2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords CHRAC-16
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
3AZIC 3C1BC 5FUGB 1AOIA 2AROA 4WU8B 1P3BD 4X23D 1M1AC 3X1UA 1M1AB 5AVCA 2CV5B 3AZNC 4NFTA 4ZBJC 1P3BB 4AWLB 5BO0B 1P3KA 4J8VA 1F1EA 1M1AD 5BNVB 1HQ3B 3KXBB 5B2IB 3NQJB 3REJD 5B31A 1S32A 1KX4C 5B0ZC 3AYWC 5BS7C 3KXBD 3C1CC 4J8XB 4ZUXA 3LJAD 3AN2A 5AVBA 4H9SC 3X1SA 4QLCB 1P34B 1P3PB 5B24C 3MVDA 4J8XD 2LY8A 3LZ0D 2PYOC 3A6ND 5E5AA 1P3LA 3W99B 5CHLB 5CP6D 4CAYA 4YM6A 3LZ0B 3W99D 3MGQC 1M18C 5JRGC 1P3GC 3B0DB 1ID3A 3REKC 3UT9A 3AZFB 2FJ7A 3AZLA 3W97C 1ZLAD 2HIOA 3AZEA 5B1LA 5AY8D 4XUJB 3WTPC 3X1TB 2NQBC 4YS3B 2YFWB 5GT3D 5C3IC 1H3OB 4J8UA 1P3MB 3LELD 5CPKC 3AZMC 5AY8C 2NZDA 3MNNC 4WNNB 3X1TD 4YS3D 4R8PA 1P3MC 4EO5B 1AOIC 3MGPA 2F8NK 1M19A 3AV1A 4XUJC 4KGCC 5KDMA 1N1JB 4H9PB 1BH8A 5GT0A 4XZQD 1P3AA 4HGAB 5DNND 4CSRB 2IO5B 5B32D 3X1VA 5F99B 4WU9B 2RVQC 5AV9A 4Z5TA 1U35B 2PYOD 3B0BA 3O62A 5B33B 3WTPE 2YFVA 4XZQB 4KUDC 2F8NH 5B32B 3LJAC 3MGSA 3R45B 1U35D 5DNMC 5G49A 2PYOB 5AV6C 1JFIB 3C1CD 1KX3C 5B24B 1P3PC 1P34C 3UTBA 5AV5A 4X23B 2BYMA 3MGRD 2F8NG 3W98C 3AFAB 2CV5D 1BH9B 3RELA 3REID 5E5AC 3V9RA 3UTAA 1P3LC 3VH6W 3AZND 3AFAD 4YM6C 3AFAC 3VH6T 4Z5TB 1TAFA 4AWLC 4X23C 3LZ1B 4ZBJB 3W96D 3AZNB 3AZNA 5B0YA 3W97A 4H9OB 4KHAB 1P3OB 3KWQD 1EQZC 3LJAB 5AV8D 3AZKB 1P34D 3LZ1D 4WZSB 1P3PD 3W96B 3AZJC 4R8PB 1P3OD 3KWQB 1U35C 3C1BB 3A6NB 5B2JA 5F99C 3AZGC 4WU9C 5AV5D 3RELB 3KWQA 3C1CA 3W96A 4KGCB 2BYMB 4Z2MH 2RVQD 3AN2C 5B1LB 5AV5B 1Q9CA 1A7WA 5CPIC 3AZFD 5B0YB 3AZHB 1HTAA 4Z2MG 3MGSB 4KGCD 4XUJD 5AY8B 5AV9C 4H9NA 5B32A 1P3KC 1TAFB 3UTAD 4J8WC 3REIA 4XZQA 3X1SD 1P3MD 3AZHD 3X1TC 1S32C 3TU4A 1P3GA 3LELC 3W97B 3AZLC 1P3PA 5GT3C 1N1JA 2HIOC 3UTBC 1P3GB 3TU4B 1M18B 3AV1B 5B2JD 4ZUXB 1M19B 3W97D 5B24A 3MVDC 3AV2C 1P3GD 5AV8A 3TU4D 1M18D 4J8VD 3R45A 2PYOA 5AY8A 3W99C 3AZED 3AZHA 3C1BA 2FJ7D 5B33D 1P3AD 3AFAA 2AROC 4QLCC 5GT0D 4JJNB 5CP6C 3AZKA 4J8VB 5GXQA 4XUJA 4X23A 1P3BA 1M18A 3C1CB 4KHAA 4J8XC 5B24D 1BH8B 5GT0B 4JJND 3KSYA 3AZEC 2NZDD 3A6NA 3MGRB 4NE6A 5B2IC 4J8UD 2AROB 3REHC 3KXBC 3O62B 3REIB 3MGRA 5B2JC 4H9NB 3REJC 1P3OA 4H9OA 2HIOD 3MVDB 4J8UB 1H3OA 3LZ1A 3AZLD 3UT9D 3O62D 1ID3D 4Z5TD 4ZUXC 5GXQB 4KGCA 5CPIA 4JJNA 4H9SA 3X1SC 2HIOB 3MGPB 3UT9B 3AZFA 5BT1D 1P3KD 5GXQD 3NQJA 5AV8B 5B32G 3LZ0A 3AZKD 3MGPD 5AVCD 5GSUC 2YFWA 5B33A 4R8PD 4J8WB 3C1BD 1KX5C 5AV9B 3MGSC 3X1VB 3RELD 2CV5A 5B0YC 1JFIA 1BFMA 5G49B 3KUYC 1P3FC 5AV5C 5B1LC 3AZGD 4H9QA 3X1UB 5B1LD 4Z66C 1F66D 3VH6A 5B0YD 1B67A 3RELC 5AV8C 5B40C 3MGSD 4WNNA 4NE3A 3AZGB 1P3ID 4CSRA 3V9RB 3UTAB 3WKJB 3KWQC 5CPJC 4NE5A 1EQZD 4R8PC 1P3MA 1BH9A 3MGPC 3W96C 3X1SB 5CP6A 3AZKC 3WA9C 3WAAD 5BNVA 5GXQC 1P3IB 1R4VA 4E45A 3B6FC 4YM6D 3AV1D 5B2JB 4ZUXD 2HUEC 4Z5TC 3REIC 1M19D 2JSSA 3O62C 4WU8A 4YM6B 4LD9C 5FUGA 3MGRC 1U35A 3LJAA 3AZEB 5E5AB 3AZIA 1P3LB 2FJ7B 1P3AB 1KX3D 3B0CW 5AV6D 3W98B 1P34A 5DNMD 5KDMB 1TZYC 5B1MC 4JJNC 2BYKA 4KUDD 1KX3B 4CAYB 5DNMB 3W99A 2NZDB 4UUZB 3B6GD 3B6GC 5B32C 5B31B 4G91C 2AROD 4XZQC 4QLCA 5B33C 4G91B 5B1MD 5B31C 1TZYD 3TU4C 2IO5C 3UTBB 3LELA 3MVDD 3AZLB 4G92C 5GT3A 1ID3B 3MNND 5B1MB 1TZYB 3AZMD 5CPKD 1S32B 4Z66A 3UTBD 4LD9D 2YFVB 1HQ3A 4EO5C 1AOIB 5B40A 3WTPD 2NQBD 3MNNB 5BO0A 1P3KB 3REJA 5F99A 4WU9A 5CPKB 1S32D 3AZHC 4LD9B 5AVCB 3REKD 3B6FD 1WWIA 4H9PA 4J8WD 3WA9A 1M1AA 3WTPB 2NQBB 5AVBB 3MGQD 3AN2B 1B6WA 5AV9D 2L5AA 5JRGA 3WAAC 3X1VD 3B6FA 5DNNA 4J8XA 3REKB 3AZFC 5JRGB 5AVBD 3MGQB 3X1UD 3AN2D 1P3IC 3A6NC 3LZ0C 5B40D 1F66B 3AZJB 5B2IA 3REHA 1F66C 4YS3A 5CPJB 3X1TA 3WKJC 3NQUB 1KX4A 2F8ND 3WKJD 1EQZB 5B40B 1P3OC 3AZJD 3LZ1C 1P3FA 3AYWD 3WAAB 5B0ZD 2F8NB 1KX4D 3X1UC 2F8NA 5AVBC 1KX5D 1P3FB 3KUYB 1ZLAA 5GSUD 1WWSA 5AVCC 3AV2A 3X1VC 5B0ZB 3B6GA 5CPJA 1KX5B 5BT1C 5GSUB 4KUDA 5GSUA 1KX5A 4UUZA 3B0CT 5E5AD 5B0ZA 1P3LD 1ID3C 5BNXA 1P3BC 3AYWA 4G92B 3REKA 3UT9C 2CV5C 2BYKB 5AV6B 3W98D 3KUYA 3AZID 4DRAA 3VH5A 1HQ3D 4WU8C 4KUDB 5JA4A 3REHD 4J8UC 3KXBA 5B2ID 3AZIB 3REJB 5CPKA 3B6GB 2NZDC 5B31D 4HGAC 2CWEA 4DRBA 3REHB 4H9RB 5B1MA 3MGQA 4H9RA 5DNNC 4QLCD 5GT0C 1P3AC 2FJ7C 1ULYA 5BNXB 3AZMB 1P3IA 4J8VC 1KU5A 5CP6B 3AV2D 5C3IB 5JA4B 1AOID 4E44A 4YS3C 4LD9A 2HUEB 3WKJA 3AZMA 5DNMA 3MNNA 3AV2B 5BS7A 3B6FB 3B0DC 1ZLAB 1M19C 4H9QB 3AV1C 3WA9B 1TZYA 4WV4B 1ZLAC 5GT3B 3LELB 5JRGD 3UTAC 4J8WA 3WA9D 3VH5W 4Z66B 5CPID 5CPJD 3VH5T 3WAAA 4M6BA 5AV6A 1KX3A 1EQZA 5DNNB 4Z66D 3AYWB 5CPIB 5F99D 3NQUA 5B31G 4WU9D 1KX4B 1P3FD 3WTPA 2NQBA 3KUYD 3W98A 3AZJA 1F66A 1HQ3C 4WU8D 3AZGA
