2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
2AROB 1JFIB 1P34C 2NQBA 4R8PD 3AZFB 4LD9C 3TU4C 1ZLAD 1P34A 4X23C 5JRGB 3MGPD 3AZKC 4KUDB 4X23A 3LELA 3LJAB 3WA9B 1P3LB 3AZKA 4M6BA 3WTPA 1M18D 4E44A 4YM6D 1HQ3A 2PYOC 5B2IC 2LY8A 2PYOA 5CPKC 4LD9B 3TU4B 4NE6A 3VH5W 4G91C 5DNNA 5BT1C 4X23B 5GSUD 3AZKB 4J8XD 3AZIC 3NQJB 1U35C 5B0YD 3W97C 1P3GC 1U35A 1M1AD 3AZEC 4H9OA 1P3MA 1P3GA 5GT0C 1M19D 2PYOB 5B2IB 3AZEA 4WNNA 5GT0A 1F66D 5CPKB 4Z66C 4G91B 5AVCC 2BYKA 3AZJD 4Z66A 2YFWB 3AZIB 5AVCA 2F8NB 3KSYA 4NFTA 5B0ZD 1U35B 5DNMD 1EQZD 3W97B 4H9OB 1P3GB 5B2JA 1AOID 5BS7A 4XUJA 5CPJD 3AN2C 4WNNB 5GT0B 5AVBC 3AN2A 3AZND 5CPIC 5AVBA 4Z66B 3NQUB 5AVCB 2NZDC 5CPIA 5AV6C 2NZDA 5AY8C 3X1UD 3C1BD 3AV2D 3AZMC 5AY8A 3X1SA 5JA4A 5KDMA 3AZMA 5B40D 5JRGD 3AN2B 4KUDD 3REHB 1TAFB 2YFVB 5AVBB 3LZ1A 3LJAD 3AZHC 5CPIB 2NZDB 3AV1C 4WV4B 3AZHA 3B0CT 5AV6B 1R4VA 1KU5A 5AY8B 3AV1A 4CAYB 5KDMB 3WKJA 3AZMB 1ID3C 3X1TC 5BNVA 1S32C 3V9RB 3TU4D 4LD9D 3LZ0C 4J8VA 3X1TA 1P3IC 1S32A 3MNNC 3LZ0A 5E5AC 3A6NC 3MGRC 3AZHB 3MNNA 5B24C 1A7WA 4QLCC 3A6NA 5C3IC 3AV1B 5B24A 3VH5A 4QLCA 1P3FA 5B1MC 2F8NG 2FJ7A 5B2ID 1P3OC 1P3KC 5AV5C 1ID3B 4JJNA 3X1TB 5B31C 5CPKD 1S32B 1KX3C 3UT9C 3LZ0B 1KX5D 5AV5A 5BT1D 1P3IB 5B31A 1KX3A 5GXQD 5AV8B 3MNNB 3UT9A 5B1LB 3AZID 2F8ND 4J8UC 5E5AB 3W99D 3A6NB 3MGRB 5F99A 3KXBA 3W97D 4J8UA 5C3IB 3AZLA 3AZGC 1P3BD 3W96D 5B1MB 1B67A 2L5AA 3AZGA 4WU9C 1P3OB 1P3KB 5AV5B 1N1JA 5B31B 1KX3B 4WU9A 3UT9B 2NQBC 5AVCD 3UTAA 4KGCC 3VH6T 4J8UB 3MVDD 3UTBA 4J8WC 3LELC 4KGCA 3AYWD 3REJD 2CV5A 3MGSD 2BYMB 4J8WA 4CSRB 3AZGB 3B0DC 5GT3C 4DRBA 3REHD 3WTPC 5AV9A 4WU9B 4HGAC 4ZUXD 1HQ3C 5GT3A 5B33D 1BH9A 4Z2MH 2NQBB 5B32C 2HIOD 1P34B 5DNNC 4YS3A 5G49A 5AV6D 3B6FC 5B32A 3W98C 4J8WB 3LELB 1TZYA 3B6FA 3W98A 1KX4D 4XZQA 3B0DB 3C1CC 5GT3B 1BH9B 3WTPB 1P3MC 3KUYA 4HGAB 3C1CA 1HQ3B 2RVQD 3RELC 5G49B 5B32B 1BH8A 3RELA 5DNNB 4E45A 5BNXA 3B6FB 3W98B 3B6GC 3WAAD 4WU8A 1ID3D 3B6GA 5FUGA 5B2JC 3C1CB 1P3ID 3MGQC 1P3PC 5AV8D 5BS7C 1P3MB 5B1LD 4XUJC 3KWQC 5E5AD 3MGQA 3MGRD 3O62C 1P3PA 1BH8B 3RELB 3AZEB 3KWQA 5B31G 5BNXB 5CP6D 4Z5TD 3O62A 3REIC 2BYKB 5B1MD 3REKC 3B6GB 5FUGB 1P3OD 1P3KD 3REIA 4H9QA 3REKA 3X1VD 2AROD 3X1SC 2JSSA 4H9PA 5B2JB 4H9RA 3AFAC 3MGQB 4R8PC 1P3PB 3WTPE 1ZLAC 4XUJB 3KWQB 3AZFD 3AFAA 4H9SC 3MGPC 4R8PA 3LZ1C 3O62B 1ZLAA 1WWIA 4H9SA 3MGPA 3WA9D 1P3LD 3REKB 1M18C 4H9PB 3WKJC 3X1SB 1M18A 2NQBD 3AFAB 4YM6A 4R8PB 5JA4B 1P34D 4J8VC 1ZLAB 3MGPB 3LZ1B 2HUEC 4X23D 3LELD 4J8XC 3AZKD 5GSUA 1P3AC 5B0YC 4J8XA 1P3AA 5B0YA 3WTPD 2IO5C 1P3FC 1M18B 1HQ3D 5CHLB 2FJ7C 4UUZA 1M1AA 3WKJB 3B0BA 4JJNC 5BNVB 2PYOD 1M19A 5DNND 4J8VB 1F66A 2HUEB 3AZJC 4J8XB 5F99C 3KXBC 5B0ZC 1P3AB 3AZJA 5B0YB 1HTAA 3C1CD 1U35D 5B0ZA 3AZLC 5B24B 4UUZB 5DNMA 1P3MD 4QLCB 2IO5B 1AOIC 1P3GD 1P3FB 5CPJC 3VH5T 2FJ7B 3AZED 1AOIA 4JJNB 5GT0D 5CPJA 3AZNC 4G92C 3AZNA 3UTAC 4Z66D 1B6WA 3X1UC 5F99B 5B0ZB 3KXBB 3R45A 3UTBC 2CV5C 3C1BC 3AV2C 5B2JD 3X1UA 3AZLB 3C1BA 1P3PD 1AOIB 4XUJD 3B0CW 5B40C 3AV2A 5CPJB 5AV9C 1N1JB 5B40A 3AN2D 5JRGA 3AZNB 5AVBD 4G92B 3LJAA 5CPID 3UTAB 4YS3C 2NZDD 3X1UB 3UTBB 4KGCB 2CV5B 1TZYC 3C1BB 2F8NH 5AY8D 3X1SD 3AV2B 3AFAD 4XZQC 3AZMD 5B40B 5AV9B 3LZ1D 3KUYC 4LD9A 3TU4A 1ULYA 4AWLC 3NQJA 3AZHD 4YS3B 3AV1D 1TZYB 3WKJD 4WU8C 4XZQB 5B2IA 4J8VD 3X1TD 1KX5C 1F1EA 1S32D 3LZ0D 3KUYB 5GXQC 5CPKA 1KX5A 3W99C 1P3AD 3MNND 5GXQA 2YFWA 3A6ND 3AZIA 2F8NA 4AWLB 3W99A 1WWSA 5B24D 3W97A 4QLCD 5BO0A 1P3FD 1P3BC 3VH6W 3W96C 2FJ7D 4WU8B 4JJND 1P3BA 3W96A 5AV5D 1KX5B 5B31D 1KX3D 3UT9D 5GXQB 3NQUA 4NE5A 3MVDC 5F99D 3KXBD 3W99B 4J8UD 3AYWC 3REJC 5BO0B 3MVDA 3MGSC 3AZLD 3AYWA 3REJA 3MGSA 1P3BB 1BFMA 3W96B 1H3OA 3AZGD 3REHC 3REIB 4ZUXC 4H9QB 5B33C 4WU9D 3REHA 1TAFA 2YFVA 4H9RB 4EO5C 4ZUXA 4YM6C 5B33A 3UTAD 2HIOC 1Q9CA 4WZSB 3MVDB 3UTBD 2HIOA 4KGCD 2CV5D 3AYWB 5GSUC 3REJB 5AV6A 3MGSB 4J8WD 1KX4C 1H3OB 4CAYA 1KX4A 5AV9D 5B32G 4NE3A 3V9RA 5GT3D 4ZUXB 1M1AC 5B33B 2RVQC 4KHAA 4EO5B 4YM6B 2F8NK 1M19C 4YS3D 2HIOB 5B32D 1F66C 3WAAC 1TZYD 2CWEA 4H9NA 3B6FD 5GSUB 3W98D 3WAAA 1KX4B 4XZQD 1ID3A 1EQZC 5DNMC 3KUYD 5AV8C 4KHAB 5B1LC 1M1AB 1P3IA 1EQZA 5AV8A 5B1LA 4Z2MG 5E5AA 1M19B 4DRAA 5CP6C 3MGRA 4Z5TC 3RELD 4ZBJC 4H9NB 1F66B 5CP6A 3WAAB 4Z5TA 4WU8D 3B6GD 5B1MA 3X1VC 3AZJB 2AROC 1P3OA 1P3KA 1EQZB 5DNMB 3X1VA 2AROA 1JFIA 3VH6A 3MGQD 3AZFC 3KWQD 5JRGC 3AZFA 4KUDC 3O62D 5CP6B 4Z5TB 3LJAC 3WA9C 4ZBJB 1P3LC 4KUDA 2BYMA 3WA9A 4CSRA 3REID 1P3LA 3REKD 3R45B 3X1VB
