2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
1ID3A 5GT3C 5BS7A 1P34C 4H9RB 2CV5C 1JFIA 3RELC 4XUJB 4ZBJB 5BNXA 3AZEA 5DNND 5AVBD 2NQBC 3WTPC 5DNMA 4Z66C 1AOIA 1EQZD 4XZQB 2CV5D 5KDMB 5AVCA 1F1EA 5B32C 3RELD 3REKA 3AZIA 3C1BC 3B6GC 4R8PC 1B6WA 4NE6A 2NQBD 3X1TB 3WTPD 3W97A 3AFAC 1M18A 3MGPB 3MVDA 5B40D 3W99B 4YM6C 3B6GD 3B6FC 2HIOB 4NE5A 3AFAD 4ZUXA 1TAFB 4H9OA 5G49B 2BYMB 5AV8A 2BYKA 1ZLAA 3X1UC 4KUDC 1P3LC 1M19B 3B6FD 4JJNB 1P3AA 3REIB 5AY8B 3KUYB 5AV5A 1P3FB 4UUZA 3C1CB 4KGCC 3MGQD 3WTPE 3AZGC 3REHA 1P3LD 1U35D 3W96C 5GXQB 3REJB 4WU8A 3LELA 3UT9D 4YS3A 3AYWD 3MGSB 2PYOC 5B33B 1WWSA 4J8XA 3AZKA 3W96D 5GT0B 4XUJC 4ZBJC 2PYOD 1S32B 2AROC 5JRGB 5B31A 3AZJA 3LZ1A 2FJ7B 3LJAA 5CP6B 4XZQC 4J8UB 3MNNB 5B1LA 1KX3B 4XUJD 5BT1C 2AROD 3UTBA 2HUEB 3X1TC 3AN2B 5AV6A 3AV2D 1KX4D 3MGPC 5CPIA 4M6BA 2NZDD 5B0ZB 4Z5TA 3W99C 3MGRD 5AVBB 4DRBA 3X1TD 4NFTA 3UTAA 3AV1C 1EQZB 3W99D 1M19C 3X1VA 2YFWA 1HQ3A 3KSYA 3REIC 5AY8C 3KUYC 3TU4A 2NQBB 5DNNA 1P3FC 3AV1D 4KHAA 3O62A 5B1MD 5GT3A 5AV9B 3C1CC 1P3BD 3NQJB 5B40B 1P34A 4G92B 1M19D 4H9NA 2CV5A 3NQUB 5GXQC 3REJC 3RELA 3MGSC 4H9SC 4X23B 2RVQD 3C1CD 5B33C 3AZND 3R45B 3WTPA 4Z66A 2YFVA 5GT0C 5B32A 3C1BA 3B6GA 4R8PA 1S32C 5B33D 1P3KD 5JRGC 3MGQB 5B31G 3AFAA 3WKJA 2FJ7C 1U35B 5CP6C 3WAAD 3A6NB 2IO5B 3MNNC 4J8UC 1KX3C 3UT9B 3AYWB 4YM6A 1S32D 3B6FA 2HUEC 4H9PA 1P3OD 3AN2C 1H3OA 3AZHD 1P3PD 5B0YD 4J8UD 4J8WB 5E5AD 1BH8A 5B0ZC 3X1UA 5GSUB 2PYOB 1P3LA 3X1SB 4KUDA 5BNVA 5AVBC 4QLCD 3AN2D 5F99B 4H9QA 1EQZC 4KGCA 4J8VD 5B0ZD 3AZGA 3W96A 3W98A 2AROB 1M1AC 4LD9D 3AV2B 1P3ID 5AV9C 1KX4B 2NZDB 5B40C 4G92C 4H9RA 3MGRB 5BO0B 1P3GD 4XUJA 5B2ID 3KXBB 1M1AD 4DRAA 4X23C 5AV9D 1BFMA 1P3MD 4XZQA 5KDMA 5B32G 5C3IB 5B2JD 4WU9D 4X23D 3AV1B 5B1MB 3X1TA 1P3BB 3MGQC 4WZSB 3MGPA 1U35C 3A6NC 2IO5C 3W99A 3UT9C 4CAYB 3AYWC 2HIOA 3AZNB 1TAFA 5G49A 2BYMA 3A6ND 4J8WC 5GSUC 1M19A 3X1SC 4JJNA 3REIA 5AY8A 3KUYA 1P3KB 2F8NB 1P3FA 1TZYD 3C1CA 5F99C 1F66D 4J8WD 3WAAB 5GSUD 3X1SD 4E44A 5GXQA 3REJA 3AZFD 1P3OB 3MGSA 4H9SA 3AZHB 3AV2C 1P3PB 5F99D 5B33A 2LY8A 1KX4C 5B0YB 1HTAA 5E5AB 5B24B 3AZEC 2NZDC 3MGRC 5GT0A 1ID3D 4QLCB 3KXBC 1S32A 4WNNB 3V9RB 5JRGA 3AZED 4J8VB 2FJ7A 5CP6A 4J8UA 3MNNA 1KX3A 3KXBD 5C3IC 4LD9B 1AOID 1P3IB 5B1MC 5AVCD 3AN2A 3REKD 3AZID 1P3BC 3KWQB 1R4VA 5B0ZA 5B2IB 1P3GB 1M1AB 1M18D 2RVQC 5AVBA 5CPJB 3MVDD 4CSRB 3AZNC 3WA9B 1P3MB 1BH9B 1EQZA 4HGAB 5B2JB 4WU9B 1P3KC 1ZLAD 2NQBA 4Z2MG 5FUGB 5AV9A 3WAAC 4WU8C 3AZLB 3NQJA 5B40A 4AWLB 3NQUA 4NE3A 5CPKB 2F8ND 1P3OC 3REHD 3B0CT 4X23A 3AZHC 1P3PC 4WU8D 5JA4B 5B0YC 3R45A 1N1JB 5E5AC 5B24C 4YS3D 4QLCC 1TZYB 3AZKD 1F66B 3MGQA 5B24D 4G91C 4J8VC 3AZMB 3UTBC 1U35A 3A6NA 3AZJD 3UT9A 3AZFB 1KX5B 3AYWA 3LZ1D 4LD9C 1P3IC 5B1LD 4Z5TC 3KWQC 2F8NH 3LZ0B 3UTBD 1ID3B 4J8WA 1P3GC 5B2IC 5GSUA 5AV6D 2PYOA 3X1SA 3UTAC 5CPJC 5CPID 1JFIB 1A7WA 4Z5TD 5BNXB 3AZEB 3KWQD 3WA9C 1P3MC 5F99A 4HGAC 5DNMB 3UTAD 3O62C 5B2JC 4WU9C 2AROA 5CPJD 1AOIB 5AVCB 3REKB 3AZIB 3AV2A 3X1VD 3WA9D 1HQ3D 4EO5B 1KX4A 1WWIA 3TU4D 3AZLC 2NZDA 3W97B 3O62D 3MGRA 4AWLC 5BO0A 5GT3D 1M18B 3MVDB 3KXBA 5CPKC 1P34D 3AZLD 4ZUXB 3B0BA 4H9OB 3VH6T 5CPKD 5AV8B 2BYKB 1ZLAB 4Z66D 1TZYC 3AV1A 3WKJC 5B1MA 5B32D 1P3AB 1F66C 1P3BA 3C1BD 5AV5B 3AZMC 4UUZB 4R8PD 1KX5C 3VH5T 4CAYA 3AZFC 3WKJD 3REHB 3AZNA 4WU8B 3LELB 4YS3B 4YM6D 3AZMD 3LZ0C 1ID3C 3B0CW 4J8XB 1KX5D 5BS7C 3AZKB 1P3KA 2F8NA 3X1UD 4KUDD 2CWEA 4WV4B 3LZ0D 3W98C 3WAAA 5B31B 3AZJB 5DNMC 3LZ1B 2F8NK 3LJAB 1AOIC 4KGCD 5AVCC 5B1LB 3AZGD 1P3OA 4G91B 3REKC 3AZIC 3AZHA 1P3PA 3W98D 3UTBB 4EO5C 4E45A 5B0YA 2L5AA 5E5AA 5B24A 5DNMD 1B67A 5AV6B 3W97C 1M18C 4QLCA 3MVDC 5CPIB 4Z5TB 4WNNA 3V9RA 4J8VA 3W97D 4ZUXC 3UTAB 5AV8C 1ZLAC 4LD9A 4XZQD 2YFWB 1HQ3B 3X1VB 1P3IA 1P3AC 3B0DB 3TU4B 3KWQA 5BT1D 5DNNB 4ZUXD 5AV5C 4KHAB 3O62B 2HIOC 5GT3B 1P3GA 5B2IA 5AV8D 1M1AA 1KU5A 1P34B 3REHC 4H9NB 3MGPD 5CPJA 2CV5B 1P3AD 4CSRA 3RELB 3LELC 4YS3C 5AV5D 3WA9A 1P3MA 1BH9A 2HIOD 4JJNC 4J8XC 3WTPB 5B2JA 4WU9A 4Z66B 3AZKC 2YFVB 5B32B 3LELD 3C1BB 3VH6W 2F8NG 4R8PB 4JJND 3B6GB 5FUGA 3REID 5AY8D 3KUYD 5B31C 4J8XD 3AZLA 1P3FD 3AZJC 2JSSA 5CHLB 3AFAB 3LZ1C 3WKJB 3LJAC 5CPKA 5B1LC 4YM6B 3B6FB 1Q9CA 5GXQD 3VH5W 3REJD 4H9PB 5JA4A 5B31D 1N1JA 3MGSD 1H3OB 5AV6C 3LJAD 5CPIC 1BH8B 3X1UB 1TZYA 4KUDB 1P3LB 5GT0D 5BNVB 3VH6A 1ULYA 1F66A 3AZMA 5JRGD 4H9QB 4KGCB 1KX5A 3AZFA 3AZGB 2FJ7D 4Z2MH 5CP6D 3W96B 3X1VC 3W98B 1HQ3C 3MNND 1KX3D 3B0DC 3VH5A 3TU4C 5DNNC 3LZ0A