chains in the Genus database with same CATH superfamily
3AZIC 3C1BC 5FUGB 1AOIA 2AROA 4WU8B 1P3BD 4X23D 1M1AC 3X1UA 2Y2HA 4UPKA 1M1AB 5AVCA 2CV5B 3AZNC 4NFTA 4ZBJC 1P3BB 4AWLB 2XD1A 2Y2QA 5BO0B 1P3KA 4J8VA 1F1EA 1M1AD 5BNVB 1HQ3B 3KXBB 5B2IB 3NQJB 2UWXA 3REJD 5B31A 1S32A 2BG1A 1KX4C 5B0ZC 3AYWC 5BS7C 3KXBD 3C1CC 4J8XB 4ZUXA 3LJAD 3AN2A 5AVBA 4H9SC 3X1SA 4QLCB 1P34B 1P3PB 5B24C 3MVDA 4J8XD 3H0MC 2LY8A 3LZ0D 2PYOC 3A6ND 5E5AA 1P3LA 3W99B 5CHLB 5CP6D 4CAYA 3EPHA 4YM6A 3EPJA 3LZ0B 3W99D 3MGQC 1M18C 5JRGC 1P3GC 3B0DB 1ID3A 3REKC 3UT9A 3AZFB 2FJ7A 3AZLA 3W97C 1ZLAD 2HIOA 3AZEA 5B1LA 5AY8D 4XUJB 2Y2KA 3WTPC 3X1TB 2ZY4A 4YS3B 2YFWB 2NQBC 5GT3D 5C3IC 1H3OB 4J8UA 1P3MB 3LELD 5CPKC 3AZMC 5AY8C 2NZDA 3MNNC 3X1TD 4WNNB 2G5HC 4YS3D 4R8PA 1T3UA 4EO5B 1P3MC 1AOIC 3MGPA 2F8NK 2XD5A 1M19A 3AV1A 4XUJC 4KGCC 5KDMA 1N1JB 4H9PB 1BH8A 5GT0A 4XZQD 1P3AA 4HGAB 5DNND 4CSRB 2IO5B 5B32D 3X1VA 5F99B 4WU9B 2RVQC 5AV9A 4Z5TA 1U35B 2PYOD 3B0BA 3A1IA 3O62A 1W2EA 5B33B 3WTPE 2YFVA 4XZQB 4KUDC 2Y2GA 2F8NH 5B32B 3LJAC 3MGSA 1PZRA 3R45B 5DNMC 5G49A 1U35D 5AV6C 1JFIB 2PYOB 3C1CD 1KX3C 5B24B 1P3PC 1P34C 3UTBA 5AV5A 4X23B 2F2AC 2BYMA 3MGRD 2F8NG 3W98C 3AFAB 2CV5D 1BH9B 3RELA 3REID 5E5AC 3V9RA 3UTAA 1P3LC 3VH6W 2Y2PA 3AZND 3AFAD 4YM6C 3AFAC 2ZY2A 3VH6T 4Z5TB 1TAFA 4AWLC 2Y2NA 4X23C 3LZ1B 4ZBJB 3W96D 3AZNB 3AZNA 5B0YA 3W97A 4H9OB 4KHAB 1P3OB 3KWQD 1EQZC 3LJAB 3EPKA 5AV8D 3AZKB 1P34D 3LZ1D 4WZSB 1P3PD 3W96B 3AZJC 4R8PB 1P3OD 3KWQB 1U35C 3C1BB 3A6NB 5B2JA 5F99C 3AZGC 4WU9C 5AV5D 3RELB 3KWQA 3C1CA 3W96A 4KGCB 2BYMB 4Z2MH 2RVQD 3AN2C 5B1LB 5AV5B 1Q9CA 1A7WA 5CPIC 3AZFD 5B0YB 3AZHB 1HTAA 4Z2MG 3MGSB 4KGCD 5AY8B 4XUJD 5AV9C 4H9NA 5B32A 1P3KC 1TAFB 3UTAD 4J8WC 3REIA 4XZQA 3X1SD 1P3MD 3AZHD 3X1TC 1S32C 3TU4A 1P3GA 3LELC 3W97B 3AZLC 1P3PA 5GT3C 1N1JA 2HIOC 3UTBC 2ZY5A 1P3GB 3TU4B 1M18B 3AV1B 2Y2OA 5B2JD 4ZUXB 1M19B 3W97D 5B24A 3MVDC 3AV2C 1P3GD 5AV8A 3TU4D 1M18D 4J8VD 3R45A 2PYOA 5AY8A 3W99C 3AZED 3AZHA 3C1BA 2FJ7D 5B33D 1P3AD 3AFAA 2AROC 4QLCC 5GT0D 4JJNB 5CP6C 3AZKA 4J8VB 5GXQA 4XUJA 3A1KA 4X23A 1P3BA 1M18A 4WJ3C 3C1CB 4KHAA 2Y2LA 5B24D 4J8XC 1BH8B 5GT0B 4JJND 3KSYA 2RIQA 3AZEC 2NZDD 3A6NA 3EPLA 3MGRB 4NE6A 5B2IC 4J8UD 2AROB 3REHC 3KXBC 3O62B 2Y2IA 3REIB 3MGRA 5B2JC 4H9NB 3REJC 1P3OA 4H9OA 2HIOD 3MVDB 4J8UB 1H3OA 3LZ1A 3AZLD 3UT9D 3O62D 2G5IC 1ID3D 4Z5TD 4ZUXC 5GXQB 4KGCA 5CPIA 2FFFB 4JJNA 4H9SA 3X1SC 2HIOB 3MGPB 3UT9B 3AZFA 5BT1D 1P3KD 5GXQD 3NQJA 5AV8B 5B32G 3LZ0A 3AZKD 3MGPD 5AVCD 5GSUC 2YFWA 5B33A 4R8PD 4J8WB 3C1BD 1KX5C 5AV9B 3MGSC 3X1VB 3RELD 2CV5A 5B0YC 1JFIA 1BFMA 5G49B 3KUYC 1P3FC 5AV5C 5B1LC 3AZGD 4H9QA 3X1UB 5B1LD 4Z66C 1F66D 3VH6A 5B0YD 1B67A 3RELC 5AV8C 5B40C 3MGSD 4WNNA 4NE3A 3AZGB 1P3ID 4CSRA 3V9RB 3UTAB 3WKJB 3KWQC 5CPJC 4NE5A 1EQZD 4R8PC 1P3MA 1BH9A 3MGPC 3W96C 3X1SB 5CP6A 3AZKC 3WA9C 3WAAD 5BNVA 5GXQC 1P3IB 1R4VA 4E45A 3B6FC 4YM6D 3AV1D 5B2JB 4ZUXD 2HUEC 4Z5TC 3REIC 1M19D 2JSSA 1Z2CB 3O62C 4WU8A 4YM6B 4LD9C 5FUGA 3MGRC 1U35A 2Y2JA 3LJAA 3AZEB 5E5AB 3AZIA 1P3LB 2FJ7B 1P3AB 1KX3D 3B0CW 5AV6D 3W98B 1P34A 5DNMD 5KDMB 3KFUG 1TZYC 5B1MC 4JJNC 2BYKA 4KUDD 1KX3B 4CAYB 5DNMB 3W99A 2NZDB 4UUZB 3B6GD 3B6GC 5B32C 5B31B 4G91C 2AROD 4XZQC 4QLCA 5B33C 4G91B 5B1MD 5B31C 1TZYD 3TU4C 2DQNC 2IO5C 3UTBB 3LELA 3MVDD 3AZLB 4G92C 5GT3A 1ID3B 3MNND 5B1MB 1TZYB 3AZMD 5CPKD 1S32B 4Z66A 3UTBD 4LD9D 2YFVB 1HQ3A 4EO5C 1AOIB 5B40A 3WTPD 2NQBD 3MNNB 5BO0A 1P3KB 3REJA 5F99A 4WU9A 5CPKB 1S32D 3AZHC 4LD9B 5AVCB 3REKD 3B6FD 1WWIA 4H9PA 4J8WD 3WA9A 1M1AA 3WTPB 2NQBB 5AVBB 3MGQD 3AN2B 1B6WA 5AV9D 2L5AA 5JRGA 3WAAC 3X1VD 3IP4C 3B6FA 5DNNA 4J8XA 3REKB 3AZFC 2Y2MA 5JRGB 5AVBD 3MGQB 3X1UD 3AN2D 1P3IC 3A6NC 3LZ0C 5B40D 1F66B 3AZJB 5B2IA 3AL0C 2JE5A 3FDDA 4DQYB 3REHA 1F66C 4YS3A 5CPJB 3X1TA 3WKJC 3NQUB 1KX4A 2F8ND 3WKJD 1EQZB 2ZY3A 5B40B 1P3OC 3AZJD 3LZ1C 2VQRA 1P3FA 3AYWD 3P5JB 3WAAB 2ZM5A 5B0ZD 2F8NB 1KX4D 3X1UC 2F8NA 5AVBC 1KX5D 1P3FB 3KUYB 1ZLAA 5GSUD 1WWSA 5AVCC 3AV2A 3X1VC 5B0ZB 3B6GA 5CPJA 1KX5B 5BT1C 5GSUB 4KUDA 5GSUA 1KX5A 4UUZA 3B0CT 5E5AD 5B0ZA 1P3LD 1ID3C 5BNXA 1P3BC 3AYWA 4G92B 3REKA 3UT9C 2CV5C 2BYKB 5AV6B 3W98D 3KUYA 3AZID 2DF4C 4DRAA 3VH5A 1HQ3D 4WU8C 4KUDB 5JA4A 3F6TA 3REHD 4J8UC 3KXBA 5B2ID 3AZIB 3REJB 5CPKA 3B6GB 2NZDC 3EG5B 5B31D 4HGAC 2CWEA 4DRBA 3REHB 4H9RB 5B1MA 3MGQA 2J8PA 4H9RA 5DNNC 4QLCD 5GT0C 1P3AC 2FJ7C 1ULYA 5BNXB 3AZMB 1P3IA 4J8VC 1KU5A 5CP6B 3AV2D 5C3IB 5JA4B 1AOID 4E44A 4YS3C 4LD9A 2HUEB 3WKJA 3AZMA 2W8SA 5DNMA 3MNNA 3AV2B 5BS7A 3B6FB 3B0DC 1ZLAB 3H0LC 1M19C 4H9QB 3AV1C 3WA9B 1TZYA 4WV4B 1ZLAC 5GT3B 3LELB 5JRGD 3UTAC 4J8WA 3WA9D 3VH5W 4Z66B 5CPID 5CPJD 3VH5T 3WAAA 4M6BA 5AV6A 1KX3A 1EQZA 5DNNB 4Z66D 3AYWB 5CPIB 3H0RC 5F99D 3NQUA 5B31G 4WU9D 1KX4B 1P3FD 3WTPA 2NQBA 3KUYD 2JCHA 3W98A 3AZJA 1F66A 1HQ3C 4WU8D 3AZGA
