B2J C;  5B1M D;  1B6W A;  1P3B A;  4JJN D;  3WTP A;  2ARO C;  3LZ1 D;  4UUZ A;  3X1U D;  5CP6 A;  4XUJ D;  2JCH A;  3REJ D;  3AYW A;  2CV5 D;  3B6G A;  3X1U A;  3MNN C;  4XUJ A;  4LD9 C;  3REJ A;  5B31 D;  3REH D;  2BYK B;  1JFI B;  3MGR C;  5JA4 B;  2YFW A;  3REH A;  1EQZ B;  1P3G D;  4Z5T A;  1P3M A;  3A6N C;  3LEL B;  4J8W C;  3WTP E;  3UT9 D;  4KGC C;  1F1E A;  4G92 B;  1S32 A;  1M18 A;  1M19 D;  3IP4 C;  5AVB C;  3WA9 B;  3UT9 A;  4H9Q A;  1P34 A;  1U35 B;  1M19 A;  3AZJ B;  5AVC D;  1TAF B;  2Y2J A;  3WAA C;  3VH5 T;  5B24 D;  3LZ0 D;  3EPK A;  3C1B D;  3AZN B;  1KX3 C;  5B33 B;  5F99 D;  1P3L B;  3TU4 C;  1M1A D;  3LZ0 A;  5B24 A;  1P3K D;  5AV9 D;  5F99 A;  4H9S C;  1HQ3 B;  1ID3 D;  3AZH D;  1M1A A;  5AV5 D;  5B0Z B;  1P3K A;  1P3O A;  4Z66 B;  4R8P B;  1ID3 A;  3EG5 B;  4J8U C;  3W98 C;  4X23 C;  2PYO C;  4LD9 A;  2FJ7 B;  3AFA B;  3X1V B;  3H0L C;  4J8X A;  4ZUX D;  4WU8 D;  2Y2M A;  2RIQ A;  3MGR A;  3AV2 B;  3AZI B;  4HGA C;  4CAY A;  4ZUX A;  1P3B B;  1P3P D;  3KWQ C;  3WKJ D;  3A6N A;  1F66 B;  5DNN C;  5B31 G;  3MVD C;  3AZM C;  3WKJ A;  5CPI C;  5AV6 B;  5CP6 B;  3AZL A;  2Y2O A;  4YM6 D;  3REK C;  3AYW B;  3B6G B;  5B32 D;  4XUJ B;  5AY8 C;  3VH6 A;  5JRG A;  5B40 C;  3B0D C;  5AV8 B;  4WU9 C;  3B6F C;  2Y2K A;  4Z2M H;  3VH5 W;  1KU5 A;  2YFW B;  3MGP C;  3REH B;  1N1J A;  3AZE B;  4Z5T B;  1P3M B;  3REI C;  5GSU C;  2HUE B;  4NE5 A;  5B2I A;  4ZBJ C;  3V9R B;  1S32 B;  1M18 B;  4J8U A;  3AZG B;  3UTB C;  4H9Q B;  1P34 B;  3F6T A;  1M19 B;  2HIO C;  3LJA B;  4EO5 B;  1JFI A;  2BYK A;  1EQZ D;  4QLC C;  5B24 B;  3LEL D;  3KWQ A;  1Z2C B;  3MVD A;  3LEL A;  3AZM A;  1P3K B;  1P3O B;  5DNM C;  1ID3 B;  1KX4 C;  1U35 D;  3AZJ D;  1TZY C;  4LD9 B;  3AZN D;  1PZR A;  5GT3 D;  2VQR A;  5B33 D;  4J8X B;  1ZLA A;  5BT1 D;  5GT0 C;  1P3L D;  3MGR B;  1BH8 B;  1BH9 A;  3AZF C;  5GT3 A;  3C1C C;  3W97 C;  3W99 A;  4CAY B;  3VH6 T;  5B32 G;  4ZUX B;  2Y2Q A;  1P3L A;  3W96 C;  3X1T A;  3A6N B;  5B0Z D;  4Z66 D;  4R8P D;  3O62 A;  3WKJ B;  3AZL B;  3UTA C;  4R8P A;  3AV1 A;  2FJ7 D;  3AFA D;  3X1V D;  2L5A A;  5JRG B;  1KX5 C;  3MGS A;  3AFA A;  3LZ1 C;  3AZI D;  4YS3 A;  3X1V A;  1KX3 B;  1P3B D;  5CPJ A;  1F66 D;  1N1J B;  5BS7 C;  1F66 A;  4NE6 A;  5AV6 D;  5CP6 D;  5KDM B;  1P3A C;  5B2I B;  3AYW D;  4J8U B;  3REL