4XZQD

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqD00
3W96C 4WU8D 3VH5A 4CSRB 3AZEB 5BO0A 3X1TA 4R8PB 5B2ID 1P3MC 5E5AC 4AWLC 3REHA 5GXQD 1JFIB 3NQUB 2L5AA 5DNNB 4YM6C 1AOIC 4QLCA 1BFMA 3C1BB 3LELA 3AN2C 3NQJA 3WTPB 5B1LB 5GT0A 3AZHA 3W98B 5AVCA 3MVDB 5JA4A 3AV1C 3KUYC 4LD9D 4E45A 5AV8B 5KDMA 3AZKB 5B40B 3W96D 4KGCA 5JRGC 3W97B 3X1SA 3AV2B 5B2JB 4ZBJB 5E5AD 5AV6B 5AVBA 3REJC 2PYOC 1P3OD 3AYWB 5GT3C 5CPJA 5C3IB 4YM6D 4J8WB 1AOID 4H9SC 2IO5C 1M1AB 3W99C 2BYKA 5BO0B 4KUDB 3X1UC 3AZMD 5B31G 1ZLAC 4WU8A 3AV1D 3KUYD 4QLCB 3C1CC 4ZUXB 5B31B 3MGPA 3AZHB 3MGSC 2AROC 5F99C 2FJ7C 5JRGD 5DNMB 5KDMB 2PYOD 1P3AA 3UT9B 5GT3D 4LD9A 3AZJA 5B1MA 3WKJA 5B33C 5B32D 3W99D 2HUEB 4YS3A 4X23A 4JJND 5CHLB 2BYMA 3KXBA 1N1JB 5CPJB 4H9PA 1BH8A 3B0DC 3KWQA 5CPKA 3WAAA 3B6GA 3AZFA 1TZYA 3MGSD 3B6FA 2AROD 5F99D 1EQZA 3A6NA 4WU8B 5BNVA 3X1TC 4XZQA 2NZDA 5B2IB 3REHC 3O62A 3AZLC 4XUJC 5G49A 1R4VA 5B33D 4CSRA 3AZEA 5GT0C 5BNXB 1P34A 4J8XC 5CPID 5AV9C 5DNNA 3MGQC 4Z66D 4LD9B 3C1BA 5B1MB 1F66D 4H9QA 3WTPA 5B1LA 4Z5TC 3W98A 2LY8A 5BT1C 1P3BC 3LZ0C 3MVDA 2CWEA 4J8VA 5B32A 3AZND 4WU9D 3UTAC 5FUGA 4JJNA 3B0CW 5E5AB 5AV8A 1BH8B 4AWLB 3AZKA 4J8UD 3B0CT 3KWQB 1P3OB 1KX3C 1M19C 5B24D 3AZLD 3WAAB 4XUJD 5B40A 4YM6B 3AZID 3VH6A 5GSUA 3W97A 1B67A 3UTBC 4XZQB 3AV2A 5B2JA 4J8XD 3AZMB 2JSSA 3O62B 5AV6A 5AV9D 4H9OA 1TAFB 3AYWA 1M1AA 5B0ZD 1P3PC 1P3KC 3AZGC 4Z5TD 3LZ1D 1P34B 3WA9D 4KUDA 5BT1D 1P3BD 1P3FD 4G92C 2YFVA 1H3OB 1KX5A 4CAYB 3UTAD 1ID3D 4ZUXA 2HIOA 4HGAB 5B31A 4H9QB 5B32G 5CPIA 1P3GC 1HQ3C 2PYOB 1KX3D 5AY8C 1M19D 1F1EA 5GT3B 2NQBC 1F66A 1U35C 2IO5B 4J8VB 5DNMA 5B32B 4YS3C 3UTBD 4H9NA 5FUGB 3REID 4JJNB 3X1VC 5AV5D 3UT9A 3LJAC 4WU9A 5GSUB 1P3PD 5CPKC 1P3KD 4J8UA 3RELC 3AZGD 5B24A 4M6BA 2CV5C 3MGSB 4UUZB 3AFAA 1S32C 1P3MD 3AZIA 1EQZC 2AROB 4H9OB 3WTPE 1N1JA 5BS7A 4NE5A 3TU4C 3AN2D 1P3GD 5B0YC 1HQ3D 3MNNC 5AY8D 2NQBD 2YFVB 5B0ZA 1KX5B 4R8PC 3LZ1A 3WA9A 5B2IA 3R45A 5CPIB 2HIOB 5GXQA 3X1VD 5DNNC 4G91C 3LJAD 3C1BC 4Z66B 1ID3A 1F66B 5CP6C 3RELD 3B0DB 5BNXA 4H9NB 2CV5D 1S32D 3MGRC 3REJD 3AZNB 4WU9B 1WWSA 3REIA 5AV8C 3TU4D 5B0YD 4J8UB 5B24B 3AZLB 1M18C 3X1UD 4XUJB 3REKC 1ZLAD 3AFAB 3AZIB 3W97C 3W96A 4ZBJC 1KU5A 1P3IC 5E5AA 3C1CD 5AV9B 1KX4C 1P3LC 1P3OA 4J8WC 4YM6A 1AOIA 3KSYA 2FJ7D 5B0ZB 5CP6D 1HTAA 3LZ1B 3WA9B 3AZMA 3R45B 1P3BB 1P3FB 1TAFA 5GXQB 3MGRD 3AV1A 3KUYA 4QLCC 3UTAB 3LELC 5B31C 1ID3B 3AZHC 1M19B 1M18D 5AVCC 1Q9CA 3REKD 2F8NK 1H3OA 5JRGA 4CAYA 4Z2MH 3UTBB 3REIB 1P3ID 3VH5W 1KX4D 1P3LD 5AV5B 2PYOA 3VH5T 5GT3A 4KGCC 2HUEC 4WNNA 3W96B 3X1SC 3W99A 1P3KB 3X1TD 4H9RB 3AZGB 1ULYA 3REHD 1P3MB 5AVBC 4G92B 5CPJC 4QLCD 3LELD 1AOIB 5BS7C 3C1CA 3AN2B 5GT0D 3AZHD 5AY8B 5AVCD 4UUZA 3MGSA 2F8ND 2AROA 5F99A 4WU8C 2NQBB 3AV1B 3KUYB 3MGQD 3MGPC 4NE3A 3X1VB 3LJAB 3LZ0D 4KGCD 5B33A 3V9RB 3X1SD 5JRGB 3RELB 4DRBA 2CV5B 5AVBD 1S32B 1P3AC 4Z2MG 3REJB 4LD9C 5CPJD 4Z66A 3AZJC 5B1MC 3WKJC 3TU4B 4WNNB 4X23C 3W99B 5B0YB 3X1UB 1ZLAB 3KXBC 3AZNA 4EO5C 3C1CB 2F8NH 3MGPD 1BH9A 3KWQC 1P3OC 3WAAC 3B6GC 3AZFC 1TZYC 4G91B 3AZLA 3B6FC 4XUJA 1WWIA 3A6NC 5F99B 2FJ7B 4XZQC 5CP6B 3AZMC 2NZDC 3O62C 4J8XA 2F8NA 5AV9A 3MGRB 1P3AD 4E44A 3MGQA 3AZJD 5B1MD 3WKJD 1U35D 2YFWB 4NFTA 5B33B 3AZEC 4YS3D 4X23D 1P34C 4Z5TA 4KHAB 1M18B 1P3BA 3LZ0A 3REKB 1P3FA 3KXBD 3UTAA 4HGAC 3WTPC 1P3IB 5B1LC 3KWQD 5CPKD 1P3LB 1KX4B 3B6GD 3WAAD 3W98C 3AZFD 1KX3A 1TZYD 1M19A 3B6FD 3MVDC 4J8VC 1EQZD 5B32C 3A6ND 4XZQD 3UTBA 3X1TB 4JJNC 2NZDD 3O62D 3REHB 3AZKC 5AV5A 1BH9B 4DRAA 3MNND 5B40C 3LELB 2F8NG 5GSUC 3NQJB 3AZED 1P3PA 1P3KA 1P34D 4H9RA 3AZGA 5GT0B 5B2JC 4R8PD 3AV2C 4NE6A 1P3MA 5AVCB 5AV6C 4J8XB 2F8NB 5JA4B 3AYWC 5DNND 5C3IC 3C1BD 3MGQB 1M1AC 3WTPD 3AN2A 1P3GA 5B1LD 4KUDC 1HQ3A 3W98D 4Z5TB 5AY8A 3MVDD 3LZ0B 4J8VD 2NQBA 1U35A 4KGCB 1KX5C 3X1SB 5CPIC 2HIOC 3VH6W 4ZUXC 5AV8D 3AZKD 5AVBB 3VH6T 3X1VA 3B0BA 4Z66C 3LJAA 1KX3B 5B40D 1F66C 5GSUD 5DNMC 3W97D 3V9RA 2BYKB 3RELA 3AV2D 5B2JD 2CV5A 5AV6D 1S32A 3AZNC 3REJA 3UT9C 3AYWD 4WU9C 4J8WD 1M1AD 4H9SA 3TU4A 4J8UC 3MGPB 1P3PB 5B0YA 5B24C 4KUDD 3MNNA 3X1UA 3AFAC 1ZLAA 3AZIC 1B6WA 1KX5D 4R8PA 4ZUXD 2HIOD 5B31D 1JFIA 1P3GB 2RVQC 3NQUA 1P3AB 1HQ3B 3AZJB 3WKJB 5B0ZC 2FJ7A 5DNMD 1U35B 5CP6A 3LZ1C 4X23B 4YS3B 3WA9C 5B2IC 1A7WA 1P3FC 2BYMB 5GXQC 3KXBB 3MGRA 3UT9D 4WZSB 1ID3C 4H9PB 2YFWA 4EO5B 5CPKB 3B6GB 4KHAA 4WV4B 1TZYB 3AZFB 1M18A 3B6FB 3AFAD 3REKA 1EQZB 3A6NB 5BNVB 3REIC 2NZDB 1P3IA 5AV5C 1KX4A 1P3LA 2RVQD 3MNNB 4J8WA 5G49B