chains in the Genus database with same CATH topology
3AZIC 3C1BC 5FUGB 1AOIA 2AROA 4WU8B 1P3BD 4X23D 1M1AC 3X1UA 2Y2HA 4UPKA 1M1AB 5AVCA 2CV5B 3AZNC 4NFTA 4ZBJC 1P3BB 4AWLB 2XD1A 2Y2QA 5BO0B 1P3KA 4J8VA 1F1EA 1M1AD 5BNVB 1HQ3B 3KXBB 5B2IB 3NQJB 2UWXA 3REJD 5B31A 1S32A 2BG1A 1KX4C 5B0ZC 3AYWC 5BS7C 3KXBD 3C1CC 4J8XB 4ZUXA 3LJAD 3AN2A 5AVBA 4H9SC 3X1SA 4QLCB 1P34B 1P3PB 5B24C 3MVDA 4J8XD 3H0MC 2LY8A 3LZ0D 2PYOC 3A6ND 5E5AA 1P3LA 3W99B 5CHLB 5CP6D 4CAYA 3EPHA 4YM6A 3EPJA 3LZ0B 3W99D 3MGQC 1M18C 5JRGC 1P3GC 3B0DB 1ID3A 3REKC 3UT9A 3AZFB 2FJ7A 3AZLA 3W97C 1ZLAD 2HIOA 3AZEA 5B1LA 5AY8D 4XUJB 2Y2KA 3WTPC 3X1TB 2ZY4A 4YS3B 2YFWB 2NQBC 5GT3D 5C3IC 1H3OB 4J8UA 1P3MB 3LELD 5CPKC 3AZMC 5AY8C 2NZDA 3MNNC 3X1TD 4WNNB 2G5HC 4YS3D 4R8PA 1T3UA 4EO5B 1P3MC 1AOIC 3MGPA 2F8NK 2XD5A 1M19A 3AV1A 4XUJC 4KGCC 5KDMA 1N1JB 4H9PB 1BH8A 5GT0A 4XZQD 1P3AA 4HGAB 5DNND 4CSRB 2IO5B 5B32D 3X1VA 5F99B 4WU9B 2RVQC 5AV9A 4Z5TA 1U35B 2PYOD 3B0BA 3A1IA 3O62A 1W2EA 5B33B 3WTPE 2YFVA 4XZQB 4KUDC 2Y2GA 2F8NH 5B32B 3LJAC 3MGSA 1PZRA 3R45B 5DNMC 5G49A 1U35D 5AV6C 1JFIB 2PYOB 3C1CD 1KX3C 5B24B 1P3PC 1P34C 3UTBA 5AV5A 4X23B 2F2AC 2BYMA 3MGRD 2F8NG 3W98C 3AFAB 2CV5D 1BH9B 3RELA 3REID 5E5AC 3V9RA 3UTAA 1P3LC 3VH6W 2Y2PA 3AZND 3AFAD 4YM6C 3AFAC 2ZY2A 3VH6T 4Z5TB 1TAFA 4AWLC 2Y2NA 4X23C 3LZ1B 4ZBJB 3W96D 3AZNB 3AZNA 5B0YA 3W97A 4H9OB 4KHAB 1P3OB 3KWQD 1EQZC 3LJAB 3EPKA 5AV8D 3AZKB 1P34D 3LZ1D 4WZSB 1P3PD 3W96B 3AZJC 4R8PB 1P3OD 3KWQB 1U35C 3C1BB 3A6NB 5B2JA 5F99C 3AZGC 4WU9C 5AV5D 3RELB 3KWQA 3C1CA 3W96A 4KGCB 2BYMB 4Z2MH 2RVQD 3AN2C 5B1LB 5AV5B 1Q9CA 1A7WA 5CPIC 3AZFD 5B0YB 3AZHB 1HTAA 4Z2MG 3MGSB 4KGCD 5AY8B 4XUJD 5AV9C 4H9NA 5B32A 1P3KC 1TAFB 3UTAD 4J8WC 3REIA 4XZQA 3X1SD 1P3MD 3AZHD 3X1TC 1S32C 3TU4A 1P3GA 3LELC 3W97B 3AZLC 1P3PA 5GT3C 1N1JA 2HIOC 3UTBC 2ZY5A 1P3GB 3TU4B 1M18B 3AV1B 2Y2OA 5B2JD 4ZUXB 1M19B 3W97D 5B24A 3MVDC 3AV2C 1P3GD 5AV8A 3TU4D 1M18D 4J8VD 3R45A 2PYOA 5AY8A 3W99C 3AZED 3AZHA 3C1BA 2FJ7D 5B33D 1P3AD 3AFAA 2AROC 4QLCC 5GT0D 4JJNB 5CP6C 3AZKA 4J8VB 5GXQA 4XUJA 3A1KA 4X23A 1P3BA 1M18A 4WJ3C 3C1CB 4KHAA 2Y2LA 5B24D 4J8XC 1BH8B 5GT0B 4JJND 3KSYA 2RIQA 3AZEC 2NZDD 3A6NA 3EPLA 3MGRB 4NE6A 5B2IC 4J8UD 2AROB 3REHC 3KXBC 3O62B 2Y2IA 3REIB 3MGRA 5B2JC 4H9NB 3REJC 1P3OA 4H9OA 2HIOD 3MVDB 4J8UB 1H3OA 3LZ1A 3AZLD 3UT9D 3O62D 2G5IC 1ID3D 4Z5TD 4ZUXC 5GXQB 4KGCA 5CPIA 2FFFB 4JJNA 4H9SA 3X1SC 2HIOB 3MGPB 3UT9B 3AZFA 5BT1D 1P3KD 5GXQD 3NQJA 5AV8B 5B32G 3LZ0A 3AZKD 3MGPD 5AVCD 5GSUC 2YFWA 5B33A 4R8PD 4J8WB 3C1BD 1KX5C 5AV9B 3MGSC 3X1VB 3RELD 2CV5A 5B0YC 1JFIA 1BFMA 5G49B 3KUYC 1P3FC 5AV5C 5B1LC 3AZGD 4H9QA 3X1UB 5B1LD 4Z66C 1F66D 3VH6A 5B0YD 1B67A 3RELC 5AV8C 5B40C 3MGSD 4WNNA 4NE3A 3AZGB 1P3ID 4CSRA 3V9RB 3UTAB 3WKJB 3KWQC 5CPJC 4NE5A 1EQZD 4R8PC 1P3MA 1BH9A 3MGPC 3W96C 3X1SB 5CP6A 3AZKC 3WA9C 3WAAD 5BNVA 5GXQC 1P3IB 1R4VA 4E45A 3B6FC 4YM6D 3AV1D 5B2JB 4ZUXD 2HUEC 4Z5TC 3REIC 1M19D 2JSSA 1Z2CB 3O62C 4WU8A 4YM6B 4LD9C 5FUGA 3MGRC 1U35A 2Y2JA 3LJAA 3AZEB 5E5AB 3AZIA 1P3LB 2FJ7B 1P3AB 1KX3D 3B0CW 5AV6D 3W98B 1P34A 5DNMD 5KDMB 3KFUG 1TZYC 5B1MC 4JJNC 2BYKA 4KUDD 1KX3B 4CAYB 5DNMB 3W99A 2NZDB 4UUZB 3B6GD 3B6GC 5B32C 5B31B 4G91C 2AROD 4XZQC 4QLCA 5B33C 4G91B 5B1MD 5B31C 1TZYD 3TU4C 2DQNC 2IO5C 3UTBB 3LELA 3MVDD 3AZLB 4G92C 5GT3A 1ID3B 3MNND 5B1MB 1TZYB 3AZMD 5CPKD 1S32B 4Z66A 3UTBD 4LD9D 2YFVB 1HQ3A 4EO5C 1AOIB 5B40A 3WTPD 2NQBD 3MNNB 5BO0A 1P3KB 3REJA 5F99A 4WU9A 5CPKB 1S32D 3AZHC 4LD9B 5AVCB 3REKD 3B6FD 1WWIA 4H9PA 4J8WD 3WA9A 1M1AA 3WTPB 2NQBB 5AVBB 3MGQD 3AN2B 1B6WA 5AV9D 2L5AA 5JRGA 3WAAC 3X1VD 3IP4C 3B6FA 5DNNA 4J8XA 3REKB 3AZFC 2Y2MA 5JRGB 5AVBD 3MGQB 3X1UD 3AN2D 1P3IC 3A6NC 3LZ0C 5B40D 1F66B 3AZJB 5B2IA 3AL0C 2JE5A 3FDDA 4DQYB 3REHA 1F66C 4YS3A 5CPJB 3X1TA 3WKJC 3NQUB 1KX4A 2F8ND 3WKJD 1EQZB 2ZY3A 5B40B 1P3OC 3AZJD 3LZ1C 2VQRA 1P3FA 3AYWD 