chains in the Genus database with same CATH superfamily
2AROB 2Y2MA 1JFIB 1P34C 2NQBA 4R8PD 3AZFB 4LD9C 3TU4C 1ZLAD 2XD5A 1P34A 4X23C 5JRGB 3MGPD 3AZKC 4KUDB 4X23A 3LELA 3LJAB 3WA9B 1P3LB 3AZKA 2RIQA 4M6BA 3WTPA 1M18D 4E44A 4YM6D 1HQ3A 2Y2LA 2PYOC 5B2IC 2LY8A 2PYOA 3FDDA 5CPKC 4LD9B 3TU4B 2ZY2A 4NE6A 3VH5W 4G91C 5DNNA 5BT1C 4X23B 5GSUD 3AZKB 4J8XD 3AZIC 3NQJB 1U35C 5B0YD 2J8PA 3W97C 1P3GC 1U35A 1M1AD 3AZEC 4H9OA 1P3MA 1P3GA 5GT0C 2Y2JA 1M19D 2PYOB 5B2IB 3AZEA 4WNNA 5GT0A 1F66D 5CPKB 4Z66C 4G91B 5AVCC 2BYKA 3AZJD 4Z66A 2YFWB 3AZIB 5AVCA 2F8NB 3KSYA 4NFTA 5B0ZD 1U35B 5DNMD 1EQZD 3W97B 4H9OB 1P3GB 5B2JA 1AOID 5BS7A 4XUJA 5CPJD 3AN2C 4WNNB 5GT0B 5AVBC 2Y2KA 3AN2A 3AZND 5CPIC 5AVBA 2XD1A 4Z66B 3NQUB 5AVCB 2NZDC 5CPIA 5AV6C 2NZDA 5AY8C 3X1UD 3C1BD 3AV2D 3AZMC 5AY8A 3X1SA 5JA4A 5KDMA 3AZMA 5B40D 5JRGD 3AN2B 4KUDD 3REHB 1TAFB 2YFVB 5AVBB 3LZ1A 3LJAD 3AZHC 3H0RC 5CPIB 2NZDB 1W2EA 3AV1C 4WV4B 3AZHA 3B0CT 5AV6B 1R4VA 1KU5A 5AY8B 3AV1A 4CAYB 5KDMB 3WKJA 3AZMB 1ID3C 3X1TC 5BNVA 1S32C 3V9RB 3TU4D 4LD9D 3LZ0C 4J8VA 3X1TA 1P3IC 1S32A 3MNNC 3LZ0A 5E5AC 3A6NC 3MGRC 3AZHB 3MNNA 5B24C 1A7WA 4QLCC 3A6NA 5C3IC 3AV1B 5B24A 3VH5A 2FFFB 4QLCA 1P3FA 5B1MC 4UPKA 2F8NG 2FJ7A 5B2ID 1P3OC 1P3KC 5AV5C 1ID3B 4JJNA 3X1TB 5B31C 5CPKD 1S32B 1KX3C 3UT9C 3LZ0B 1KX5D 5AV5A 5BT1D 1P3IB 5B31A 1KX3A 5GXQD 5AV8B 2VQRA 3MNNB 5B1LB 3UT9A 3AZID 2F8ND 4J8UC 5E5AB 3W99D 3A6NB 3MGRB 5F99A 3KXBA 3W97D 4J8UA 5C3IB 2JE5A 3AZLA 3AZGC 4WJ3C 1P3BD 3W96D 5B1MB 1B67A 2L5AA 3AZGA 4WU9C 1P3OB 1P3KB 5AV5B 1N1JA 5B31B 1KX3B 4WU9A 3UT9B 2NQBC 5AVCD 3P5JB 3UTAA 4KGCC 3VH6T 4J8UB 3MVDD 3KFUG 3UTBA 4J8WC 3LELC 4KGCA 3AYWD 3REJD 2CV5A 3MGSD 2BYMB 4J8WA 4CSRB 3AZGB 3B0DC 5GT3C 4DRBA 3REHD 3WTPC 5AV9A 4WU9B 4HGAC 4ZUXD 1HQ3C 5GT3A 5B33D 1BH9A 4Z2MH 2NQBB 5B32C 2HIOD 1P34B 5DNNC 4YS3A 5G49A 5AV6D 3B6FC 5B32A 3W98C 4J8WB 3LELB 1TZYA 3B6FA 3W98A 1KX4D 4XZQA 3B0DB 3C1CC 5GT3B 1BH9B 3WTPB 1P3MC 3KUYA 4HGAB 3C1CA 1HQ3B 2RVQD 3RELC 5G49B 5B32B 1BH8A 3RELA 5DNNB 4E45A 5BNXA 3B6FB 3W98B 3B6GC 3WAAD 4WU8A 1ID3D 3B6GA 5FUGA 5B2JC 3C1CB 1P3ID 3MGQC 1P3PC 5AV8D 5BS7C 1P3MB 5B1LD 4XUJC 3KWQC 5E5AD 2UWXA 3MGQA 3MGRD 3O62C 1P3PA 1BH8B 3RELB 3AZEB 3KWQA 5B31G 5BNXB 5CP6D 4Z5TD 3O62A 3REIC 2BYKB 5B1MD 3REKC 3B6GB 2Y2QA 5FUGB 1P3OD 1P3KD 3REIA 4H9QA 3REKA 3X1VD 2AROD 3X1SC 2JSSA 4H9PA 5B2JB 4H9RA 3AFAC 3MGQB 4R8PC 1P3PB 3WTPE 1ZLAC 4XUJB 3KWQB 3AZFD 3AFAA 4H9SC 3MGPC 4R8PA 3LZ1C 3O62B 3EPHA 1ZLAA 1WWIA 4H9SA 3MGPA 3WA9D 1P3LD 3EPLA 3REKB 1M18C 4H9PB 3WKJC 3X1SB 1M18A 2NQBD 3AFAB 4YM6A 4R8PB 5JA4B 1P34D 4J8VC 1ZLAB 3MGPB 3LZ1B 2HUEC 4X23D 3LELD 4J8XC 3AZKD 5GSUA 1P3AC 5B0YC 4J8XA 1P3AA 5B0YA 3WTPD 2IO5C 1P3FC 1M18B 1HQ3D 5CHLB 2FJ7C 4UUZA 1M1AA 3WKJB 3B0BA 4JJNC 5BNVB 2PYOD 1M19A 5DNND 4J8VB 1F66A 2HUEB 3AZJC 4J8XB 3A1KA 5F99C 3KXBC 5B0ZC 1P3AB 3AZJA 5B0YB 1HTAA 3C1CD 1U35D 5B0ZA 3AZLC 5B24B 4UUZB 5DNMA 1P3MD 4QLCB 2IO5B 1AOIC 1P3GD 1P3FB 5CPJC 3VH5T 2FJ7B 2Y2NA 3AZED 1AOIA 4JJNB 5GT0D 5CPJA 3AZNC 4G92C 3AZNA 3UTAC 4Z66D 2ZY5A 1B6WA 5F99B 3X1UC 5B0ZB 3KXBB 3R45A 3UTBC 2CV5C 3C1BC 3AV2C 5B2JD 3X1UA 3AZLB 3C1BA 1P3PD 1PZRA 4XUJD 3B0CW 5B40C 3AV2A 1Z2CB 1AOIB 5CPJB 5AV9C 1N1JB 5B40A 3AN2D 5JRGA 3AZNB 5AVBD 4G92B 3LJAA 5CPID 3UTAB 4YS3C 2NZDD 3F6TA 3X1UB 3UTBB 4KGCB 2CV5B 1TZYC 3C1BB 2F8NH 2ZM5A 5AY8D 3X1SD 3AV2B 3AFAD 4XZQC 3AZMD 5B40B 5AV9B 3LZ1D 3KUYC 4LD9A 3TU4A 1ULYA 2DQNC 4AWLC 3NQJA 3AZHD 4YS3B 3AV1D 1TZYB 3WKJD 4WU8C 4XZQB 5B2IA 4J8VD 3X1TD 1KX5C 1F1EA 1S32D 2JCHA 3LZ0D 3KUYB 5GXQC 5CPKA 1KX5A 3W99C 1P3AD 3MNND 5GXQA 2YFWA 3A6ND 3AZIA 2F8NA 3EG5B 4AWLB 3W99A 1WWSA 5B24D 3W97A 4QLCD 5BO0A 1P3FD 3EPJA 1P3BC 3VH6W 3W96C 2FJ7D 4WU8B 4JJND 1P3BA 3W96A 5AV5D 1KX5B 3IP4C 5B31D 1KX3D 3UT9D 2F2AC 5GXQB 3NQUA 4NE5A 3MVDC 5F99D 3KXBD 3W99B 2G5HC 4J8UD 3REJC 5BO0B 3AYWC 3MVDA 3MGSC 3AZLD 3AYWA 3REJA 3MGSA 1P3BB 1BFMA 3W96B 1H3OA 3AZGD 3REHC 3REIB 4ZUXC 4H9QB 2Y2PA 5B33C 4WU9D 3REHA 1TAFA 2YFVA 4H9RB 4EO5C 4ZUXA 4YM6C 5B33A 3UTAD 2HIOC 1Q9CA 4WZSB 3MVDB 4DQYB 3UTBD 2HIOA 4KGCD 2CV5D 3AYWB 5GSUC 3REJB 5AV6A 3MGSB 4J8WD 1KX4C 1H3OB 3H0MC 4CAYA 2Y2IA 2BG1A 1KX4A 5AV9D 5B32G 4NE3A 3V9RA 5GT3D 4ZUXB 1M1AC 5B33B 2RVQC 4KHAA 4EO5B 4YM6B 2F8NK 1M19C 2HIOB 4YS3D 3AL0C 5B32D 1F66C 3WAAC 1TZYD 2CWEA 4H9NA 3B6FD 5GSUB 3W98D 3WAAA 1KX4B 4XZQD 2G5IC 1ID3A 1EQZC 5DNMC 3EPKA 3KUYD 5AV8C 4KHAB 5B1LC 2W8SA 1M1AB 1P3IA 1EQZA 3H0LC 5AV8A 5B1LA 4Z2MG 5E5AA 1M19B 4DRAA 5CP6C 3MGRA 4Z5TC 3RELD 4ZBJC 4H9NB 1F66B 5CP6A 3WAAB 4Z5TA 4WU8D 3B6GD 5B1MA 3X1VC 3AZJB 2AROC 1P3OA 1P3KA 1EQZB 5DNMB 3X1VA 2AROA 2Y2OA 1JFIA 3VH6A 3MGQD 3AZFC 2ZY3A 3KWQD 1T3UA 3A1IA 5JRGC 3AZFA 2Y2HA 3O62D 4KUDC 2ZY4A 5CP6B 4Z5TB 3LJAC 2DF4C 3WA9C 4ZBJB 1P3LC 4KUDA 2BYMA 3WA9A 4CSRA 3REID 2Y2GA 1P3LA 3REKD 3R45B 3X1VB