chains in the Genus database with same CATH superfamily
1ID3A 5GT3C 5BS7A 1P34C 4H9RB 2CV5C 1JFIA 3RELC 4XUJB 4ZBJB 5BNXA 3AZEA 5DNND 5AVBD 2NQBC 2Y2QA 3WTPC 5DNMA 4Z66C 1AOIA 1EQZD 4XZQB 2CV5D 5KDMB 5AVCA 1F1EA 5B32C 3RELD 3REKA 3AZIA 3C1BC 3B6GC 4R8PC 1B6WA 4NE6A 2NQBD 3X1TB 3WTPD 3W97A 3AFAC 1M18A 3MGPB 3MVDA 2FFFB 5B40D 3W99B 4YM6C 3B6GD 3B6FC 2HIOB 4NE5A 3AFAD 4ZUXA 1TAFB 4H9OA 5G49B 2BYMB 5AV8A 2BYKA 1ZLAA 3X1UC 4KUDC 1P3LC 1M19B 3B6FD 4JJNB 1P3AA 3REIB 5AY8B 3KUYB 5AV5A 1P3FB 4UUZA 3C1CB 4KGCC 3MGQD 3WTPE 3AZGC 3REHA 1P3LD 1U35D 3W96C 5GXQB 3REJB 4WU8A 2UWXA 3LELA 3UT9D 4YS3A 3AYWD 3MGSB 2PYOC 5B33B 1WWSA 4J8XA 3AZKA 3W96D 5GT0B 4XUJC 4ZBJC 2PYOD 1S32B 2AROC 5JRGB 5B31A 3AZJA 3LZ1A 2FJ7B 3LJAA 5CP6B 4XZQC 4J8UB 3MNNB 5B1LA 1KX3B 4XUJD 5BT1C 2AROD 3UTBA 2HUEB 3AL0C 3X1TC 3AN2B 5AV6A 3AV2D 1KX4D 3MGPC 5CPIA 4M6BA 2NZDD 5B0ZB 4Z5TA 3W99C 3MGRD 4UPKA 5AVBB 4DRBA 2Y2HA 3X1TD 4NFTA 3UTAA 3AV1C 1EQZB 3W99D 1M19C 3X1VA 2YFWA 1HQ3A 3KSYA 3REIC 5AY8C 3KUYC 3TU4A 2NQBB 5DNNA 1P3FC 3AV1D 4KHAA 3O62A 5B1MD 5GT3A 5AV9B 3C1CC 1P3BD 3NQJB 5B40B 1P34A 4G92B 1M19D 4H9NA 2CV5A 3NQUB 5GXQC 3REJC 3RELA 3MGSC 4H9SC 4X23B 2Y2IA 2RVQD 3C1CD 5B33C 3AZND 3R45B 3WTPA 4Z66A 2YFVA 5GT0C 5B32A 3C1BA 3B6GA 4R8PA 1S32C 2Y2OA 5B33D 1P3KD 5JRGC 3A1KA 3MGQB 5B31G 3AFAA 3WKJA 2FJ7C 1U35B 5CP6C 3WAAD 3A6NB 2IO5B 3MNNC 4J8UC 1KX3C 3UT9B 3AYWB 4YM6A 1S32D 3B6FA 2HUEC 4H9PA 2Y2NA 2Y2MA 1P3OD 3AN2C 1H3OA 3AZHD 1P3PD 5B0YD 4J8UD 4J8WB 5E5AD 1BH8A 5B0ZC 3X1UA 5GSUB 2PYOB 1P3LA 3X1SB 4KUDA 5BNVA 5AVBC 4QLCD 3AN2D 2DQNC 5F99B 4H9QA 1EQZC 4KGCA 4J8VD 5B0ZD 3AZGA 3W96A 3W98A 1W2EA 2AROB 3EPLA 1M1AC 4LD9D 3AV2B 1P3ID 3H0MC 5AV9C 1KX4B 3EPJA 2NZDB 5B40C 4G92C 4H9RA 3MGRB 5BO0B 1P3GD 4XUJA 5B2ID 3KXBB 1M1AD 4DRAA 4X23C 3FDDA 5AV9D 1BFMA 1P3MD 3IP4C 4XZQA 2ZY5A 5KDMA 5B32G 5C3IB 5B2JD 4WU9D 4X23D 3AV1B 5B1MB 3X1TA 1P3BB 3MGQC 4WZSB 3MGPA 1U35C 3A6NC 2IO5C 3W99A 3UT9C 4CAYB 3AYWC 3A1IA 2HIOA 3AZNB 1TAFA 5G49A 2BYMA 3A6ND 4J8WC 5GSUC 1M19A 3X1SC 4JJNA 3REIA 5AY8A 3KUYA 1P3KB 2F8NB 1P3FA 1TZYD 2J8PA 3C1CA 5F99C 1F66D 4J8WD 3WAAB 2RIQA 3H0RC 5GSUD 2JCHA 3X1SD 4E44A 4DQYB 5GXQA 3REJA 3AZFD 1P3OB 3MGSA 4H9SA 3AZHB 3AV2C 1P3PB 5F99D 5B33A 2LY8A 1KX4C 5B0YB 1HTAA 5E5AB 5B24B 3AZEC 2W8SA 2JE5A 2NZDC 3F6TA 3MGRC 5GT0A 1ID3D 4QLCB 3KXBC 1S32A 4WNNB 3V9RB 5JRGA 3AZED 4J8VB 2FJ7A 5CP6A 4J8UA 3MNNA 1KX3A 3KXBD 5C3IC 4LD9B 1AOID 1P3IB 5B1MC 5AVCD 2Y2KA 3REKD 3AZID 3AN2A 1P3BC 3KWQB 2G5HC 1R4VA 5B0ZA 5B2IB 1P3GB 1M1AB 1M18D 2RVQC 5AVBA 5CPJB 3MVDD 4CSRB 3AZNC 3EPKA 3WA9B 1P3MB 1BH9B 1EQZA 4HGAB 5B2JB 4WU9B 1P3KC 1ZLAD 2NQBA 4Z2MG 5FUGB 5AV9A 3WAAC 4WU8C 3AZLB 3NQJA 5B40A 4AWLB 3NQUA 4NE3A 5CPKB 2F8ND 1P3OC 3REHD 3B0CT 4X23A 3AZHC 1P3PC 1PZRA 5JA4B 5B0YC 3R45A 1N1JB 5E5AC 5B24C 4YS3D 4WU8D 4QLCC 1TZYB 3AZKD 2BG1A 1F66B 3MGQA 5B24D 4G91C 4J8VC 3AZMB 3UTBC 1U35A 3A6NA 3AZJD 3UT9A 3AZFB 1KX5B 3AYWA 3LZ1D 2DF4C 4LD9C 1P3IC 5B1LD 4Z5TC 3KWQC 2VQRA 3LZ0B 3UTBD 2F8NH 1ID3B 4J8WA 1P3GC 5B2IC 5GSUA 5AV6D 2PYOA 3X1SA 3UTAC 2Y2JA 5CPJC 5CPID 1JFIB 1A7WA 4Z5TD 5BNXB 3AZEB 3KWQD 3WA9C 1P3MC 5F99A 4HGAC 5DNMB 3UTAD 3O62C 5B2JC 4WU9C 2AROA 5CPJD 1AOIB 5AVCB 3REKB 3AZIB 3AV2A 3X1VD 3WA9D 1HQ3D 4EO5B 1KX4A 1WWIA 3TU4D 3AZLC 2NZDA 3W97B 3O62D 3MGRA 4AWLC 5BO0A 5GT3D 1M18B 