3P5JB 3WAAB 2ZM5A 5B0ZD 2F8NB 1KX4D 3X1UC 2F8NA 5AVBC 1KX5D 1P3FB 3KUYB 1ZLAA 5GSUD 1WWSA 5AVCC 3AV2A 3X1VC 5B0ZB 3B6GA 5CPJA 1KX5B 5BT1C 5GSUB 4KUDA 5GSUA 1KX5A 4UUZA 3B0CT 5E5AD 5B0ZA 1P3LD 1ID3C 5BNXA 1P3BC 3AYWA 4G92B 3REKA 3UT9C 2CV5C 2BYKB 5AV6B 3W98D 3KUYA 3AZID 2DF4C 4DRAA 3VH5A 1HQ3D 4WU8C 4KUDB 5JA4A 3F6TA 3REHD 4J8UC 3KXBA 5B2ID 3AZIB 3REJB 5CPKA 3B6GB 2NZDC 3EG5B 5B31D 4HGAC 2CWEA 4DRBA 3REHB 4H9RB 5B1MA 3MGQA 2J8PA 4H9RA 5DNNC 4QLCD 5GT0C 1P3AC 2FJ7C 1ULYA 5BNXB 3AZMB 1P3IA 4J8VC 1KU5A 5CP6B 3AV2D 5C3IB 5JA4B 1AOID 4E44A 4YS3C 4LD9A 2HUEB 3WKJA 3AZMA 2W8SA 5DNMA 3MNNA 3AV2B 5BS7A 3B6FB 3B0DC 1ZLAB 3H0LC 1M19C 4H9QB 3AV1C 3WA9B 1TZYA 4WV4B 1ZLAC 5GT3B 3LELB 5JRGD 3UTAC 4J8WA 3WA9D 3VH5W 4Z66B 5CPID 5CPJD 3VH5T 3WAAA 4M6BA 5AV6A 1KX3A 1EQZA 5DNNB 4Z66D 3AYWB 5CPIB 3H0RC 5F99D 3NQUA 5B31G 4WU9D 1KX4B 1P3FD 3WTPA 2NQBA 3KUYD 2JCHA 3W98A 3AZJA 1F66A 1HQ3C 4WU8D 3AZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI C;  3C1B C;  5FUG B;  1AOI A;  2ARO A;  4WU8 B;  1P3B D;  4X23 D;  1M1A C;  3X1U A;  1M1A B;  5AVC A;  2CV5 B;  3AZN C;  4NFT A;  4ZBJ C;  1P3B B;  4AWL B;  5BO0 B;  1P3K A;  4J8V A;  1F1E A;  1M1A D;  5BNV B;  1HQ3 B;  3KXB B;  5B2I B;  3NQJ B;  3REJ D;  5B31 A;  1S32 A;  1KX4 C;  5B0Z C;  3AYW C;  5BS7 C;  3KXB D;  3C1C C;  4J8X B;  4ZUX A;  3LJA D;  3AN2 A;  5AVB A;  4H9S C;  3X1S A;  4QLC B;  1P34 B;  1P3P B;  5B24 C;  3MVD A;  4J8X D;  2LY8 A;  3LZ0 D;  2PYO C;  3A6N D;  5E5A A;  1P3L A;  3W99 B;  5CHL B;  5CP6 D;  4CAY A;  4YM6 A;  3LZ0 B;  3W99 D;  3MGQ C;  1M18 C;  5JRG C;  1P3G C;  3B0D B;  1ID3 A;  3REK C;  3UT9 A;  3AZF B;  2FJ7 A;  3AZL A;  3W97 C;  1ZLA D;  2HIO A;  3AZE A;  5B1L A;  5AY8 D;  4XUJ B;  3WTP C;  3X1T B;  2NQB C;  4YS3 B;  2YFW B;  5GT3 D;  5C3I C;  1H3O B;  4J8U A;  1P3M B;  3LEL D;  5CPK C;  3AZM C;  5AY8 C;  2NZD A;  3MNN C;  4WNN B;  3X1T D;  4YS3 D;  4R8P A;  1P3M C;  4EO5 B;  1AOI C;  3MGP A;  2F8N K;  1M19 A;  3AV1 A;  4XUJ C;  4KGC C;  5KDM A;  1N1J B;  4H9P B;  1BH8 A;  5GT0 A;  4XZQ D;  1P3A A;  4HGA B;  5DNN D;  4CSR B;  2IO5 B;  5B32 D;  3X1V A;  5F99 B;  4WU9 B;  2RVQ C;  5AV9 A;  4Z5T A;  1U35 B;  2PYO D;  3B0B A;  3O62 A;  5B33 B;  3WTP E;  2YFV A;  4XZQ B;  4KUD C;  2F8N H;  5B32 B;  3LJA C;  3MGS A;  3R45 B;  1U35 D;  5DNM C;  5G49 A;  2PYO B;  5AV6 C;  1JFI B;  3C1C D;  1KX3 C;  5B24 B;  1P3P C;  1P34 C;  3UTB A;  5AV5 A;  4X23 B;  2BYM A;  3MGR D;  2F8N G;  3W98 C;  3AFA B;  2CV5 D;  1BH9 B;  3REL A;  3REI D;  5E5A C;  3V9R A;  3UTA A;  1P3L C;  3VH6 W;  3AZN D;  3AFA D;  4YM6 C;  3AFA C;  3VH6 T;  4Z5T B;  1TAF A;  4AWL C;  4X23 C;  3LZ1 B;  4ZBJ B;  3W96 D;  3AZN B;  3AZN A;  5B0Y A;  3W97 A;  4H9O B;  4KHA B;  1P3O B;  3KWQ D;  1EQZ C;  3LJA B;  5AV8 D;  3AZK B;  1P34 D;  3LZ1 D;  4WZS B;  1P3P D;  3W96 B;  3AZJ C;  4R8P B;  1P3O D;  3KWQ B;  1U35 C;  3C1B B;  3A6N B;  5B2J A;  5F99 C;  3AZG C;  4WU9 C;  5AV5 D;  3REL B;  3KWQ A;  3C1C A;  3W96 A;  4KGC B;  2BYM B;  4Z2M H;  2RVQ D;  3AN2 C;  5B1L B;  5AV5 B;  1Q9C A;  1A7W A;  5CPI C;  3AZF D;  5B0Y B;  3AZH B;  1HTA A;  4Z2M G;  3MGS B;  4KGC D;  4XUJ D;  5AY8 B;  5AV9 C;  4H9N A;  5B32 A;  1P3K C;  1TAF B;  3UTA D;  4J8W C;  3REI A;  4XZQ A;  3X1S D;  1P3M D;  3AZH D;  3X1T C;  1S32 C;  3TU4 A;  1P3G A;  3LEL C;  3W97 B;  3AZL C;  1P3P A;  5GT3 C;  1N1J A;  2HIO C;  3UTB C;  1P3G B;  3TU4 B;  1M18 B;  3AV1 B;  5B2J D;  4ZUX B;  1M19 B;  3W97 D;  5B24 A;  3MVD C;  3AV2 C;  1P3G D;  5AV8 A;  3TU4 D;  1M18 D;  4J8V D;  3R45 A;  2PYO A;  5AY8 A;  3W99 C;  3AZE D;  3AZH A;  3C1B A;  2FJ7 D;  5B33 D;  1P3A D;  3AFA A;  2ARO C;  4QLC C;  5GT0 D;  4JJN B;  5CP6 C;  3AZK A;  4J8V B;  5GXQ A;  4XUJ A;  4X23 A;  1P3B A;  1M18 A;  3C1C B;  4KHA A;  4J8X C;  5B24 D;  1BH8 B;  5GT0 B;  4JJN D;  3KSY A;  3AZE C;  2NZD D;  3A6N A;  3MGR B;  4NE6 A;  5B2I C;  4J8U D;  2ARO B;  3REH C;  3KXB C;  3O62 B;  3REI B;  3MGR A;  5B2J C;  4H9N B;  3REJ C;  1P3O A;  4H9O A;  2HIO D;  3MVD B;  4J8U B;  1H3O A;  3LZ1 A;  3AZL D;  3UT9 D;  3O62 D;  1ID3 D;  4Z5T D;  4ZUX C;  5GXQ B;  4KGC A;  5CPI A;  4JJN A;  4H9S A;  3X1S C;  2HIO B;  3MGP B;  3UT9 B;  3AZF A;  5BT1 D;  1P3K D;  5GXQ D;  3NQJ A;  5AV8 B;  5B32 G;  3LZ0 A;  3AZK D;  3MGP D;  5AVC D;  5GSU C;  2YFW A;  5B33 A;  4R8P D;  4J8W B;  