2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
4XUJD 4H9OA 5AY8D 5B0YC 3X1SD 3NQUA 5B1MB 3REID 3X1TA 4CAYA 4Z66D 4YM6C 3AZJA 5GT3C 3MGSD 5AVCA 1P3AA 5B40C 5B32A 3B0DB 4J8UB 1F66C 1WWSA 3AZND 5FUGB 3AV1B 5GXQC 4H9QA 5G49B 3LELB 3MNNA 2PYOB 3MGPB 1P3MC 4NFTA 3C1CB 1P3PD 4KGCA 4J8XA 3MVDC 3AZKA 4YS3A 1KX5D 4QLCB 1M19D 4KUDA 3AV2D 2FJ7C 5BNVA 2CV5B 5DNND 5AV6B 3LJAD 3B6FD 5B31D 3B0DC 3AZFD 4J8UC 4WU8D 1EQZA 3X1VD 3AV1C 4G92B 1P3BB 3B0CW 3AYWB 3LELC 4XZQD 3AZIA 3AN2A 4Z2MG 3MGPC 2NZDA 5B24A 3X1SB 3C1CC 3REJA 3C1BD 3LZ0A 3MGRA 3AZEA 3REIB 1JFIB 3AZGA 4Z66B 4QLCC 2F8NH 3A6NB 4J8WD 5B2ID 5CPJA 4WU9D 5AV6C 1N1JB 1KX3D 1AOID 3WTPC 3KWQD 3WKJA 1P3PB 5GT0D 1HQ3D 4XUJA 4E44A 5AY8A 3TU4A 1KX5B 1P3BC 3AYWC 3V9RB 3MGSA 1BH8A 4JJNB 3KXBA 5DNNB 3AFAB 5CPIB 3X1SC 4J8VA 3REIC 3AZNA 3AZJD 1S32A 4H9RB 2NQBD 4Z66C 5B31B 3A6NC 5B32D 1KX4C 3X1UD 3AZFB 1P3GD 3X1VB 4H9SA 1P3KA 3MNND 1R4VA 1M19A 2RVQD 3AV2A 4X23D 1P3PC 3AZKD 1KX5C 5KDMB 3LJAA 1HTAA 4KUDD 3B6FA 4J8WB 2F8NG 5B2IB 3REKA 4WU9B 4JJNC 3KUYB 3UT9A 5CPIC 3AFAC 3LZ1A 3MGQA 4WU8A 3O62B 5B2JB 1KX3B 1AOIB 5F99C 4XZQA 1EQZD 4KHAB 3KWQB 3AZFC 5AV9C 5GT0B 1HQ3B 3C1BA 2AROA 2NZDD 4H9OB 3REJD 3NQUB 3LZ0D 3MGRD 3X1TB 3AZGD 4CAYB 3AZJB 4ZUXA 5AVCB 1P3AB 5CPJD 1P34D 5B32B 4J8WC 3VH6A 5B2IC 4UUZA 4M6BA 4WU9C 3KUYC 4H9QB 3O62C 5JRGA 5B2JC 4ZBJB 1KX3C 1AOIC 1P3FD 3MNNB 3KWQC 2CWEA 4KGCB 3TU4D 4J8XB 5GT0C 1HQ3C 5E5AD 5B33D 3AZKB 4YS3B 4E45A 2HIOC 2NQBA 3B6GD 3KXBD 5BNVB 3UTAD 1TZYA 3X1UA 1H3OA 4Z5TA 5BNXA 4J8VD 3X1TC 1P3GA 1S32D 3AZJC 5AVCC 1P3AC 5B32C 1EQZB 2YFWA 1TAFA 5AV8B 4CSRA 4R8PA 4X23A 1P3KD 1M1AC 5CPKD 5BO0A 3AZIB 3AN2B 4LD9A 2NZDB 2RVQC 5B24B 4WZSB 3REJB 3AZEB 4KGCC 3MGRB 4J8XC 4YS3C 3AZKC 4AWLB 5B1MC 3REKD 5CPJB 3AZLD 1B67A 5BS7A 3UT9D 3LZ1D 1P3LD 3MGQD 4H9PA 3AZHA 1ZLAA 3WKJB 5GSUD 2PYOC 4XUJB 3TU4B 5AY8B 5AV8C 5JA4A 2AROD 3MGSB 1BH8B 3AZIC 3KXBB 3AN2C 1M18D 1P34A 2YFVA 3KSYA 2NZDC 5B24C 3REJC 3AZEC 2CV5C 3MGRC 3AZNB 4H9NA 4ZUXD 1S32B 3B0CT 5AV5D 5BT1C 3W99D 5CP6D 1P3FA 1U35A 1ULYA 1P3KB 5DNMD 5JRGD 5B33A 3W96A 5E5AA 4G92C 1P3OA 1M19B 3B6GA 3WKJC 2JSSA 3AV2B 4NE3A 4XUJC 5AY8C 3REHD 3UTAA 5B31G 1A7WA 4EO5B 3LJAB 2FJ7B 3WAAD 3B6FB 1KU5A 3WA9A 3REKB 3MGSC 3WTPA 3AZMD 3UT9B 1TZYD 3LZ1B 4Z5TD 3W97D 3MGQB 4WU8B 3AZNC 1S32C 3W98D 5CPKA 4XZQB 4YM6D 4R8PD 1JFIA 4H9SC 3C1BB 1P3KC 3A6NA 5B40D 2AROB 5AVBA 1KX4A 4DRAA 1F66D 1M19C 4LD9D 5B0ZA 3AZLA 3AV2C 5GXQD 5DNNC 1P3IA 5CHLB 4ZUXB 1N1JA 1P3LA 4EO5C 3LJAC 3B6FC 5B31C 3REKC 4UUZB 3LZ1C 1Q9CA 4WNNB 3MVDD 4WU8C 3X1VC 5GSUA 5JRGB 3AZHD 1ZLAD 3VH6W 4XZQC 2BYMA 1M18A 3RELA 4H9RA 3C1BC 5B32G 2AROC 3WTPE 2NQBB 5F99A 4J8UD 1F1EA 2BYKA 3B0BA 5AV5A 1ID3A 5AV9A 3R45A 3VH5W 5CP6A 1H3OB 4Z5TB 3X1UB 5BNXB 3AV1D 3W99A 1P3GB 1BH9A 4ZUXC 1WWIA 3LELD 3VH6T 5DNMA 3MGPD 1U35D 2YFWB 1TAFB 4HGAB 4CSRB 4R8PB 4WV4B 3VH5A 4QLCD 5KDMA 4X23B 3W96D 5JRGC 3REHA 3UTBA 5BO0B 1P3OD 5B1LA 3WAAA 4KUDB 4LD9B 2F8NA 3AZMA 3W97A 3WA9D 2LY8A 3NQJA 2L5AA 2NQBC 3WTPD 3W98A 3X1UC 4Z5TC 5B0YA 1P3GC 4H9PB 4YM6A 2HIOA 5GT3A 3AZHB 1ZLAB 4ZBJC 5B40A 3MNNC 1F66A 4HGAC 1B6WA 4R8PC 5JA4B 4X23C 3LZ0B 5GXQA 3A6ND 5AVBD 3AZGB 1KX4D 4KUDC 4LD9C 1P34B 2YFVB 5B0ZD 1P3MA 1BFMA 1P3ID 1M1AA 4H9NB 3MVDA 5BS7C 2FJ7A 1P3FB 1U35B 1EQZC 5B1MA 4NE5A 2F8NK 5B33B 5E5AB 3W96B 3AZHC 1ZLAC 1P3OB 4JJND 3AFAD 5CPID 3B6GB 4J8UA 3RELD 2HUEB 5FUGA 3UTAB 3LZ0C 3AV1A 4J8VB 3AZGC 5G49A 4AWLC 3WA9B 5F99D 3LELA 3WTPB 1ID3D 5CPJC 5AV9D 1P34C 2PYOA 3MGPA 5AV8A 3C1CA 4QLCA 5CPKB 1P3FC 1U35C 2CV5A 5AV6A 3TU4C 5B33C 3W96C 5E5AC 5AVBB 3UTBD 1KX4B 5B1LD 1P3OC 3KUYD 4G91B 2F8ND 3B6GC 5B0ZB 3AZLB 3KXBC 1P3IB 2HUEC 3O62D 3UTAC 1P3LB 5B2JD 4J8VC 1P3BA 3WA9C 3AYWA 5B0YD 3X1SA 5GSUB 3REIA 2HIOD 5GT3D 4Z66A 5CPKC 2BYMB 3X1TD 1M18B 3RELB 5AVCD 1P3AD 5C3IB 5AVBC 5F99B 2BYKB 5AV5B 4G91C 1ID3B 5AV9B 3R45B 5B0ZC 5CP6B 3AZLC 1P3MD 3W99B 1M1AD 3UT9C 1BH9B 1P3IC 1P3PA 1P3LC 3MGQC 1KX5A 5DNMB 3V9RA 2FJ7D 4KGCD 4J8XD 4JJNA 5DNNA 3AFAA 4YS3D 5CPIA 5B1MD 5GSUC 3REHB 3UTBB 5B31A 2IO5B 5B1LB 3WAAB 2F8NB 3AZMB 3AZFA 1M18C 3RELC 3X1VA 1TZYB 4DRBA 3W97B 5C3IC 3NQJB 5AV5C 1ID3C 3W98B 2PYOD 3W99C 5CP6C 5AV8D 5B0YB 3C1CD 4YM6B 2HIOB 5GT3B 3AZID 5DNMC 3AN2D 5B40B 4J8WA 5B2IA 5B24D 3AZED 4WU9A 2CV5D 1F66B 3KUYA 5AV6D 3VH5T 5GXQB 3REHC 3O62A 5BT1D 5B2JA 2IO5C 3UTBC 4NE6A 5B1LC 1KX3A 3WAAC 1AOIA 1P3MB 3AZMC 4WNNA 4KHAA 3KWQA 1M1AB 1TZYC 5GT0A 1HQ3A 3W97C 3MVDB 1P3BD 3AYWD 3WKJD 4Z2MH 3W98C