2ZM5A 3MVDB 3KXBA 5CPKC 1P34D 3AZLD 4ZUXB 3B0BA 4H9OB 3VH6T 5CPKD 3EPHA 5AV8B 2BYKB 1ZLAB 2Y2PA 4Z66D 1TZYC 3AV1A 3WKJC 2Y2LA 2F2AC 5B1MA 5B32D 1P3AB 1F66C 1P3BA 3C1BD 5AV5B 3AZMC 4UUZB 4R8PD 1KX5C 3VH5T 4CAYA 3AZFC 3WKJD 3REHB 3AZNA 4WU8B 3LELB 4YS3B 4YM6D 3AZMD 3LZ0C 2XD5A 1ID3C 3B0CW 4J8XB 1KX5D 5BS7C 3AZKB 1P3KA 2F8NA 3X1UD 4KUDD 2ZY2A 2CWEA 4WV4B 3LZ0D 3W98C 4WJ3C 3WAAA 5B31B 3KFUG 3AZJB 5DNMC 3LZ1B 2F8NK 3LJAB 1AOIC 4KGCD 5AVCC 5B1LB 3AZGD 1P3OA 4G91B 3REKC 3AZIC 3AZHA 1P3PA 3W98D 3UTBB 4EO5C 4E45A 5B0YA 2L5AA 5E5AA 5B24A 5DNMD 1B67A 5AV6B 3W97C 1M18C 2ZY4A 4QLCA 3MVDC 5CPIB 4Z5TB 4WNNA 3V9RA 2ZY3A 4J8VA 3W97D 4ZUXC 3UTAB 3H0LC 5AV8C 1ZLAC 4LD9A 4XZQD 2YFWB 1HQ3B 3X1VB 1P3IA 1P3AC 3B0DB 3TU4B 2G5IC 3KWQA 5BT1D 5DNNB 4ZUXD 5AV5C 4KHAB 3O62B 2HIOC 5GT3B 1P3GA 5B2IA 5AV8D 1M1AA 1KU5A 1P34B 3REHC 4H9NB 1Z2CB 3MGPD 5CPJA 2CV5B 1P3AD 4CSRA 3P5JB 3RELB 3LELC 4YS3C 5AV5D 3WA9A 1P3MA 1BH9A 2HIOD 4JJNC 4J8XC 3WTPB 5B2JA 4WU9A 4Z66B 3AZKC 2YFVB 5B32B 3LELD 1T3UA 3C1BB 3VH6W 2F8NG 4R8PB 4JJND 3B6GB 5FUGA 3REID 5AY8D 3KUYD 5B31C 4J8XD 3AZLA 1P3FD 3AZJC 2JSSA 5CHLB 3AFAB 3LZ1C 3WKJB 3LJAC 5CPKA 5B1LC 4YM6B 3B6FB 1Q9CA 5GXQD 3VH5W 3REJD 4H9PB 5JA4A 5B31D 1N1JA 3MGSD 1H3OB 5AV6C 3LJAD 5CPIC 1BH8B 3X1UB 1TZYA 4KUDB 1P3LB 5GT0D 2Y2GA 5BNVB 3VH6A 1ULYA 1F66A 3AZMA 2XD1A 5JRGD 4H9QB 4KGCB 1KX5A 3AZFA 3AZGB 2FJ7D 4Z2MH 5CP6D 3W96B 3X1VC 3W98B 1HQ3C 3MNND 1KX3D 3B0DC 3VH5A 3TU4C 5DNNC 3EG5B 3LZ0A
chains in the Genus database with same CATH topology
1ID3A 5GT3C 5BS7A 1P34C 4H9RB 2CV5C 1JFIA 3RELC 4XUJB 4ZBJB 5BNXA 3AZEA 5DNND 5AVBD 2NQBC 2Y2QA 3WTPC 5DNMA 4Z66C 1AOIA 1EQZD 4XZQB 2CV5D 5KDMB 5AVCA 1F1EA 5B32C 3RELD 3REKA 3AZIA 3C1BC 3B6GC 4R8PC 1B6WA 4NE6A 2NQBD 3X1TB 3WTPD 3W97A 3AFAC 1M18A 3MGPB 3MVDA 2FFFB 5B40D 3W99B 4YM6C 3B6GD 3B6FC 2HIOB 4NE5A 3AFAD 4ZUXA 1TAFB 4H9OA 5G49B 2BYMB 5AV8A 2BYKA 1ZLAA 3X1UC 4KUDC 1P3LC 1M19B 3B6FD 4JJNB 1P3AA 3REIB 5AY8B 3KUYB 5AV5A 1P3FB 4UUZA 3C1CB 4KGCC 3MGQD 3WTPE 3AZGC 3REHA 1P3LD 1U35D 3W96C 5GXQB 3REJB 4WU8A 2UWXA 3LELA 3UT9D 4YS3A 3AYWD 3MGSB 2PYOC 5B33B 1WWSA 4J8XA 3AZKA 3W96D 5GT0B 4XUJC 4ZBJC 2PYOD 1S32B 2AROC 5JRGB 5B31A 3AZJA 3LZ1A 2FJ7B 3LJAA 5CP6B 4XZQC 4J8UB 3MNNB 5B1LA 1KX3B 4XUJD 5BT1C 2AROD 3UTBA 2HUEB 3AL0C 3X1TC 3AN2B 5AV6A 3AV2D 1KX4D 3MGPC 5CPIA 4M6BA 2NZDD 5B0ZB 4Z5TA 3W99C 3MGRD 4UPKA 5AVBB 4DRBA 2Y2HA 3X1TD 4NFTA 3UTAA 3AV1C 1EQZB 3W99D 1M19C 3X1VA 2YFWA 1HQ3A 3KSYA 3REIC 5AY8C 3KUYC 3TU4A 2NQBB 5DNNA 1P3FC 3AV1D 4KHAA 3O62A 5B1MD 5GT3A 5AV9B 3C1CC 1P3BD 3NQJB 5B40B 1P34A 4G92B 1M19D 4H9NA 2CV5A 3NQUB 5GXQC 3REJC 3RELA 3MGSC 4H9SC 4X23B 2Y2IA 2RVQD 3C1CD 5B33C 3AZND 3R45B 3WTPA 4Z66A 2YFVA 5GT0C 5B32A 3C1BA 3B6GA 4R8PA 1S32C 2Y2OA 5B33D 1P3KD 5JRGC 3A1KA 3MGQB 5B31G 3AFAA 3WKJA 2FJ7C 1U35B 5CP6C 3WAAD 3A6NB 2IO5B 3MNNC 4J8UC 1KX3C 3UT9B 3AYWB 4YM6A 1S32D 3B6FA 2HUEC 4H9PA 2Y2NA 2Y2MA 1P3OD 3AN2C 1H3OA 3AZHD 1P3PD 5B0YD 4J8UD 4J8WB 5E5AD 1BH8A 5B0ZC 3X1UA 5GSUB 2PYOB 1P3LA 3X1SB 4KUDA 5BNVA 5AVBC 4QLCD 3AN2D 2DQNC 5F99B 4H9QA 1EQZC 4KGCA 4J8VD 5B0ZD 3AZGA 3W96A 3W98A 1W2EA 2AROB 3EPLA 1M1AC 4LD9D 3AV2B 1P3ID 3H0MC 5AV9C 1KX4B 3EPJA 2NZDB 5B40C 4G92C 4H9RA 3MGRB 5BO0B 1P3GD 4XUJA 5B2ID 3KXBB 1M1AD 4DRAA 4X23C 3FDDA 5AV9D 1BFMA 1P3MD 3IP4C 4XZQA 2ZY5A 5KDMA 5B32G 5C3IB 5B2JD 4WU9D 4X23D 3AV1B 5B1MB 3X1TA 1P3BB 3MGQC 4WZSB 3MGPA 1U35C 3A6NC 2IO5C 3W99A 3UT9C 4CAYB 3AYWC 3A1IA 2HIOA 3AZNB 1TAFA 5G49A 2BYMA 3A6ND 4J8WC 5GSUC 1M19A 3X1SC 4JJNA 3REIA 5AY8A 3KUYA 1P3KB 2F8NB 1P3FA 1TZYD 2J8PA 3C1CA 5F99C 1F66D 4J8WD 3WAAB 2RIQA 3H0RC 5GSUD 2JCHA 3X1SD 4E44A 4DQYB 5GXQA 3REJA 3AZFD 1P3OB 3MGSA 4H9SA 3AZHB 3AV2C 1P3PB 5F99D 5B33A 2LY8A 1KX4C 5B0YB 1HTAA 5E5AB 5B24B 3AZEC 2W8SA 2JE5A 2NZDC 3F6TA 3MGRC 5GT0A 1ID3D 4QLCB 3KXBC 1S32A 4WNNB 3V9RB 5JRGA 3AZED 4J8VB 2FJ7A 5CP6A 4J8UA 3MNNA 1KX3A 