C;  3B6G D;  5AV6 A;  3W98 B;  4DQY B;  3AN2 A;  1P3G C;  5AV8 D;  3B0B A;  1H3O A;  5AV8 A;  5CPK C;  4HGA B;  3AZE D;  2NZD A;  2Y2G A;  5B1L A;  1ULY A;  4Z5T D;  3KUY D;  1P3M D;  3EPJ A;  3KWQ B;  2DQN C;  2JSS A;  3AZE A;  3VH6 W;  5AVC C;  2Y2L A;  3KUY A;  2F2A C;  3MVD B;  4KUD A;  1S32 D;  3AZM B;  3C1B C;  1M18 D;  1WWI A;  4CSR B;  1Q9C A;  3AZG D;  3V9R A;  1P34 D;  5GXQ C;  3H0M C;  5AV9 C;  3AZG A;  3AZH C;  3LJA D;  1ZLA B;  1P3F A;  3B6F B;  1BH9 B;  2XD5 A;  3NQU A;  5GT3 B;  3LJA A;  3W99 B;  3MGP B;  3MGQ C;  3X1T B;  5B2J A;  4M6B A;  1P3I C;  1P3O D;  2ARO A;  3R45 A;  3O62 B;  4WNN A;  4WU8 C;  1R4V A;  3KFU G;  2G5I C;  2BYM A;  4LD9 D;  3AV1 B;  1P3P C;  4J8X D;  1B67 A;  4XZQ C;  3MNN A;  3MGR D;  3MGS B;  4YS3 B;  4WJ3 C;  5CPK A;  3KSY A;  3EPL A;  1BH8 A;  5C3I C;  4QLC B;  5CPJ B;  3A6N D;  2F8N K;  5B32 C;  4J8W A;  3AZL D;  3X1S C;  2FFF B;  4KGC A;  2J8P A;  5AVB A;  5JRG D;  3AN2 B;  2DF4 C;  1KX3 D;  2IO5 B;  5GT0 B;  3WAA A;  1H3O B;  2ZY3 A;  2XD1 A;  2NZD B;  1KX3 A;  5B1L B;  3MGQ A;  3TU4 A;  4E44 A;  3KUY B;  4KUD B;  5B2I D;  4H9S A;  3AZK C;  2RVQ D;  4J8U D;  3W98 D;  5KDM A;  3UTA B;  5E5A C;  1EQZ C;  4H9N A;  5B0Y C;  3W98 A;  4X23 A;  1KX5 B;  2PYO A;  4J8V C;  1P3F B;  1AOI C;  3WA9 C;  3NQU B;  3KWQ D;  4G91 B;  1U35 C;  5DNN D;  3AZJ C;  5B2J B;  3KXB C;  3MVD D;  3AZM D;  2ARO B;  2BG1 A;  3R45 B;  5DNN A;  5B33 C;  1P3A B;  4WNN B;  5BT1 C;  2F8N H;  5CPI A;  2BYM B;  4CSR A;  5AY8 D;  1HQ3 C;  3REK A;  5B0Z C;  4WU9 D;  3MNN B;  1ZLA D;  3B6F D;  5AY8 A;  5B40 A;  2NQB C;  4Z66 C;  3P5J B;  3W99 D;  3MGP D;  5CPK B;  4WU9 A;  3B6F A;  3X1T D;  1WWS A;  4H9O B;  3MGP A;  4Z2M G;  3O62 D;  4J8W B;  3AV2 C;  3REI A;  5GSU A;  3AZI C;  3UTB D;  3AV1 D;  4KGC B;  3B0C T;  3WTP C;  5GXQ B;  5AVB B;  5B0Y A;  5B1M C;  3MGS D;  2HIO D;  3UTB A;  4JJN C;  4YS3 D;  4J8V A;  1AOI A;  3WAA B;  2HIO A;  5CPJ D;  4QLC D;  5BNV A;  3AYW C;  3B6G C;  3X1U C;  3MGQ B;  4XUJ C;  3TU4 B;  4QLC A;  3REJ C;  2CV5 C;  1P3I B;  2ZY4 A;  5DNM D;  5B31 C;  3REH C;  3AN2 D;  4H9N B;  5DNM A;  2Y2P A;  4Z5T C;  1P3M C;  2CWE A;  1KX4 A;  1TZY A;  4X23 B;  5GT0 D;  4XZQ B;  2PYO B;  3W97 D;  2NZD D;  4H9P A;  5B1L D;  5GT0 A;  5BNX B; 
#chains in the Genus database with same CATH homology