chains in the Genus database with same CATH superfamily
3W96C 4WU8D 3VH5A 4CSRB 3AZEB 5BO0A 3X1TA 4R8PB 5B2ID 1P3MC 5E5AC 4AWLC 3REHA 5GXQD 1JFIB 3NQUB 2L5AA 5DNNB 3EPHA 4YM6C 1AOIC 4QLCA 1BFMA 3C1BB 3LELA 3AN2C 3NQJA 3WTPB 5B1LB 2Y2MA 5GT0A 3AZHA 2Y2GA 3W98B 5AVCA 3AL0C 3MVDB 5JA4A 3AV1C 3KUYC 4LD9D 2FFFB 4E45A 2RIQA 2G5IC 5AV8B 5KDMA 3AZKB 5B40B 3W96D 4KGCA 5JRGC 3W97B 3X1SA 2UWXA 3AV2B 5B2JB 4ZBJB 5E5AD 5AV6B 5AVBA 3REJC 2PYOC 1P3OD 3AYWB 5GT3C 5CPJA 5C3IB 4YM6D 4J8WB 1AOID 4H9SC 2IO5C 1M1AB 3W99C 2BYKA 5BO0B 4KUDB 3X1UC 3AZMD 5B31G 1ZLAC 4WU8A 3AV1D 3KUYD 4QLCB 3C1CC 4ZUXB 5B31B 2DF4C 3MGPA 3AZHB 3MGSC 2AROC 5F99C 2FJ7C 5JRGD 5DNMB 2BG1A 5KDMB 2PYOD 1P3AA 3UT9B 5GT3D 4LD9A 3AZJA 5B1MA 3WKJA 5B33C 3P5JB 5B32D 3EG5B 2Y2OA 3W99D 2HUEB 4YS3A 4X23A 4JJND 5CHLB 2BYMA 3KXBA 1N1JB 5CPJB 4H9PA 1BH8A 3B0DC 3KWQA 5CPKA 3WAAA 3B6GA 3AZFA 1TZYA 3MGSD 3B6FA 2AROD 5F99D 1EQZA 3A6NA 4WU8B 5BNVA 3X1TC 4XZQA 2ZY4A 2NZDA 5B2IB 3REHC 3O62A 3AZLC 4XUJC 5G49A 1R4VA 5B33D 4CSRA 3AZEA 5GT0C 5BNXB 1P34A 4J8XC 3KFUG 5CPID 5AV9C 5DNNA 3MGQC 4Z66D 4LD9B 3C1BA 2JCHA 5B1MB 1F66D 2W8SA 4H9QA 3WTPA 5B1LA 3A1IA 4Z5TC 3W98A 2LY8A 5BT1C 1P3BC 3LZ0C 3MVDA 2CWEA 4J8VA 2VQRA 5B32A 3AZND 4WU9D 2Y2LA 3UTAC 5FUGA 4JJNA 3B0CW 5E5AB 5AV8A 1BH8B 4AWLB 3AZKA 4J8UD 3B0CT 3KWQB 1P3OB 1KX3C 1M19C 5B24D 3AZLD 3WAAB 4XUJD 5B40A 4YM6B 3AZID 3VH6A 2ZM5A 5GSUA 3A1KA 3W97A 1B67A 3UTBC 4XZQB 3AV2A 5B2JA 4J8XD 3AZMB 2JSSA 3O62B 5AV6A 5AV9D 4H9OA 1TAFB 2Y2JA 3AYWA 1M1AA 5B0ZD 1P3PC 1P3KC 3AZGC 4Z5TD 3LZ1D 1P34B 3WA9D 4KUDA 5BT1D 1P3BD 1P3FD 4G92C 2YFVA 1H3OB 1KX5A 2Y2KA 4CAYB 3UTAD 1ID3D 4ZUXA 2HIOA 4HGAB 5B31A 4H9QB 5B32G 3F6TA 5CPIA 1P3GC 1HQ3C 2PYOB 1KX3D 5AY8C 1M19D 1F1EA 5GT3B 2NQBC 1F66A 1U35C 2IO5B 4J8VB 5DNMA 5B32B 4YS3C 3UTBD 4H9NA 5FUGB 3REID 4JJNB 3X1VC 5AV5D 3UT9A 3LJAC 4WU9A 5GSUB 1P3PD 5CPKC 1P3KD 4J8UA 3RELC 3AZGD 5B24A 4M6BA 2CV5C 3MGSB 4UUZB 3AFAA 1S32C 1P3MD 3AZIA 1EQZC 2AROB 4H9OB 4UPKA 3WTPE 1N1JA 2JE5A 5BS7A 4NE5A 3TU4C 3AN2D 1P3GD 2Y2PA 5B0YC 1HQ3D 3MNNC 5AY8D 2NQBD 2YFVB 5B0ZA 2F2AC 1KX5B 4R8PC 3LZ1A 3WA9A 5B2IA 3R45A 1W2EA 5CPIB 2HIOB 5GXQA 3X1VD 3H0MC 5DNNC 4G91C 3LJAD 3C1BC 4Z66B 1ID3A 1F66B 5CP6C 3RELD 3B0DB 2ZY5A 5BNXA 4H9NB 2CV5D 1S32D 3MGRC 3REJD 3AZNB 4WU9B 1WWSA 3REIA 5AV8C 2DQNC 3TU4D 2G5HC 5B0YD 4J8UB 5B24B 3AZLB 1M18C 3X1UD 4XUJB 3REKC 1ZLAD 3AFAB 3AZIB 3W97C 3W96A 4ZBJC 1KU5A 1Z2CB 1P3IC 5E5AA 3C1CD 5AV9B 1KX4C 1P3LC 1P3OA 4J8WC 4YM6A 1AOIA 3KSYA 2FJ7D 5B0ZB 5CP6D 1HTAA 3LZ1B 3WA9B 3AZMA 3R45B 1P3BB 1P3FB 1TAFA 5GXQB 3MGRD 3AV1A 3KUYA 4QLCC 3UTAB 3LELC 5B31C 1ID3B 2Y2HA 3AZHC 1M19B 1M18D 5AVCC 1Q9CA 3REKD 2F8NK 2ZY2A 1H3OA 5JRGA 4CAYA 4Z2MH 3UTBB 3REIB 1P3ID 3VH5W 1KX4D 1P3LD 5AV5B 2PYOA 3VH5T 5GT3A 4KGCC 2HUEC 4WNNA 3W96B 3X1SC 3W99A 1P3KB 3X1TD 4H9RB 3AZGB 1ULYA 3REHD 1P3MB 5AVBC 4G92B 1T3UA 5CPJC 4QLCD 3LELD 1AOIB 5BS7C 3C1CA 3AN2B 5GT0D 3AZHD 5AY8B 5AVCD 4UUZA 3MGSA 2F8ND 2AROA 5F99A 4WU8C 2NQBB 3EPLA 3AV1B 3KUYB 3MGQD 3MGPC 4NE3A 3X1VB 3LJAB 3LZ0D 4KGCD 5B33A 3V9RB 3X1SD 5JRGB 3RELB 3EPJA 4DRBA 2CV5B 5AVBD 1S32B 1P3AC 4Z2MG 3REJB 4LD9C 5CPJD 2XD1A 4Z66A 5B1MC 3AZJC 3WKJC 4WJ3C 3TU4B 4WNNB 4X23C 3W99B 5B0YB 3X1UB 1ZLAB 3KXBC 3AZNA 4EO5C 3C1CB 2F8NH 3MGPD 1BH9A 3KWQC 1P3OC 3WAAC 3B6GC 3AZFC 1TZYC 4G91B 3AZLA 3B6FC 4XUJA 1WWIA 3A6NC 5F99B 2FJ7B 4XZQC 5CP6B 2J8PA 3AZMC 2NZDC 3O62C 4J8XA 2F8NA 5AV9A 3MGRB 1P3AD 4E44A 3MGQA 3AZJD 5B1MD 3WKJD 3IP4C 1U35D 2YFWB 4NFTA 5B33B 3AZEC 4YS3D 2Y2QA 4X23D 1P34C 4Z5TA 4KHAB 1M18B 1P3BA 3LZ0A 3REKB 1P3FA 3KXBD 3UTAA 4HGAC 3FDDA 3WTPC 1P3IB 5B1LC 3KWQD 5CPKD 1P3LB 1KX4B 3B6GD 3WAAD 3W98C 3AZFD 1KX3A 1TZYD 1M19A 3H0RC 3B6FD 3MVDC 4J8VC 1EQZD 5B32C 3A6ND 4XZQD 3UTBA 3X1TB 4JJNC 2NZDD 3O62D 3REHB 3AZKC 5AV5A 1BH9B 4DRAA 3EPKA 3MNND 5B40C 3LELB 2F8NG 5GSUC 3NQJB 3AZED 1P3PA 1P3KA 1P34D 4H9RA 2Y2IA 5GT0B 5B2JC 4R8PD 3AZGA 3AV2C 4NE6A 1P3MA 5AVCB 5AV6C 4J8XB 2F8NB 5JA4B 3AYWC 5DNND 5C3IC 3C1BD 3MGQB 1M1AC 3WTPD 3AN2A 1P3GA 5B1LD 4KUDC 1HQ3A 3W98D 4Z5TB 5AY8A 3MVDD 3LZ0B 4J8VD 2NQBA 1U35A 4KGCB 1KX5C 3X1SB 4DQYB 5CPIC 2HIOC 3VH6W 4ZUXC 5AV8D 3AZKD 5AVBB 3VH6T 3X1VA 3B0BA 4Z66C 3LJAA 1KX3B 5B40D 1F66C 5GSUD 5DNMC 3W97D 3V9RA 2BYKB 3RELA 3AV2D 5B2JD 2CV5A 5AV6D 1S32A 3AZNC 3REJA 3UT9C 3AYWD 4WU9C 4J8WD 1PZRA 1M1AD 2Y2NA 4H9SA 3TU4A 4J8UC 3MGPB 1P3PB 2XD5A 5B24C 5B0YA 4KUDD 3MNNA 3X1UA 3AFAC 1ZLAA 3AZIC 1B6WA 1KX5D 4R8PA 4ZUXD 2HIOD 5B31D 1JFIA 1P3GB 2RVQC 3NQUA 1P3AB 1HQ3B 3AZJB 3WKJB 5B0ZC 2FJ7A 5DNMD 1U35B 5CP6A 3LZ1C 4X23B 4YS3B 3WA9C 5B2IC 1A7WA 1P3FC 2BYMB 5GXQC 3KXBB 3MGRA 3UT9D 4WZSB 1ID3C 4H9PB 2YFWA 4EO5B 3H0LC 5CPKB 3B6GB 4KHAA 4WV4B 1TZYB 3AZFB 1M18A 3B6FB 3AFAD 3REKA 1EQZB 3A6NB 5BNVB 3REIC 2ZY3A 2NZDB 1P3IA 5AV5C 1KX4A 1P3LA 2RVQD 3MNNB 4J8WA 5G49B