chains in the Genus database with same CATH superfamily
4XUJD 4H9OA 5AY8D 5B0YC 3X1SD 3NQUA 5B1MB 3REID 3X1TA 4CAYA 4Z66D 4YM6C 3AZJA 5GT3C 3MGSD 5AVCA 1P3AA 5B40C 5B32A 3B0DB 4J8UB 1F66C 1WWSA 3AZND 5FUGB 3AV1B 5GXQC 4H9QA 5G49B 3LELB 3MNNA 2PYOB 3MGPB 1P3MC 4NFTA 3C1CB 1P3PD 4KGCA 4J8XA 3MVDC 3AZKA 4YS3A 1KX5D 4QLCB 1M19D 4KUDA 3AV2D 2FJ7C 5BNVA 2CV5B 5DNND 5AV6B 3LJAD 3B6FD 5B31D 3P5JB 3B0DC 3AZFD 4J8UC 4WU8D 1EQZA 3X1VD 2JCHA 3AV1C 4G92B 1P3BB 3B0CW 3AYWB 3LELC 4XZQD 3AZIA 3AN2A 4Z2MG 3MGPC 2NZDA 5B24A 3X1SB 3C1CC 3REJA 3C1BD 3LZ0A 3MGRA 3AZEA 3REIB 3WKJD 1JFIB 3AZGA 4Z66B 4QLCC 2F8NH 3A6NB 4J8WD 2ZY2A 5B2ID 5CPJA 4WU9D 5AV6C 2Y2GA 1N1JB 1KX3D 1AOID 3WTPC 3KWQD 3WKJA 1P3PB 5GT0D 1HQ3D 4XUJA 4E44A 5AY8A 3TU4A 1KX5B 1P3BC 3AYWC 3V9RB 3MGSA 1BH8A 2F2AC 4JJNB 3KXBA 5DNNB 3AFAB 5CPIB 3X1SC 3A1KA 4J8VA 3REIC 3AZNA 3AZJD 1S32A 4H9RB 2NQBD 4Z66C 5B31B 3A6NC 5B32D 1KX4C 3X1UD 2Y2NA 3AZFB 1P3GD 3X1VB 4H9SA 1P3KA 2XD5A 3MNND 1R4VA 1M19A 2RVQD 3AV2A 4X23D 1P3PC 3AZKD 1KX5C 2UWXA 5KDMB 3LJAA 1HTAA 4KUDD 3B6FA 4J8WB 2F8NG 5B2IB 3REKA 2J8PA 4WU9B 4JJNC 3KUYB 4WJ3C 3UT9A 5CPIC 3AFAC 3LZ1A 3MGQA 2ZM5A 4WU8A 2Y2HA 3O62B 5B2JB 1KX3B 3EG5B 2DF4C 1AOIB 5F99C 4XZQA 1EQZD 4KHAB 3KWQB 3AZFC 5AV9C 5GT0B 1HQ3B 3C1BA 2AROA 2NZDD 4H9OB 3REJD 3NQUB 3LZ0D 3MGRD 2ZY5A 3X1TB 3AZGD 4CAYB 3AZJB 4ZUXA 5AVCB 1P3AB 5CPJD 1P34D 5B32B 4J8WC 3VH6A 5B2IC 4UUZA 4M6BA 4WU9C 3KUYC 4H9QB 3O62C 5JRGA 5B2JC 4ZBJB 1KX3C 1AOIC 2DQNC 1P3FD 3MNNB 3KWQC 2CWEA 2RIQA 3H0MC 4KGCB 3TU4D 4J8XB 5GT0C 1HQ3C 5E5AD 5B33D 3AZKB 4YS3B 4E45A 2HIOC 2NQBA 3B6GD 3KXBD 5BNVB 3UTAD 1TZYA 3X1UA 1H3OA 4Z5TA 5BNXA 4J8VD 3X1TC 1P3GA 1S32D 3AZJC 5AVCC 1P3AC 3H0LC 5B32C 1EQZB 2YFWA 1TAFA 5AV8B 4CSRA 4R8PA 4X23A 1P3KD 1M1AC 5CPKD 2FFFB 5BO0A 3AZIB 3AN2B 4LD9A 2NZDB 2RVQC 5B24B 4WZSB 3REJB 3AZEB 4KGCC 3MGRB 4J8XC 4YS3C 3AZKC 4AWLB 5B1MC 3REKD 5CPJB 3AZLD 1B67A 5BS7A 3UT9D 3LZ1D 1P3LD 3MGQD 4H9PA 2Y2PA 3AZHA 1ZLAA 3WKJB 5GSUD 2PYOC 4XUJB 3TU4B 5AY8B 5AV8C 5JA4A 2AROD 3MGSB 1BH8B 3AZIC 3KXBB 3AN2C 1M18D 1P34A 2YFVA 3KSYA 2NZDC 5B24C 3REJC 3AZEC 2CV5C 3MGRC 1Z2CB 3AZNB 4H9NA 4ZUXD 1S32B 2ZY3A 3B0CT 5AV5D 5BT1C 3W99D 5CP6D 1P3FA 1U35A 1ULYA 1P3KB 5DNMD 5JRGD 5B33A 3W96A 5E5AA 4G92C 2Y2JA 1P3OA 1M19B 3B6GA 3WKJC 2JSSA 3AV2B 4NE3A 4XUJC 2Y2QA 5AY8C 3REHD 3UTAA 5B31G 1A7WA 4EO5B 3LJAB 2FJ7B 3WAAD 3B6FB 1KU5A 1PZRA 3WA9A 3REKB 3MGSC 3WTPA 3AZMD 3UT9B 1TZYD 3LZ1B 4Z5TD 3W97D 3MGQB 4WU8B 3AZNC 1S32C 3W98D 5CPKA 2W8SA 4XZQB 3IP4C 4YM6D 4R8PD 1JFIA 4H9SC 3C1BB 1P3KC 3A6NA 5B40D 2AROB 5AVBA 1KX4A 4DRAA 1F66D 1M19C 4LD9D 5B0ZA 3AZLA 3AV2C 5GXQD 5DNNC 1P3IA 5CHLB 4ZUXB 1N1JA 1P3LA 4EO5C 3LJAC 3B6FC 5B31C 3REKC 4UUZB 3LZ1C 1Q9CA 4WNNB 3MVDD 4WU8C 3X1VC 5GSUA 5JRGB 3AZHD 1ZLAD 3VH6W 2Y2KA 4XZQC 2BYMA 3EPJA 1M18A 3RELA 4H9RA 3C1BC 5B32G 2AROC 3WTPE 2NQBB 5F99A 4J8UD 1F1EA 2BYKA 3B0BA 5AV5A 1ID3A 5AV9A 3R45A 3VH5W 5CP6A 1H3OB 4Z5TB 3X1UB 5BNXB 3AV1D 3W99A 1P3GB 1BH9A 4ZUXC 2Y2LA 1WWIA 3LELD 3VH6T 1W2EA 5DNMA 3MGPD 1U35D 2YFWB 1TAFB 4HGAB 4CSRB 4R8PB 4WV4B 3VH5A 4QLCD 5KDMA 4X23B 3AL0C 3W96D 5JRGC 3REHA 4UPKA 3UTBA 5BO0B 1P3OD 5B1LA 3WAAA 4KUDB 4LD9B 2F8NA 3AZMA 3EPKA 3W97A 2Y2MA 2LY8A 3WA9D 3NQJA 2L5AA 2NQBC 3WTPD 3W98A 3X1UC 4Z5TC 5B0YA 1P3GC 4H9PB 4YM6A 2HIOA 5GT3A 3AZHB 1ZLAB 4ZBJC 5B40A 3MNNC 1F66A 2VQRA 4HGAC 1B6WA 4R8PC 5JA4B 4X23C 3LZ0B 5GXQA 3A6ND 3A1IA 5AVBD 3AZGB 1KX4D 4KUDC 4LD9C 1P34B 2YFVB 5B0ZD 1P3MA 1BFMA 1P3ID 1M1AA 4H9NB 3MVDA 5BS7C 2FJ7A 1P3FB 1U35B 2Y2OA 1EQZC 2XD1A 5B1MA 3F6TA 4NE5A 2F8NK 5B33B 5E5AB 3W96B 3AZHC 1ZLAC 1P3OB 4JJND 3AFAD 5CPID 3B6GB 4J8UA 3RELD 2HUEB 5FUGA 3UTAB 3LZ0C 3AV1A 4J8VB 3EPHA 3AZGC 5G49A 4AWLC 3WA9B 5F99D 2Y2IA 3LELA 3WTPB 1ID3D 5CPJC 5AV9D 1P34C 2PYOA 3MGPA 5AV8A 3C1CA 4QLCA 5CPKB 1P3FC 1U35C 2CV5A 5AV6A 3TU4C 5B33C 3W96C 5E5AC 2BG1A 5AVBB 3UTBD 1KX4B 5B1LD 1P3OC 3KUYD 4G91B 2F8ND 3B6GC 5B0ZB 3AZLB 3KXBC 1P3IB 2HUEC 3O62D 3UTAC 1P3LB 5B2JD 4J8VC 1T3UA 1P3BA 3WA9C 3AYWA 3KFUG 5B0YD 3X1SA 5GSUB 3REIA 2HIOD 5GT3D 4Z66A 5CPKC 2BYMB 3X1TD 1M18B 3RELB 5AVCD 1P3AD 5C3IB 5AVBC 3EPLA 5F99B 2BYKB 5AV5B 4G91C 1ID3B 5AV9B 3R45B 5B0ZC 5CP6B 3FDDA 3AZLC 1P3MD 3W99B 1M1AD 3UT9C 1BH9B 1P3IC 1P3PA 1P3LC 3MGQC 2ZY4A 1KX5A 2G5HC 5DNMB 3V9RA 2FJ7D 4KGCD 4J8XD 4JJNA 5DNNA 3AFAA 4YS3D 5CPIA 5B1MD 5GSUC 3H0RC 3REHB 3UTBB 5B31A 2IO5B 5B1LB 3WAAB 2F8NB 3AZMB 3AZFA 1M18C 3RELC 3X1VA 1TZYB 4DRBA 3W97B 5C3IC 3NQJB 4DQYB 5AV5C 1ID3C 3W98B 2PYOD 3W99C 5CP6C 5AV8D 5B0YB 3C1CD 4YM6B 2G5IC 2HIOB 5GT3B 3AZID 5DNMC 3AN2D 5B40B 4J8WA 5B2IA 5B24D 3AZED 4WU9A 2CV5D 1F66B 3KUYA 5AV6D 3VH5T 5GXQB 3REHC 3O62A 5BT1D 5B2JA 2IO5C 3UTBC 4NE6A 5B1LC 1KX3A 3WAAC 1AOIA 1P3MB 3AZMC 4WNNA 4KHAA 3KWQA 1M1AB 1TZYC 5GT0A 1HQ3A 3W97C 3MVDB 1P3BD 3AYWD 2JE5A 4Z2MH 3W98C