3C1B D;  1KX5 C;  5AV9 B;  3MGS C;  3X1V B;  3REL D;  2CV5 A;  5B0Y C;  1JFI A;  1BFM A;  5G49 B;  3KUY C;  1P3F C;  5AV5 C;  5B1L C;  3AZG D;  4H9Q A;  3X1U B;  5B1L D;  4Z66 C;  1F66 D;  3VH6 A;  5B0Y D;  1B67 A;  3REL C;  5AV8 C;  5B40 C;  3MGS D;  4WNN A;  4NE3 A;  3AZG B;  1P3I D;  4CSR A;  3V9R B;  3UTA B;  3WKJ B;  3KWQ C;  5CPJ C;  4NE5 A;  1EQZ D;  4R8P C;  1P3M A;  1BH9 A;  3MGP C;  3W96 C;  3X1S B;  5CP6 A;  3AZK C;  3WA9 C;  3WAA D;  5BNV A;  5GXQ C;  1P3I B;  1R4V A;  4E45 A;  3B6F C;  4YM6 D;  3AV1 D;  5B2J B;  4ZUX D;  2HUE C;  4Z5T C;  3REI C;  1M19 D;  2JSS A;  3O62 C;  4WU8 A;  4YM6 B;  4LD9 C;  5FUG A;  3MGR C;  1U35 A;  3LJA A;  3AZE B;  5E5A B;  3AZI A;  1P3L B;  2FJ7 B;  1P3A B;  1KX3 D;  3B0C W;  5AV6 D;  3W98 B;  1P34 A;  5DNM D;  5KDM B;  1TZY C;  5B1M C;  4JJN C;  2BYK A;  4KUD D;  1KX3 B;  4CAY B;  5DNM B;  3W99 A;  2NZD B;  4UUZ B;  3B6G D;  3B6G C;  5B32 C;  5B31 B;  4G91 C;  2ARO D;  4XZQ C;  4QLC A;  5B33 C;  4G91 B;  5B1M D;  5B31 C;  1TZY D;  3TU4 C;  2IO5 C;  3UTB B;  3LEL A;  3MVD D;  3AZL B;  4G92 C;  5GT3 A;  1ID3 B;  3MNN D;  5B1M B;  1TZY B;  3AZM D;  5CPK D;  1S32 B;  4Z66 A;  3UTB D;  4LD9 D;  2YFV B;  1HQ3 A;  4EO5 C;  1AOI B;  5B40 A;  3WTP D;  2NQB D;  3MNN B;  5BO0 A;  1P3K B;  3REJ A;  5F99 A;  4WU9 A;  5CPK B;  1S32 D;  3AZH C;  4LD9 B;  5AVC B;  3REK D;  3B6F D;  1WWI A;  4H9P A;  4J8W D;  3WA9 A;  1M1A A;  3WTP B;  2NQB B;  5AVB B;  3MGQ D;  3AN2 B;  1B6W A;  5AV9 D;  2L5A A;  5JRG A;  3WAA C;  3X1V D;  3B6F A;  5DNN A;  4J8X A;  3REK B;  3AZF C;  5JRG B;  5AVB D;  3MGQ B;  3X1U D;  3AN2 D;  1P3I C;  3A6N C;  3LZ0 C;  5B40 D;  1F66 B;  3AZJ B;  5B2I A;  3REH A;  1F66 C;  4YS3 A;  5CPJ B;  3X1T A;  3WKJ C;  3NQU B;  1KX4 A;  2F8N D;  3WKJ D;  1EQZ B;  5B40 B;  1P3O C;  3AZJ D;  3LZ1 C;  1P3F A;  3AYW D;  3WAA B;  5B0Z D;  2F8N B;  1KX4 D;  3X1U C;  2F8N A;  5AVB C;  1KX5 D;  1P3F B;  3KUY B;  1ZLA A;  5GSU D;  1WWS A;  5AVC C;  3AV2 A;  3X1V C;  5B0Z B;  3B6G A;  5CPJ A;  1KX5 B;  5BT1 C;  5GSU B;  4KUD A;  5GSU A;  1KX5 A;  4UUZ A;  3B0C T;  5E5A D;  5B0Z A;  1P3L D;  1ID3 C;  5BNX A;  1P3B C;  3AYW A;  4G92 B;  3REK A;  3UT9 C;  2CV5 C;  2BYK B;  5AV6 B;  3W98 D;  3KUY A;  3AZI D;  4DRA A;  3VH5 A;  1HQ3 D;  4WU8 C;  4KUD B;  5JA4 A;  3REH D;  4J8U C;  3KXB A;  5B2I D;  3AZI B;  3REJ B;  5CPK A;  3B6G B;  2NZD C;  5B31 D;  4HGA C;  2CWE A;  4DRB A;  3REH B;  4H9R B;  5B1M A;  3MGQ A;  4H9R A;  5DNN C;  4QLC D;  5GT0 C;  1P3A C;  2FJ7 C;  1ULY A;  5BNX B;  3AZM B;  1P3I A;  4J8V C;  1KU5 A;  5CP6 B;  3AV2 D;  5C3I B;  5JA4 B;  1AOI D;  4E44 A;  4YS3 C;  4LD9 A;  2HUE B;  3WKJ A;  3AZM A;  5DNM A;  3MNN A;  3AV2 B;  5BS7 A;  3B6F B;  3B0D C;  1ZLA B;  1M19 C;  4H9Q B;  3AV1 C;  3WA9 B;  1TZY A;  4WV4 B;  1ZLA C;  5GT3 B;  3LEL B;  5JRG D;  3UTA C;  4J8W A;  3WA9 D;  3VH5 W;  4Z66 B;  5CPI D;  5CPJ D;  3VH5 T;  3WAA A;  4M6B A;  5AV6 A;  1KX3 A;  1EQZ A;  5DNN B;  4Z66 D;  3AYW B;  5CPI B;  5F99 D;  3NQU A;  5B31 G;  4WU9 D;  1KX4 B;  1P3F D;  3WTP A;  2NQB A;  3KUY D;  3W98 A;  3AZJ A;  1F66 A;  1HQ3 C;  4WU8 D;  3AZG A; 
#chains in the Genus database with same CATH topology
 3AZI C;  3C1B C;  5FUG B;  1AOI A;  2ARO A;  4WU8 B;  1P3B D;  4X23 D;  1M1A C;  3X1U A;  2Y2H A;  4UPK A;  1M1A B;  5AVC A;  2CV5 B;  3AZN C;  4NFT A;  4ZBJ C;  1P3B B;  4AWL B;  2XD1 A;  2Y2Q A;  5BO0 B;  1P3K A;  4J8V A;  1F1E A;  1M1A D;  5BNV B;  1HQ3 B;  3KXB B;  5B2I B;  3NQJ B;  2UWX A;  3REJ D;  5B31 A;  1S32 A;  2BG1 A;  1KX4 C;  5B0Z C;  3AYW C;  5BS7 C;  3KXB D;  3C1C C;  4J8X B;  4ZUX A;  3LJA D;  3AN2 A;  5AVB A;  4H9S C;  3X1S A;  4QLC B;  1P34 B;  1P3P B;  5B24 C;  3MVD A;  4J8X D;  3H0M C;  2LY8 A;  3LZ0 D;  2PYO C;  3A6N D;  5E5A A;  1P3L A;  3W99 B;  5CHL B;  5CP6 D;  4CAY A;  3EPH A;  4YM6 A;  3EPJ A;  3LZ0 B;  3W99 D;  3MGQ C;  1M18 C;  5JRG C;  1P3G C;  3B0D B;  1ID3 A;  3REK C;  3UT9 A;  3AZF B;  2FJ7 A;  3AZL A;  3W97 C;  1ZLA D;  2HIO A;  3AZE A;  5B1L A;  5AY8 D;  4XUJ B;  2Y2K A;  3WTP C;  3X1T B;  2ZY4 A;  4YS3 B;  2YFW B;  2NQB C;  5GT3 D;  5C3I C;  1H3O B;  4J8U A;  1P3M B;  3LEL D;  5CPK C;  3AZM C;  5AY8 C;  2NZD A;  3MNN C;  3X1T D;  4WNN B;  2G5H C;  4YS3 D;  4R8P A;  1T3U A;  4EO5 B;  1P3M C;  1AOI C;  3MGP A;  2F8N K;  2XD5 A;  1M19 A;  3AV1 