chains in the Genus database with same CATH topology
2AROB 2Y2MA 1JFIB 1P34C 2NQBA 4R8PD 3AZFB 4LD9C 3TU4C 1ZLAD 2XD5A 1P34A 4X23C 5JRGB 3MGPD 3AZKC 4KUDB 4X23A 3LELA 3LJAB 3WA9B 1P3LB 3AZKA 2RIQA 4M6BA 3WTPA 1M18D 4E44A 4YM6D 1HQ3A 2Y2LA 2PYOC 5B2IC 2LY8A 2PYOA 3FDDA 5CPKC 4LD9B 3TU4B 2ZY2A 4NE6A 3VH5W 4G91C 5DNNA 5BT1C 4X23B 5GSUD 3AZKB 4J8XD 3AZIC 3NQJB 1U35C 5B0YD 2J8PA 3W97C 1P3GC 1U35A 1M1AD 3AZEC 4H9OA 1P3MA 1P3GA 5GT0C 2Y2JA 1M19D 2PYOB 5B2IB 3AZEA 4WNNA 5GT0A 1F66D 5CPKB 4Z66C 4G91B 5AVCC 2BYKA 3AZJD 4Z66A 2YFWB 3AZIB 5AVCA 2F8NB 3KSYA 4NFTA 5B0ZD 1U35B 5DNMD 1EQZD 3W97B 4H9OB 1P3GB 5B2JA 1AOID 5BS7A 4XUJA 5CPJD 3AN2C 4WNNB 5GT0B 5AVBC 2Y2KA 3AN2A 3AZND 5CPIC 5AVBA 2XD1A 4Z66B 3NQUB 5AVCB 2NZDC 5CPIA 5AV6C 2NZDA 5AY8C 3X1UD 3C1BD 3AV2D 3AZMC 5AY8A 3X1SA 5JA4A 5KDMA 3AZMA 5B40D 5JRGD 3AN2B 4KUDD 3REHB 1TAFB 2YFVB 5AVBB 3LZ1A 3LJAD 3AZHC 3H0RC 5CPIB 2NZDB 1W2EA 3AV1C 4WV4B 3AZHA 3B0CT 5AV6B 1R4VA 1KU5A 5AY8B 3AV1A 4CAYB 5KDMB 3WKJA 3AZMB 1ID3C 3X1TC 5BNVA 1S32C 3V9RB 3TU4D 4LD9D 3LZ0C 4J8VA 3X1TA 1P3IC 1S32A 3MNNC 3LZ0A 5E5AC 3A6NC 3MGRC 3AZHB 3MNNA 5B24C 1A7WA 4QLCC 3A6NA 5C3IC 3AV1B 5B24A 3VH5A 2FFFB 4QLCA 1P3FA 5B1MC 4UPKA 2F8NG 2FJ7A 5B2ID 1P3OC 1P3KC 5AV5C 1ID3B 4JJNA 3X1TB 5B31C 5CPKD 1S32B 1KX3C 3UT9C 3LZ0B 1KX5D 5AV5A 5BT1D 1P3IB 5B31A 1KX3A 5GXQD 5AV8B 2VQRA 3MNNB 5B1LB 3UT9A 3AZID 2F8ND 4J8UC 5E5AB 3W99D 3A6NB 3MGRB 5F99A 3KXBA 3W97D 4J8UA 5C3IB 2JE5A 3AZLA 3AZGC 4WJ3C 1P3BD 3W96D 5B1MB 1B67A 2L5AA 3AZGA 4WU9C 1P3OB 1P3KB 5AV5B 1N1JA 5B31B 1KX3B 4WU9A 3UT9B 2NQBC 5AVCD 3P5JB 3UTAA 4KGCC 3VH6T 4J8UB 3MVDD 3KFUG 3UTBA 4J8WC 3LELC 4KGCA 3AYWD 3REJD 2CV5A 3MGSD 2BYMB 4J8WA 4CSRB 3AZGB 3B0DC 5GT3C 4DRBA 3REHD 3WTPC 5AV9A 4WU9B 4HGAC 4ZUXD 1HQ3C 5GT3A 5B33D 1BH9A 4Z2MH 2NQBB 5B32C 2HIOD 1P34B 5DNNC 4YS3A 5G49A 5AV6D 3B6FC 5B32A 3W98C 4J8WB 3LELB 1TZYA 3B6FA 3W98A 1KX4D 4XZQA 3B0DB 3C1CC 5GT3B 1BH9B 3WTPB 1P3MC 3KUYA 4HGAB 3C1CA 1HQ3B 2RVQD 3RELC 5G49B 5B32B 1BH8A 3RELA 5DNNB 4E45A 5BNXA 3B6FB 3W98B 3B6GC 3WAAD 4WU8A 1ID3D 3B6GA 5FUGA 5B2JC 3C1CB 1P3ID 3MGQC 1P3PC 5AV8D 5BS7C 1P3MB 5B1LD 4XUJC 3KWQC 5E5AD 2UWXA 3MGQA 3MGRD 3O62C 1P3PA 1BH8B 3RELB 3AZEB 3KWQA 5B31G 5BNXB 5CP6D 4Z5TD 3O62A 3REIC 2BYKB 5B1MD 3REKC 3B6GB 2Y2QA 5FUGB 1P3OD 1P3KD 3REIA 4H9QA 3REKA 3X1VD 2AROD 3X1SC 2JSSA 4H9PA 5B2JB 4H9RA 3AFAC 3MGQB 4R8PC 1P3PB 3WTPE 1ZLAC 4XUJB 3KWQB 3AZFD 3AFAA 4H9SC 3MGPC 4R8PA 3LZ1C 3O62B 3EPHA 1ZLAA 1WWIA 4H9SA 3MGPA 3WA9D 1P3LD 3EPLA 3REKB 1M18C 4H9PB 3WKJC 3X1SB 1M18A 2NQBD 3AFAB 4YM6A 4R8PB 5JA4B 1P34D 4J8VC 1ZLAB 3MGPB 3LZ1B 2HUEC 4X23D 3LELD 4J8XC 3AZKD 5GSUA 1P3AC 5B0YC 4J8XA 1P3AA 5B0YA 3WTPD 2IO5C 1P3FC 1M18B 1HQ3D 5CHLB 2FJ7C 4UUZA 1M1AA 3WKJB 3B0BA 4JJNC 5BNVB 2PYOD 1M19A 5DNND 4J8VB 1F66A 2HUEB 3AZJC 4J8XB 3A1KA 5F99C 3KXBC 5B0ZC 1P3AB 3AZJA 5B0YB 1HTAA 3C1CD 1U35D 5B0ZA 3AZLC 5B24B 4UUZB 5DNMA 1P3MD 4QLCB 2IO5B 1AOIC 1P3GD 1P3FB 5CPJC 3VH5T 2FJ7B 2Y2NA 3AZED 1AOIA 4JJNB 5GT0D 5CPJA 3AZNC 4G92C 3AZNA 3UTAC 4Z66D 2ZY5A 1B6WA 5F99B 3X1UC 5B0ZB 3KXBB 3R45A 3UTBC 2CV5C 3C1BC 3AV2C 5B2JD 3X1UA 3AZLB 3C1BA 1P3PD 1PZRA 4XUJD 3B0CW 5B40C 3AV2A 1Z2CB 1AOIB 5CPJB 5AV9C 1N1JB 5B40A 3AN2D 5JRGA 3AZNB 5AVBD 4G92B 3LJAA 5CPID 3UTAB 4YS3C 2NZDD 3F6TA 3X1UB 3UTBB 4KGCB 2CV5B 1TZYC 3C1BB 2F8NH 2ZM5A 5AY8D 3X1SD 3AV2B 3AFAD 4XZQC 3AZMD 5B40B 5AV9B 3LZ1D 3KUYC 4LD9A 3TU4A 1ULYA 2DQNC 4AWLC 3NQJA 3AZHD 4YS3B 3AV1D 1TZYB 3WKJD 4WU8C 4XZQB 5B2IA 4J8VD 3X1TD 1KX5C 1F1EA 1S32D 2JCHA 3LZ0D 3KUYB 5GXQC 5CPKA 1KX5A 3W99C 1P3AD 3MNND 5GXQA 2YFWA 3A6ND 3AZIA 2F8NA 3EG5B 4AWLB 3W99A 1WWSA 5B24D 3W97A 4QLCD 5BO0A 1P3FD 3EPJA 1P3BC 3VH6W 3W96C 2FJ7D 4WU8B 4JJND 1P3BA 3W96A 5AV5D 1KX5B 3IP4C 5B31D 1KX3D 3UT9D 2F2AC 5GXQB 3NQUA 4NE5A 3MVDC 5F99D 3KXBD 3W99B 2G5HC 4J8UD 3REJC 5BO0B 3AYWC 3MVDA 3MGSC 3AZLD 3AYWA 3REJA 3MGSA 1P3BB 1BFMA 3W96B 1H3OA 3AZGD 