chains in the Genus database with same CATH topology
4XUJD 4H9OA 5AY8D 5B0YC 3X1SD 3NQUA 5B1MB 3REID 3X1TA 4CAYA 4Z66D 4YM6C 3AZJA 5GT3C 3MGSD 5AVCA 1P3AA 5B40C 5B32A 3B0DB 4J8UB 1F66C 1WWSA 3AZND 5FUGB 3AV1B 5GXQC 4H9QA 5G49B 3LELB 3MNNA 2PYOB 3MGPB 1P3MC 4NFTA 3C1CB 1P3PD 4KGCA 4J8XA 3MVDC 3AZKA 4YS3A 1KX5D 4QLCB 1M19D 4KUDA 3AV2D 2FJ7C 5BNVA 2CV5B 5DNND 5AV6B 3LJAD 3B6FD 5B31D 3P5JB 3B0DC 3AZFD 4J8UC 4WU8D 1EQZA 3X1VD 2JCHA 3AV1C 4G92B 1P3BB 3B0CW 3AYWB 3LELC 4XZQD 3AZIA 3AN2A 4Z2MG 3MGPC 2NZDA 5B24A 3X1SB 3C1CC 3REJA 3C1BD 3LZ0A 3MGRA 3AZEA 3REIB 3WKJD 1JFIB 3AZGA 4Z66B 4QLCC 2F8NH 3A6NB 4J8WD 2ZY2A 5B2ID 5CPJA 4WU9D 5AV6C 2Y2GA 1N1JB 1KX3D 1AOID 3WTPC 3KWQD 3WKJA 1P3PB 5GT0D 1HQ3D 4XUJA 4E44A 5AY8A 3TU4A 1KX5B 1P3BC 3AYWC 3V9RB 3MGSA 1BH8A 2F2AC 4JJNB 3KXBA 5DNNB 3AFAB 5CPIB 3X1SC 3A1KA 4J8VA 3REIC 3AZNA 3AZJD 1S32A 4H9RB 2NQBD 4Z66C 5B31B 3A6NC 5B32D 1KX4C 3X1UD 2Y2NA 3AZFB 1P3GD 3X1VB 4H9SA 1P3KA 2XD5A 3MNND 1R4VA 1M19A 2RVQD 3AV2A 4X23D 1P3PC 3AZKD 1KX5C 2UWXA 5KDMB 3LJAA 1HTAA 4KUDD 3B6FA 4J8WB 2F8NG 5B2IB 3REKA 2J8PA 4WU9B 4JJNC 3KUYB 4WJ3C 3UT9A 5CPIC 3AFAC 3LZ1A 3MGQA 2ZM5A 4WU8A 2Y2HA 3O62B 5B2JB 1KX3B 3EG5B 2DF4C 1AOIB 5F99C 4XZQA 1EQZD 4KHAB 3KWQB 3AZFC 5AV9C 5GT0B 1HQ3B 3C1BA 2AROA 2NZDD 4H9OB 3REJD 3NQUB 3LZ0D 3MGRD 2ZY5A 3X1TB 3AZGD 4CAYB 3AZJB 4ZUXA 5AVCB 1P3AB 5CPJD 1P34D 5B32B 4J8WC 3VH6A 5B2IC 4UUZA 4M6BA 4WU9C 3KUYC 4H9QB 3O62C 5JRGA 5B2JC 4ZBJB 1KX3C 1AOIC 2DQNC 1P3FD 3MNNB 3KWQC 2CWEA 2RIQA 3H0MC 4KGCB 3TU4D 4J8XB 5GT0C 1HQ3C 5E5AD 5B33D 3AZKB 4YS3B 4E45A 2HIOC 2NQBA 3B6GD 3KXBD 5BNVB 3UTAD 1TZYA 3X1UA 1H3OA 4Z5TA 5BNXA 4J8VD 3X1TC 1P3GA 1S32D 3AZJC 5AVCC 1P3AC 3H0LC 5B32C 1EQZB 2YFWA 1TAFA 5AV8B 4CSRA 4R8PA 4X23A 1P3KD 1M1AC 5CPKD 2FFFB 5BO0A 3AZIB 3AN2B 4LD9A 2NZDB 2RVQC 5B24B 4WZSB 3REJB 3AZEB 4KGCC 3MGRB 4J8XC 4YS3C 3AZKC 4AWLB 5B1MC 3REKD 5CPJB 3AZLD 1B67A 5BS7A 3UT9D 3LZ1D 1P3LD 3MGQD 4H9PA 2Y2PA 3AZHA 1ZLAA 3WKJB 5GSUD 2PYOC 4XUJB 3TU4B 5AY8B 5AV8C 5JA4A 2AROD 3MGSB 1BH8B 3AZIC 3KXBB 3AN2C 1M18D 1P34A 2YFVA 3KSYA 2NZDC 5B24C 3REJC 3AZEC 2CV5C 3MGRC 1Z2CB 3AZNB 4H9NA 4ZUXD 1S32B 2ZY3A 3B0CT 5AV5D 5BT1C 3W99D 5CP6D 1P3FA 1U35A 1ULYA 1P3KB 5DNMD 5JRGD 5B33A 3W96A 5E5AA 4G92C 2Y2JA 1P3OA 1M19B 3B6GA 3WKJC 2JSSA 3AV2B 4NE3A 4XUJC 2Y2QA 5AY8C 3REHD 3UTAA 5B31G 1A7WA 4EO5B 3LJAB 2FJ7B 3WAAD 3B6FB 1KU5A 1PZRA 3WA9A 3REKB 3MGSC 3WTPA 3AZMD 3UT9B 1TZYD 3LZ1B 4Z5TD 3W97D 3MGQB 4WU8B 3AZNC 1S32C 3W98D 5CPKA 2W8SA 4XZQB 3IP4C 4YM6D 4R8PD 1JFIA 4H9SC 3C1BB 1P3KC 3A6NA 5B40D 2AROB 5AVBA 1KX4A 4DRAA 1F66D 1M19C 4LD9D 5B0ZA 3AZLA 3AV2C 5GXQD 5DNNC 1P3IA 5CHLB 4ZUXB 1N1JA 1P3LA 4EO5C 3LJAC 3B6FC 5B31C 3REKC 4UUZB 3LZ1C 1Q9CA 4WNNB 3MVDD 4WU8C 3X1VC 5GSUA 5JRGB 3AZHD 1ZLAD 3VH6W 2Y2KA 4XZQC 2BYMA 3EPJA 1M18A 3RELA 4H9RA 3C1BC 5B32G 2AROC 3WTPE 2NQBB 5F99A 4J8UD 1F1EA 2BYKA 3B0BA 5AV5A 1ID3A 5AV9A 3R45A 3VH5W 5CP6A 1H3OB 4Z5TB 3X1UB 5BNXB 3AV1D 3W99A 1P3GB 1BH9A 4ZUXC 2Y2LA 1WWIA 3LELD 3VH6T 1W2EA 5DNMA 3MGPD 1U35D 2YFWB 1TAFB 4HGAB 4CSRB 4R8PB 4WV4B 3VH5A 4QLCD 5KDMA 4X23B 3AL0C 3W96D 5JRGC 3REHA 4UPKA 3UTBA 5BO0B 1P3OD 5B1LA 3WAAA 4KUDB 4LD9B 2F8NA 3AZMA 3EPKA 3W97A 2Y2MA 2LY8A 3WA9D 3NQJA 2L5AA 2NQBC 3WTPD 3W98A 3X1UC 4Z5TC 5B0YA 1P3GC 4H9PB 4YM6A 2HIOA 5GT3A 3AZHB 1ZLAB 4ZBJC 5B40A 3MNNC 1F66A 2VQRA 4HGAC 1B6WA 4R8PC 5JA4B 4X23C 3LZ0B 5GXQA 3A6ND 3A1IA 5AVBD 3AZGB 1KX4D 4KUDC 4LD9C 1P34B 2YFVB 5B0ZD 1P3MA 1BFMA 1P3ID 1M1AA 4H9NB 3MVDA 5BS7C 2FJ7A 1P3FB 1U35B 2Y2OA 1EQZC 2XD1A 5B1MA 3F6TA 4NE5A 2F8NK 5B33B 5E5AB 3W96B 3AZHC 1ZLAC 1P3OB 4JJND 3AFAD 5CPID 3B6GB 4J8UA 3RELD 2HUEB 5FUGA 3UTAB 3LZ0C 3AV1A 4J8VB 3EPHA 3AZGC 5G49A 4AWLC 3WA9B 5F99D 2Y2IA 3LELA 3WTPB 1ID3D 5CPJC 5AV9D 1P34C 2PYOA 3MGPA 5AV8A 3C1CA 4QLCA 5CPKB 1P3FC 1U35C 2CV5A 5AV6A 3TU4C 5B33C 3W96C 5E5AC 2BG1A 5AVBB 3UTBD 1KX4B 5B1LD 1P3OC 3KUYD 4G91B 2F8ND 3B6GC 