 5C3I B;  3UT9 C;  3W96 D;  4H9R A;  3W97 A;  3C1C A;  3AZF A;  1M19 C;  4KUD D;  3W96 A;  5DNN B;  4EO5 C;  3X1S B;  4AWL C;  3UTA D;  2F8N B;  2LY8 A;  3LZ0 C;  5B24 C;  5CPI B;  3UTA A;  5F99 C;  3H0R C;  1KX5 D;  3REK B;  1M1A C;  5B1M A;  3B0C W;  4JJN A;  1P3K C;  1P3F D;  4DRA A;  5B40 B;  5AY8 B;  1P3O C;  1KX5 A;  1ID3 C;  5CHL B;  2Y2N A;  3B0D B;  5AV5 C;  3LZ1 A;  4WU9 B;  1HTA A;  5B2J D;  3A1I A;  2ARO D;  2CV5 A;  1P3A D;  4J8X C;  3AZK B;  3REI B;  5BS7 A;  5GSU B;  3REL D;  5B31 A;  1P3A A;  4ZUX C;  5E5A B;  4ZBJ B;  1A7W A;  4NE3 A;  5B0Y B;  3REL A;  4DRB A;  3MNN D;  3UTB B;  1P3G A;  4J8V B;  3WKJ C;  4KHA A;  5CPK D;  3AZL C;  1AOI B;  2HIO B;  5BNV B;  5JRG C;  4YM6 C;  3KXB B;  4H9O A;  4J8W D;  3NQJ A;  5AVC A;  4KGC D;  5GXQ D;  3C1B A;  1BFM A;  5AVB D;  5DNM B;  2YFV B;  1KX4 B;  2ZY5 A;  5GXQ A;  1T3U A;  1TZY B;  5AV9 A;  2NQB B;  5B2I C;  3WAA D;  2JE5 A;  3AZH A;  4H9P B;  2RVQ C;  5AV5 A;  3MGQ D;  2Y2I A;  3TU4 D;  4H9R B;  3AZF B;  3C1C B;  1P3I D;  3W97 B;  3W96 B;  1P3I A;  4WU8 A;  3WTP B;  4X23 D;  2PYO D;  4XZQ D;  5B1M B;  1P3P A;  4E45 A;  5G49 A;  3LEL C;  4JJN B;  4UUZ B;  5FUG A;  4XZQ A;  3AL0 C;  4G92 C;  5BO0 A;  3LZ1 B;  3X1U B;  5BNX A;  4YM6 A;  2W8S A;  3REJ B;  2CV5 B;  3X1S D;  1ZLA C;  5B32 A;  2F8N D;  3AZN C;  5CPI D;  5GT3 C;  3W99 C;  3X1S A;  5B31 B;  2F8N A;  1P3L C;  3REK D;  3X1T C;  3REL B;  5B40 D;  1P3G B;  1W2E A;  3O62 C;  2ZM5 A;  4KHA B;  4WZS B;  4R8P C;  3UT9 B;  3AV1 C;  3MGS C;  2FJ7 C;  3AZK D;  3REI D;  5GSU D;  4YS3 C;  3AFA C;  4AWL B;  3X1V C;  3NQJ B;  5AVC B;  5E5A D;  3LZ0 B;  3C1B B;  3AZK A;  5CPJ C;  5JA4 A;  5B0Y D;  5F99 B;  5E5A A;  1P3B C;  1EQZ A;  1M1A B;  4J8V D;  1F66 C;  5AV9 B;  1AOI D;  3WA9 D;  3AZH B;  5AV6 C;  5AV5 B;  5CP6 C;  3EPH A;  3AN2 C;  3WA9 A;  3KXB D;  1U35 A;  3AZJ A;  2Y2H A;  2IO5 C;  2ZY2 A;  3KXB A;  1TAF A;  5AV8 C;  3AZN A;  2NZD C;  4WV4 B;  5B33 A;  5B1L C;  4WU8 B;  1KX4 D;  1HQ3 D;  1TZY D;  3AZE C;  3A1K A;  2NQB D;  3KUY C;  2YFV A;  2F8N G;  2G5H C;  1P3P B;  4KUD C;  5G49 B;  1HQ3 A;  5FUG B;  5B0Z A;  2NQB A;  2HUE C;  4UPK A;  5BO0 B;  4Z66 A;  3VH5 A;  2UWX A;  3C1C D;  3AZF D;  1S32 C;  1M18 C;  3AZG C;  1P34 C;  4YM6 B;  3AV2 D;  2FJ7 A;  5B32 B;  1P3F C;  3WTP D;  4NFT A;  3LJA C;  3AV2 A;  3AZI A;  3FDD