3KXBD 5C3IC 4LD9B 1AOID 1P3IB 5B1MC 5AVCD 2Y2KA 3REKD 3AZID 3AN2A 1P3BC 3KWQB 2G5HC 1R4VA 5B0ZA 5B2IB 1P3GB 1M1AB 1M18D 2RVQC 5AVBA 5CPJB 3MVDD 4CSRB 3AZNC 3EPKA 3WA9B 1P3MB 1BH9B 1EQZA 4HGAB 5B2JB 4WU9B 1P3KC 1ZLAD 2NQBA 4Z2MG 5FUGB 5AV9A 3WAAC 4WU8C 3AZLB 3NQJA 5B40A 4AWLB 3NQUA 4NE3A 5CPKB 2F8ND 1P3OC 3REHD 3B0CT 4X23A 3AZHC 1P3PC 1PZRA 5JA4B 5B0YC 3R45A 1N1JB 5E5AC 5B24C 4YS3D 4WU8D 4QLCC 1TZYB 3AZKD 2BG1A 1F66B 3MGQA 5B24D 4G91C 4J8VC 3AZMB 3UTBC 1U35A 3A6NA 3AZJD 3UT9A 3AZFB 1KX5B 3AYWA 3LZ1D 2DF4C 4LD9C 1P3IC 5B1LD 4Z5TC 3KWQC 2VQRA 3LZ0B 3UTBD 2F8NH 1ID3B 4J8WA 1P3GC 5B2IC 5GSUA 5AV6D 2PYOA 3X1SA 3UTAC 2Y2JA 5CPJC 5CPID 1JFIB 1A7WA 4Z5TD 5BNXB 3AZEB 3KWQD 3WA9C 1P3MC 5F99A 4HGAC 5DNMB 3UTAD 3O62C 5B2JC 4WU9C 2AROA 5CPJD 1AOIB 5AVCB 3REKB 3AZIB 3AV2A 3X1VD 3WA9D 1HQ3D 4EO5B 1KX4A 1WWIA 3TU4D 3AZLC 2NZDA 3W97B 3O62D 3MGRA 4AWLC 5BO0A 5GT3D 1M18B 2ZM5A 3MVDB 3KXBA 5CPKC 1P34D 3AZLD 4ZUXB 3B0BA 4H9OB 3VH6T 5CPKD 3EPHA 5AV8B 2BYKB 1ZLAB 2Y2PA 4Z66D 1TZYC 3AV1A 3WKJC 2Y2LA 2F2AC 5B1MA 5B32D 1P3AB 1F66C 1P3BA 3C1BD 5AV5B 3AZMC 4UUZB 4R8PD 1KX5C 3VH5T 4CAYA 3AZFC 3WKJD 3REHB 3AZNA 4WU8B 3LELB 4YS3B 4YM6D 3AZMD 3LZ0C 2XD5A 1ID3C 3B0CW 4J8XB 1KX5D 5BS7C 3AZKB 1P3KA 2F8NA 3X1UD 4KUDD 2ZY2A 2CWEA 4WV4B 3LZ0D 3W98C 4WJ3C 3WAAA 5B31B 3KFUG 3AZJB 5DNMC 3LZ1B 2F8NK 3LJAB 1AOIC 4KGCD 5AVCC 5B1LB 3AZGD 1P3OA 4G91B 3REKC 3AZIC 3AZHA 1P3PA 3W98D 3UTBB 4EO5C 4E45A 5B0YA 2L5AA 5E5AA 5B24A 5DNMD 1B67A 5AV6B 3W97C 1M18C 2ZY4A 4QLCA 3MVDC 5CPIB 4Z5TB 4WNNA 3V9RA 2ZY3A 4J8VA 3W97D 4ZUXC 3UTAB 3H0LC 5AV8C 1ZLAC 4LD9A 4XZQD 2YFWB 1HQ3B 3X1VB 1P3IA 1P3AC 3B0DB 3TU4B 2G5IC 3KWQA 5BT1D 5DNNB 4ZUXD 5AV5C 4KHAB 3O62B 2HIOC 5GT3B 1P3GA 5B2IA 5AV8D 1M1AA 1KU5A 1P34B 3REHC 4H9NB 1Z2CB 3MGPD 5CPJA 2CV5B 1P3AD 4CSRA 3P5JB 3RELB 3LELC 4YS3C 5AV5D 3WA9A 1P3MA 1BH9A 2HIOD 4JJNC 4J8XC 3WTPB 5B2JA 4WU9A 4Z66B 3AZKC 2YFVB 5B32B 3LELD 1T3UA 3C1BB 3VH6W 2F8NG 4R8PB 4JJND 3B6GB 5FUGA 3REID 5AY8D 3KUYD 5B31C 4J8XD 3AZLA 1P3FD 3AZJC 2JSSA 5CHLB 3AFAB 3LZ1C 3WKJB 3LJAC 5CPKA 5B1LC 4YM6B 3B6FB 1Q9CA 5GXQD 3VH5W 3REJD 4H9PB 5JA4A 5B31D 1N1JA 3MGSD 1H3OB 5AV6C 3LJAD 5CPIC 1BH8B 3X1UB 1TZYA 4KUDB 1P3LB 5GT0D 2Y2GA 5BNVB 3VH6A 1ULYA 1F66A 3AZMA 2XD1A 5JRGD 4H9QB 4KGCB 1KX5A 3AZFA 3AZGB 2FJ7D 4Z2MH 5CP6D 3W96B 3X1VC 3W98B 1HQ3C 3MNND 1KX3D 3B0DC 3VH5A 3TU4C 5DNNC 3EG5B 3LZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 A;  5GT3 C;  5BS7 A;  1P34 C;  4H9R B;  2CV5 C;  1JFI A;  3REL C;  4XUJ B;  4ZBJ B;  5BNX A;  3AZE A;  5DNN D;  5AVB D;  2NQB C;  3WTP C;  5DNM A;  4Z66 C;  1AOI A;  1EQZ D;  4XZQ B;  2CV5 D;  5KDM B;  5AVC A;  1F1E A;  5B32 C;  3REL D;  3REK A;  3AZI A;  3C1B C;  3B6G C;  4R8P C;  1B6W A;  4NE6 A;  2NQB D;  3X1T B;  3WTP D;  3W97 A;  3AFA C;  1M18 A;  3MGP B;  3MVD A;  5B40 D;  3W99 B;  4YM6 C;  3B6G D;  3B6F C;  2HIO B;  4NE5 A;  3AFA D;  4ZUX A;  1TAF B;  4H9O A;  5G49 B;  2BYM B;  5AV8 A;  2BYK A;  1ZLA A;  3X1U C;  4KUD C;  1P3L C;  1M19 B;  3B6F D;  4JJN B;  1P3A A;  3REI B;  5AY8 B;  3KUY B;  5AV5 A;  1P3F B;  4UUZ A;  3C1C B;  4KGC C;  3MGQ D;  3WTP E;  3AZG C;  3REH A;  1P3L D;  1U35 D;  3W96 C;  5GXQ B;  3REJ B;  4WU8 A;  3LEL A;  3UT9 D;  4YS3 A;  3AYW D;  3MGS B;  2PYO C;  5B33 B;  1WWS A;  4J8X A;  3AZK A;  3W96 D;  5GT0 B;  4XUJ C;  4ZBJ C;  2PYO D;  1S32 B;  2ARO C;  5JRG B;  5B31 A;  3AZJ A;  3LZ1 A;  2FJ7 B;  3LJA A;  5CP6 B;  4XZQ C;  4J8U B;  3MNN B;  5B1L A;  1KX3 B;  4XUJ D;  5BT1 C;  2ARO D;  3UTB A;  2HUE B;  3X1T C;  3AN2 B;  5AV6 A;  3AV2 D;  1KX4 D;  3MGP C;  5CPI A;  4M6B A;  2NZD D;  5B0Z B;  4Z5T A;  3W99 C;  3MGR D;  5AVB B;  4DRB A;  3X1T D;  4NFT A;  3UTA A;  3AV1 C;  1EQZ B;  3W99 D;  1M19 C;  3X1V A;  2YFW A;  1HQ3 A;  3KSY A;  3REI C;  5AY8 C;  3KUY C;  3TU4 A;  2NQB B;  5DNN A;  1P3F C;  3AV1 D;  4KHA A;  3O62 A;  