5B0ZB 3AZLB 3KXBC 1P3IB 2HUEC 3O62D 3UTAC 1P3LB 5B2JD 4J8VC 1T3UA 1P3BA 3WA9C 3AYWA 3KFUG 5B0YD 3X1SA 5GSUB 3REIA 2HIOD 5GT3D 4Z66A 5CPKC 2BYMB 3X1TD 1M18B 3RELB 5AVCD 1P3AD 5C3IB 5AVBC 3EPLA 5F99B 2BYKB 5AV5B 4G91C 1ID3B 5AV9B 3R45B 5B0ZC 5CP6B 3FDDA 3AZLC 1P3MD 3W99B 1M1AD 3UT9C 1BH9B 1P3IC 1P3PA 1P3LC 3MGQC 2ZY4A 1KX5A 2G5HC 5DNMB 3V9RA 2FJ7D 4KGCD 4J8XD 4JJNA 5DNNA 3AFAA 4YS3D 5CPIA 5B1MD 5GSUC 3H0RC 3REHB 3UTBB 5B31A 2IO5B 5B1LB 3WAAB 2F8NB 3AZMB 3AZFA 1M18C 3RELC 3X1VA 1TZYB 4DRBA 3W97B 5C3IC 3NQJB 4DQYB 5AV5C 1ID3C 3W98B 2PYOD 3W99C 5CP6C 5AV8D 5B0YB 3C1CD 4YM6B 2G5IC 2HIOB 5GT3B 3AZID 5DNMC 3AN2D 5B40B 4J8WA 5B2IA 5B24D 3AZED 4WU9A 2CV5D 1F66B 3KUYA 5AV6D 3VH5T 5GXQB 3REHC 3O62A 5BT1D 5B2JA 2IO5C 3UTBC 4NE6A 5B1LC 1KX3A 3WAAC 1AOIA 1P3MB 3AZMC 4WNNA 4KHAA 3KWQA 1M1AB 1TZYC 5GT0A 1HQ3A 3W97C 3MVDB 1P3BD 3AYWD 2JE5A 4Z2MH 3W98C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ D;  4H9O A;  5AY8 D;  5B0Y C;  3X1S D;  3NQU A;  5B1M B;  3REI D;  3X1T A;  4CAY A;  4Z66 D;  4YM6 C;  3AZJ A;  5GT3 C;  3MGS D;  5AVC A;  1P3A A;  5B40 C;  5B32 A;  3B0D B;  4J8U B;  1F66 C;  1WWS A;  3AZN D;  5FUG B;  3AV1 B;  5GXQ C;  4H9Q A;  5G49 B;  3LEL B;  3MNN A;  2PYO B;  3MGP B;  1P3M C;  4NFT A;  3C1C B;  1P3P D;  4KGC A;  4J8X A;  3MVD C;  3AZK A;  4YS3 A;  1KX5 D;  4QLC B;  1M19 D;  4KUD A;  3AV2 D;  2FJ7 C;  5BNV A;  2CV5 B;  5DNN D;  5AV6 B;  3LJA D;  3B6F D;  5B31 D;  3B0D C;  3AZF D;  4J8U C;  4WU8 D;  1EQZ A;  3X1V D;  3AV1 C;  4G92 B;  1P3B B;  3B0C W;  3AYW B;  3LEL C;  4XZQ D;  3AZI A;  3AN2 A;  4Z2M G;  3MGP C;  2NZD A;  5B24 A;  3X1S B;  3C1C C;  3REJ A;  3C1B D;  3LZ0 A;  3MGR A;  3AZE A;  3REI B;  1JFI B;  3AZG A;  4Z66 B;  4QLC C;  2F8N H;  3A6N B;  4J8W D;  5B2I D;  5CPJ A;  4WU9 D;  5AV6 C;  1N1J B;  1KX3 D;  1AOI D;  3WTP C;  3KWQ D;  3WKJ A;  1P3P B;  5GT0 D;  1HQ3 D;  4XUJ A;  4E44 A;  5AY8 A;  3TU4 A;  1KX5 B;  1P3B C;  3AYW C;  3V9R B;  3MGS A;  1BH8 A;  4JJN B;  3KXB A;  5DNN B;  3AFA B;  5CPI B;  3X1S C;  4J8V A;  3REI C;  3AZN A;  3AZJ D;  1S32 A;  4H9R B;  2NQB D;  4Z66 C;  5B31 B;  3A6N C;  5B32 D;  1KX4 C;  3X1U D;  3AZF B;  1P3G D;  3X1V B;  4H9S A;  1P3K A;  3MNN D;  1R4V A;  1M19 A;  2RVQ D;  3AV2 A;  4X23 D;  1P3P C;  3AZK D;  1KX5 C;  5KDM B;  3LJA A;  1HTA A;  4KUD D;  3B6F A;  4J8W B;  2F8N G;  5B2I B;  3REK A;  4WU9 B;  4JJN C;  3KUY B;  3UT9 A;  5CPI C;  3AFA C;  3LZ1 A;  3MGQ A;  4WU8 A;  3O62 B;  5B2J B;  1KX3 B;  1AOI B;  5F99 C;  4XZQ A;  1EQZ D;  4KHA B;  3KWQ B;  3AZF C;  5AV9 C;  5GT0 B;  1HQ3 B;  3C1B A;  2ARO A;  2NZD D;  4H9O B;  3REJ D;  3NQU B;  3LZ0 D;  3MGR D;  3X1T B;  3AZG D;  4CAY B;  3AZJ B;  4ZUX A;  5AVC B;  1P3A B;  5CPJ D;  1P34 D;  5B32 B;  4J8W C;  3VH6 A;  5B2I C;  4UUZ A;  4M6B A;  4WU9 C;  3KUY C;  4H9Q B;  3O62 C;  5JRG A;  5B2J C;  4ZBJ B;  1KX3 C;  1AOI C;  1P3F D;  3MNN B;  3KWQ C;  2CWE A;  4KGC B;  3TU4 D;  4J8X B;  5GT0 C;  1HQ3 C;  5E5A D;  5B33 D;  3AZK B;  4YS3 B;  4E45 A;  2HIO C;  2NQB A;  3B6G D;  3KXB D;  5BNV B;  3UTA D;  1TZY A;  3X1U A;  1H3O A;  4Z5T A;  5BNX A;  4J8V D;  3X1T C;  1P3G A;  1S32 D;  3AZJ C;  5AVC C;  1P3A C;  5B32 C;  1EQZ B;  2YFW A;  1TAF A;  5AV8 B;  4CSR A;  4R8P A;  4X23 A;  1P3K D;  1M1A C;  5CPK D;  5BO0 A;  3AZI B;  3AN2 B;  4LD9 A;  2NZD B;  2RVQ C;  5B24 B;  4WZS B;  3REJ B;  3AZE B;  4KGC C;  3MGR B;  4J8X C;  4YS3 C;  3AZK C;  4AWL B;  5B1M C;  3REK D;  5CPJ B;  3AZL D;  1B67 A;  5BS7 A;  3UT9 D;  3LZ1 D;  1P3L D;  3MGQ D;  4H9P A;  3AZH A;  1ZLA A;  3WKJ B;  5GSU D;  2PYO C;  4XUJ B;  3TU4 B;  5AY8 B;  5AV8 C;  5JA4 A;  2ARO D;  3MGS B;  1BH8 B;  3AZI C;  3KXB B;  3AN2 C;  1M18 D;  1P34 A;  2YFV A;  3KSY A;  2NZD C;  5B24 C;  3REJ C;  3AZE C;  2CV5 C;  3MGR C;  3AZN B;  4H9N A;  4ZUX D;  1S32 B;  3B0C T;  5AV5 D;  5BT1 C;  3W99 D;  5CP6 D;  1P3F A;  1U35 A;  1ULY A;  1P3K B;  5DNM D;  5JRG D;  5B33 A;  3W96 A;  5E5A A;  4G92 C;  1P3O A;  1M19 B;  3B6G A;  3WKJ C;  2JSS A;  3AV2 B;  4NE3 A;  4XUJ C;  5AY8 C;  3REH D;  3UTA A;  5B31 G;  1A7W A;  4EO5 B;  3LJA B;  2FJ7 B;  3WAA D;  3B6F B;  1KU5 A;  3WA9 A;  3REK B;  3MGS C;  3WTP A;  3AZM D;  3UT9 B;  1TZY D;  3LZ1 B;  4Z5T D;  3W97 D;  3MGQ B;  4WU8 B;  3AZN C;  1S32 C;  3W98 D;  5CPK A;  4XZQ B;  4YM6 D;  4R8P D;  1JFI A;  4H9S C;  