A;  4G91 C;  5B2J C;  5B1M D;  1B6W A;  1P3B A;  4JJN D;  3WTP A;  2ARO C;  3LZ1 D;  4UUZ A;  3X1U D;  5CP6 A;  4XUJ D;  2JCH A;  3REJ D;  3AYW A;  2CV5 D;  3B6G A;  3X1U A;  3MNN C;  4XUJ A;  4LD9 C;  3REJ A;  5B31 D;  3REH D;  2BYK B;  1JFI B;  3MGR C;  5JA4 B;  2YFW A;  3REH A;  1EQZ B;  1P3G D;  4Z5T A;  1P3M A;  3A6N C;  3LEL B;  4J8W C;  3WTP E;  3UT9 D;  4KGC C;  1F1E A;  4G92 B;  1S32 A;  1M18 A;  1M19 D;  3IP4 C;  5AVB C;  3WA9 B;  3UT9 A;  4H9Q A;  1P34 A;  1U35 B;  1M19 A;  3AZJ B;  5AVC D;  1TAF B;  2Y2J A;  3WAA C;  3VH5 T;  5B24 D;  3LZ0 D;  3EPK A;  3C1B D;  3AZN B;  1KX3 C;  5B33 B;  5F99 D;  1P3L B;  3TU4 C;  1M1A D;  3LZ0 A;  5B24 A;  1P3K D;  5AV9 D;  5F99 A;  4H9S C;  1HQ3 B;  1ID3 D;  3AZH D;  1M1A A;  5AV5 D;  5B0Z B;  1P3K A;  1P3O A;  4Z66 B;  4R8P B;  1ID3 A;  3EG5 B;  4J8U C;  3W98 C;  4X23 C;  2PYO C;  4LD9 A;  2FJ7 B;  3AFA B;  3X1V B;  3H0L C;  4J8X A;  4ZUX D;  4WU8 D;  2Y2M A;  2RIQ A;  3MGR A;  3AV2 B;  3AZI B;  4HGA C;  4CAY A;  4ZUX A;  1P3B B;  1P3P D;  3KWQ C;  3WKJ D;  3A6N A;  1F66 B;  5DNN C;  5B31 G;  3MVD C;  3AZM C;  3WKJ A;  5CPI C;  5AV6 B;  5CP6 B;  3AZL A;  2Y2O A;  4YM6 D;  3REK C;  3AYW B;  3B6G B;  5B32 D;  4XUJ B;  5AY8 C;  3VH6 A;  5JRG A;  5B40 C;  3B0D C;  5AV8 B;  4WU9 C;  3B6F C;  2Y2K A;  4Z2M H;  3VH5 W;  1KU5 A;  2YFW B;  3MGP C;  3REH B;  1N1J A;  3AZE B;  4Z5T B;  1P3M B;  3REI C;  5GSU C;  2HUE B;  4NE5 A;  5B2I A;  4ZBJ C;  3V9R B;  1S32 B;  1M18 B;  4J8U A;  3AZG B;  3UTB C;  4H9Q B;  1P34 B;  3F6T A;  1M19 B;  2HIO C;  3LJA B;  4EO5 B;  1JFI A;  2BYK A;  1EQZ D;  4QLC C;  5B24 B;  3LEL D;  3KWQ A;  1Z2C B;  3MVD A;  3LEL A;  3AZM A;  1P3K B;  1P3O B;  5DNM C;  1ID3 B;  1KX4 C;  1U35 D;  3AZJ D;  1TZY C;  4LD9 B;  3AZN D;  1PZR A;  5GT3 D;  2VQR A;  5B33 D;  4J8X B;  1ZLA A;  5BT1 D;  5GT0 C;  1P3L D;  3MGR B;  1BH8 B;  1BH9 A;  3AZF C;  5GT3 A;  3C1C C;  3W97 C;  3W99 A;  4CAY B;  3VH6 T;  5B32 G;  4ZUX B;  2Y2Q A;  1P3L A;  3W96 C;  3X1T A;  3A6N B;  5B0Z D;  4Z66 D;  4R8P D;  3O62 A;  3WKJ B;  3AZL B;  3UTA C;  4R8P A;  3AV1 A;  2FJ7 D;  3AFA D;  3X1V D;  2L5A A;  5JRG B;  1KX5 C;  3MGS A;  3AFA A;  3LZ1 C;  3AZI D;  4YS3 A;  3X1V A;  1KX3 B;  1P3B D;  5CPJ A;  1F66 D;  1N1J B;  5BS7 C;  1F66 A;  4NE6 A;  5AV6 D;  5CP6 D;  5KDM B;  1P3A C;  5B2I B;  3AYW D;  