5B1M D;  5GT3 A;  5AV9 B;  3C1C C;  1P3B D;  3NQJ B;  5B40 B;  1P34 A;  4G92 B;  1M19 D;  4H9N A;  2CV5 A;  3NQU B;  5GXQ C;  3REJ C;  3REL A;  3MGS C;  4H9S C;  4X23 B;  2RVQ D;  3C1C D;  5B33 C;  3AZN D;  3R45 B;  3WTP A;  4Z66 A;  2YFV A;  5GT0 C;  5B32 A;  3C1B A;  3B6G A;  4R8P A;  1S32 C;  5B33 D;  1P3K D;  5JRG C;  3MGQ B;  5B31 G;  3AFA A;  3WKJ A;  2FJ7 C;  1U35 B;  5CP6 C;  3WAA D;  3A6N B;  2IO5 B;  3MNN C;  4J8U C;  1KX3 C;  3UT9 B;  3AYW B;  4YM6 A;  1S32 D;  3B6F A;  2HUE C;  4H9P A;  1P3O D;  3AN2 C;  1H3O A;  3AZH D;  1P3P D;  5B0Y D;  4J8U D;  4J8W B;  5E5A D;  1BH8 A;  5B0Z C;  3X1U A;  5GSU B;  2PYO B;  1P3L A;  3X1S B;  4KUD A;  5BNV A;  5AVB C;  4QLC D;  3AN2 D;  5F99 B;  4H9Q A;  1EQZ C;  4KGC A;  4J8V D;  5B0Z D;  3AZG A;  3W96 A;  3W98 A;  2ARO B;  1M1A C;  4LD9 D;  3AV2 B;  1P3I D;  5AV9 C;  1KX4 B;  2NZD B;  5B40 C;  4G92 C;  4H9R A;  3MGR B;  5BO0 B;  1P3G D;  4XUJ A;  5B2I D;  3KXB B;  1M1A D;  4DRA A;  4X23 C;  5AV9 D;  1BFM A;  1P3M D;  4XZQ A;  5KDM A;  5B32 G;  5C3I B;  5B2J D;  4WU9 D;  4X23 D;  3AV1 B;  5B1M B;  3X1T A;  1P3B B;  3MGQ C;  4WZS B;  3MGP A;  1U35 C;  3A6N C;  2IO5 C;  3W99 A;  3UT9 C;  4CAY B;  3AYW C;  2HIO A;  3AZN B;  1TAF A;  5G49 A;  2BYM A;  3A6N D;  4J8W C;  5GSU C;  1M19 A;  3X1S C;  4JJN A;  3REI A;  5AY8 A;  3KUY A;  1P3K B;  2F8N B;  1P3F A;  1TZY D;  3C1C A;  5F99 C;  1F66 D;  4J8W D;  3WAA B;  5GSU D;  3X1S D;  4E44 A;  5GXQ A;  3REJ A;  3AZF D;  1P3O B;  3MGS A;  4H9S A;  3AZH B;  3AV2 C;  1P3P B;  5F99 D;  5B33 A;  2LY8 A;  1KX4 C;  5B0Y B;  1HTA A;  5E5A B;  5B24 B;  3AZE C;  2NZD C;  3MGR C;  5GT0 A;  1ID3 D;  4QLC B;  3KXB C;  1S32 A;  4WNN B;  3V9R B;  5JRG A;  3AZE D;  4J8V B;  2FJ7 A;  5CP6 A;  4J8U A;  3MNN A;  1KX3 A;  3KXB D;  5C3I C;  4LD9 B;  1AOI D;  1P3I B;  5B1M C;  5AVC D;  3AN2 A;  3REK D;  3AZI D;  1P3B C;  3KWQ B;  1R4V A;  5B0Z A;  5B2I B;  1P3G B;  1M1A B;  1M18 D;  2RVQ C;  5AVB A;  5CPJ B;  3MVD D;  4CSR B;  3AZN C;  3WA9 B;  1P3M B;  1BH9 B;  1EQZ A;  4HGA B;  5B2J B;  4WU9 B;  1P3K C;  1ZLA D;  2NQB A;  4Z2M G;  5FUG B;  5AV9 A;  3WAA C;  4WU8 C;  3AZL B;  3NQJ A;  5B40 A;  4AWL B;  3NQU A;  4NE3 A;  5CPK B;  2F8N D;  1P3O C;  3REH D;  3B0C T;  4X23 A;  3AZH C;  1P3P C;  4WU8 D;  5JA4 B;  5B0Y C;  3R45 A;  1N1J B;  5E5A C;  5B24 C;  4YS3 D;  4QLC C;  1TZY B;  3AZK D;  1F66 B;  3MGQ A;  5B24 D;  4G91 C;  4J8V C;  3AZM B;  3UTB C;  1U35 A;  3A6N A;  3AZJ D;  3UT9 A;  3AZF B;  1KX5 B;  3AYW A;  3LZ1 D;  4LD9 C;  1P3I C;  5B1L D;  4Z5T C;  3KWQ C;  2F8N H;  3LZ0 B;  3UTB D;  1ID3 B;  4J8W A;  1P3G C;  5B2I C;  5GSU A;  5AV6 D;  2PYO A;  3X1S A;  3UTA C;  5CPJ C;  5CPI D;  1JFI B;  1A7W A;  4Z5T D;  5BNX B;  3AZE B;  3KWQ D;  3WA9 C;  1P3M C;  5F99 A;  4HGA C;  5DNM B;  3UTA D;  3O62 C;  5B2J C;  4WU9 C;  2ARO A;  5CPJ D;  1AOI B;  5AVC B;  3REK B;  3AZI B;  3AV2 A;  3X1V D;  3WA9 D;  1HQ3 D;  4EO5 B;  1KX4 A;  1WWI A;  3TU4 D;  3AZL C;  2NZD A;  3W97 B;  3O62 D;  3MGR A;  4AWL C;  5BO0 A;  5GT3 D;  1M18 B;  3MVD B;  3KXB A;  5CPK C;  1P34 D;  3AZL D;  4ZUX B;  3B0B A;  4H9O B;  3VH6 T;  5CPK D;  5AV8 B;  2BYK B;  1ZLA B;  4Z66 D;  1TZY C;  3AV1 A;  3WKJ C;  5B1M A;  5B32 D;  1P3A B;  1F66 C;  1P3B A;  3C1B D;  5AV5 B;  3AZM C;  4UUZ B;  4R8P D;  1KX5 C;  3VH5 T;  4CAY A;  3AZF C;  3WKJ D;  3REH B;  3AZN A;  4WU8 B;  3LEL B;  4YS3 B;  4YM6 D;  3AZM D;  3LZ0 C;  1ID3 C;  3B0C W;  4J8X B;  1KX5 D;  5BS7 C;  3AZK B;  1P3K A;  2F8N A;  3X1U D;  4KUD D;  2CWE A;  4WV4 B;  3LZ0 D;  3W98 C;  3WAA A;  5B31 B;  3AZJ B;  5DNM C;  3LZ1 B;  2F8N K;  3LJA B;  1AOI C;  4KGC D;  5AVC C;  5B1L B;  3AZG D;  1P3O A;  4G91 B;  3REK C;  3AZI C;  3AZH A;  1P3P A;  3W98 D;  3UTB B;  4EO5 C;  4E45 A;  5B0Y A;  2L5A A;  5E5A A;  5B24 A;  5DNM D;  1B67 A;  5AV6 B;  