3C1B B;  1P3K C;  3A6N A;  5B40 D;  2ARO B;  5AVB A;  1KX4 A;  4DRA A;  1F66 D;  1M19 C;  4LD9 D;  5B0Z A;  3AZL A;  3AV2 C;  5GXQ D;  5DNN C;  1P3I A;  5CHL B;  4ZUX B;  1N1J A;  1P3L A;  4EO5 C;  3LJA C;  3B6F C;  5B31 C;  3REK C;  4UUZ B;  3LZ1 C;  1Q9C A;  4WNN B;  3MVD D;  4WU8 C;  3X1V C;  5GSU A;  5JRG B;  3AZH D;  1ZLA D;  3VH6 W;  4XZQ C;  2BYM A;  1M18 A;  3REL A;  4H9R A;  3C1B C;  5B32 G;  2ARO C;  3WTP E;  2NQB B;  5F99 A;  4J8U D;  1F1E A;  2BYK A;  3B0B A;  5AV5 A;  1ID3 A;  5AV9 A;  3R45 A;  3VH5 W;  5CP6 A;  1H3O B;  4Z5T B;  3X1U B;  5BNX B;  3AV1 D;  3W99 A;  1P3G B;  1BH9 A;  4ZUX C;  1WWI A;  3LEL D;  3VH6 T;  5DNM A;  3MGP D;  1U35 D;  2YFW B;  1TAF B;  4HGA B;  4CSR B;  4R8P B;  4WV4 B;  3VH5 A;  4QLC D;  5KDM A;  4X23 B;  3W96 D;  5JRG C;  3REH A;  3UTB A;  5BO0 B;  1P3O D;  5B1L A;  3WAA A;  4KUD B;  4LD9 B;  2F8N A;  3AZM A;  3W97 A;  3WA9 D;  2LY8 A;  3NQJ A;  2L5A A;  2NQB C;  3WTP D;  3W98 A;  3X1U C;  4Z5T C;  5B0Y A;  1P3G C;  4H9P B;  4YM6 A;  2HIO A;  5GT3 A;  3AZH B;  1ZLA B;  4ZBJ C;  5B40 A;  3MNN C;  1F66 A;  4HGA C;  1B6W A;  4R8P C;  5JA4 B;  4X23 C;  3LZ0 B;  5GXQ A;  3A6N D;  5AVB D;  3AZG B;  1KX4 D;  4KUD C;  4LD9 C;  1P34 B;  2YFV B;  5B0Z D;  1P3M A;  1BFM A;  1P3I D;  1M1A A;  4H9N B;  3MVD A;  5BS7 C;  2FJ7 A;  1P3F B;  1U35 B;  1EQZ C;  5B1M A;  4NE5 A;  2F8N K;  5B33 B;  5E5A B;  3W96 B;  3AZH C;  1ZLA C;  1P3O B;  4JJN D;  3AFA D;  5CPI D;  3B6G B;  4J8U A;  3REL D;  2HUE B;  5FUG A;  3UTA B;  3LZ0 C;  3AV1 A;  4J8V B;  3AZG C;  5G49 A;  4AWL C;  3WA9 B;  5F99 D;  3LEL A;  3WTP B;  1ID3 D;  5CPJ C;  5AV9 D;  1P34 C;  2PYO A;  3MGP A;  5AV8 A;  3C1C A;  4QLC A;  5CPK B;  1P3F C;  1U35 C;  2CV5 A;  5AV6 A;  3TU4 C;  5B33 C;  3W96 C;  5E5A C;  5AVB B;  3UTB D;  1KX4 B;  5B1L D;  1P3O C;  3KUY D;  4G91 B;  2F8N D;  3B6G C;  5B0Z B;  3AZL B;  3KXB C;  1P3I B;  2HUE C;  3O62 D;  3UTA C;  1P3L B;  5B2J D;  4J8V C;  1P3B A;  3WA9 C;  3AYW A;  5B0Y D;  3X1S A;  5GSU B;  3REI A;  2HIO D;  5GT3 D;  4Z66 A;  5CPK C;  2BYM B;  3X1T D;  1M18 B;  3REL B;  5AVC D;  1P3A D;  5C3I B;  5AVB C;  5F99 B;  2BYK B;  5AV5 B;  4G91 C;  1ID3 B;  5AV9 B;  3R45 B;  5B0Z C;  5CP6 B;  3AZL C;  1P3M D;  3W99 B;  1M1A D;  3UT9 C;  1BH9 B;  1P3I C;  1P3P A;  1P3L C;  3MGQ C;  1KX5 A;  5DNM B;  3V9R A;  2FJ7 D;  4KGC D;  4J8X D;  4JJN A;  5DNN A;  3AFA A;  4YS3 D;  5CPI A;  5B1M D;  5GSU C;  3REH B;  3UTB B;  5B31 A;  2IO5 B;  5B1L B;  3WAA B;  2F8N B;  3AZM B;  3AZF A;  1M18 C;  3REL C;  3X1V A;  1TZY B;  4DRB A;  3W97 B;  5C3I C;  3NQJ B;  5AV5 C;  1ID3 C;  3W98 B;  2PYO D;  3W99 C;  5CP6 C;  5AV8 D;  5B0Y B;  3C1C D;  4YM6 B;  2HIO B;  5GT3 B;  3AZI D;  5DNM C;  3AN2 D;  5B40 B;  4J8W A;  5B2I A;  5B24 D;  3AZE D;  4WU9 A;  2CV5 D;  1F66 B;  3KUY A;  5AV6 D;  3VH5 T;  5GXQ B;  3REH C;  3O62 A;  5BT1 D;  5B2J A;  2IO5 C;  3UTB C;  4NE6 A;  5B1L C;  1KX3 A;  3WAA C;  1AOI A;  1P3M B;  3AZM C;  4WNN A;  4KHA A;  3KWQ A;  1M1A B;  1TZY C;  5GT0 A;  1HQ3 A;  3W97 C;  3MVD B;  1P3B D;  3AYW D;  3WKJ D;  4Z2M H;  3W98 C; 
#chains in the Genus database with same CATH topology
 4XUJ D;  4H9O A;  5AY8 D;  5B0Y C;  3X1S D;  3NQU A;  5B1M B;  3REI D;  3X1T A;  4CAY A;  4Z66 D;  4YM6 C;  3AZJ A;  5GT3 C;  3MGS D;  5AVC A;  1P3A A;  5B40 C;  5B32 A;  3B0D B;  4J8U B;  1F66 C;  1WWS A;  3AZN D;  5FUG B;  3AV1 B;  5GXQ C;  4H9Q A;  5G49 B;  3LEL B;  3MNN A;  2PYO B;  3MGP B;  1P3M C;  4NFT A;  3C1C B;  1P3P D;  4KGC A;  4J8X A;  3MVD C;  3AZK A;  4YS3 A;  1KX5 D;  4QLC B;  1M19 D;  4KUD A;  3AV2 D;  2FJ7 C;  5BNV A;  2CV5 B;  5DNN D;  5AV6 B;  3LJA D;  3B6F D;  5B31 D;  3P5J B;  3B0D C;  3AZF D;  4J8U C;  4WU8 D;  1EQZ A;  3X1V D;  2JCH A;  3AV1 C;  4G92 B;  1P3B B;  3B0C W;  3AYW B;  3LEL C;  4XZQ D;  3AZI A;  3AN2 A;  4Z2M G;  3MGP C;  2NZD A;  5B24 A;  3X1S B;  3C1C C;  3REJ A;  3C1B D;  3LZ0 A;  3MGR A;  3AZE A;  3REI B;  3WKJ D;  1JFI B;  3AZG A;  4Z66 B;  4QLC C;  2F8N H;  3A6N B;  4J8W D;  2ZY2 A;  5B2I D;  5CPJ A;  4WU9 D;  5AV6 C;  2Y2G A;  1N1J B;  1KX3 D;  1AOI D;  3WTP C;  3KWQ D;  3WKJ A;  1P3P B;  5GT0 D;  1HQ3 D;  4XUJ A;  4E44 A;  5AY8 A;  3TU4 A;  1KX5 B;  1P3B C;  3AYW C;  3V9R B;  3MGS A;  1BH8 A;  2F2A C;  4JJN B;  3KXB A;  5DNN B;  3AFA B;  5CPI B;  3X1S C;  3A1K