3REHC 3REIB 4ZUXC 4H9QB 2Y2PA 5B33C 4WU9D 3REHA 1TAFA 2YFVA 4H9RB 4EO5C 4ZUXA 4YM6C 5B33A 3UTAD 2HIOC 1Q9CA 4WZSB 3MVDB 4DQYB 3UTBD 2HIOA 4KGCD 2CV5D 3AYWB 5GSUC 3REJB 5AV6A 3MGSB 4J8WD 1KX4C 1H3OB 3H0MC 4CAYA 2Y2IA 2BG1A 1KX4A 5AV9D 5B32G 4NE3A 3V9RA 5GT3D 4ZUXB 1M1AC 5B33B 2RVQC 4KHAA 4EO5B 4YM6B 2F8NK 1M19C 2HIOB 4YS3D 3AL0C 5B32D 1F66C 3WAAC 1TZYD 2CWEA 4H9NA 3B6FD 5GSUB 3W98D 3WAAA 1KX4B 4XZQD 2G5IC 1ID3A 1EQZC 5DNMC 3EPKA 3KUYD 5AV8C 4KHAB 5B1LC 2W8SA 1M1AB 1P3IA 1EQZA 3H0LC 5AV8A 5B1LA 4Z2MG 5E5AA 1M19B 4DRAA 5CP6C 3MGRA 4Z5TC 3RELD 4ZBJC 4H9NB 1F66B 5CP6A 3WAAB 4Z5TA 4WU8D 3B6GD 5B1MA 3X1VC 3AZJB 2AROC 1P3OA 1P3KA 1EQZB 5DNMB 3X1VA 2AROA 2Y2OA 1JFIA 3VH6A 3MGQD 3AZFC 2ZY3A 3KWQD 1T3UA 3A1IA 5JRGC 3AZFA 2Y2HA 3O62D 4KUDC 2ZY4A 5CP6B 4Z5TB 3LJAC 2DF4C 3WA9C 4ZBJB 1P3LC 4KUDA 2BYMA 3WA9A 4CSRA 3REID 2Y2GA 1P3LA 3REKD 3R45B 3X1VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO B;  1JFI B;  1P34 C;  2NQB A;  4R8P D;  3AZF B;  4LD9 C;  3TU4 C;  1ZLA D;  1P34 A;  4X23 C;  5JRG B;  3MGP D;  3AZK C;  4KUD B;  4X23 A;  3LEL A;  3LJA B;  3WA9 B;  1P3L B;  3AZK A;  4M6B A;  3WTP A;  1M18 D;  4E44 A;  4YM6 D;  1HQ3 A;  2PYO C;  5B2I C;  2LY8 A;  2PYO A;  5CPK C;  4LD9 B;  3TU4 B;  4NE6 A;  3VH5 W;  4G91 C;  5DNN A;  5BT1 C;  4X23 B;  5GSU D;  3AZK B;  4J8X D;  3AZI C;  3NQJ B;  1U35 C;  5B0Y D;  3W97 C;  1P3G C;  1U35 A;  1M1A D;  3AZE C;  4H9O A;  1P3M A;  1P3G A;  5GT0 C;  1M19 D;  2PYO B;  5B2I B;  3AZE A;  4WNN A;  5GT0 A;  1F66 D;  5CPK B;  4Z66 C;  4G91 B;  5AVC C;  2BYK A;  3AZJ D;  4Z66 A;  2YFW B;  3AZI B;  5AVC A;  2F8N B;  3KSY A;  4NFT A;  5B0Z D;  1U35 B;  5DNM D;  1EQZ D;  3W97 B;  4H9O B;  1P3G B;  5B2J A;  1AOI D;  5BS7 A;  4XUJ A;  5CPJ D;  3AN2 C;  4WNN B;  5GT0 B;  5AVB C;  3AN2 A;  3AZN D;  5CPI C;  5AVB A;  4Z66 B;  3NQU B;  5AVC B;  2NZD C;  5CPI A;  5AV6 C;  2NZD A;  5AY8 C;  3X1U D;  3C1B D;  3AV2 D;  3AZM C;  5AY8 A;  3X1S A;  5JA4 A;  5KDM A;  3AZM A;  5B40 D;  5JRG D;  3AN2 B;  4KUD D;  3REH B;  1TAF B;  2YFV B;  5AVB B;  3LZ1 A;  3LJA D;  3AZH C;  5CPI B;  2NZD B;  3AV1 C;  4WV4 B;  3AZH A;  3B0C T;  5AV6 B;  1R4V A;  1KU5 A;  5AY8 B;  3AV1 A;  4CAY B;  5KDM B;  3WKJ A;  3AZM B;  1ID3 C;  3X1T C;  5BNV A;  1S32 C;  3V9R B;  3TU4 D;  4LD9 D;  3LZ0 C;  4J8V A;  3X1T A;  1P3I C;  1S32 A;  3MNN C;  3LZ0 A;  5E5A C;  3A6N C;  3MGR C;  3AZH B;  3MNN A;  5B24 C;  1A7W A;  4QLC C;  3A6N A;  5C3I C;  3AV1 B;  5B24 A;  3VH5 A;  4QLC A;  1P3F A;  5B1M C;  2F8N G;  2FJ7 A;  5B2I D;  1P3O C;  1P3K C;  5AV5 C;  1ID3 B;  4JJN A;  3X1T B;  5B31 C;  5CPK D;  1S32 B;  1KX3 C;  3UT9 C;  3LZ0 B;  1KX5 D;  5AV5 A;  5BT1 D;  1P3I B;  5B31 A;  1KX3 A;  5GXQ D;  5AV8 B;  3MNN B;  3UT9 A;  5B1L B;  3AZI D;  2F8N D;  4J8U C;  5E5A B;  3W99 D;  3A6N B;  3MGR B;  5F99 A;  3KXB A;  3W97 D;  4J8U A;  5C3I B;  3AZL A;  3AZG C;  1P3B D;  3W96 D;  5B1M B;  1B67 A;  2L5A A;  3AZG A;  4WU9 C;  1P3O B;  1P3K B;  5AV5 B;  1N1J A;  5B31 B;  1KX3 B;  4WU9 A;  3UT9 B;  2NQB C;  5AVC D;  3UTA A;  4KGC C;  3VH6 T;  4J8U B;  3MVD D;  3UTB A;  4J8W C;  3LEL C;  4KGC A;  3AYW D;  3REJ D;  2CV5 A;  3MGS D;  2BYM B;  4J8W A;  4CSR B;  3AZG B;  3B0D C;  5GT3 C;  4DRB A;  3REH D;  3WTP C;  5AV9 A;  4WU9 B;  4HGA C;  4ZUX D;  1HQ3 C;  5GT3 A;  5B33 D;  1BH9 A;  4Z2M H;  2NQB B;  5B32 C;  2HIO D;  1P34 B;  5DNN C;  4YS3 A;  5G49 A;  5AV6 D;  3B6F C;  5B32 A;  3W98 C;  4J8W B;  3LEL B;  1TZY A;  3B6F A;  3W98 A;  1KX4 D;  4XZQ A;  3B0D B;  3C1C C;  5GT3 B;  1BH9 B;  3WTP B;  1P3M C;  3KUY A;  4HGA B;  3C1C A;  1HQ3 B;  2RVQ D;  3REL C;  5G49 B;  5B32 B;  1BH8 A;  3REL A;  5DNN B;  4E45 A;  5BNX A;  3B6F B;  3W98 B;  3B6G C;  3WAA D;  4WU8 A;  1ID3 D;  3B6G A;  5FUG A;  5B2J C;  3C1C B;  1P3I D;  3MGQ C;  1P3P C;  5AV8 D;  5BS7 C;  1P3M B;  5B1L D;  4XUJ C;  3KWQ C;  5E5A D;  3MGQ A;  3MGR D;  3O62 C;  1P3P A;  1BH8 B;  3REL B;  3AZE B;  3KWQ A;  5B31 G;  5BNX B;  5CP6 D;  4Z5T D;  3O62 A;  3REI C;  2BYK B;  5B1M D;  3REK C;  3B6G B;  5FUG B;  1P3O D;  1P3K D;  3REI A;  4H9Q A;  3REK A;  3X1V D;  2ARO D;  3X1S C;  2JSS A;  4H9P A;  5B2J B;  4H9R A;  3AFA C;  3MGQ B;  4R8P C;  1P3P B;  3WTP E;  1ZLA C;  4XUJ B;  3KWQ B;  3AZF D;  3AFA A;  4H9S C;  3MGP C;  4R8P A;  3LZ1 C;  3O62 B;  1ZLA A;  1WWI A;  4H9S A;  