chains in the Genus database with same CATH topology
3W96C 4WU8D 3VH5A 4CSRB 3AZEB 5BO0A 3X1TA 4R8PB 5B2ID 1P3MC 5E5AC 4AWLC 3REHA 5GXQD 1JFIB 3NQUB 2L5AA 5DNNB 3EPHA 4YM6C 1AOIC 4QLCA 1BFMA 3C1BB 3LELA 3AN2C 3NQJA 3WTPB 5B1LB 2Y2MA 5GT0A 3AZHA 2Y2GA 3W98B 5AVCA 3AL0C 3MVDB 5JA4A 3AV1C 3KUYC 4LD9D 2FFFB 4E45A 2RIQA 2G5IC 5AV8B 5KDMA 3AZKB 5B40B 3W96D 4KGCA 5JRGC 3W97B 3X1SA 2UWXA 3AV2B 5B2JB 4ZBJB 5E5AD 5AV6B 5AVBA 3REJC 2PYOC 1P3OD 3AYWB 5GT3C 5CPJA 5C3IB 4YM6D 4J8WB 1AOID 4H9SC 2IO5C 1M1AB 3W99C 2BYKA 5BO0B 4KUDB 3X1UC 3AZMD 5B31G 1ZLAC 4WU8A 3AV1D 3KUYD 4QLCB 3C1CC 4ZUXB 5B31B 2DF4C 3MGPA 3AZHB 3MGSC 2AROC 5F99C 2FJ7C 5JRGD 5DNMB 2BG1A 5KDMB 2PYOD 1P3AA 3UT9B 5GT3D 4LD9A 3AZJA 5B1MA 3WKJA 5B33C 3P5JB 5B32D 3EG5B 2Y2OA 3W99D 2HUEB 4YS3A 4X23A 4JJND 5CHLB 2BYMA 3KXBA 1N1JB 5CPJB 4H9PA 1BH8A 3B0DC 3KWQA 5CPKA 3WAAA 3B6GA 3AZFA 1TZYA 3MGSD 3B6FA 2AROD 5F99D 1EQZA 3A6NA 4WU8B 5BNVA 3X1TC 4XZQA 2ZY4A 2NZDA 5B2IB 3REHC 3O62A 3AZLC 4XUJC 5G49A 1R4VA 5B33D 4CSRA 3AZEA 5GT0C 5BNXB 1P34A 4J8XC 3KFUG 5CPID 5AV9C 5DNNA 3MGQC 4Z66D 4LD9B 3C1BA 2JCHA 5B1MB 1F66D 2W8SA 4H9QA 3WTPA 5B1LA 3A1IA 4Z5TC 3W98A 2LY8A 5BT1C 1P3BC 3LZ0C 3MVDA 2CWEA 4J8VA 2VQRA 5B32A 3AZND 4WU9D 2Y2LA 3UTAC 5FUGA 4JJNA 3B0CW 5E5AB 5AV8A 1BH8B 4AWLB 3AZKA 4J8UD 3B0CT 3KWQB 1P3OB 1KX3C 1M19C 5B24D 3AZLD 3WAAB 4XUJD 5B40A 4YM6B 3AZID 3VH6A 2ZM5A 5GSUA 3A1KA 3W97A 1B67A 3UTBC 4XZQB 3AV2A 5B2JA 4J8XD 3AZMB 2JSSA 3O62B 5AV6A 5AV9D 4H9OA 1TAFB 2Y2JA 3AYWA 1M1AA 5B0ZD 1P3PC 1P3KC 3AZGC 4Z5TD 3LZ1D 1P34B 3WA9D 4KUDA 5BT1D 1P3BD 1P3FD 4G92C 2YFVA 1H3OB 1KX5A 2Y2KA 4CAYB 3UTAD 1ID3D 4ZUXA 2HIOA 4HGAB 5B31A 4H9QB 5B32G 3F6TA 5CPIA 1P3GC 1HQ3C 2PYOB 1KX3D 5AY8C 1M19D 1F1EA 5GT3B 2NQBC 1F66A 1U35C 2IO5B 4J8VB 5DNMA 5B32B 4YS3C 3UTBD 4H9NA 5FUGB 3REID 4JJNB 3X1VC 5AV5D 3UT9A 3LJAC 4WU9A 5GSUB 1P3PD 5CPKC 1P3KD 4J8UA 3RELC 3AZGD 5B24A 4M6BA 2CV5C 3MGSB 4UUZB 3AFAA 1S32C 1P3MD 3AZIA 1EQZC 2AROB 4H9OB 4UPKA 3WTPE 1N1JA 2JE5A 5BS7A 4NE5A 3TU4C 3AN2D 1P3GD 2Y2PA 5B0YC 1HQ3D 3MNNC 5AY8D 2NQBD 2YFVB 5B0ZA 2F2AC 1KX5B 4R8PC 3LZ1A 3WA9A 5B2IA 3R45A 1W2EA 5CPIB 2HIOB 5GXQA 3X1VD 3H0MC 5DNNC 4G91C 3LJAD 3C1BC 4Z66B 1ID3A 1F66B 5CP6C 3RELD 3B0DB 2ZY5A 5BNXA 4H9NB 2CV5D 1S32D 3MGRC 3REJD 3AZNB 4WU9B 1WWSA 3REIA 5AV8C 2DQNC 3TU4D 2G5HC 5B0YD 4J8UB 5B24B 3AZLB 1M18C 3X1UD 4XUJB 3REKC 1ZLAD 3AFAB 3AZIB 3W97C 3W96A 4ZBJC 1KU5A 1Z2CB 1P3IC 5E5AA 3C1CD 5AV9B 1KX4C 1P3LC 1P3OA 4J8WC 4YM6A 1AOIA 3KSYA 2FJ7D 5B0ZB 5CP6D 1HTAA 3LZ1B 3WA9B 3AZMA 3R45B 1P3BB 1P3FB 1TAFA 5GXQB 3MGRD 3AV1A 3KUYA 4QLCC 3UTAB 3LELC 5B31C 1ID3B 2Y2HA 3AZHC 1M19B 1M18D 5AVCC 1Q9CA 3REKD 2F8NK 2ZY2A 1H3OA 5JRGA 4CAYA 4Z2MH 3UTBB 3REIB 1P3ID 3VH5W 1KX4D 1P3LD 5AV5B 2PYOA 3VH5T 5GT3A 4KGCC 2HUEC 4WNNA 3W96B 3X1SC 3W99A 1P3KB 3X1TD 4H9RB 3AZGB 1ULYA 3REHD 1P3MB 5AVBC 4G92B 1T3UA 5CPJC 4QLCD 3LELD 1AOIB 5BS7C 3C1CA 3AN2B 5GT0D 3AZHD 5AY8B 5AVCD 4UUZA 3MGSA 2F8ND 2AROA 5F99A 4WU8C 2NQBB 3EPLA 3AV1B 3KUYB 3MGQD 3MGPC 4NE3A 3X1VB 3LJAB 3LZ0D 4KGCD 5B33A 3V9RB 3X1SD 5JRGB 3RELB 3EPJA 4DRBA 2CV5B 5AVBD 1S32B 1P3AC 4Z2MG 3REJB 4LD9C 5CPJD 2XD1A 4Z66A 5B1MC 3AZJC 3WKJC 4WJ3C 3TU4B 4WNNB 4X23C 3W99B 5B0YB 3X1UB 1ZLAB 3KXBC 3AZNA 4EO5C 3C1CB 2F8NH 3MGPD 1BH9A 3KWQC 1P3OC 3WAAC 3B6GC 3AZFC 1TZYC 4G91B 3AZLA 3B6FC 4XUJA 1WWIA 3A6NC 5F99B 2FJ7B 4XZQC 5CP6B 2J8PA 3AZMC 2NZDC 3O62C 4J8XA 2F8NA 5AV9A 3MGRB 1P3AD 4E44A 3MGQA 3AZJD 5B1MD 3WKJD 3IP4C 1U35D 2YFWB 4NFTA 5B33B 3AZEC 4YS3D 2Y2QA 4X23D 1P34C 4Z5TA 4KHAB 1M18B 1P3BA 3LZ0A 3REKB 1P3FA 3KXBD 3UTAA 4HGAC 3FDDA 3WTPC 1P3IB 5B1LC 3KWQD 5CPKD 1P3LB 1KX4B 3B6GD 3WAAD 3W98C 3AZFD 1KX3A 1TZYD 1M19A 3H0RC 3B6FD 3MVDC 4J8VC 1EQZD 5B32C 3A6ND 4XZQD 3UTBA 3X1TB 4JJNC 2NZDD 3O62D 3REHB 3AZKC 5AV5A 1BH9B 4DRAA 3EPKA 3MNND 5B40C 3LELB 2F8NG 5GSUC 3NQJB 3AZED 1P3PA 1P3KA 1P34D 4H9RA 2Y2IA 5GT0B 5B2JC 4R8PD 3AZGA 