A;  4J8V A;  3REI C;  3AZN A;  3AZJ D;  1S32 A;  4H9R B;  2NQB D;  4Z66 C;  5B31 B;  3A6N C;  5B32 D;  1KX4 C;  3X1U D;  2Y2N A;  3AZF B;  1P3G D;  3X1V B;  4H9S A;  1P3K A;  2XD5 A;  3MNN D;  1R4V A;  1M19 A;  2RVQ D;  3AV2 A;  4X23 D;  1P3P C;  3AZK D;  1KX5 C;  2UWX A;  5KDM B;  3LJA A;  1HTA A;  4KUD D;  3B6F A;  4J8W B;  2F8N G;  5B2I B;  3REK A;  2J8P A;  4WU9 B;  4JJN C;  3KUY B;  4WJ3 C;  3UT9 A;  5CPI C;  3AFA C;  3LZ1 A;  3MGQ A;  2ZM5 A;  4WU8 A;  2Y2H A;  3O62 B;  5B2J B;  1KX3 B;  3EG5 B;  2DF4 C;  1AOI B;  5F99 C;  4XZQ A;  1EQZ D;  4KHA B;  3KWQ B;  3AZF C;  5AV9 C;  5GT0 B;  1HQ3 B;  3C1B A;  2ARO A;  2NZD D;  4H9O B;  3REJ D;  3NQU B;  3LZ0 D;  3MGR D;  2ZY5 A;  3X1T B;  3AZG D;  4CAY B;  3AZJ B;  4ZUX A;  5AVC B;  1P3A B;  5CPJ D;  1P34 D;  5B32 B;  4J8W C;  3VH6 A;  5B2I C;  4UUZ A;  4M6B A;  4WU9 C;  3KUY C;  4H9Q B;  3O62 C;  5JRG A;  5B2J C;  4ZBJ B;  1KX3 C;  1AOI C;  2DQN C;  1P3F D;  3MNN B;  3KWQ C;  2CWE A;  2RIQ A;  3H0M C;  4KGC B;  3TU4 D;  4J8X B;  5GT0 C;  1HQ3 C;  5E5A D;  5B33 D;  3AZK B;  4YS3 B;  4E45 A;  2HIO C;  2NQB A;  3B6G D;  3KXB D;  5BNV B;  3UTA D;  1TZY A;  3X1U A;  1H3O A;  4Z5T A;  5BNX A;  4J8V D;  3X1T C;  1P3G A;  1S32 D;  3AZJ C;  5AVC C;  1P3A C;  3H0L C;  5B32 C;  1EQZ B;  2YFW A;  1TAF A;  5AV8 B;  4CSR A;  4R8P A;  4X23 A;  1P3K D;  1M1A C;  5CPK D;  2FFF B;  5BO0 A;  3AZI B;  3AN2 B;  4LD9 A;  2NZD B;  2RVQ C;  5B24 B;  4WZS B;  3REJ B;  3AZE B;  4KGC C;  3MGR B;  4J8X C;  4YS3 C;  3AZK C;  4AWL B;  5B1M C;  3REK D;  5CPJ B;  3AZL D;  1B67 A;  5BS7 A;  3UT9 D;  3LZ1 D;  1P3L D;  3MGQ D;  4H9P A;  2Y2P A;  3AZH A;  1ZLA A;  3WKJ B;  5GSU D;  2PYO C;  4XUJ B;  3TU4 B;  5AY8 B;  5AV8 C;  5JA4 A;  2ARO D;  3MGS B;  1BH8 B;  3AZI C;  3KXB B;  3AN2 C;  1M18 D;  1P34 A;  2YFV A;  3KSY A;  2NZD C;  5B24 C;  3REJ C;  3AZE C;  2CV5 C;  3MGR C;  1Z2C B;  3AZN B;  4H9N A;  4ZUX D;  1S32 B;  2ZY3 A;  3B0C T;  5AV5 D;  5BT1 C;  3W99 D;  5CP6 D;  1P3F A;  1U35 A;  1ULY A;  1P3K B;  5DNM D;  5JRG D;  5B33 A;  3W96 A;  5E5A A;  4G92 C;  2Y2J A;  1P3O A;  1M19 B;  3B6G A;  3WKJ C;  2JSS A;  3AV2 B;  4NE3 A;  4XUJ C;  2Y2Q A;  5AY8 C;  3REH D;  3UTA A;  5B31 G;  1A7W A;  4EO5 B;  3LJA B;  2FJ7 B;  3WAA D;  3B6F B;  1KU5 A;  1PZR A;  3WA9 A;  3REK B;  3MGS C;  3WTP A;  3AZM D;  3UT9 B;  1TZY D;  3LZ1 B;  4Z5T D;  3W97 D;  3MGQ B;  4WU8 B;  3AZN C;  1S32 C;  3W98 D;  5CPK A;  2W8S A;  4XZQ B;  3IP4 C;  4YM6 D;  4R8P D;  1JFI A;  4H9S C;  3C1B B;  1P3K C;  3A6N A;  5B40 D;  2ARO B;  5AVB A;  1KX4 A;  4DRA A;  1F66 D;  1M19 C;  4LD9 D;  5B0Z A;  3AZL A;  3AV2 C;  5GXQ D;  5DNN C;  1P3I A;  5CHL B;  4ZUX B;  1N1J A;  1P3L A;  4EO5 C;  3LJA C;  3B6F C;  5B31 C;  3REK C;  4UUZ B;  3LZ1 C;  1Q9C A;  4WNN B;  3MVD D;  4WU8 C;  3X1V C;  5GSU A;  5JRG B;  3AZH D;  1ZLA D;  3VH6 W;  2Y2K A;  4XZQ C;  2BYM A;  3EPJ A;  1M18 A;  3REL A;  4H9R A;  3C1B C;  5B32 G;  2ARO C;  3WTP E;  2NQB B;  5F99 A;  4J8U D;  1F1E A;  2BYK A;  3B0B A;  5AV5 A;  1ID3 A;  5AV9 A;  3R45 A;  3VH5 W;  5CP6 A;  1H3O B;  4Z5T B;  3X1U B;  5BNX B;  3AV1 D;  3W99 A;  1P3G B;  1BH9 A;  4ZUX C;  2Y2L A;  1WWI A;  3LEL D;  3VH6 T;  1W2E A;  5DNM A;  3MGP D;  1U35 D;  2YFW B;  1TAF B;  4HGA B;  4CSR B;  4R8P B;  4WV4 B;  3VH5 A;  4QLC D;  5KDM A;  4X23 B;  3AL0 C;  3W96 D;  5JRG C;  3REH A;  4UPK A;  3UTB A;  5BO0 B;  1P3O D;  5B1L A;  3WAA A;  4KUD B;  4LD9 B;  2F8N A;  3AZM A;  3EPK A;  3W97 A;  2Y2M A;  2LY8 A;  3WA9 D;  3NQJ A;  2L5A A;  2NQB C;  3WTP D;  3W98 A;  3X1U C;  4Z5T C;  5B0Y A;  1P3G C;  4H9P B;  4YM6 A;  2HIO A;  5GT3 A;  3AZH B;  1ZLA B;  4ZBJ C;  5B40 A;  3MNN C;  1F66 A;  2VQR A;  4HGA C;  1B6W A;  4R8P C;  5JA4 B;  4X23 C;  3LZ0 B;  5GXQ A;  3A6N D;  3A1I A;  5AVB D;  3AZG B;  1KX4 D;  4KUD C;  4LD9 C;  1P34 B;  2YFV B;  5B0Z D;  1P3M A;  1BFM A;  1P3I D;  1M1A A;  4H9N B;  3MVD A;  5BS7 C;  2FJ7 A;  1P3F B;  1U35 B;  2Y2O A;  1EQZ C;  2XD1 A;  5B1M A;  3F6T A;  4NE5 A;  2F8N K;  5B33 B;  5E5A B;  3W96 B;  3AZH C;  1ZLA C;  1P3O B;  4JJN D;  3AFA D;  5CPI D;  3B6G B;  4J8U A;  3REL D;  2HUE B;  5FUG A;  3UTA B;  3LZ0 C;  3AV1 A;  4J8V B;  3EPH A;  3AZG C;  5G49 A;  4AWL C;  3WA9 B;  5F99 D;  2Y2I A;  3LEL A;  3WTP B;  1ID3 D;  5CPJ C;  5AV9 D;  1P34 C;  2PYO A;  3MGP A;  