3W97 C;  1M18 C;  4QLC A;  3MVD C;  5CPI B;  4Z5T B;  4WNN A;  3V9R A;  4J8V A;  3W97 D;  4ZUX C;  3UTA B;  5AV8 C;  1ZLA C;  4LD9 A;  4XZQ D;  2YFW B;  1HQ3 B;  3X1V B;  1P3I A;  1P3A C;  3B0D B;  3TU4 B;  3KWQ A;  5BT1 D;  5DNN B;  4ZUX D;  5AV5 C;  4KHA B;  3O62 B;  2HIO C;  5GT3 B;  1P3G A;  5B2I A;  5AV8 D;  1M1A A;  1KU5 A;  1P34 B;  3REH C;  4H9N B;  3MGP D;  5CPJ A;  2CV5 B;  1P3A D;  4CSR A;  3REL B;  3LEL C;  4YS3 C;  5AV5 D;  3WA9 A;  1P3M A;  1BH9 A;  2HIO D;  4JJN C;  4J8X C;  3WTP B;  5B2J A;  4WU9 A;  4Z66 B;  3AZK C;  2YFV B;  5B32 B;  3LEL D;  3C1B B;  3VH6 W;  2F8N G;  4R8P B;  4JJN D;  3B6G B;  5FUG A;  3REI D;  5AY8 D;  3KUY D;  5B31 C;  4J8X D;  3AZL A;  1P3F D;  3AZJ C;  2JSS A;  5CHL B;  3AFA B;  3LZ1 C;  3WKJ B;  3LJA C;  5CPK A;  5B1L C;  4YM6 B;  3B6F B;  1Q9C A;  5GXQ D;  3VH5 W;  3REJ D;  4H9P B;  5JA4 A;  5B31 D;  1N1J A;  3MGS D;  1H3O B;  5AV6 C;  3LJA D;  5CPI C;  1BH8 B;  3X1U B;  1TZY A;  4KUD B;  1P3L B;  5GT0 D;  5BNV B;  3VH6 A;  1ULY A;  1F66 A;  3AZM A;  5JRG D;  4H9Q B;  4KGC B;  1KX5 A;  3AZF A;  3AZG B;  2FJ7 D;  4Z2M H;  5CP6 D;  3W96 B;  3X1V C;  3W98 B;  1HQ3 C;  3MNN D;  1KX3 D;  3B0D C;  3VH5 A;  3TU4 C;  5DNN C;  3LZ0 A; 
#chains in the Genus database with same CATH topology
 1ID3 A;  5GT3 C;  5BS7 A;  1P34 C;  4H9R B;  2CV5 C;  1JFI A;  3REL C;  4XUJ B;  4ZBJ B;  5BNX A;  3AZE A;  5DNN D;  5AVB D;  2NQB C;  2Y2Q A;  3WTP C;  5DNM A;  4Z66 C;  1AOI A;  1EQZ D;  4XZQ B;  2CV5 D;  5KDM B;  5AVC A;  1F1E A;  5B32 C;  3REL D;  3REK A;  3AZI A;  3C1B C;  3B6G C;  4R8P C;  1B6W A;  4NE6 A;  2NQB D;  3X1T B;  3WTP D;  3W97 A;  3AFA C;  1M18 A;  3MGP B;  3MVD A;  2FFF B;  5B40 D;  3W99 B;  4YM6 C;  3B6G D;  3B6F C;  2HIO B;  4NE5 A;  3AFA D;  4ZUX A;  1TAF B;  4H9O A;  5G49 B;  2BYM B;  5AV8 A;  2BYK A;  1ZLA A;  3X1U C;  4KUD C;  1P3L C;  1M19 B;  3B6F D;  4JJN B;  1P3A A;  3REI B;  5AY8 B;  3KUY B;  5AV5 A;  1P3F B;  4UUZ A;  3C1C B;  4KGC C;  3MGQ D;  3WTP E;  3AZG C;  3REH A;  1P3L D;  1U35 D;  3W96 C;  5GXQ B;  3REJ B;  4WU8 A;  2UWX A;  3LEL A;  3UT9 D;  4YS3 A;  3AYW D;  3MGS B;  2PYO C;  5B33 B;  1WWS A;  4J8X A;  3AZK A;  3W96 D;  5GT0 B;  4XUJ C;  4ZBJ C;  2PYO D;  1S32 B;  2ARO C;  5JRG B;  5B31 A;  3AZJ A;  3LZ1 A;  2FJ7 B;  3LJA A;  5CP6 B;  4XZQ C;  4J8U B;  3MNN B;  5B1L A;  1KX3 B;  4XUJ D;  5BT1 C;  2ARO D;  3UTB A;  2HUE B;  3AL0 C;  3X1T C;  3AN2 B;  5AV6 A;  3AV2 D;  1KX4 D;  3MGP C;  5CPI A;  4M6B A;  2NZD D;  5B0Z B;  4Z5T A;  3W99 C;  3MGR D;  4UPK A;  5AVB B;  4DRB A;  2Y2H A;  3X1T D;  4NFT A;  3UTA A;  3AV1 C;  1EQZ B;  3W99 D;  1M19 C;  3X1V A;  2YFW A;  1HQ3 A;  3KSY A;  3REI C;  5AY8 C;  3KUY C;  3TU4 A;  2NQB B;  5DNN A;  1P3F C;  3AV1 D;  4KHA A;  3O62 A;  5B1M D;  5GT3 A;  5AV9 B;  3C1C C;  1P3B D;  3NQJ B;  5B40 B;  1P34 A;  4G92 B;  1M19 D;  4H9N A;  2CV5 A;  3NQU B;  5GXQ C;  3REJ C;  3REL A;  3MGS C;  4H9S C;  4X23 B;  2Y2I A;  2RVQ D;  3C1C D;  5B33 C;  3AZN D;  3R45 B;  3WTP A;  4Z66 A;  2YFV A;  5GT0 C;  5B32 A;  3C1B A;  3B6G A;  4R8P A;  1S32 C;  2Y2O A;  5B33 D;  1P3K D;  5JRG C;  3A1K A;  3MGQ B;  5B31 G;  3AFA A;  3WKJ A;  2FJ7 C;  1U35 B;  5CP6 C;  3WAA D;  3A6N B;  2IO5 B;  3MNN C;  4J8U C;  1KX3 C;  3UT9 B;  3AYW B;  4YM6 A;  1S32 D;  3B6F A;  2HUE C;  4H9P A;  2Y2N A;  2Y2M A;  1P3O D;  3AN2 C;  1H3O A;  3AZH D;  1P3P D;  5B0Y D;  4J8U D;  4J8W B;  5E5A D;  1BH8 A;  5B0Z C;  3X1U A;  5GSU B;  2PYO B;  1P3L A;  3X1S B;  4KUD A;  5BNV A;  5AVB C;  4QLC D;  3AN2 D;  2DQN C;  5F99 B;  4H9Q A;  1EQZ C;  4KGC A;  4J8V D;  5B0Z D;  3AZG A;  3W96 A;  3W98 A;  1W2E A;  2ARO B;  3EPL A;  1M1A C;  4LD9 D;  3AV2 B;  1P3I D;  3H0M C;  5AV9 C;  1KX4 B;  3EPJ A;  2NZD B;  5B40 C;  4G92 C;  4H9R A;  3MGR B;  5BO0 B;  1P3G D;  4XUJ A;  5B2I D;  3KXB