3AV2C 4NE6A 1P3MA 5AVCB 5AV6C 4J8XB 2F8NB 5JA4B 3AYWC 5DNND 5C3IC 3C1BD 3MGQB 1M1AC 3WTPD 3AN2A 1P3GA 5B1LD 4KUDC 1HQ3A 3W98D 4Z5TB 5AY8A 3MVDD 3LZ0B 4J8VD 2NQBA 1U35A 4KGCB 1KX5C 3X1SB 4DQYB 5CPIC 2HIOC 3VH6W 4ZUXC 5AV8D 3AZKD 5AVBB 3VH6T 3X1VA 3B0BA 4Z66C 3LJAA 1KX3B 5B40D 1F66C 5GSUD 5DNMC 3W97D 3V9RA 2BYKB 3RELA 3AV2D 5B2JD 2CV5A 5AV6D 1S32A 3AZNC 3REJA 3UT9C 3AYWD 4WU9C 4J8WD 1PZRA 1M1AD 2Y2NA 4H9SA 3TU4A 4J8UC 3MGPB 1P3PB 2XD5A 5B24C 5B0YA 4KUDD 3MNNA 3X1UA 3AFAC 1ZLAA 3AZIC 1B6WA 1KX5D 4R8PA 4ZUXD 2HIOD 5B31D 1JFIA 1P3GB 2RVQC 3NQUA 1P3AB 1HQ3B 3AZJB 3WKJB 5B0ZC 2FJ7A 5DNMD 1U35B 5CP6A 3LZ1C 4X23B 4YS3B 3WA9C 5B2IC 1A7WA 1P3FC 2BYMB 5GXQC 3KXBB 3MGRA 3UT9D 4WZSB 1ID3C 4H9PB 2YFWA 4EO5B 3H0LC 5CPKB 3B6GB 4KHAA 4WV4B 1TZYB 3AZFB 1M18A 3B6FB 3AFAD 3REKA 1EQZB 3A6NB 5BNVB 3REIC 2ZY3A 2NZDB 1P3IA 5AV5C 1KX4A 1P3LA 2RVQD 3MNNB 4J8WA 5G49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 C;  4WU8 D;  3VH5 A;  4CSR B;  3AZE B;  5BO0 A;  3X1T A;  4R8P B;  5B2I D;  1P3M C;  5E5A C;  4AWL C;  3REH A;  5GXQ D;  1JFI B;  3NQU B;  2L5A A;  5DNN B;  4YM6 C;  1AOI C;  4QLC A;  1BFM A;  3C1B B;  3LEL A;  3AN2 C;  3NQJ A;  3WTP B;  5B1L B;  5GT0 A;  3AZH A;  3W98 B;  5AVC A;  3MVD B;  5JA4 A;  3AV1 C;  3KUY C;  4LD9 D;  4E45 A;  5AV8 B;  5KDM A;  3AZK B;  5B40 B;  3W96 D;  4KGC A;  5JRG C;  3W97 B;  3X1S A;  3AV2 B;  5B2J B;  4ZBJ B;  5E5A D;  5AV6 B;  5AVB A;  3REJ C;  2PYO C;  1P3O D;  3AYW B;  5GT3 C;  5CPJ A;  5C3I B;  4YM6 D;  4J8W B;  1AOI D;  4H9S C;  2IO5 C;  1M1A B;  3W99 C;  2BYK A;  5BO0 B;  4KUD B;  3X1U C;  3AZM D;  5B31 G;  1ZLA C;  4WU8 A;  3AV1 D;  3KUY D;  4QLC B;  3C1C C;  4ZUX B;  5B31 B;  3MGP A;  3AZH B;  3MGS C;  2ARO C;  5F99 C;  2FJ7 C;  5JRG D;  5DNM B;  5KDM B;  2PYO D;  1P3A A;  3UT9 B;  5GT3 D;  4LD9 A;  3AZJ A;  5B1M A;  3WKJ A;  5B33 C;  5B32 D;  3W99 D;  2HUE B;  4YS3 A;  4X23 A;  4JJN D;  5CHL B;  2BYM A;  3KXB A;  1N1J B;  5CPJ B;  4H9P A;  1BH8 A;  3B0D C;  3KWQ A;  5CPK A;  3WAA A;  3B6G A;  3AZF A;  1TZY A;  3MGS D;  3B6F A;  2ARO D;  5F99 D;  1EQZ A;  3A6N A;  4WU8 B;  5BNV A;  3X1T C;  4XZQ A;  2NZD A;  5B2I B;  3REH C;  3O62 A;  3AZL C;  4XUJ C;  5G49 A;  1R4V A;  5B33 D;  4CSR A;  3AZE A;  5GT0 C;  5BNX B;  1P34 A;  4J8X C;  5CPI D;  5AV9 C;  5DNN A;  3MGQ C;  4Z66 D;  4LD9 B;  3C1B A;  5B1M B;  1F66 D;  4H9Q A;  3WTP A;  5B1L A;  4Z5T C;  3W98 A;  2LY8 A;  5BT1 C;  1P3B C;  3LZ0 C;  3MVD A;  2CWE A;  4J8V A;  5B32 A;  3AZN D;  4WU9 D;  3UTA C;  5FUG A;  4JJN A;  3B0C W;  5E5A B;  5AV8 A;  1BH8 B;  4AWL B;  3AZK A;  4J8U D;  3B0C T;  3KWQ B;  1P3O B;  1KX3 C;  1M19 C;  5B24 D;  3AZL D;  3WAA B;  4XUJ D;  5B40 A;  4YM6 B;  3AZI D;  3VH6 A;  5GSU A;  3W97 A;  1B67 A;  3UTB C;  4XZQ B;  3AV2 A;  5B2J A;  4J8X D;  3AZM B;  2JSS A;  3O62 B;  5AV6 A;  5AV9 D;  4H9O A;  1TAF B;  3AYW A;  1M1A A;  5B0Z D;  1P3P C;  1P3K C;  3AZG C;  4Z5T D;  3LZ1 D;  1P34 B;  3WA9 D;  4KUD A;  5BT1 D;  1P3B D;  1P3F D;  4G92 C;  2YFV A;  1H3O B;  1KX5 A;  4CAY B;  3UTA D;  1ID3 D;  4ZUX A;  2HIO A;  4HGA B;  5B31 A;  4H9Q B;  5B32 G;  5CPI A;  1P3G C;  1HQ3 C;  2PYO B;  1KX3 D;  5AY8 C;  1M19 D;  1F1E A;  5GT3 B;  2NQB C;  1F66 A;  1U35 C;  2IO5 B;  4J8V B;  5DNM A;  5B32 B;  4YS3 C;  3UTB D;  4H9N A;  5FUG B;  3REI D;  4JJN B;  3X1V C;  5AV5 D;  3UT9 A;  3LJA C;  4WU9 A;  5GSU B;  1P3P D;  5CPK C;  1P3K D;  4J8U A;  3REL C;  3AZG D;  5B24 A;  4M6B A;  2CV5 C;  3MGS B;  4UUZ B;  3AFA A;  1S32 C;  1P3M D;  3AZI A;  1EQZ C;  2ARO B;  4H9O B;  3WTP E;  1N1J A;  5BS7 A;  4NE5 A;  3TU4 C;  3AN2 D;  1P3G D;  5B0Y C;  1HQ3 D;  3MNN C;  5AY8 D;  2NQB D;  2YFV B;  5B0Z A;  1KX5 B;  4R8P C;  3LZ1 A;  3WA9 A;  5B2I A;  3R45 A;  5CPI B;  2HIO B;  5GXQ A;  3X1V D;  5DNN C;  4G91 C;  3LJA D;  3C1B C;  4Z66 B;  1ID3 A;  1F66 B;  5CP6 C;  3REL D;  3B0D B;  5BNX A;  4H9N B;  2CV5 D;  1S32 D;  3MGR C;  3REJ D;  3AZN B;  4WU9 B;  1WWS A;  3REI A;  5AV8 C;  3TU4 D;  5B0Y D;  4J8U B;  5B24 B;  3AZL B;  1M18 C;  3X1U D;  4XUJ B;  3REK C;  1ZLA D;  3AFA B;  3AZI B;  3W97 C;  3W96 A;  4ZBJ C;  1KU5 A;  1P3I C;  5E5A A;  3C1C D;  5AV9 B;  1KX4 C;  1P3L C;  1P3O A;  4J8W C;  4YM6 A;  1AOI A;  3KSY A;  2FJ7 D;  5B0Z B;  5CP6 D;  1HTA A;  3LZ1 B;  3WA9 B;  3AZM A;  3R45 B;  1P3B B;  1P3F B;  1TAF A;  5GXQ B;  3MGR D;  3AV1 A;  3KUY A;  4QLC C;  3UTA B;  3LEL C;  5B31 C;  1ID3 B;  3AZH C;  1M19 B;  1M18 D;  5AVC C;  1Q9C A;  3REK D;  2F8N K;  1H3O A;  5JRG A;  4CAY A;  4Z2M H;  3UTB B;  3REI B;  1P3I D;  3VH5 W;  1KX4 D;  1P3L D;  5AV5 B;  2PYO A;  3VH5 T;  5GT3 A;  4KGC C;  2HUE C;  4WNN A;  3W96 B;  3X1S C;  3W99 A;  1P3K B;  3X1T D;  4H9R B;  3AZG B;  1ULY A;  3REH D;  1P3M B;  5AVB C;  4G92 B;  5CPJ C;  4QLC D;  3LEL D;  1AOI B;  5BS7 C;  3C1C A;  3AN2 B;  5GT0 D;  3AZH D;  5AY8 B;  5AVC D;  4UUZ A;  3MGS A;  2F8N D;  2ARO A;  5F99 A;  4WU8 C;  2NQB B;  3AV1 B;  3KUY B;  3MGQ D;  3MGP C;  4NE3 A;  3X1V B;  3LJA B;  3LZ0 D;  4KGC D;  5B33 A;  3V9R B;  3X1S D;  5JRG B;  3REL B;  4DRB A;  2CV5 B;  5AVB D;  1S32 B;  1P3A C;  4Z2M G;  3REJ B;  4LD9 C;  5CPJ D;  4Z66 A;  3AZJ C;  5B1M C;  3WKJ C;  3TU4 B;  4WNN B;  4X23 C;  3W99 B;  5B0Y B;  3X1U B;  1ZLA B;  3KXB C;  3AZN A;  4EO5 C;  3C1C B;  2F8N H;  3MGP D;  1BH9 A;  3KWQ C;  1P3O C;  3WAA C;  3B6G C;  3AZF C;  1TZY C;  4G91 B;  3AZL A;  3B6F C;  4XUJ A;  1WWI A;  3A6N C;  5F99 B;  2FJ7 B;  4XZQ C;  5CP6 B;  3AZM C;  2NZD C;  3O62 C;  4J8X A;  2F8N A;  5AV9 A;  3MGR B;  1P3A D;  4E44 A;  3MGQ A;  3AZJ D;  5B1M D;  3WKJ D;  1U35 D;  2YFW B;  4NFT A;  5B33 B;  3AZE C;  4YS3 D;  4X23 D;  1P34 C;  4Z5T A;  4KHA B;  1M18 B;  1P3B A;  3LZ0 A;  3REK B;  1P3F A;  3KXB D;  3UTA A;  4HGA C;  3WTP C;  1P3I B;  5B1L C;  3KWQ D;  5CPK D;  1P3L B;  1KX4 B;  3B6G D;  3WAA D;  3W98 C;  3AZF D;  1KX3 A;  1TZY D;  1M19 A;  3B6F D;  3MVD C;  4J8V C;  1EQZ D;  5B32 C;  3A6N D;  4XZQ D;  3UTB A;  3X1T B;  4JJN C;  2NZD D;  3O62 D;  3REH B;  3AZK C;  5AV5 A;  1BH9 B;  4DRA A;  3MNN D;  5B40 C;  3LEL B;  2F8N G;  5GSU C;  3NQJ B;  3AZE D;  1P3P A;  1P3K A;  1P34 D;  4H9R A;  3AZG A;  5GT0 B;  5B2J C;  4R8P D;  3AV2 C;  4NE6 A;  1P3M A;  5AVC B;  5AV6 C;  4J8X B;  2F8N B;  5JA4 B;  3AYW C;  5DNN D;  5C3I C;  3C1B D;  3MGQ B;  1M1A C;  3WTP D;  3AN2 A;  1P3G A;  5B1L D;  4KUD C;  1HQ3 A;  3W98 D;  4Z5T B;  5AY8 A;  3MVD D;  3LZ0 B;  4J8V D;  2NQB A;  1U35 A;  4KGC B;  1KX5 C;  3X1S B;  5CPI C;  2HIO C;  3VH6 W;  4ZUX C;  5AV8 D;  3AZK D;  5AVB B;  3VH6 T;  3X1V A;  3B0B A;  4Z66 C;  3LJA A;  1KX3 B;  5B40 D;  1F66 C;  5GSU D;  5DNM C;  3W97 D;  3V9R A;  2BYK B;  3REL A;  3AV2 D;  5B2J D;  2CV5 A;  5AV6 D;  1S32 A;  3AZN C;  3REJ A;  3UT9 C;  3AYW D;  4WU9 C;  4J8W D;  1M1A D;  4H9S A;  3TU4 A;  4J8U C;  3MGP B;  1P3P B;  5B0Y A;  5B24 C;  4KUD D;  3MNN A;  3X1U A;  3AFA C;  1ZLA A;  3AZI C;  1B6W A;  1KX5 D;  4R8P A;  4ZUX D;  2HIO D;  5B31 D;  1JFI A;  1P3G B;  2RVQ C;  3NQU A;  1P3A B;  1HQ3 B;  3AZJ B;  3WKJ B;  5B0Z C;  2FJ7 A;  5DNM D;  1U35 B;  5CP6 A;  3LZ1 C;  4X23 B;  4YS3 B;  3WA9 C;  5B2I C;  1A7W A;  1P3F C;  2BYM B;  5GXQ C;  3KXB B;  3MGR A;  3UT9 D;  4WZS B;  1ID3 C;  4H9P B;  2YFW A;  4EO5 B;  5CPK B;  3B6G B;  4KHA A;  4WV4 B;  1TZY B;  3AZF B;  1M18 A;  3B6F B;  3AFA D;  3REK A;  1EQZ B;  3A6N B;  5BNV B;  3REI C;  2NZD B;  1P3I A;  5AV5 C;  1KX4 A;  1P3L A;  2RVQ D;  3MNN B;  4J8W A;  5G49 B; 
#chains in the Genus database with same CATH topology
 3W96 C;  4WU8 D;  3VH5 A;  4CSR B;  3AZE B;  5BO0 A;  3X1T A;  4R8P B;  5B2I D;  1P3M C;  5E5A C;  4AWL C;  3REH A;  5GXQ D;  1JFI B;  3NQU B;  2L5A A;  5DNN B;  3EPH A;  4YM6 C;  1AOI C;  4QLC A;  1BFM A;  3C1B B;  3LEL A;  3AN2 C;  3NQJ A;  3WTP B;  5B1L B;  2Y2M A;  5GT0 A;  3AZH A;  2Y2G A;  3W98 B;  5AVC A;  3AL0 C;  3MVD B;  5JA4 A;  3AV1 C;  3KUY C;  4LD9 D;  2FFF B;  4E45 A;  2RIQ A;  2G5I C;  5AV8 B;  5KDM A;  3AZK B;  5B40 B;  3W96 D;  4KGC A;  5JRG C;  3W97 B;  3X1S A;  2UWX A;  3AV2 B;  5B2J B;  4ZBJ B;  5E5A D;  5AV6 B;  5AVB A;  3REJ C;  2PYO C;  1P3O D;  3AYW B;  5GT3 C;  5CPJ A;  5C3I B;  4YM6 D;  4J8W B;  1AOI D;  4H9S C;  2IO5 C;  1M1A B;  3W99 C;  2BYK A;  5BO0 B;  4KUD B;  3X1U C;  3AZM D;  5B31 G;  1ZLA C;  4WU8 A;  3AV1 D;  3KUY D;  4QLC B;  3C1C C;  4ZUX B;  5B31 B;  2DF4 C;  3MGP A;  3AZH B;  3MGS C;  2ARO C;  5F99 C;  2FJ7 C;  5JRG D;  5DNM B;  2BG1 A;  5KDM B;  2PYO D;  1P3A A;  3UT9 B;  5GT3 D;  4LD9 A;  3AZJ A;  5B1M A;  3WKJ A;  5B33 C;  3P5J B;  5B32 D;  3EG5 B;  2Y2O A;  3W99 D;  2HUE B;  4YS3 A;  4X23 A;  4JJN D;  5CHL B;  2BYM A;  3KXB A;  1N1J B;  5CPJ B;  4H9P A;  