3MGP A;  3WA9 D;  1P3L D;  3REK B;  1M18 C;  4H9P B;  3WKJ C;  3X1S B;  1M18 A;  2NQB D;  3AFA B;  4YM6 A;  4R8P B;  5JA4 B;  1P34 D;  4J8V C;  1ZLA B;  3MGP B;  3LZ1 B;  2HUE C;  4X23 D;  3LEL D;  4J8X C;  3AZK D;  5GSU A;  1P3A C;  5B0Y C;  4J8X A;  1P3A A;  5B0Y A;  3WTP D;  2IO5 C;  1P3F C;  1M18 B;  1HQ3 D;  5CHL B;  2FJ7 C;  4UUZ A;  1M1A A;  3WKJ B;  3B0B A;  4JJN C;  5BNV B;  2PYO D;  1M19 A;  5DNN D;  4J8V B;  1F66 A;  2HUE B;  3AZJ C;  4J8X B;  5F99 C;  3KXB C;  5B0Z C;  1P3A B;  3AZJ A;  5B0Y B;  1HTA A;  3C1C D;  1U35 D;  5B0Z A;  3AZL C;  5B24 B;  4UUZ B;  5DNM A;  1P3M D;  4QLC B;  2IO5 B;  1AOI C;  1P3G D;  1P3F B;  5CPJ C;  3VH5 T;  2FJ7 B;  3AZE D;  1AOI A;  4JJN B;  5GT0 D;  5CPJ A;  3AZN C;  4G92 C;  3AZN A;  3UTA C;  4Z66 D;  1B6W A;  3X1U C;  5F99 B;  5B0Z B;  3KXB B;  3R45 A;  3UTB C;  2CV5 C;  3C1B C;  3AV2 C;  5B2J D;  3X1U A;  3AZL B;  3C1B A;  1P3P D;  1AOI B;  4XUJ D;  3B0C W;  5B40 C;  3AV2 A;  5CPJ B;  5AV9 C;  1N1J B;  5B40 A;  3AN2 D;  5JRG A;  3AZN B;  5AVB D;  4G92 B;  3LJA A;  5CPI D;  3UTA B;  4YS3 C;  2NZD D;  3X1U B;  3UTB B;  4KGC B;  2CV5 B;  1TZY C;  3C1B B;  2F8N H;  5AY8 D;  3X1S D;  3AV2 B;  3AFA D;  4XZQ C;  3AZM D;  5B40 B;  5AV9 B;  3LZ1 D;  3KUY C;  4LD9 A;  3TU4 A;  1ULY A;  4AWL C;  3NQJ A;  3AZH D;  4YS3 B;  3AV1 D;  1TZY B;  3WKJ D;  4WU8 C;  4XZQ B;  5B2I A;  4J8V D;  3X1T D;  1KX5 C;  1F1E A;  1S32 D;  3LZ0 D;  3KUY B;  5GXQ C;  5CPK A;  1KX5 A;  3W99 C;  1P3A D;  3MNN D;  5GXQ A;  2YFW A;  3A6N D;  3AZI A;  2F8N A;  4AWL B;  3W99 A;  1WWS A;  5B24 D;  3W97 A;  4QLC D;  5BO0 A;  1P3F D;  1P3B C;  3VH6 W;  3W96 C;  2FJ7 D;  4WU8 B;  4JJN D;  1P3B A;  3W96 A;  5AV5 D;  1KX5 B;  5B31 D;  1KX3 D;  3UT9 D;  5GXQ B;  3NQU A;  4NE5 A;  3MVD C;  5F99 D;  3KXB D;  3W99 B;  4J8U D;  3AYW C;  3REJ C;  5BO0 B;  3MVD A;  3MGS C;  3AZL D;  3AYW A;  3REJ A;  3MGS A;  1P3B B;  1BFM A;  3W96 B;  1H3O A;  3AZG D;  3REH C;  3REI B;  4ZUX C;  4H9Q B;  5B33 C;  4WU9 D;  3REH A;  1TAF A;  2YFV A;  4H9R B;  4EO5 C;  4ZUX A;  4YM6 C;  5B33 A;  3UTA D;  2HIO C;  1Q9C A;  4WZS B;  3MVD B;  3UTB D;  2HIO A;  4KGC D;  2CV5 D;  3AYW B;  5GSU C;  3REJ B;  5AV6 A;  3MGS B;  4J8W D;  1KX4 C;  1H3O B;  4CAY A;  1KX4 A;  5AV9 D;  5B32 G;  4NE3 A;  3V9R A;  5GT3 D;  4ZUX B;  1M1A C;  5B33 B;  2RVQ C;  4KHA A;  4EO5 B;  4YM6 B;  2F8N K;  1M19 C;  4YS3 D;  2HIO B;  5B32 D;  1F66 C;  3WAA C;  1TZY D;  2CWE A;  4H9N A;  3B6F D;  5GSU B;  3W98 D;  3WAA A;  1KX4 B;  4XZQ D;  1ID3 A;  1EQZ C;  5DNM C;  3KUY D;  5AV8 C;  4KHA B;  5B1L C;  1M1A B;  1P3I A;  1EQZ A;  5AV8 A;  5B1L A;  4Z2M G;  5E5A A;  1M19 B;  4DRA A;  5CP6 C;  3MGR A;  4Z5T C;  3REL D;  4ZBJ C;  4H9N B;  1F66 B;  5CP6 A;  3WAA B;  4Z5T A;  4WU8 D;  3B6G D;  5B1M A;  3X1V C;  3AZJ B;  2ARO C;  1P3O A;  1P3K A;  1EQZ B;  5DNM B;  3X1V A;  2ARO A;  1JFI A;  3VH6 A;  3MGQ D;  3AZF C;  3KWQ D;  5JRG C;  3AZF A;  4KUD C;  3O62 D;  5CP6 B;  4Z5T B;  3LJA C;  3WA9 C;  4ZBJ B;  1P3L C;  4KUD A;  2BYM A;  3WA9 A;  4CSR A;  3REI D;  1P3L A;  3REK D;  3R45 B;  3X1V B; 
#chains in the Genus database with same CATH topology
 2ARO B;  2Y2M A;  1JFI B;  1P34 C;  2NQB A;  4R8P D;  3AZF B;  4LD9 C;  3TU4 C;  1ZLA D;  2XD5 A;  1P34 A;  4X23 C;  5JRG B;  3MGP D;  3AZK C;  4KUD B;  4X23 A;  3LEL A;  3LJA B;  3WA9 B;  1P3L B;  3AZK A;  2RIQ A;  4M6B A;  3WTP A;  1M18 D;  4E44 A;  4YM6 D;  1HQ3 A;  2Y2L A;  2PYO C;  5B2I C;  2LY8 A;  2PYO A;  3FDD A;  5CPK C;  4LD9 B;  3TU4 B;  2ZY2 A;  4NE6 A;  3VH5 W;  4G91 C;  5DNN A;  5BT1 C;  4X23 B;  5GSU D;  3AZK B;  4J8X D;  3AZI C;  3NQJ B;  1U35 C;  5B0Y D;  2J8P A;  3W97 C;  1P3G C;  1U35 A;  1M1A D;  3AZE C;  4H9O A;  1P3M A;  1P3G A;  5GT0 C;  2Y2J A;  1M19 D;  2PYO B;  5B2I B;  3AZE A;  4WNN A;  5GT0 A;  1F66 D;  5CPK B;  4Z66 C;  4G91 B;  5AVC C;  2BYK A;  3AZJ D;  4Z66 A;  2YFW B;  3AZI B;  5AVC A;  2F8N B;  3KSY A;  4NFT A;  5B0Z D;  1U35 B;  5DNM D;  1EQZ D;  3W97 B;  4H9O B;  1P3G B;  5B2J A;  1AOI D;  5BS7 A;  4XUJ A;  5CPJ D;  3AN2 C;  4WNN B;  5GT0 B;  5AVB C;  2Y2K A;  3AN2 A;  3AZN D;  5CPI C;  5AVB A;  2XD1 A;  4Z66 B;  3NQU B;  5AVC B;  2NZD C;  5CPI A;  5AV6 C;  2NZD A;  5AY8 C;  3X1U D;  3C1B D;  3AV2 D;  3AZM C;  5AY8 A;  3X1S A;  5JA4 A;  5KDM A;  3AZM A;  5B40 D;  5JRG D;  3AN2 B;  4KUD D;  3REH B;  1TAF B;  2YFV B;  5AVB B;  3LZ1 A;  3LJA D;  3AZH C;  3H0R C;  5CPI B;  2NZD B;  1W2E A;  3AV1 C;  4WV4 B;  3AZH A;  3B0C T;  5AV6 B;  1R4V A;  1KU5 A;  5AY8 B;  3AV1 A;  4CAY B;  5KDM B;  3WKJ A;  3AZM B;  1ID3 C;  3X1T C;  5BNV A;  1S32 C;  3V9R B;  3TU4 D;  4LD9 D;  3LZ0 C;  4J8V A;  3X1T A;  1P3I C;  1S32 A;  3MNN C;  3LZ0 A;  5E5A C;  3A6N C;  3MGR C;  3AZH B;  3MNN A;  5B24 C;  1A7W A;  4QLC C;  3A6N A;  5C3I C;  3AV1 B;  5B24 A;  3VH5 A;  2FFF B;  4QLC A;  1P3F A;  5B1M C;  4UPK A;  2F8N G;  2FJ7 A;  5B2I D;  1P3O C;  1P3K C;  5AV5 C;  1ID3 B;  4JJN A;  3X1T B;  5B31 C;  5CPK D;  1S32 B;  1KX3 C;  3UT9 C;  3LZ0 B;  1KX5 D;  5AV5 A;  5BT1 D;  1P3I B;  5B31 A;  1KX3 A;  5GXQ D;  5AV8 B;  2VQR A;  3MNN B;  5B1L B;  3UT9 A;  3AZI D;  2F8N D;  4J8U C;  5E5A B;  3W99 D;  3A6N B;  3MGR B;  5F99 A;  3KXB A;  3W97 D;  4J8U A;  5C3I B;  2JE5 A;  3AZL A;  3AZG C;  4WJ3 C;  1P3B D;  3W96 D;  5B1M B;  1B67 A;  2L5A A;  3AZG A;  4WU9 C;  1P3O B;  1P3K B;  5AV5 B;  1N1J A;  5B31 B;  1KX3 B;  4WU9 A;  3UT9 B;  2NQB C;  5AVC D;  3P5J B;  3UTA A;  4KGC C;  3VH6 T;  4J8U B;  3MVD D;  3KFU G;  3UTB A;  4J8W C;  3LEL C;  4KGC A;  3AYW D;  3REJ D;  2CV5 A;  3MGS D;  2BYM B;  4J8W A;  4CSR B;  3AZG B;  3B0D C;  5GT3 C;  4DRB A;  3REH D;  3WTP C;  5AV9 A;  4WU9 B;  4HGA C;  4ZUX D;  1HQ3 C;  5GT3 A;  5B33 D;  1BH9 A;  4Z2M H;  2NQB B;  5B32 C;  2HIO D;  1P34 B;  5DNN C;  4YS3 A;  5G49 A;  5AV6 D;  3B6F C;  5B32 A;  3W98 C;  4J8W B;  3LEL B;  1TZY A;  3B6F A;  3W98 A;  1KX4 D;  4XZQ A;  3B0D B;  3C1C C;  5GT3 B;  1BH9 B;  3WTP B;  1P3M C;  3KUY A;  4HGA B;  3C1C A;  1HQ3 B;  2RVQ D;  3REL C;  5G49 B;  5B32 B;  1BH8 A;  3REL A;  5DNN B;  4E45 A;  5BNX A;  3B6F B;  3W98 B;  3B6G C;  3WAA D;  4WU8 A;  1ID3 D;  3B6G A;  5FUG A;  5B2J C;  3C1C B;  1P3I D;  3MGQ C;  1P3P C;  5AV8 D;  5BS7 C;  1P3M B;  5B1L D;  4XUJ C;  3KWQ C;  5E5A D;  2UWX A;  3MGQ A;  3MGR D;  3O62 C;  1P3P A;  1BH8 B;  3REL B;  3AZE B;  3KWQ A;  5B31 G;  5BNX B;  5CP6 D;  4Z5T D;  3O62 A;  3REI C;  2BYK B;  5B1M D;  3REK C;  3B6G B;  2Y2Q A;  5FUG B;  1P3O D;  1P3K D;  3REI A;  4H9Q A;  3REK A;  3X1V D;  2ARO D;  3X1S C;  2JSS A;  4H9P A;  5B2J B;  4H9R A;  3AFA C;  3MGQ B;  4R8P C;  1P3P B;  3WTP E;  1ZLA C;  4XUJ B;  3KWQ B;  3AZF D;  3AFA A;  4H9S C;  3MGP C;  4R8P A;  3LZ1 C;  3O62 B;  3EPH A;  1ZLA A;  1WWI A;  4H9S A;  3MGP A;  3WA9 D;  1P3L D;  3EPL A;  3REK B;  1M18 C;  4H9P B;  3WKJ C;  3X1S B;  1M18 A;  2NQB D;  3AFA B;  4YM6 A;  4R8P B;  5JA4 B;  1P34 D;  4J8V C;  1ZLA B;  3MGP B;  3LZ1 B;  2HUE C;  4X23 D;  3LEL D;  4J8X C;  3AZK D;  5GSU A;  1P3A C;  5B0Y C;  4J8X A;  1P3A A;  5B0Y A;  3WTP D;  2IO5 C;  1P3F C;  1M18 B;  1HQ3 D;  5CHL B;  2FJ7 C;  4UUZ A;  1M1A A;  3WKJ B;  3B0B A;  4JJN C;  5BNV B;  2PYO D;  1M19 A;  5DNN D;  4J8V B;  1F66 A;  2HUE B;  3AZJ C;  4J8X B;  3A1K A;  5F99 C;  3KXB C;  5B0Z C;  1P3A B;  3AZJ A;  5B0Y B;  1HTA A;  3C1C D;  1U35 D;  5B0Z A;  3AZL C;  5B24 B;  4UUZ B;  5DNM A;  1P3M D;  4QLC B;  2IO5 B;  1AOI C;  1P3G D;  1P3F B;  5CPJ C;  3VH5 T;  2FJ7 B;  2Y2N A;  3AZE D;  1AOI A;  4JJN B;  5GT0 D;  5CPJ A;  3AZN C;  4G92 C;  3AZN A;  3UTA C;  4Z66 D;  2ZY5 A;  1B6W A;  5F99 B;  3X1U C;  5B0Z B;  3KXB B;  3R45 A;  3UTB C;  2CV5 C;  3C1B C;  3AV2 C;  5B2J D;  3X1U A;  3AZL B;  3C1B A;  1P3P D;  1PZR A;  4XUJ D;  3B0C W;  5B40 C;  3AV2 A;  1Z2C B;  1AOI B;  5CPJ B;  5AV9 C;  1N1J B;  5B40 A;  3AN2 D;  5JRG A;  3AZN B;  5AVB D;  4G92 B;  3LJA A;  5CPI D;  3UTA B;  4YS3 C;  2NZD D;  3F6T A;  3X1U B;  3UTB B;  4KGC B;  2CV5 B;  1TZY C;  3C1B B;  2F8N H;  2ZM5 A;  5AY8 D;  3X1S D;  3AV2 B;  3AFA D;  4XZQ C;  3AZM D;  5B40 B;  5AV9 B;  3LZ1 D;  3KUY C;  4LD9 A;  3TU4 A;  1ULY A;  2DQN C;  4AWL C;  3NQJ A;  3AZH D;  4YS3 B;  3AV1 D;  1TZY B;  3WKJ D;  4WU8 C;  4XZQ B;  5B2I A;  4J8V D;  3X1T D;  1KX5 C;  1F1E A;  1S32 D;  2JCH A;  3LZ0 D;  3KUY B;  5GXQ C;  5CPK A;  1KX5 A;  3W99 C;  1P3A D;  3MNN D;  5GXQ A;  2YFW A;  3A6N D;  3AZI A;  2F8N A;  3EG5 B;  4AWL B;  3W99 A;  1WWS A;  5B24 D;  3W97 A;  4QLC D;  5BO0 A;  1P3F D;  3EPJ A;  1P3B C;  3VH6 W;  3W96 C;  2FJ7 D;  4WU8 B;  4JJN D;  1P3B A;  3W96 A;  5AV5 D;  1KX5 B;  3IP4 C;  5B31 D;  1KX3 D;  3UT9 D;  2F2A C;  5GXQ B;  