B;  1M1A D;  4DRA A;  4X23 C;  3FDD A;  5AV9 D;  1BFM A;  1P3M D;  3IP4 C;  4XZQ A;  2ZY5 A;  5KDM A;  5B32 G;  5C3I B;  5B2J D;  4WU9 D;  4X23 D;  3AV1 B;  5B1M B;  3X1T A;  1P3B B;  3MGQ C;  4WZS B;  3MGP A;  1U35 C;  3A6N C;  2IO5 C;  3W99 A;  3UT9 C;  4CAY B;  3AYW C;  3A1I A;  2HIO A;  3AZN B;  1TAF A;  5G49 A;  2BYM A;  3A6N D;  4J8W C;  5GSU C;  1M19 A;  3X1S C;  4JJN A;  3REI A;  5AY8 A;  3KUY A;  1P3K B;  2F8N B;  1P3F A;  1TZY D;  2J8P A;  3C1C A;  5F99 C;  1F66 D;  4J8W D;  3WAA B;  2RIQ A;  3H0R C;  5GSU D;  2JCH A;  3X1S D;  4E44 A;  4DQY B;  5GXQ A;  3REJ A;  3AZF D;  1P3O B;  3MGS A;  4H9S A;  3AZH B;  3AV2 C;  1P3P B;  5F99 D;  5B33 A;  2LY8 A;  1KX4 C;  5B0Y B;  1HTA A;  5E5A B;  5B24 B;  3AZE C;  2W8S A;  2JE5 A;  2NZD C;  3F6T A;  3MGR C;  5GT0 A;  1ID3 D;  4QLC B;  3KXB C;  1S32 A;  4WNN B;  3V9R B;  5JRG A;  3AZE D;  4J8V B;  2FJ7 A;  5CP6 A;  4J8U A;  3MNN A;  1KX3 A;  3KXB D;  5C3I C;  4LD9 B;  1AOI D;  1P3I B;  5B1M C;  5AVC D;  2Y2K A;  3REK D;  3AZI D;  3AN2 A;  1P3B C;  3KWQ B;  2G5H C;  1R4V A;  5B0Z A;  5B2I B;  1P3G B;  1M1A B;  1M18 D;  2RVQ C;  5AVB A;  5CPJ B;  3MVD D;  4CSR B;  3AZN C;  3EPK A;  3WA9 B;  1P3M B;  1BH9 B;  1EQZ A;  4HGA B;  5B2J B;  4WU9 B;  1P3K C;  1ZLA D;  2NQB A;  4Z2M G;  5FUG B;  5AV9 A;  3WAA C;  4WU8 C;  3AZL B;  3NQJ A;  5B40 A;  4AWL B;  3NQU A;  4NE3 A;  5CPK B;  2F8N D;  1P3O C;  3REH D;  3B0C T;  4X23 A;  3AZH C;  1P3P C;  1PZR A;  5JA4 B;  5B0Y C;  3R45 A;  1N1J B;  5E5A C;  5B24 C;  4YS3 D;  4WU8 D;  4QLC C;  1TZY B;  3AZK D;  2BG1 A;  1F66 B;  3MGQ A;  5B24 D;  4G91 C;  4J8V C;  3AZM B;  3UTB C;  1U35 A;  3A6N A;  3AZJ D;  3UT9 A;  3AZF B;  1KX5 B;  3AYW A;  3LZ1 D;  2DF4 C;  4LD9 C;  1P3I C;  5B1L D;  4Z5T C;  3KWQ C;  2VQR A;  3LZ0 B;  3UTB D;  2F8N H;  1ID3 B;  4J8W A;  1P3G C;  5B2I C;  5GSU A;  5AV6 D;  2PYO A;  3X1S A;  3UTA C;  2Y2J A;  5CPJ C;  5CPI D;  1JFI B;  1A7W A;  4Z5T D;  5BNX B;  3AZE B;  3KWQ D;  3WA9 C;  1P3M C;  5F99 A;  4HGA C;  5DNM B;  3UTA D;  3O62 C;  5B2J C;  4WU9 C;  2ARO A;  5CPJ D;  1AOI B;  5AVC B;  3REK B;  3AZI B;  3AV2 A;  3X1V D;  3WA9 D;  1HQ3 D;  4EO5 B;  1KX4 A;  1WWI A;  3TU4 D;  3AZL C;  2NZD A;  3W97 B;  3O62 D;  3MGR A;  4AWL C;  5BO0 A;  5GT3 D;  1M18 B;  2ZM5 A;  3MVD B;  3KXB A;  5CPK C;  1P34 D;  3AZL D;  4ZUX B;  3B0B A;  4H9O B;  3VH6 T;  5CPK D;  3EPH A;  5AV8 B;  2BYK B;  1ZLA B;  2Y2P A;  4Z66 D;  1TZY C;  3AV1 A;  3WKJ C;  2Y2L A;  2F2A C;  5B1M A;  5B32 D;  1P3A B;  1F66 C;  1P3B A;  3C1B D;  5AV5 B;  3AZM C;  4UUZ B;  4R8P D;  1KX5 C;  3VH5 T;  4CAY A;  3AZF C;  3WKJ D;  3REH B;  3AZN A;  4WU8 B;  3LEL B;  4YS3 B;  4YM6 D;  3AZM D;  3LZ0 C;  2XD5 A;  1ID3 C;  3B0C W;  4J8X B;  1KX5 D;  5BS7 C;  3AZK B;  1P3K A;  2F8N A;  3X1U D;  4KUD D;  2ZY2 A;  2CWE A;  4WV4 B;  3LZ0 D;  3W98 C;  4WJ3 C;  3WAA A;  5B31 B;  3KFU G;  3AZJ B;  5DNM C;  3LZ1 B;  2F8N K;  3LJA B;  1AOI C;  4KGC D;  5AVC C;  5B1L B;  3AZG D;  1P3O A;  4G91 B;  3REK C;  3AZI C;  3AZH A;  1P3P A;  3W98 D;  3UTB B;  4EO5 C;  4E45 A;  5B0Y A;  2L5A A;  5E5A A;  5B24 A;  5DNM D;  1B67 A;  5AV6 B;  3W97 C;  1M18 C;  2ZY4 A;  4QLC A;  3MVD C;  5CPI B;  4Z5T B;  4WNN A;  3V9R A;  2ZY3 A;  4J8V A;  3W97 D;  4ZUX C;  3UTA B;  3H0L C;  5AV8 C;  1ZLA C;  4LD9 A;  4XZQ D;  2YFW B;  1HQ3 B;  3X1V B;  1P3I A;  1P3A C;  3B0D B;  3TU4 B;  2G5I C;  3KWQ A;  5BT1 D;  5DNN B;  4ZUX D;  5AV5 C;  4KHA B;  3O62 B;  2HIO C;  5GT3 B;  1P3G A;  5B2I A;  5AV8 D;  1M1A A;  1KU5 A;  1P34 B;  3REH C;  4H9N B;  1Z2C B;  3MGP D;  5CPJ A;  2CV5 B;  1P3A D;  4CSR A;  3P5J B;  3REL B;  3LEL C;  4YS3 C;  5AV5 D;  3WA9 A;  1P3M A;  1BH9 A;  2HIO D;  4JJN C;  4J8X C;  3WTP B;  5B2J A;  4WU9 A;  4Z66 B;  3AZK C;  2YFV B;  5B32 B;  3LEL D;  1T3U A;  3C1B B;  3VH6 W;  2F8N G;  4R8P