5AV8 A;  3C1C A;  4QLC A;  5CPK B;  1P3F C;  1U35 C;  2CV5 A;  5AV6 A;  3TU4 C;  5B33 C;  3W96 C;  5E5A C;  2BG1 A;  5AVB B;  3UTB D;  1KX4 B;  5B1L D;  1P3O C;  3KUY D;  4G91 B;  2F8N D;  3B6G C;  5B0Z B;  3AZL B;  3KXB C;  1P3I B;  2HUE C;  3O62 D;  3UTA C;  1P3L B;  5B2J D;  4J8V C;  1T3U A;  1P3B A;  3WA9 C;  3AYW A;  3KFU G;  5B0Y D;  3X1S A;  5GSU B;  3REI A;  2HIO D;  5GT3 D;  4Z66 A;  5CPK C;  2BYM B;  3X1T D;  1M18 B;  3REL B;  5AVC D;  1P3A D;  5C3I B;  5AVB C;  3EPL A;  5F99 B;  2BYK B;  5AV5 B;  4G91 C;  1ID3 B;  5AV9 B;  3R45 B;  5B0Z C;  5CP6 B;  3FDD A;  3AZL C;  1P3M D;  3W99 B;  1M1A D;  3UT9 C;  1BH9 B;  1P3I C;  1P3P A;  1P3L C;  3MGQ C;  2ZY4 A;  1KX5 A;  2G5H C;  5DNM B;  3V9R A;  2FJ7 D;  4KGC D;  4J8X D;  4JJN A;  5DNN A;  3AFA A;  4YS3 D;  5CPI A;  5B1M D;  5GSU C;  3H0R C;  3REH B;  3UTB B;  5B31 A;  2IO5 B;  5B1L B;  3WAA B;  2F8N B;  3AZM B;  3AZF A;  1M18 C;  3REL C;  3X1V A;  1TZY B;  4DRB A;  3W97 B;  5C3I C;  3NQJ B;  4DQY B;  5AV5 C;  1ID3 C;  3W98 B;  2PYO D;  3W99 C;  5CP6 C;  5AV8 D;  5B0Y B;  3C1C D;  4YM6 B;  2G5I C;  2HIO B;  5GT3 B;  3AZI D;  5DNM C;  3AN2 D;  5B40 B;  4J8W A;  5B2I A;  5B24 D;  3AZE D;  4WU9 A;  2CV5 D;  1F66 B;  3KUY A;  5AV6 D;  3VH5 T;  5GXQ B;  3REH C;  3O62 A;  5BT1 D;  5B2J A;  2IO5 C;  3UTB C;  4NE6 A;  5B1L C;  1KX3 A;  3WAA C;  1AOI A;  1P3M B;  3AZM C;  4WNN A;  4KHA A;  3KWQ A;  1M1A B;  1TZY C;  5GT0 A;  1HQ3 A;  3W97 C;  3MVD B;  1P3B D;  3AYW D;  2JE5 A;  4Z2M H;  3W98 C; 
#chains in the Genus database with same CATH homology
 4XUJ D;  4H9O A;  5AY8 D;  5B0Y C;  3X1S D;  3NQU A;  5B1M B;  3REI D;  3X1T A;  4CAY A;  4Z66 D;  4YM6 C;  3AZJ A;  5GT3 C;  3MGS D;  5AVC A;  1P3A A;  5B40 C;  5B32 A;  3B0D B;  4J8U B;  1F66 C;  1WWS A;  3AZN D;  5FUG B;  3AV1 B;  5GXQ C;  4H9Q A;  5G49 B;  3LEL B;  3MNN A;  2PYO B;  3MGP B;  1P3M C;  4NFT A;  3C1C B;  1P3P D;  4KGC A;  4J8X A;  3MVD C;  3AZK A;  4YS3 A;  1KX5 D;  4QLC B;  1M19 D;  4KUD A;  3AV2 D;  2FJ7 C;  5BNV A;  2CV5 B;  5DNN D;  5AV6 B;  3LJA D;  3B6F D;  5B31 D;  3P5J B;  3B0D C;  3AZF D;  4J8U C;  4WU8 D;  1EQZ A;  3X1V D;  2JCH A;  3AV1 C;  4G92 B;  1P3B B;  3B0C W;  3AYW B;  3LEL C;  4XZQ D;  3AZI A;  3AN2 A;  4Z2M G;  3MGP C;  2NZD A;  5B24 A;  3X1S B;  3C1C C;  3REJ A;  3C1B D;  3LZ0 A;  3MGR A;  3AZE A;  3REI B;  3WKJ D;  1JFI B;  3AZG A;  4Z66 B;  4QLC C;  2F8N H;  3A6N B;  4J8W D;  2ZY2 A;  5B2I D;  5CPJ A;  4WU9 D;  5AV6 C;  2Y2G A;  1N1J B;  1KX3 D;  1AOI D;  3WTP C;  3KWQ D;  3WKJ A;  1P3P B;  5GT0 D;  1HQ3 D;  4XUJ A;  4E44 A;  5AY8 A;  3TU4 A;  1KX5 B;  1P3B C;  3AYW C;  3V9R B;  3MGS A;  1BH8 A;  2F2A C;  4JJN B;  3KXB A;  5DNN B;  3AFA B;  5CPI B;  3X1S C;  3A1K A;  4J8V A;  3REI C;  3AZN A;  3AZJ D;  1S32 A;  4H9R B;  2NQB D;  4Z66 C;  5B31 B;  3A6N C;  5B32 D;  1KX4 C;  3X1U D;  2Y2N A;  3AZF B;  1P3G D;  3X1V B;  4H9S A;  1P3K A;  2XD5 A;  3MNN D;  1R4V A;  1M19 A;  2RVQ D;  3AV2 A;  4X23 D;  1P3P C;  3AZK D;  1KX5 C;  2UWX A;  5KDM B;  3LJA A;  1HTA A;  4KUD D;  3B6F A;  4J8W B;  2F8N G;  5B2I B;  3REK A;  2J8P A;  4WU9 B;  4JJN C;  3KUY B;  4WJ3 C;  3UT9 A;  5CPI C;  3AFA C;  3LZ1 A;  3MGQ A;  2ZM5 A;  4WU8 A;  2Y2H A;  3O62 B;  5B2J B;  1KX3 B;  3EG5 B;  2DF4 C;  1AOI B;  5F99 C;  4XZQ A;  1EQZ D;  4KHA B;  3KWQ B;  3AZF C;  5AV9 C;  5GT0 B;  1HQ3 B;  3C1B A;  2ARO A;  2NZD D;  4H9O B;  3REJ D;  3NQU B;  3LZ0 D;  3MGR D;  2ZY5 A;  3X1T B;  3AZG D;  4CAY B;  3AZJ B;  4ZUX A;  5AVC B;  1P3A B;  5CPJ D;  1P34 D;  5B32 B;  4J8W C;  3VH6 A;  5B2I C;  4UUZ A;  4M6B A;  4WU9 C;  3KUY C;  4H9Q B;  3O62 C;  5JRG A;  5B2J C;  4ZBJ B;  1KX3 C;  1AOI C;  2DQN C;  1P3F D;  3MNN B;  3KWQ C;  2CWE A;  2RIQ A;  3H0M C;  4KGC B;  3TU4 D;  4J8X B;  5GT0 C;  1HQ3 C;  5E5A D;  5B33 D;  3AZK B;  4YS3 B;  4E45 A;  2HIO C;  2NQB A;  3B6G D;  3KXB D;  5BNV B;  3UTA D;  1TZY A;  3X1U A;  1H3O A;  4Z5T A;  5BNX A;  4J8V D;  3X1T C;  1P3G A;  1S32 D;  3AZJ C;  5AVC C;  1P3A C;  3H0L C;  5B32 C;  1EQZ B;  2YFW A;  1TAF A;  5AV8 B;  4CSR A;  4R8P A;  4X23 A;  1P3K D;  1M1A C;  5CPK D;  2FFF B;  5BO0 A;  3AZI B;  3AN2 B;  4LD9 A;  2NZD B;  2RVQ C;  5B24 B;  4WZS B;  3REJ B;  3AZE B;  4KGC C;  3MGR B;  4J8X C;  4YS3 C;  3AZK C;  4AWL B;  5B1M C;  3REK D;  5CPJ B;  3AZL D;  1B67 