4J8U B;  3REL C;  3B6G D;  5AV6 A;  3W98 B;  4DQY B;  3AN2 A;  1P3G C;  5AV8 D;  3B0B A;  1H3O A;  5AV8 A;  5CPK C;  4HGA B;  3AZE D;  2NZD A;  2Y2G A;  5B1L A;  1ULY A;  4Z5T D;  3KUY D;  1P3M D;  3EPJ A;  3KWQ B;  2DQN C;  2JSS A;  3AZE A;  3VH6 W;  5AVC C;  2Y2L A;  3KUY A;  2F2A C;  3MVD B;  4KUD A;  1S32 D;  3AZM B;  3C1B C;  1M18 D;  1WWI A;  4CSR B;  1Q9C A;  3AZG D;  3V9R A;  1P34 D;  5GXQ C;  3H0M C;  5AV9 C;  3AZG A;  3AZH C;  3LJA D;  1ZLA B;  1P3F A;  3B6F B;  1BH9 B;  2XD5 A;  3NQU A;  5GT3 B;  3LJA A;  3W99 B;  3MGP B;  3MGQ C;  3X1T B;  5B2J A;  4M6B A;  1P3I C;  1P3O D;  2ARO A;  3R45 A;  3O62 B;  4WNN A;  4WU8 C;  1R4V A;  3KFU G;  2G5I C;  2BYM A;  4LD9 D;  3AV1 B;  1P3P C;  4J8X D;  1B67 A;  4XZQ C;  3MNN A;  3MGR D;  3MGS B;  4YS3 B;  4WJ3 C;  5CPK A;  3KSY A;  3EPL A;  1BH8 A;  5C3I C;  4QLC B;  5CPJ B;  3A6N D;  2F8N K;  5B32 C;  4J8W A;  3AZL D;  3X1S C;  2FFF B;  4KGC A;  2J8P A;  5AVB A;  5JRG D;  3AN2 B;  2DF4 C;  1KX3 D;  2IO5 B;  5GT0 B;  3WAA A;  1H3O B;  2ZY3 A;  2XD1 A;  2NZD B;  1KX3 A;  5B1L B;  3MGQ A;  3TU4 A;  4E44 A;  3KUY B;  4KUD B;  5B2I D;  4H9S A;  3AZK C;  2RVQ D;  4J8U D;  3W98 D;  5KDM A;  3UTA B;  5E5A C;  1EQZ C;  4H9N A;  5B0Y C;  3W98 A;  4X23 A;  1KX5 B;  2PYO A;  4J8V C;  1P3F B;  1AOI C;  3WA9 C;  3NQU B;  3KWQ D;  4G91 B;  1U35 C;  5DNN D;  3AZJ C;  5B2J B;  3KXB C;  3MVD D;  3AZM D;  2ARO B;  2BG1 A;  3R45 B;  5DNN A;  5B33 C;  1P3A B;  4WNN B;  5BT1 C;  2F8N H;  5CPI A;  2BYM B;  4CSR A;  5AY8 D;  1HQ3 C;  3REK A;  5B0Z C;  4WU9 D;  3MNN B;  1ZLA D;  3B6F D;  5AY8 A;  5B40 A;  2NQB C;  4Z66 C;  3P5J B;  3W99 D;  3MGP D;  5CPK B;  4WU9 A;  3B6F A;  3X1T D;  1WWS A;  4H9O B;  3MGP A;  4Z2M G;  3O62 D;  4J8W B;  3AV2 C;  3REI A;  5GSU A;  3AZI C;  3UTB D;  3AV1 D;  4KGC B;  3B0C T;  3WTP C;  5GXQ B;  5AVB B;  5B0Y A;  5B1M C;  3MGS D;  2HIO D;  3UTB A;  4JJN C;  4YS3 D;  4J8V A;  1AOI A;  3WAA B;  2HIO A;  5CPJ D;  4QLC D;  5BNV A;  3AYW C;  3B6G C;  3X1U C;  3MGQ B;  4XUJ C;  3TU4 B;  4QLC A;  3REJ C;  2CV5 C;  1P3I B;  2ZY4 A;  5DNM D;  5B31 C;  3REH C;  3AN2 D;  4H9N B;  5DNM A;  2Y2P A;  4Z5T C;  1P3M C;  2CWE A;  1KX4 A;  1TZY A;  4X23 B;  5GT0 D;  4XZQ B;  2PYO B;  3W97 D;  2NZD D;  4H9P A;  5B1L D;  5GT0 A;  5BNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...