A;  4XUJ C;  4KGC C;  5KDM A;  1N1J B;  4H9P B;  1BH8 A;  5GT0 A;  4XZQ D;  1P3A A;  4HGA B;  5DNN D;  4CSR B;  2IO5 B;  5B32 D;  3X1V A;  5F99 B;  4WU9 B;  2RVQ C;  5AV9 A;  4Z5T A;  1U35 B;  2PYO D;  3B0B A;  3A1I A;  3O62 A;  1W2E A;  5B33 B;  3WTP E;  2YFV A;  4XZQ B;  4KUD C;  2Y2G A;  2F8N H;  5B32 B;  3LJA C;  3MGS A;  1PZR A;  3R45 B;  5DNM C;  5G49 A;  1U35 D;  5AV6 C;  1JFI B;  2PYO B;  3C1C D;  1KX3 C;  5B24 B;  1P3P C;  1P34 C;  3UTB A;  5AV5 A;  4X23 B;  2F2A C;  2BYM A;  3MGR D;  2F8N G;  3W98 C;  3AFA B;  2CV5 D;  1BH9 B;  3REL A;  3REI D;  5E5A C;  3V9R A;  3UTA A;  1P3L C;  3VH6 W;  2Y2P A;  3AZN D;  3AFA D;  4YM6 C;  3AFA C;  2ZY2 A;  3VH6 T;  4Z5T B;  1TAF A;  4AWL C;  2Y2N A;  4X23 C;  3LZ1 B;  4ZBJ B;  3W96 D;  3AZN B;  3AZN A;  5B0Y A;  3W97 A;  4H9O B;  4KHA B;  1P3O B;  3KWQ D;  1EQZ C;  3LJA B;  3EPK A;  5AV8 D;  3AZK B;  1P34 D;  3LZ1 D;  4WZS B;  1P3P D;  3W96 B;  3AZJ C;  4R8P B;  1P3O D;  3KWQ B;  1U35 C;  3C1B B;  3A6N B;  5B2J A;  5F99 C;  3AZG C;  4WU9 C;  5AV5 D;  3REL B;  3KWQ A;  3C1C A;  3W96 A;  4KGC B;  2BYM B;  4Z2M H;  2RVQ D;  3AN2 C;  5B1L B;  5AV5 B;  1Q9C A;  1A7W A;  5CPI C;  3AZF D;  5B0Y B;  3AZH B;  1HTA A;  4Z2M G;  3MGS B;  4KGC D;  5AY8 B;  4XUJ D;  5AV9 C;  4H9N A;  5B32 A;  1P3K C;  1TAF B;  3UTA D;  4J8W C;  3REI A;  4XZQ A;  3X1S D;  1P3M D;  3AZH D;  3X1T C;  1S32 C;  3TU4 A;  1P3G A;  3LEL C;  3W97 B;  3AZL C;  1P3P A;  5GT3 C;  1N1J A;  2HIO C;  3UTB C;  2ZY5 A;  1P3G B;  3TU4 B;  1M18 B;  3AV1 B;  2Y2O A;  5B2J D;  4ZUX B;  1M19 B;  3W97 D;  5B24 A;  3MVD C;  3AV2 C;  1P3G D;  5AV8 A;  3TU4 D;  1M18 D;  4J8V D;  3R45 A;  2PYO A;  5AY8 A;  3W99 C;  3AZE D;  3AZH A;  3C1B A;  2FJ7 D;  5B33 D;  1P3A D;  3AFA A;  2ARO C;  4QLC C;  5GT0 D;  4JJN B;  5CP6 C;  3AZK A;  4J8V B;  5GXQ A;  4XUJ A;  3A1K A;  4X23 A;  1P3B A;  1M18 A;  4WJ3 C;  3C1C B;  4KHA A;  2Y2L A;  5B24 D;  4J8X C;  1BH8 B;  5GT0 B;  4JJN D;  3KSY A;  2RIQ A;  3AZE C;  2NZD D;  3A6N A;  3EPL A;  3MGR B;  4NE6 A;  5B2I C;  4J8U D;  2ARO B;  3REH C;  3KXB C;  3O62 B;  2Y2I A;  3REI B;  3MGR A;  5B2J C;  4H9N B;  3REJ C;  1P3O A;  4H9O A;  2HIO D;  3MVD B;  4J8U B;  1H3O A;  3LZ1 A;  3AZL D;  3UT9 D;  3O62 D;  2G5I C;  1ID3 D;  4Z5T D;  4ZUX C;  5GXQ B;  4KGC A;  5CPI A;  2FFF B;  4JJN A;  4H9S A;  3X1S C;  2HIO B;  3MGP B;  3UT9 B;  3AZF A;  5BT1 D;  1P3K D;  5GXQ D;  3NQJ A;  5AV8 B;  5B32 G;  3LZ0 A;  3AZK D;  3MGP D;  5AVC D;  5GSU C;  2YFW A;  5B33 A;  4R8P D;  4J8W B;  3C1B D;  1KX5 C;  5AV9 B;  3MGS C;  3X1V B;  3REL D;  2CV5 A;  5B0Y C;  1JFI A;  1BFM A;  5G49 B;  3KUY C;  1P3F C;  5AV5 C;  5B1L C;  3AZG D;  4H9Q A;  3X1U B;  5B1L D;  4Z66 C;  1F66 D;  3VH6 A;  5B0Y D;  1B67 A;  3REL C;  5AV8 C;  5B40 C;  3MGS D;  4WNN A;  4NE3 A;  3AZG B;  1P3I D;  4CSR A;  3V9R B;  3UTA B;  3WKJ B;  3KWQ C;  5CPJ C;  4NE5 A;  1EQZ D;  4R8P C;  1P3M A;  1BH9 A;  3MGP C;  3W96 C;  3X1S B;  5CP6 A;  3AZK C;  3WA9 C;  3WAA D;  5BNV A;  5GXQ C;  1P3I B;  1R4V A;  4E45 A;  3B6F C;  4YM6 D;  3AV1 D;  5B2J B;  4ZUX D;  2HUE C;  4Z5T C;  3REI C;  1M19 D;  2JSS A;  1Z2C B;  3O62 C;  4WU8 A;  4YM6 B;  4LD9 C;  5FUG A;  3MGR C;  1U35 A;  2Y2J A;  3LJA A;  3AZE B;  5E5A B;  3AZI A;  1P3L B;  2FJ7 B;  1P3A B;  1KX3 D;  3B0C W;  5AV6 D;  3W98 B;  1P34 A;  5DNM D;  5KDM B;  3KFU G;  1TZY C;  5B1M C;  4JJN C;  2BYK A;  4KUD D;  1KX3 B;  4CAY B;  5DNM B;  3W99 A;  2NZD B;  4UUZ B;  3B6G D;  3B6G C;  5B32 C;  5B31 B;  4G91 C;  2ARO D;  4XZQ C;  4QLC A;  5B33 C;  4G91 B;  5B1M D;  5B31 C;  1TZY D;  3TU4 C;  2DQN C;  2IO5 C;  3UTB B;  3LEL A;  3MVD D;  3AZL B;  4G92 C;  5GT3 A;  1ID3 B;  3MNN D;  5B1M B;  1TZY B;  3AZM D;  5CPK D;  1S32 B;  4Z66 A;  3UTB D;  4LD9 D;  2YFV B;  1HQ3 A;  4EO5 C;  1AOI B;  5B40 A;  3WTP D;  2NQB D;  3MNN B;  5BO0 A;  1P3K B;  3REJ A;  5F99 A;  4WU9 A;  5CPK B;  1S32 D;  3AZH C;  4LD9 B;  5AVC B;  3REK D;  3B6F D;  1WWI A;  4H9P A;  4J8W D;  3WA9 A;  1M1A A;  3WTP B;  2NQB B;  5AVB B;  3MGQ D;  3AN2 B;  1B6W A;  5AV9 D;  2L5A A;  5JRG A;  3WAA C;  3X1V D;  3IP4 C;  3B6F A;  5DNN A;  4J8X A;  3REK B;  3AZF C;  2Y2M A;  5JRG B;  5AVB D;  3MGQ B;  3X1U D;  3AN2 D;  1P3I C;  3A6N C;  3LZ0 C;  5B40 D;  1F66 B;  3AZJ B;  5B2I A;  3AL0 C;  2JE5 A;  3FDD A;  4DQY B;  3REH A;  1F66 C;  