A;  5BS7 A;  3UT9 D;  3LZ1 D;  1P3L D;  3MGQ D;  4H9P A;  2Y2P A;  3AZH A;  1ZLA A;  3WKJ B;  5GSU D;  2PYO C;  4XUJ B;  3TU4 B;  5AY8 B;  5AV8 C;  5JA4 A;  2ARO D;  3MGS B;  1BH8 B;  3AZI C;  3KXB B;  3AN2 C;  1M18 D;  1P34 A;  2YFV A;  3KSY A;  2NZD C;  5B24 C;  3REJ C;  3AZE C;  2CV5 C;  3MGR C;  1Z2C B;  3AZN B;  4H9N A;  4ZUX D;  1S32 B;  2ZY3 A;  3B0C T;  5AV5 D;  5BT1 C;  3W99 D;  5CP6 D;  1P3F A;  1U35 A;  1ULY A;  1P3K B;  5DNM D;  5JRG D;  5B33 A;  3W96 A;  5E5A A;  4G92 C;  2Y2J A;  1P3O A;  1M19 B;  3B6G A;  3WKJ C;  2JSS A;  3AV2 B;  4NE3 A;  4XUJ C;  2Y2Q A;  5AY8 C;  3REH D;  3UTA A;  5B31 G;  1A7W A;  4EO5 B;  3LJA B;  2FJ7 B;  3WAA D;  3B6F B;  1KU5 A;  1PZR A;  3WA9 A;  3REK B;  3MGS C;  3WTP A;  3AZM D;  3UT9 B;  1TZY D;  3LZ1 B;  4Z5T D;  3W97 D;  3MGQ B;  4WU8 B;  3AZN C;  1S32 C;  3W98 D;  5CPK A;  2W8S A;  4XZQ B;  3IP4 C;  4YM6 D;  4R8P D;  1JFI A;  4H9S C;  3C1B B;  1P3K C;  3A6N A;  5B40 D;  2ARO B;  5AVB A;  1KX4 A;  4DRA A;  1F66 D;  1M19 C;  4LD9 D;  5B0Z A;  3AZL A;  3AV2 C;  5GXQ D;  5DNN C;  1P3I A;  5CHL B;  4ZUX B;  1N1J A;  1P3L A;  4EO5 C;  3LJA C;  3B6F C;  5B31 C;  3REK C;  4UUZ B;  3LZ1 C;  1Q9C A;  4WNN B;  3MVD D;  4WU8 C;  3X1V C;  5GSU A;  5JRG B;  3AZH D;  1ZLA D;  3VH6 W;  2Y2K A;  4XZQ C;  2BYM A;  3EPJ A;  1M18 A;  3REL A;  4H9R A;  3C1B C;  5B32 G;  2ARO C;  3WTP E;  2NQB B;  5F99 A;  4J8U D;  1F1E A;  2BYK A;  3B0B A;  5AV5 A;  1ID3 A;  5AV9 A;  3R45 A;  3VH5 W;  5CP6 A;  1H3O B;  4Z5T B;  3X1U B;  5BNX B;  3AV1 D;  3W99 A;  1P3G B;  1BH9 A;  4ZUX C;  2Y2L A;  1WWI A;  3LEL D;  3VH6 T;  1W2E A;  5DNM A;  3MGP D;  1U35 D;  2YFW B;  1TAF B;  4HGA B;  4CSR B;  4R8P B;  4WV4 B;  3VH5 A;  4QLC D;  5KDM A;  4X23 B;  3AL0 C;  3W96 D;  5JRG C;  3REH A;  4UPK A;  3UTB A;  5BO0 B;  1P3O D;  5B1L A;  3WAA A;  4KUD B;  4LD9 B;  2F8N A;  3AZM A;  3EPK A;  3W97 A;  2Y2M A;  2LY8 A;  3WA9 D;  3NQJ A;  2L5A A;  2NQB C;  3WTP D;  3W98 A;  3X1U C;  4Z5T C;  5B0Y A;  1P3G C;  4H9P B;  4YM6 A;  2HIO A;  5GT3 A;  3AZH B;  1ZLA B;  4ZBJ C;  5B40 A;  3MNN C;  1F66 A;  2VQR A;  4HGA C;  1B6W A;  4R8P C;  5JA4 B;  4X23 C;  3LZ0 B;  5GXQ A;  3A6N D;  3A1I A;  5AVB D;  3AZG B;  1KX4 D;  4KUD C;  4LD9 C;  1P34 B;  2YFV B;  5B0Z D;  1P3M A;  1BFM A;  1P3I D;  1M1A A;  4H9N B;  3MVD A;  5BS7 C;  2FJ7 A;  1P3F B;  1U35 B;  2Y2O A;  1EQZ C;  2XD1 A;  5B1M A;  3F6T A;  4NE5 A;  2F8N K;  5B33 B;  5E5A B;  3W96 B;  3AZH C;  1ZLA C;  1P3O B;  4JJN D;  3AFA D;  5CPI D;  3B6G B;  4J8U A;  3REL D;  2HUE B;  5FUG A;  3UTA B;  3LZ0 C;  3AV1 A;  4J8V B;  3EPH A;  3AZG C;  5G49 A;  4AWL C;  3WA9 B;  5F99 D;  2Y2I A;  3LEL A;  3WTP B;  1ID3 D;  5CPJ C;  5AV9 D;  1P34 C;  2PYO A;  3MGP A;  5AV8 A;  3C1C A;  4QLC A;  5CPK B;  1P3F C;  1U35 C;  2CV5 A;  5AV6 A;  3TU4 C;  5B33 C;  3W96 C;  5E5A C;  2BG1 A;  5AVB B;  3UTB D;  1KX4 B;  5B1L D;  1P3O C;  3KUY D;  4G91 B;  2F8N D;  3B6G C;  5B0Z B;  3AZL B;  3KXB C;  1P3I B;  2HUE C;  3O62 D;  3UTA C;  1P3L B;  5B2J D;  4J8V C;  1T3U A;  1P3B A;  3WA9 C;  3AYW A;  3KFU G;  5B0Y D;  3X1S A;  5GSU B;  3REI A;  2HIO D;  5GT3 D;  4Z66 A;  5CPK C;  2BYM B;  3X1T D;  1M18 B;  3REL B;  5AVC D;  1P3A D;  5C3I B;  5AVB C;  3EPL A;  5F99 B;  2BYK B;  5AV5 B;  4G91 C;  1ID3 B;  5AV9 B;  3R45 B;  5B0Z C;  5CP6 B;  3FDD A;  3AZL C;  1P3M D;  3W99 B;  1M1A D;  3UT9 C;  1BH9 B;  1P3I C;  1P3P A;  1P3L C;  3MGQ C;  2ZY4 A;  1KX5 A;  2G5H C;  5DNM B;  3V9R A;  2FJ7 D;  4KGC D;  4J8X D;  4JJN A;  5DNN A;  3AFA A;  4YS3 D;  5CPI A;  5B1M D;  5GSU C;  3H0R C;  3REH B;  3UTB B;  5B31 A;  2IO5 B;  5B1L B;  3WAA B;  2F8N B;  3AZM B;  3AZF A;  1M18 C;  3REL C;  3X1V A;  1TZY B;  4DRB A;  3W97 B;  5C3I C;  3NQJ B;  4DQY B;  5AV5 C;  1ID3 C;  3W98 B;  2PYO D;  3W99 C;  5CP6 C;  5AV8 D;  5B0Y B;  3C1C D;  4YM6 B;  2G5I C;  2HIO B;  5GT3 B;  3AZI D;  5DNM C;  3AN2 D;  5B40 B;  4J8W A;  5B2I A;  5B24 D;  3AZE D;  4WU9 A;  2CV5 D;  1F66 B;  3KUY A;  5AV6 D;  3VH5 T;  5GXQ B;  3REH C;  3O62 A;  5BT1 D;  5B2J A;  2IO5 C;  3UTB C;  4NE6 A;  5B1L C;  1KX3 A;  3WAA C;  1AOI A;  1P3M B;  3AZM C;  4WNN A;  4KHA A;  3KWQ A;  1M1A B;  1TZY C;  5GT0 A;  1HQ3 A;  3W97 C;  3MVD B;  1P3B D;  3AYW D;  2JE5 A;  4Z2M H;  3W98 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...