1BH8 A;  3B0D C;  3KWQ A;  5CPK A;  3WAA A;  3B6G A;  3AZF A;  1TZY A;  3MGS D;  3B6F A;  2ARO D;  5F99 D;  1EQZ A;  3A6N A;  4WU8 B;  5BNV A;  3X1T C;  4XZQ A;  2ZY4 A;  2NZD A;  5B2I B;  3REH C;  3O62 A;  3AZL C;  4XUJ C;  5G49 A;  1R4V A;  5B33 D;  4CSR A;  3AZE A;  5GT0 C;  5BNX B;  1P34 A;  4J8X C;  3KFU G;  5CPI D;  5AV9 C;  5DNN A;  3MGQ C;  4Z66 D;  4LD9 B;  3C1B A;  2JCH A;  5B1M B;  1F66 D;  2W8S A;  4H9Q A;  3WTP A;  5B1L A;  3A1I A;  4Z5T C;  3W98 A;  2LY8 A;  5BT1 C;  1P3B C;  3LZ0 C;  3MVD A;  2CWE A;  4J8V A;  2VQR A;  5B32 A;  3AZN D;  4WU9 D;  2Y2L A;  3UTA C;  5FUG A;  4JJN A;  3B0C W;  5E5A B;  5AV8 A;  1BH8 B;  4AWL B;  3AZK A;  4J8U D;  3B0C T;  3KWQ B;  1P3O B;  1KX3 C;  1M19 C;  5B24 D;  3AZL D;  3WAA B;  4XUJ D;  5B40 A;  4YM6 B;  3AZI D;  3VH6 A;  2ZM5 A;  5GSU A;  3A1K A;  3W97 A;  1B67 A;  3UTB C;  4XZQ B;  3AV2 A;  5B2J A;  4J8X D;  3AZM B;  2JSS A;  3O62 B;  5AV6 A;  5AV9 D;  4H9O A;  1TAF B;  2Y2J A;  3AYW A;  1M1A A;  5B0Z D;  1P3P C;  1P3K C;  3AZG C;  4Z5T D;  3LZ1 D;  1P34 B;  3WA9 D;  4KUD A;  5BT1 D;  1P3B D;  1P3F D;  4G92 C;  2YFV A;  1H3O B;  1KX5 A;  2Y2K A;  4CAY B;  3UTA D;  1ID3 D;  4ZUX A;  2HIO A;  4HGA B;  5B31 A;  4H9Q B;  5B32 G;  3F6T A;  5CPI A;  1P3G C;  1HQ3 C;  2PYO B;  1KX3 D;  5AY8 C;  1M19 D;  1F1E A;  5GT3 B;  2NQB C;  1F66 A;  1U35 C;  2IO5 B;  4J8V B;  5DNM A;  5B32 B;  4YS3 C;  3UTB D;  4H9N A;  5FUG B;  3REI D;  4JJN B;  3X1V C;  5AV5 D;  3UT9 A;  3LJA C;  4WU9 A;  5GSU B;  1P3P D;  5CPK C;  1P3K D;  4J8U A;  3REL C;  3AZG D;  5B24 A;  4M6B A;  2CV5 C;  3MGS B;  4UUZ B;  3AFA A;  1S32 C;  1P3M D;  3AZI A;  1EQZ C;  2ARO B;  4H9O B;  4UPK A;  3WTP E;  1N1J A;  2JE5 A;  5BS7 A;  4NE5 A;  3TU4 C;  3AN2 D;  1P3G D;  2Y2P A;  5B0Y C;  1HQ3 D;  3MNN C;  5AY8 D;  2NQB D;  2YFV B;  5B0Z A;  2F2A C;  1KX5 B;  4R8P C;  3LZ1 A;  3WA9 A;  5B2I A;  3R45 A;  1W2E A;  5CPI B;  2HIO B;  5GXQ A;  3X1V D;  3H0M C;  5DNN C;  4G91 C;  3LJA D;  3C1B C;  4Z66 B;  1ID3 A;  1F66 B;  5CP6 C;  3REL D;  3B0D B;  2ZY5 A;  5BNX A;  4H9N B;  2CV5 D;  1S32 D;  3MGR C;  3REJ D;  3AZN B;  4WU9 B;  1WWS A;  3REI A;  5AV8 C;  2DQN C;  3TU4 D;  2G5H C;  5B0Y D;  4J8U B;  5B24 B;  3AZL B;  1M18 C;  3X1U D;  4XUJ B;  3REK C;  1ZLA D;  3AFA B;  3AZI B;  3W97 C;  3W96 A;  4ZBJ C;  1KU5 A;  1Z2C B;  1P3I C;  5E5A A;  3C1C D;  5AV9 B;  1KX4 C;  1P3L C;  1P3O A;  4J8W C;  4YM6 A;  1AOI A;  3KSY A;  2FJ7 D;  5B0Z B;  5CP6 D;  1HTA A;  3LZ1 B;  3WA9 B;  3AZM A;  3R45 B;  1P3B B;  1P3F B;  1TAF A;  5GXQ B;  3MGR D;  3AV1 A;  3KUY A;  4QLC C;  3UTA B;  3LEL C;  5B31 C;  1ID3 B;  2Y2H A;  3AZH C;  1M19 B;  1M18 D;  5AVC C;  1Q9C A;  3REK D;  2F8N K;  2ZY2 A;  1H3O A;  5JRG A;  4CAY A;  4Z2M H;  3UTB B;  3REI B;  1P3I D;  3VH5 W;  1KX4 D;  1P3L D;  5AV5 B;  2PYO A;  3VH5 T;  5GT3 A;  4KGC C;  2HUE C;  4WNN A;  3W96 B;  3X1S C;  3W99 A;  1P3K B;  3X1T D;  4H9R B;  3AZG B;  1ULY A;  3REH D;  1P3M B;  5AVB C;  4G92 B;  1T3U A;  5CPJ C;  4QLC D;  3LEL D;  1AOI B;  5BS7 C;  3C1C A;  3AN2 B;  5GT0 D;  3AZH D;  5AY8 B;  5AVC D;  4UUZ A;  3MGS A;  2F8N D;  2ARO A;  5F99 A;  4WU8 C;  2NQB B;  3EPL A;  3AV1 B;  3KUY B;  3MGQ D;  3MGP C;  4NE3 A;  3X1V B;  3LJA B;  3LZ0 D;  4KGC D;  5B33 A;  3V9R B;  3X1S D;  5JRG B;  3REL B;  3EPJ A;  4DRB A;  2CV5 B;  5AVB D;  1S32 B;  1P3A C;  4Z2M G;  3REJ B;  4LD9 C;  5CPJ D;  2XD1 A;  4Z66 A;  5B1M C;  3AZJ C;  3WKJ C;  4WJ3 C;  3TU4 B;  4WNN B;  4X23 C;  3W99 B;  5B0Y B;  3X1U B;  1ZLA B;  3KXB C;  3AZN A;  4EO5 C;  3C1C B;  2F8N H;  3MGP D;  1BH9 A;  3KWQ C;  1P3O C;  3WAA C;  3B6G C;  3AZF C;  1TZY C;  4G91 B;  3AZL A;  3B6F C;  4XUJ A;  1WWI A;  3A6N C;  5F99 B;  2FJ7 B;  4XZQ C;  5CP6 B;  2J8P A;  3AZM C;  2NZD C;  3O62 C;  4J8X A;  2F8N A;  5AV9 A;  3MGR B;  1P3A D;  4E44 A;  3MGQ A;  3AZJ D;  5B1M D;  3WKJ D;  3IP4 C;  1U35 D;  2YFW B;  4NFT A;  5B33 B;  3AZE C;  4YS3 D;  2Y2Q A;  4X23 D;  1P34 C;  4Z5T A;  4KHA B;  1M18 B;  1P3B A;  3LZ0 A;  3REK B;  1P3F A;  3KXB D;  3UTA A;  4HGA C;  3FDD A;  3WTP C;  1P3I B;  5B1L C;  3KWQ D;  5CPK D;  1P3L B;  1KX4 B;  3B6G D;  3WAA D;  3W98 C;  3AZF D;  1KX3 A;  1TZY D;  1M19 A;  3H0R C;  3B6F D;  3MVD C;  4J8V C;  1EQZ D;  5B32 C;  3A6N D;  4XZQ D;  3UTB A;  3X1T B;  4JJN C;  2NZD D;  3O62 D;  3REH