4YS3 A;  5CPJ B;  3X1T A;  3WKJ C;  3NQU B;  1KX4 A;  2F8N D;  3WKJ D;  1EQZ B;  2ZY3 A;  5B40 B;  1P3O C;  3AZJ D;  3LZ1 C;  2VQR A;  1P3F A;  3AYW D;  3P5J B;  3WAA B;  2ZM5 A;  5B0Z D;  2F8N B;  1KX4 D;  3X1U C;  2F8N A;  5AVB C;  1KX5 D;  1P3F B;  3KUY B;  1ZLA A;  5GSU D;  1WWS A;  5AVC C;  3AV2 A;  3X1V C;  5B0Z B;  3B6G A;  5CPJ A;  1KX5 B;  5BT1 C;  5GSU B;  4KUD A;  5GSU A;  1KX5 A;  4UUZ A;  3B0C T;  5E5A D;  5B0Z A;  1P3L D;  1ID3 C;  5BNX A;  1P3B C;  3AYW A;  4G92 B;  3REK A;  3UT9 C;  2CV5 C;  2BYK B;  5AV6 B;  3W98 D;  3KUY A;  3AZI D;  2DF4 C;  4DRA A;  3VH5 A;  1HQ3 D;  4WU8 C;  4KUD B;  5JA4 A;  3F6T A;  3REH D;  4J8U C;  3KXB A;  5B2I D;  3AZI B;  3REJ B;  5CPK A;  3B6G B;  2NZD C;  3EG5 B;  5B31 D;  4HGA C;  2CWE A;  4DRB A;  3REH B;  4H9R B;  5B1M A;  3MGQ A;  2J8P A;  4H9R A;  5DNN C;  4QLC D;  5GT0 C;  1P3A C;  2FJ7 C;  1ULY A;  5BNX B;  3AZM B;  1P3I A;  4J8V C;  1KU5 A;  5CP6 B;  3AV2 D;  5C3I B;  5JA4 B;  1AOI D;  4E44 A;  4YS3 C;  4LD9 A;  2HUE B;  3WKJ A;  3AZM A;  2W8S A;  5DNM A;  3MNN A;  3AV2 B;  5BS7 A;  3B6F B;  3B0D C;  1ZLA B;  3H0L C;  1M19 C;  4H9Q B;  3AV1 C;  3WA9 B;  1TZY A;  4WV4 B;  1ZLA C;  5GT3 B;  3LEL B;  5JRG D;  3UTA C;  4J8W A;  3WA9 D;  3VH5 W;  4Z66 B;  5CPI D;  5CPJ D;  3VH5 T;  3WAA A;  4M6B A;  5AV6 A;  1KX3 A;  1EQZ A;  5DNN B;  4Z66 D;  3AYW B;  5CPI B;  3H0R C;  5F99 D;  3NQU A;  5B31 G;  4WU9 D;  1KX4 B;  1P3F D;  3WTP A;  2NQB A;  3KUY D;  2JCH A;  3W98 A;  3AZJ A;  1F66 A;  1HQ3 C;  4WU8 D;  3AZG A; 
#chains in the Genus database with same CATH homology
 3AZI C;  3C1B C;  5FUG B;  1AOI A;  2ARO A;  4WU8 B;  1P3B D;  4X23 D;  1M1A C;  3X1U A;  2Y2H A;  4UPK A;  1M1A B;  5AVC A;  2CV5 B;  3AZN C;  4NFT A;  4ZBJ C;  1P3B B;  4AWL B;  2XD1 A;  2Y2Q A;  5BO0 B;  1P3K A;  4J8V A;  1F1E A;  1M1A D;  5BNV B;  1HQ3 B;  3KXB B;  5B2I B;  3NQJ B;  2UWX A;  3REJ D;  5B31 A;  1S32 A;  2BG1 A;  1KX4 C;  5B0Z C;  3AYW C;  5BS7 C;  3KXB D;  3C1C C;  4J8X B;  4ZUX A;  3LJA D;  3AN2 A;  5AVB A;  4H9S C;  3X1S A;  4QLC B;  1P34 B;  1P3P B;  5B24 C;  3MVD A;  4J8X D;  3H0M C;  2LY8 A;  3LZ0 D;  2PYO C;  3A6N D;  5E5A A;  1P3L A;  3W99 B;  5CHL B;  5CP6 D;  4CAY A;  3EPH A;  4YM6 A;  3EPJ A;  3LZ0 B;  3W99 D;  3MGQ C;  1M18 C;  5JRG C;  1P3G C;  3B0D B;  1ID3 A;  3REK C;  3UT9 A;  3AZF B;  2FJ7 A;  3AZL A;  3W97 C;  1ZLA D;  2HIO A;  3AZE A;  5B1L A;  5AY8 D;  4XUJ B;  2Y2K A;  3WTP C;  3X1T B;  2ZY4 A;  4YS3 B;  2YFW B;  2NQB C;  5GT3 D;  5C3I C;  1H3O B;  4J8U A;  1P3M B;  3LEL D;  5CPK C;  3AZM C;  5AY8 C;  2NZD A;  3MNN C;  3X1T D;  4WNN B;  2G5H C;  4YS3 D;  4R8P A;  1T3U A;  4EO5 B;  1P3M C;  1AOI C;  3MGP A;  2F8N K;  2XD5 A;  1M19 A;  3AV1 A;  4XUJ C;  4KGC C;  5KDM A;  1N1J B;  4H9P B;  1BH8 A;  5GT0 A;  4XZQ D;  1P3A A;  4HGA B;  5DNN D;  4CSR B;  2IO5 B;  5B32 D;  3X1V A;  5F99 B;  4WU9 B;  2RVQ C;  5AV9 A;  4Z5T A;  1U35 B;  2PYO D;  3B0B A;  3A1I A;  3O62 A;  1W2E A;  5B33 B;  3WTP E;  2YFV A;  4XZQ B;  4KUD C;  2Y2G A;  2F8N H;  5B32 B;  3LJA C;  3MGS A;  1PZR A;  3R45 B;  5DNM C;  5G49 A;  1U35 D;  5AV6 C;  1JFI B;  2PYO B;  3C1C D;  1KX3 C;  5B24 B;  1P3P C;  1P34 C;  3UTB A;  5AV5 A;  4X23 B;  2F2A C;  2BYM A;  3MGR D;  2F8N G;  3W98 C;  3AFA B;  2CV5 D;  1BH9 B;  3REL A;  3REI D;  5E5A C;  3V9R A;  3UTA A;  1P3L C;  3VH6 W;  2Y2P A;  3AZN D;  3AFA D;  4YM6 C;  3AFA C;  2ZY2 A;  3VH6 T;  4Z5T B;  1TAF A;  4AWL C;  2Y2N A;  4X23 C;  3LZ1 B;  4ZBJ B;  3W96 D;  3AZN B;  3AZN A;  5B0Y A;  3W97 A;  4H9O B;  4KHA B;  1P3O B;  3KWQ D;  1EQZ C;  3LJA B;  3EPK A;  5AV8 D;  3AZK B;  1P34 D;  3LZ1 D;  4WZS B;  1P3P D;  3W96 B;  3AZJ C;  4R8P B;  1P3O D;  3KWQ B;  1U35 C;  3C1B B;  3A6N B;  5B2J A;  5F99 C;  3AZG C;  4WU9 C;  5AV5 D;  3REL B;  3KWQ A;  3C1C A;  3W96 A;  4KGC B;  2BYM B;  4Z2M H;  2RVQ D;  3AN2 C;  5B1L B;  5AV5 B;  1Q9C A;  1A7W A;  5CPI C;  3AZF D;  5B0Y B;  3AZH B;  1HTA A;  4Z2M G;  3MGS B;  4KGC D;  5AY8 B;  4XUJ D;  5AV9 C;  4H9N A;  5B32 A;  1P3K C;  1TAF B;  3UTA D;  4J8W C;  3REI A;  4XZQ A;  3X1S D;  1P3M D;  3AZH D;  3X1T C;  1S32 C;  3TU4 A;  1P3G A;  3LEL C;  3W97 B;  3AZL C;  1P3P A;  5GT3 C;  1N1J A;  2HIO C;  3UTB C;  2ZY5 A;  1P3G B;  3TU4 B;  1M18 B;  3AV1 B;  2Y2O A;  5B2J D;  4ZUX B;  1M19 B;  3W97 D;  5B24 A;  