3NQU A;  4NE5 A;  3MVD C;  5F99 D;  3KXB D;  3W99 B;  2G5H C;  4J8U D;  3REJ C;  5BO0 B;  3AYW C;  3MVD A;  3MGS C;  3AZL D;  3AYW A;  3REJ A;  3MGS A;  1P3B B;  1BFM A;  3W96 B;  1H3O A;  3AZG D;  3REH C;  3REI B;  4ZUX C;  4H9Q B;  2Y2P A;  5B33 C;  4WU9 D;  3REH A;  1TAF A;  2YFV A;  4H9R B;  4EO5 C;  4ZUX A;  4YM6 C;  5B33 A;  3UTA D;  2HIO C;  1Q9C A;  4WZS B;  3MVD B;  4DQY B;  3UTB D;  2HIO A;  4KGC D;  2CV5 D;  3AYW B;  5GSU C;  3REJ B;  5AV6 A;  3MGS B;  4J8W D;  1KX4 C;  1H3O B;  3H0M C;  4CAY A;  2Y2I A;  2BG1 A;  1KX4 A;  5AV9 D;  5B32 G;  4NE3 A;  3V9R A;  5GT3 D;  4ZUX B;  1M1A C;  5B33 B;  2RVQ C;  4KHA A;  4EO5 B;  4YM6 B;  2F8N K;  1M19 C;  2HIO B;  4YS3 D;  3AL0 C;  5B32 D;  1F66 C;  3WAA C;  1TZY D;  2CWE A;  4H9N A;  3B6F D;  5GSU B;  3W98 D;  3WAA A;  1KX4 B;  4XZQ D;  2G5I C;  1ID3 A;  1EQZ C;  5DNM C;  3EPK A;  3KUY D;  5AV8 C;  4KHA B;  5B1L C;  2W8S A;  1M1A B;  1P3I A;  1EQZ A;  3H0L C;  5AV8 A;  5B1L A;  4Z2M G;  5E5A A;  1M19 B;  4DRA A;  5CP6 C;  3MGR A;  4Z5T C;  3REL D;  4ZBJ C;  4H9N B;  1F66 B;  5CP6 A;  3WAA B;  4Z5T A;  4WU8 D;  3B6G D;  5B1M A;  3X1V C;  3AZJ B;  2ARO C;  1P3O A;  1P3K A;  1EQZ B;  5DNM B;  3X1V A;  2ARO A;  2Y2O A;  1JFI A;  3VH6 A;  3MGQ D;  3AZF C;  2ZY3 A;  3KWQ D;  1T3U A;  3A1I A;  5JRG C;  3AZF A;  2Y2H A;  3O62 D;  4KUD C;  2ZY4 A;  5CP6 B;  4Z5T B;  3LJA C;  2DF4 C;  3WA9 C;  4ZBJ B;  1P3L C;  4KUD A;  2BYM A;  3WA9 A;  4CSR A;  3REI D;  2Y2G A;  1P3L A;  3REK D;  3R45 B;  3X1V B; 
#chains in the Genus database with same CATH homology
 2ARO B;  2Y2M A;  1JFI B;  1P34 C;  2NQB A;  4R8P D;  3AZF B;  4LD9 C;  3TU4 C;  1ZLA D;  2XD5 A;  1P34 A;  4X23 C;  5JRG B;  3MGP D;  3AZK C;  4KUD B;  4X23 A;  3LEL A;  3LJA B;  3WA9 B;  1P3L B;  3AZK A;  2RIQ A;  4M6B A;  3WTP A;  1M18 D;  4E44 A;  4YM6 D;  1HQ3 A;  2Y2L A;  2PYO C;  5B2I C;  2LY8 A;  2PYO A;  3FDD A;  5CPK C;  4LD9 B;  3TU4 B;  2ZY2 A;  4NE6 A;  3VH5 W;  4G91 C;  5DNN A;  5BT1 C;  4X23 B;  5GSU D;  3AZK B;  4J8X D;  3AZI C;  3NQJ B;  1U35 C;  5B0Y D;  2J8P A;  3W97 C;  1P3G C;  1U35 A;  1M1A D;  3AZE C;  4H9O A;  1P3M A;  1P3G A;  5GT0 C;  2Y2J A;  1M19 D;  2PYO B;  5B2I B;  3AZE A;  4WNN A;  5GT0 A;  1F66 D;  5CPK B;  4Z66 C;  4G91 B;  5AVC C;  2BYK A;  3AZJ D;  4Z66 A;  2YFW B;  3AZI B;  5AVC A;  2F8N B;  3KSY A;  4NFT A;  5B0Z D;  1U35 B;  5DNM D;  1EQZ D;  3W97 B;  4H9O B;  1P3G B;  5B2J A;  1AOI D;  5BS7 A;  4XUJ A;  5CPJ D;  3AN2 C;  4WNN B;  5GT0 B;  5AVB C;  2Y2K A;  3AN2 A;  3AZN D;  5CPI C;  5AVB A;  2XD1 A;  4Z66 B;  3NQU B;  5AVC B;  2NZD C;  5CPI A;  5AV6 C;  2NZD A;  5AY8 C;  3X1U D;  3C1B D;  3AV2 D;  3AZM C;  5AY8 A;  3X1S A;  5JA4 A;  5KDM A;  3AZM A;  5B40 D;  5JRG D;  3AN2 B;  4KUD D;  3REH B;  1TAF B;  2YFV B;  5AVB B;  3LZ1 A;  3LJA D;  3AZH C;  3H0R C;  5CPI B;  2NZD B;  1W2E A;  3AV1 C;  4WV4 B;  3AZH A;  3B0C T;  5AV6 B;  1R4V A;  1KU5 A;  5AY8 B;  3AV1 A;  4CAY B;  5KDM B;  3WKJ A;  3AZM B;  1ID3 C;  3X1T C;  5BNV A;  1S32 C;  3V9R B;  3TU4 D;  4LD9 D;  3LZ0 C;  4J8V A;  3X1T A;  1P3I C;  1S32 A;  3MNN C;  3LZ0 A;  5E5A C;  3A6N C;  3MGR C;  3AZH B;  3MNN A;  5B24 C;  1A7W A;  4QLC C;  3A6N A;  5C3I C;  3AV1 B;  5B24 A;  3VH5 A;  2FFF B;  4QLC A;  1P3F A;  5B1M C;  4UPK A;  2F8N G;  2FJ7 A;  5B2I D;  1P3O C;  1P3K C;  5AV5 C;  1ID3 B;  4JJN A;  3X1T B;  5B31 C;  5CPK D;  1S32 B;  1KX3 C;  3UT9 C;  3LZ0 B;  1KX5 D;  5AV5 A;  5BT1 D;  1P3I B;  5B31 A;  1KX3 A;  5GXQ D;  5AV8 B;  2VQR A;  3MNN B;  5B1L B;  3UT9 A;  3AZI D;  2F8N D;  4J8U C;  5E5A B;  3W99 D;  3A6N B;  3MGR B;  5F99 A;  3KXB A;  3W97 D;  4J8U A;  5C3I B;  2JE5 A;  3AZL A;  3AZG C;  4WJ3 C;  1P3B D;  3W96 D;  5B1M B;  1B67 A;  2L5A A;  3AZG A;  4WU9 C;  1P3O B;  1P3K B;  5AV5 B;  1N1J A;  5B31 B;  1KX3 B;  4WU9 A;  3UT9 B;  2NQB C;  5AVC D;  3P5J B;  3UTA A;  4KGC C;  3VH6 T;  4J8U B;  3MVD D;  3KFU G;  3UTB A;  4J8W C;  3LEL C;  4KGC A;  3AYW D;  3REJ D;  2CV5 A;  3MGS D;  2BYM B;  4J8W A;  4CSR B;  3AZG B;  3B0D C;  5GT3 C;  4DRB A;  3REH D;  3WTP C;  5AV9 A;  4WU9 B;  4HGA C;  4ZUX D;  1HQ3 C;  5GT3 A;  5B33 D;  1BH9 A;  4Z2M H;  2NQB B;  5B32 C;  2HIO D;  1P34 B;  5DNN C;  4YS3 A;  5G49 A;  5AV6 D;  3B6F C;  5B32 A;  3W98 C;  4J8W B;  3LEL B;  1TZY A;  3B6F A;  3W98 A;  1KX4 D;  