B;  3AZK C;  5AV5 A;  1BH9 B;  4DRA A;  3EPK A;  3MNN D;  5B40 C;  3LEL B;  2F8N G;  5GSU C;  3NQJ B;  3AZE D;  1P3P A;  1P3K A;  1P34 D;  4H9R A;  2Y2I A;  5GT0 B;  5B2J C;  4R8P D;  3AZG A;  3AV2 C;  4NE6 A;  1P3M A;  5AVC B;  5AV6 C;  4J8X B;  2F8N B;  5JA4 B;  3AYW C;  5DNN D;  5C3I C;  3C1B D;  3MGQ B;  1M1A C;  3WTP D;  3AN2 A;  1P3G A;  5B1L D;  4KUD C;  1HQ3 A;  3W98 D;  4Z5T B;  5AY8 A;  3MVD D;  3LZ0 B;  4J8V D;  2NQB A;  1U35 A;  4KGC B;  1KX5 C;  3X1S B;  4DQY B;  5CPI C;  2HIO C;  3VH6 W;  4ZUX C;  5AV8 D;  3AZK D;  5AVB B;  3VH6 T;  3X1V A;  3B0B A;  4Z66 C;  3LJA A;  1KX3 B;  5B40 D;  1F66 C;  5GSU D;  5DNM C;  3W97 D;  3V9R A;  2BYK B;  3REL A;  3AV2 D;  5B2J D;  2CV5 A;  5AV6 D;  1S32 A;  3AZN C;  3REJ A;  3UT9 C;  3AYW D;  4WU9 C;  4J8W D;  1PZR A;  1M1A D;  2Y2N A;  4H9S A;  3TU4 A;  4J8U C;  3MGP B;  1P3P B;  2XD5 A;  5B24 C;  5B0Y A;  4KUD D;  3MNN A;  3X1U A;  3AFA C;  1ZLA A;  3AZI C;  1B6W A;  1KX5 D;  4R8P A;  4ZUX D;  2HIO D;  5B31 D;  1JFI A;  1P3G B;  2RVQ C;  3NQU A;  1P3A B;  1HQ3 B;  3AZJ B;  3WKJ B;  5B0Z C;  2FJ7 A;  5DNM D;  1U35 B;  5CP6 A;  3LZ1 C;  4X23 B;  4YS3 B;  3WA9 C;  5B2I C;  1A7W A;  1P3F C;  2BYM B;  5GXQ C;  3KXB B;  3MGR A;  3UT9 D;  4WZS B;  1ID3 C;  4H9P B;  2YFW A;  4EO5 B;  3H0L C;  5CPK B;  3B6G B;  4KHA A;  4WV4 B;  1TZY B;  3AZF B;  1M18 A;  3B6F B;  3AFA D;  3REK A;  1EQZ B;  3A6N B;  5BNV B;  3REI C;  2ZY3 A;  2NZD B;  1P3I A;  5AV5 C;  1KX4 A;  1P3L A;  2RVQ D;  3MNN B;  4J8W A;  5G49 B; 
#chains in the Genus database with same CATH homology
 3W96 C;  4WU8 D;  3VH5 A;  4CSR B;  3AZE B;  5BO0 A;  3X1T A;  4R8P B;  5B2I D;  1P3M C;  5E5A C;  4AWL C;  3REH A;  5GXQ D;  1JFI B;  3NQU B;  2L5A A;  5DNN B;  3EPH A;  4YM6 C;  1AOI C;  4QLC A;  1BFM A;  3C1B B;  3LEL A;  3AN2 C;  3NQJ A;  3WTP B;  5B1L B;  2Y2M A;  5GT0 A;  3AZH A;  2Y2G A;  3W98 B;  5AVC A;  3AL0 C;  3MVD B;  5JA4 A;  3AV1 C;  3KUY C;  4LD9 D;  2FFF B;  4E45 A;  2RIQ A;  2G5I C;  5AV8 B;  5KDM A;  3AZK B;  5B40 B;  3W96 D;  4KGC A;  5JRG C;  3W97 B;  3X1S A;  2UWX A;  3AV2 B;  5B2J B;  4ZBJ B;  5E5A D;  5AV6 B;  5AVB A;  3REJ C;  2PYO C;  1P3O D;  3AYW B;  5GT3 C;  5CPJ A;  5C3I B;  4YM6 D;  4J8W B;  1AOI D;  4H9S C;  2IO5 C;  1M1A B;  3W99 C;  2BYK A;  5BO0 B;  4KUD B;  3X1U C;  3AZM D;  5B31 G;  1ZLA C;  4WU8 A;  3AV1 D;  3KUY D;  4QLC B;  3C1C C;  4ZUX B;  5B31 B;  2DF4 C;  3MGP A;  3AZH B;  3MGS C;  2ARO C;  5F99 C;  2FJ7 C;  5JRG D;  5DNM B;  2BG1 A;  5KDM B;  2PYO D;  1P3A A;  3UT9 B;  5GT3 D;  4LD9 A;  3AZJ A;  5B1M A;  3WKJ A;  5B33 C;  3P5J B;  5B32 D;  3EG5 B;  2Y2O A;  3W99 D;  2HUE B;  4YS3 A;  4X23 A;  4JJN D;  5CHL B;  2BYM A;  3KXB A;  1N1J B;  5CPJ B;  4H9P A;  1BH8 A;  3B0D C;  3KWQ A;  5CPK A;  3WAA A;  3B6G A;  3AZF A;  1TZY A;  3MGS D;  3B6F A;  2ARO D;  5F99 D;  1EQZ A;  3A6N A;  4WU8 B;  5BNV A;  3X1T C;  4XZQ A;  2ZY4 A;  2NZD A;  5B2I B;  3REH C;  3O62 A;  3AZL C;  4XUJ C;  5G49 A;  1R4V A;  5B33 D;  4CSR A;  3AZE A;  5GT0 C;  5BNX B;  1P34 A;  4J8X C;  3KFU G;  5CPI D;  5AV9 C;  5DNN A;  3MGQ C;  4Z66 D;  4LD9 B;  3C1B A;  2JCH A;  5B1M B;  1F66 D;  2W8S A;  4H9Q A;  3WTP A;  5B1L A;  3A1I A;  4Z5T C;  3W98 A;  2LY8 A;  5BT1 C;  1P3B C;  3LZ0 C;  3MVD A;  2CWE A;  4J8V A;  2VQR A;  5B32 A;  3AZN D;  4WU9 D;  2Y2L A;  3UTA C;  5FUG A;  4JJN A;  3B0C W;  5E5A B;  5AV8 A;  1BH8 B;  4AWL B;  3AZK A;  4J8U D;  3B0C T;  3KWQ B;  1P3O B;  1KX3 C;  1M19 C;  5B24 D;  3AZL D;  3WAA B;  4XUJ D;  5B40 A;  4YM6 B;  3AZI D;  3VH6 A;  2ZM5 A;  5GSU A;  3A1K A;  3W97 A;  1B67 A;  3UTB C;  4XZQ B;  3AV2 A;  5B2J A;  4J8X D;  3AZM B;  2JSS A;  3O62 B;  5AV6 A;  5AV9 D;  4H9O A;  1TAF B;  2Y2J A;  3AYW A;  1M1A A;  5B0Z D;  1P3P C;  1P3K C;  3AZG C;  4Z5T D;  3LZ1 D;  1P34 B;  3WA9 D;  4KUD A;  5BT1 D;  1P3B D;  1P3F D;  4G92 C;  2YFV A;  1H3O B;  1KX5 A;  2Y2K A;  4CAY B;  3UTA D;  1ID3 D;  4ZUX A;  2HIO A;  4HGA B;  5B31 A;  4H9Q B;  5B32 G;  3F6T A;  5CPI A;  1P3G C;  1HQ3 C;  2PYO B;  1KX3 D;  5AY8 C;  1M19 D;  1F1E A;  5GT3 B;  2NQB C;  1F66 A;  1U35 C;  2IO5 B;  4J8V B;  5DNM A;  5B32 B;  4YS3 C;  3UTB D;  4H9N A;  5FUG B;  3REI D;  4JJN B;  3X1V C;  5AV5 D;  3UT9 A;  3LJA C;  4WU9 A;  5GSU B;  1P3P D;  5CPK C;  1P3K D;  4J8U A;  3REL C;  3AZG D;  5B24 A;  