3MVD C;  3AV2 C;  1P3G D;  5AV8 A;  3TU4 D;  1M18 D;  4J8V D;  3R45 A;  2PYO A;  5AY8 A;  3W99 C;  3AZE D;  3AZH A;  3C1B A;  2FJ7 D;  5B33 D;  1P3A D;  3AFA A;  2ARO C;  4QLC C;  5GT0 D;  4JJN B;  5CP6 C;  3AZK A;  4J8V B;  5GXQ A;  4XUJ A;  3A1K A;  4X23 A;  1P3B A;  1M18 A;  4WJ3 C;  3C1C B;  4KHA A;  2Y2L A;  5B24 D;  4J8X C;  1BH8 B;  5GT0 B;  4JJN D;  3KSY A;  2RIQ A;  3AZE C;  2NZD D;  3A6N A;  3EPL A;  3MGR B;  4NE6 A;  5B2I C;  4J8U D;  2ARO B;  3REH C;  3KXB C;  3O62 B;  2Y2I A;  3REI B;  3MGR A;  5B2J C;  4H9N B;  3REJ C;  1P3O A;  4H9O A;  2HIO D;  3MVD B;  4J8U B;  1H3O A;  3LZ1 A;  3AZL D;  3UT9 D;  3O62 D;  2G5I C;  1ID3 D;  4Z5T D;  4ZUX C;  5GXQ B;  4KGC A;  5CPI A;  2FFF B;  4JJN A;  4H9S A;  3X1S C;  2HIO B;  3MGP B;  3UT9 B;  3AZF A;  5BT1 D;  1P3K D;  5GXQ D;  3NQJ A;  5AV8 B;  5B32 G;  3LZ0 A;  3AZK D;  3MGP D;  5AVC D;  5GSU C;  2YFW A;  5B33 A;  4R8P D;  4J8W B;  3C1B D;  1KX5 C;  5AV9 B;  3MGS C;  3X1V B;  3REL D;  2CV5 A;  5B0Y C;  1JFI A;  1BFM A;  5G49 B;  3KUY C;  1P3F C;  5AV5 C;  5B1L C;  3AZG D;  4H9Q A;  3X1U B;  5B1L D;  4Z66 C;  1F66 D;  3VH6 A;  5B0Y D;  1B67 A;  3REL C;  5AV8 C;  5B40 C;  3MGS D;  4WNN A;  4NE3 A;  3AZG B;  1P3I D;  4CSR A;  3V9R B;  3UTA B;  3WKJ B;  3KWQ C;  5CPJ C;  4NE5 A;  1EQZ D;  4R8P C;  1P3M A;  1BH9 A;  3MGP C;  3W96 C;  3X1S B;  5CP6 A;  3AZK C;  3WA9 C;  3WAA D;  5BNV A;  5GXQ C;  1P3I B;  1R4V A;  4E45 A;  3B6F C;  4YM6 D;  3AV1 D;  5B2J B;  4ZUX D;  2HUE C;  4Z5T C;  3REI C;  1M19 D;  2JSS A;  1Z2C B;  3O62 C;  4WU8 A;  4YM6 B;  4LD9 C;  5FUG A;  3MGR C;  1U35 A;  2Y2J A;  3LJA A;  3AZE B;  5E5A B;  3AZI A;  1P3L B;  2FJ7 B;  1P3A B;  1KX3 D;  3B0C W;  5AV6 D;  3W98 B;  1P34 A;  5DNM D;  5KDM B;  3KFU G;  1TZY C;  5B1M C;  4JJN C;  2BYK A;  4KUD D;  1KX3 B;  4CAY B;  5DNM B;  3W99 A;  2NZD B;  4UUZ B;  3B6G D;  3B6G C;  5B32 C;  5B31 B;  4G91 C;  2ARO D;  4XZQ C;  4QLC A;  5B33 C;  4G91 B;  5B1M D;  5B31 C;  1TZY D;  3TU4 C;  2DQN C;  2IO5 C;  3UTB B;  3LEL A;  3MVD D;  3AZL B;  4G92 C;  5GT3 A;  1ID3 B;  3MNN D;  5B1M B;  1TZY B;  3AZM D;  5CPK D;  1S32 B;  4Z66 A;  3UTB D;  4LD9 D;  2YFV B;  1HQ3 A;  4EO5 C;  1AOI B;  5B40 A;  3WTP D;  2NQB D;  3MNN B;  5BO0 A;  1P3K B;  3REJ A;  5F99 A;  4WU9 A;  5CPK B;  1S32 D;  3AZH C;  4LD9 B;  5AVC B;  3REK D;  3B6F D;  1WWI A;  4H9P A;  4J8W D;  3WA9 A;  1M1A A;  3WTP B;  2NQB B;  5AVB B;  3MGQ D;  3AN2 B;  1B6W A;  5AV9 D;  2L5A A;  5JRG A;  3WAA C;  3X1V D;  3IP4 C;  3B6F A;  5DNN A;  4J8X A;  3REK B;  3AZF C;  2Y2M A;  5JRG B;  5AVB D;  3MGQ B;  3X1U D;  3AN2 D;  1P3I C;  3A6N C;  3LZ0 C;  5B40 D;  1F66 B;  3AZJ B;  5B2I A;  3AL0 C;  2JE5 A;  3FDD A;  4DQY B;  3REH A;  1F66 C;  4YS3 A;  5CPJ B;  3X1T A;  3WKJ C;  3NQU B;  1KX4 A;  2F8N D;  3WKJ D;  1EQZ B;  2ZY3 A;  5B40 B;  1P3O C;  3AZJ D;  3LZ1 C;  2VQR A;  1P3F A;  3AYW D;  3P5J B;  3WAA B;  2ZM5 A;  5B0Z D;  2F8N B;  1KX4 D;  3X1U C;  2F8N A;  5AVB C;  1KX5 D;  1P3F B;  3KUY B;  1ZLA A;  5GSU D;  1WWS A;  5AVC C;  3AV2 A;  3X1V C;  5B0Z B;  3B6G A;  5CPJ A;  1KX5 B;  5BT1 C;  5GSU B;  4KUD A;  5GSU A;  1KX5 A;  4UUZ A;  3B0C T;  5E5A D;  5B0Z A;  1P3L D;  1ID3 C;  5BNX A;  1P3B C;  3AYW A;  4G92 B;  3REK A;  3UT9 C;  2CV5 C;  2BYK B;  5AV6 B;  3W98 D;  3KUY A;  3AZI D;  2DF4 C;  4DRA A;  3VH5 A;  1HQ3 D;  4WU8 C;  4KUD B;  5JA4 A;  3F6T A;  3REH D;  4J8U C;  3KXB A;  5B2I D;  3AZI B;  3REJ B;  5CPK A;  3B6G B;  2NZD C;  3EG5 B;  5B31 D;  4HGA C;  2CWE A;  4DRB A;  3REH B;  4H9R B;  5B1M A;  3MGQ A;  2J8P A;  4H9R A;  5DNN C;  4QLC D;  5GT0 C;  1P3A C;  2FJ7 C;  1ULY A;  5BNX B;  3AZM B;  1P3I A;  4J8V C;  1KU5 A;  5CP6 B;  3AV2 D;  5C3I B;  5JA4 B;  1AOI D;  4E44 A;  4YS3 C;  4LD9 A;  2HUE B;  3WKJ A;  3AZM A;  2W8S A;  5DNM A;  3MNN A;  3AV2 B;  5BS7 A;  3B6F B;  3B0D C;  1ZLA B;  3H0L C;  1M19 C;  4H9Q B;  3AV1 C;  3WA9 B;  1TZY A;  4WV4 B;  1ZLA C;  5GT3 B;  3LEL B;  5JRG D;  3UTA C;  4J8W A;  3WA9 D;  3VH5 W;  4Z66 B;  5CPI D;  5CPJ D;  3VH5 T;  3WAA A;  4M6B A;  5AV6 A;  1KX3 A;  1EQZ A;  5DNN B;  4Z66 D;  3AYW B;  5CPI B;  3H0R C;  5F99 D;  3NQU A;  5B31 G;  4WU9 D;  1KX4 B;  1P3F D;  3WTP A;  2NQB A;  3KUY D;  2JCH A;  3W98 A;  3AZJ A;  1F66 A;  1HQ3 C;  4WU8 D;  3AZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...