4XZQ A;  3B0D B;  3C1C C;  5GT3 B;  1BH9 B;  3WTP B;  1P3M C;  3KUY A;  4HGA B;  3C1C A;  1HQ3 B;  2RVQ D;  3REL C;  5G49 B;  5B32 B;  1BH8 A;  3REL A;  5DNN B;  4E45 A;  5BNX A;  3B6F B;  3W98 B;  3B6G C;  3WAA D;  4WU8 A;  1ID3 D;  3B6G A;  5FUG A;  5B2J C;  3C1C B;  1P3I D;  3MGQ C;  1P3P C;  5AV8 D;  5BS7 C;  1P3M B;  5B1L D;  4XUJ C;  3KWQ C;  5E5A D;  2UWX A;  3MGQ A;  3MGR D;  3O62 C;  1P3P A;  1BH8 B;  3REL B;  3AZE B;  3KWQ A;  5B31 G;  5BNX B;  5CP6 D;  4Z5T D;  3O62 A;  3REI C;  2BYK B;  5B1M D;  3REK C;  3B6G B;  2Y2Q A;  5FUG B;  1P3O D;  1P3K D;  3REI A;  4H9Q A;  3REK A;  3X1V D;  2ARO D;  3X1S C;  2JSS A;  4H9P A;  5B2J B;  4H9R A;  3AFA C;  3MGQ B;  4R8P C;  1P3P B;  3WTP E;  1ZLA C;  4XUJ B;  3KWQ B;  3AZF D;  3AFA A;  4H9S C;  3MGP C;  4R8P A;  3LZ1 C;  3O62 B;  3EPH A;  1ZLA A;  1WWI A;  4H9S A;  3MGP A;  3WA9 D;  1P3L D;  3EPL A;  3REK B;  1M18 C;  4H9P B;  3WKJ C;  3X1S B;  1M18 A;  2NQB D;  3AFA B;  4YM6 A;  4R8P B;  5JA4 B;  1P34 D;  4J8V C;  1ZLA B;  3MGP B;  3LZ1 B;  2HUE C;  4X23 D;  3LEL D;  4J8X C;  3AZK D;  5GSU A;  1P3A C;  5B0Y C;  4J8X A;  1P3A A;  5B0Y A;  3WTP D;  2IO5 C;  1P3F C;  1M18 B;  1HQ3 D;  5CHL B;  2FJ7 C;  4UUZ A;  1M1A A;  3WKJ B;  3B0B A;  4JJN C;  5BNV B;  2PYO D;  1M19 A;  5DNN D;  4J8V B;  1F66 A;  2HUE B;  3AZJ C;  4J8X B;  3A1K A;  5F99 C;  3KXB C;  5B0Z C;  1P3A B;  3AZJ A;  5B0Y B;  1HTA A;  3C1C D;  1U35 D;  5B0Z A;  3AZL C;  5B24 B;  4UUZ B;  5DNM A;  1P3M D;  4QLC B;  2IO5 B;  1AOI C;  1P3G D;  1P3F B;  5CPJ C;  3VH5 T;  2FJ7 B;  2Y2N A;  3AZE D;  1AOI A;  4JJN B;  5GT0 D;  5CPJ A;  3AZN C;  4G92 C;  3AZN A;  3UTA C;  4Z66 D;  2ZY5 A;  1B6W A;  5F99 B;  3X1U C;  5B0Z B;  3KXB B;  3R45 A;  3UTB C;  2CV5 C;  3C1B C;  3AV2 C;  5B2J D;  3X1U A;  3AZL B;  3C1B A;  1P3P D;  1PZR A;  4XUJ D;  3B0C W;  5B40 C;  3AV2 A;  1Z2C B;  1AOI B;  5CPJ B;  5AV9 C;  1N1J B;  5B40 A;  3AN2 D;  5JRG A;  3AZN B;  5AVB D;  4G92 B;  3LJA A;  5CPI D;  3UTA B;  4YS3 C;  2NZD D;  3F6T A;  3X1U B;  3UTB B;  4KGC B;  2CV5 B;  1TZY C;  3C1B B;  2F8N H;  2ZM5 A;  5AY8 D;  3X1S D;  3AV2 B;  3AFA D;  4XZQ C;  3AZM D;  5B40 B;  5AV9 B;  3LZ1 D;  3KUY C;  4LD9 A;  3TU4 A;  1ULY A;  2DQN C;  4AWL C;  3NQJ A;  3AZH D;  4YS3 B;  3AV1 D;  1TZY B;  3WKJ D;  4WU8 C;  4XZQ B;  5B2I A;  4J8V D;  3X1T D;  1KX5 C;  1F1E A;  1S32 D;  2JCH A;  3LZ0 D;  3KUY B;  5GXQ C;  5CPK A;  1KX5 A;  3W99 C;  1P3A D;  3MNN D;  5GXQ A;  2YFW A;  3A6N D;  3AZI A;  2F8N A;  3EG5 B;  4AWL B;  3W99 A;  1WWS A;  5B24 D;  3W97 A;  4QLC D;  5BO0 A;  1P3F D;  3EPJ A;  1P3B C;  3VH6 W;  3W96 C;  2FJ7 D;  4WU8 B;  4JJN D;  1P3B A;  3W96 A;  5AV5 D;  1KX5 B;  3IP4 C;  5B31 D;  1KX3 D;  3UT9 D;  2F2A C;  5GXQ B;  3NQU A;  4NE5 A;  3MVD C;  5F99 D;  3KXB D;  3W99 B;  2G5H C;  4J8U D;  3REJ C;  5BO0 B;  3AYW C;  3MVD A;  3MGS C;  3AZL D;  3AYW A;  3REJ A;  3MGS A;  1P3B B;  1BFM A;  3W96 B;  1H3O A;  3AZG D;  3REH C;  3REI B;  4ZUX C;  4H9Q B;  2Y2P A;  5B33 C;  4WU9 D;  3REH A;  1TAF A;  2YFV A;  4H9R B;  4EO5 C;  4ZUX A;  4YM6 C;  5B33 A;  3UTA D;  2HIO C;  1Q9C A;  4WZS B;  3MVD B;  4DQY B;  3UTB D;  2HIO A;  4KGC D;  2CV5 D;  3AYW B;  5GSU C;  3REJ B;  5AV6 A;  3MGS B;  4J8W D;  1KX4 C;  1H3O B;  3H0M C;  4CAY A;  2Y2I A;  2BG1 A;  1KX4 A;  5AV9 D;  5B32 G;  4NE3 A;  3V9R A;  5GT3 D;  4ZUX B;  1M1A C;  5B33 B;  2RVQ C;  4KHA A;  4EO5 B;  4YM6 B;  2F8N K;  1M19 C;  2HIO B;  4YS3 D;  3AL0 C;  5B32 D;  1F66 C;  3WAA C;  1TZY D;  2CWE A;  4H9N A;  3B6F D;  5GSU B;  3W98 D;  3WAA A;  1KX4 B;  4XZQ D;  2G5I C;  1ID3 A;  1EQZ C;  5DNM C;  3EPK A;  3KUY D;  5AV8 C;  4KHA B;  5B1L C;  2W8S A;  1M1A B;  1P3I A;  1EQZ A;  3H0L C;  5AV8 A;  5B1L A;  4Z2M G;  5E5A A;  1M19 B;  4DRA A;  5CP6 C;  3MGR A;  4Z5T C;  3REL D;  4ZBJ C;  4H9N B;  1F66 B;  5CP6 A;  3WAA B;  4Z5T A;  4WU8 D;  3B6G D;  5B1M A;  3X1V C;  3AZJ B;  2ARO C;  1P3O A;  1P3K A;  1EQZ B;  5DNM B;  3X1V A;  2ARO A;  2Y2O A;  1JFI A;  3VH6 A;  3MGQ D;  3AZF C;  2ZY3 A;  3KWQ D;  1T3U A;  3A1I A;  5JRG C;  3AZF A;  2Y2H A;  3O62 D;  4KUD C;  2ZY4 A;  5CP6 B;  4Z5T B;  3LJA C;  2DF4 C;  3WA9 C;  4ZBJ B;  1P3L C;  4KUD A;  2BYM A;  3WA9 A;  4CSR A;  3REI D;  2Y2G A;  1P3L A;  3REK D;  3R45 B;  3X1V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...