4M6B A;  2CV5 C;  3MGS B;  4UUZ B;  3AFA A;  1S32 C;  1P3M D;  3AZI A;  1EQZ C;  2ARO B;  4H9O B;  4UPK A;  3WTP E;  1N1J A;  2JE5 A;  5BS7 A;  4NE5 A;  3TU4 C;  3AN2 D;  1P3G D;  2Y2P A;  5B0Y C;  1HQ3 D;  3MNN C;  5AY8 D;  2NQB D;  2YFV B;  5B0Z A;  2F2A C;  1KX5 B;  4R8P C;  3LZ1 A;  3WA9 A;  5B2I A;  3R45 A;  1W2E A;  5CPI B;  2HIO B;  5GXQ A;  3X1V D;  3H0M C;  5DNN C;  4G91 C;  3LJA D;  3C1B C;  4Z66 B;  1ID3 A;  1F66 B;  5CP6 C;  3REL D;  3B0D B;  2ZY5 A;  5BNX A;  4H9N B;  2CV5 D;  1S32 D;  3MGR C;  3REJ D;  3AZN B;  4WU9 B;  1WWS A;  3REI A;  5AV8 C;  2DQN C;  3TU4 D;  2G5H C;  5B0Y D;  4J8U B;  5B24 B;  3AZL B;  1M18 C;  3X1U D;  4XUJ B;  3REK C;  1ZLA D;  3AFA B;  3AZI B;  3W97 C;  3W96 A;  4ZBJ C;  1KU5 A;  1Z2C B;  1P3I C;  5E5A A;  3C1C D;  5AV9 B;  1KX4 C;  1P3L C;  1P3O A;  4J8W C;  4YM6 A;  1AOI A;  3KSY A;  2FJ7 D;  5B0Z B;  5CP6 D;  1HTA A;  3LZ1 B;  3WA9 B;  3AZM A;  3R45 B;  1P3B B;  1P3F B;  1TAF A;  5GXQ B;  3MGR D;  3AV1 A;  3KUY A;  4QLC C;  3UTA B;  3LEL C;  5B31 C;  1ID3 B;  2Y2H A;  3AZH C;  1M19 B;  1M18 D;  5AVC C;  1Q9C A;  3REK D;  2F8N K;  2ZY2 A;  1H3O A;  5JRG A;  4CAY A;  4Z2M H;  3UTB B;  3REI B;  1P3I D;  3VH5 W;  1KX4 D;  1P3L D;  5AV5 B;  2PYO A;  3VH5 T;  5GT3 A;  4KGC C;  2HUE C;  4WNN A;  3W96 B;  3X1S C;  3W99 A;  1P3K B;  3X1T D;  4H9R B;  3AZG B;  1ULY A;  3REH D;  1P3M B;  5AVB C;  4G92 B;  1T3U A;  5CPJ C;  4QLC D;  3LEL D;  1AOI B;  5BS7 C;  3C1C A;  3AN2 B;  5GT0 D;  3AZH D;  5AY8 B;  5AVC D;  4UUZ A;  3MGS A;  2F8N D;  2ARO A;  5F99 A;  4WU8 C;  2NQB B;  3EPL A;  3AV1 B;  3KUY B;  3MGQ D;  3MGP C;  4NE3 A;  3X1V B;  3LJA B;  3LZ0 D;  4KGC D;  5B33 A;  3V9R B;  3X1S D;  5JRG B;  3REL B;  3EPJ A;  4DRB A;  2CV5 B;  5AVB D;  1S32 B;  1P3A C;  4Z2M G;  3REJ B;  4LD9 C;  5CPJ D;  2XD1 A;  4Z66 A;  5B1M C;  3AZJ C;  3WKJ C;  4WJ3 C;  3TU4 B;  4WNN B;  4X23 C;  3W99 B;  5B0Y B;  3X1U B;  1ZLA B;  3KXB C;  3AZN A;  4EO5 C;  3C1C B;  2F8N H;  3MGP D;  1BH9 A;  3KWQ C;  1P3O C;  3WAA C;  3B6G C;  3AZF C;  1TZY C;  4G91 B;  3AZL A;  3B6F C;  4XUJ A;  1WWI A;  3A6N C;  5F99 B;  2FJ7 B;  4XZQ C;  5CP6 B;  2J8P A;  3AZM C;  2NZD C;  3O62 C;  4J8X A;  2F8N A;  5AV9 A;  3MGR B;  1P3A D;  4E44 A;  3MGQ A;  3AZJ D;  5B1M D;  3WKJ D;  3IP4 C;  1U35 D;  2YFW B;  4NFT A;  5B33 B;  3AZE C;  4YS3 D;  2Y2Q A;  4X23 D;  1P34 C;  4Z5T A;  4KHA B;  1M18 B;  1P3B A;  3LZ0 A;  3REK B;  1P3F A;  3KXB D;  3UTA A;  4HGA C;  3FDD A;  3WTP C;  1P3I B;  5B1L C;  3KWQ D;  5CPK D;  1P3L B;  1KX4 B;  3B6G D;  3WAA D;  3W98 C;  3AZF D;  1KX3 A;  1TZY D;  1M19 A;  3H0R C;  3B6F D;  3MVD C;  4J8V C;  1EQZ D;  5B32 C;  3A6N D;  4XZQ D;  3UTB A;  3X1T B;  4JJN C;  2NZD D;  3O62 D;  3REH B;  3AZK C;  5AV5 A;  1BH9 B;  4DRA A;  3EPK A;  3MNN D;  5B40 C;  3LEL B;  2F8N G;  5GSU C;  3NQJ B;  3AZE D;  1P3P A;  1P3K A;  1P34 D;  4H9R A;  2Y2I A;  5GT0 B;  5B2J C;  4R8P D;  3AZG A;  3AV2 C;  4NE6 A;  1P3M A;  5AVC B;  5AV6 C;  4J8X B;  2F8N B;  5JA4 B;  3AYW C;  5DNN D;  5C3I C;  3C1B D;  3MGQ B;  1M1A C;  3WTP D;  3AN2 A;  1P3G A;  5B1L D;  4KUD C;  1HQ3 A;  3W98 D;  4Z5T B;  5AY8 A;  3MVD D;  3LZ0 B;  4J8V D;  2NQB A;  1U35 A;  4KGC B;  1KX5 C;  3X1S B;  4DQY B;  5CPI C;  2HIO C;  3VH6 W;  4ZUX C;  5AV8 D;  3AZK D;  5AVB B;  3VH6 T;  3X1V A;  3B0B A;  4Z66 C;  3LJA A;  1KX3 B;  5B40 D;  1F66 C;  5GSU D;  5DNM C;  3W97 D;  3V9R A;  2BYK B;  3REL A;  3AV2 D;  5B2J D;  2CV5 A;  5AV6 D;  1S32 A;  3AZN C;  3REJ A;  3UT9 C;  3AYW D;  4WU9 C;  4J8W D;  1PZR A;  1M1A D;  2Y2N A;  4H9S A;  3TU4 A;  4J8U C;  3MGP B;  1P3P B;  2XD5 A;  5B24 C;  5B0Y A;  4KUD D;  3MNN A;  3X1U A;  3AFA C;  1ZLA A;  3AZI C;  1B6W A;  1KX5 D;  4R8P A;  4ZUX D;  2HIO D;  5B31 D;  1JFI A;  1P3G B;  2RVQ C;  3NQU A;  1P3A B;  1HQ3 B;  3AZJ B;  3WKJ B;  5B0Z C;  2FJ7 A;  5DNM D;  1U35 B;  5CP6 A;  3LZ1 C;  4X23 B;  4YS3 B;  3WA9 C;  5B2I C;  1A7W A;  1P3F C;  2BYM B;  5GXQ C;  3KXB B;  3MGR A;  3UT9 D;  4WZS B;  1ID3 C;  4H9P B;  2YFW A;  4EO5 B;  3H0L C;  5CPK B;  3B6G B;  4KHA A;  4WV4 B;  1TZY B;  3AZF B;  1M18 A;  3B6F B;  3AFA D;  3REK A;  1EQZ B;  3A6N B;  5BNV B;  3REI C;  2ZY3 A;  2NZD B;  1P3I A;  5AV5 C;  1KX4 A;  1P3L A;  2RVQ D;  3MNN B;  4J8W A;  5G49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...