B;  4JJN D;  3B6G B;  5FUG A;  3REI D;  5AY8 D;  3KUY D;  5B31 C;  4J8X D;  3AZL A;  1P3F D;  3AZJ C;  2JSS A;  5CHL B;  3AFA B;  3LZ1 C;  3WKJ B;  3LJA C;  5CPK A;  5B1L C;  4YM6 B;  3B6F B;  1Q9C A;  5GXQ D;  3VH5 W;  3REJ D;  4H9P B;  5JA4 A;  5B31 D;  1N1J A;  3MGS D;  1H3O B;  5AV6 C;  3LJA D;  5CPI C;  1BH8 B;  3X1U B;  1TZY A;  4KUD B;  1P3L B;  5GT0 D;  2Y2G A;  5BNV B;  3VH6 A;  1ULY A;  1F66 A;  3AZM A;  2XD1 A;  5JRG D;  4H9Q B;  4KGC B;  1KX5 A;  3AZF A;  3AZG B;  2FJ7 D;  4Z2M H;  5CP6 D;  3W96 B;  3X1V C;  3W98 B;  1HQ3 C;  3MNN D;  1KX3 D;  3B0D C;  3VH5 A;  3TU4 C;  5DNN C;  3EG5 B;  3LZ0 A; 
#chains in the Genus database with same CATH homology
 1ID3 A;  5GT3 C;  5BS7 A;  1P34 C;  4H9R B;  2CV5 C;  1JFI A;  3REL C;  4XUJ B;  4ZBJ B;  5BNX A;  3AZE A;  5DNN D;  5AVB D;  2NQB C;  2Y2Q A;  3WTP C;  5DNM A;  4Z66 C;  1AOI A;  1EQZ D;  4XZQ B;  2CV5 D;  5KDM B;  5AVC A;  1F1E A;  5B32 C;  3REL D;  3REK A;  3AZI A;  3C1B C;  3B6G C;  4R8P C;  1B6W A;  4NE6 A;  2NQB D;  3X1T B;  3WTP D;  3W97 A;  3AFA C;  1M18 A;  3MGP B;  3MVD A;  2FFF B;  5B40 D;  3W99 B;  4YM6 C;  3B6G D;  3B6F C;  2HIO B;  4NE5 A;  3AFA D;  4ZUX A;  1TAF B;  4H9O A;  5G49 B;  2BYM B;  5AV8 A;  2BYK A;  1ZLA A;  3X1U C;  4KUD C;  1P3L C;  1M19 B;  3B6F D;  4JJN B;  1P3A A;  3REI B;  5AY8 B;  3KUY B;  5AV5 A;  1P3F B;  4UUZ A;  3C1C B;  4KGC C;  3MGQ D;  3WTP E;  3AZG C;  3REH A;  1P3L D;  1U35 D;  3W96 C;  5GXQ B;  3REJ B;  4WU8 A;  2UWX A;  3LEL A;  3UT9 D;  4YS3 A;  3AYW D;  3MGS B;  2PYO C;  5B33 B;  1WWS A;  4J8X A;  3AZK A;  3W96 D;  5GT0 B;  4XUJ C;  4ZBJ C;  2PYO D;  1S32 B;  2ARO C;  5JRG B;  5B31 A;  3AZJ A;  3LZ1 A;  2FJ7 B;  3LJA A;  5CP6 B;  4XZQ C;  4J8U B;  3MNN B;  5B1L A;  1KX3 B;  4XUJ D;  5BT1 C;  2ARO D;  3UTB A;  2HUE B;  3AL0 C;  3X1T C;  3AN2 B;  5AV6 A;  3AV2 D;  1KX4 D;  3MGP C;  5CPI A;  4M6B A;  2NZD D;  5B0Z B;  4Z5T A;  3W99 C;  3MGR D;  4UPK A;  5AVB B;  4DRB A;  2Y2H A;  3X1T D;  4NFT A;  3UTA A;  3AV1 C;  1EQZ B;  3W99 D;  1M19 C;  3X1V A;  2YFW A;  1HQ3 A;  3KSY A;  3REI C;  5AY8 C;  3KUY C;  3TU4 A;  2NQB B;  5DNN A;  1P3F C;  3AV1 D;  4KHA A;  3O62 A;  5B1M D;  5GT3 A;  5AV9 B;  3C1C C;  1P3B D;  3NQJ B;  5B40 B;  1P34 A;  4G92 B;  1M19 D;  4H9N A;  2CV5 A;  3NQU B;  5GXQ C;  3REJ C;  3REL A;  3MGS C;  4H9S C;  4X23 B;  2Y2I A;  2RVQ D;  3C1C D;  5B33 C;  3AZN D;  3R45 B;  3WTP A;  4Z66 A;  2YFV A;  5GT0 C;  5B32 A;  3C1B A;  3B6G A;  4R8P A;  1S32 C;  2Y2O A;  5B33 D;  1P3K D;  5JRG C;  3A1K A;  3MGQ B;  5B31 G;  3AFA A;  3WKJ A;  2FJ7 C;  1U35 B;  5CP6 C;  3WAA D;  3A6N B;  2IO5 B;  3MNN C;  4J8U C;  1KX3 C;  3UT9 B;  3AYW B;  4YM6 A;  1S32 D;  3B6F A;  2HUE C;  4H9P A;  2Y2N A;  2Y2M A;  1P3O D;  3AN2 C;  1H3O A;  3AZH D;  1P3P D;  5B0Y D;  4J8U D;  4J8W B;  5E5A D;  1BH8 A;  5B0Z C;  3X1U A;  5GSU B;  2PYO B;  1P3L A;  3X1S B;  4KUD A;  5BNV A;  5AVB C;  4QLC D;  3AN2 D;  2DQN C;  5F99 B;  4H9Q A;  1EQZ C;  4KGC A;  4J8V D;  5B0Z D;  3AZG A;  3W96 A;  3W98 A;  1W2E A;  2ARO B;  3EPL A;  1M1A C;  4LD9 D;  3AV2 B;  1P3I D;  3H0M C;  5AV9 C;  1KX4 B;  3EPJ A;  2NZD B;  5B40 C;  4G92 C;  4H9R A;  3MGR B;  5BO0 B;  1P3G D;  4XUJ A;  5B2I D;  3KXB B;  1M1A D;  4DRA A;  4X23 C;  3FDD A;  5AV9 D;  1BFM A;  1P3M D;  3IP4 C;  4XZQ A;  2ZY5 A;  5KDM A;  5B32 G;  5C3I B;  5B2J D;  4WU9 D;  4X23 D;  3AV1 B;  5B1M B;  3X1T A;  1P3B B;  3MGQ C;  4WZS B;  3MGP A;  1U35 C;  3A6N C;  2IO5 C;  3W99 A;  3UT9 C;  4CAY B;  3AYW C;  3A1I A;  2HIO A;  3AZN B;  1TAF A;  5G49 A;  2BYM A;  3A6N D;  4J8W C;  5GSU C;  1M19 A;  3X1S C;  4JJN A;  3REI A;  5AY8 A;  3KUY A;  1P3K B;  2F8N B;  1P3F A;  1TZY D;  2J8P A;  3C1C A;  5F99 C;  1F66 D;  4J8W D;  3WAA B;  2RIQ A;  3H0R C;  5GSU D;  2JCH A;  3X1S D;  4E44 A;  4DQY B;  5GXQ A;  3REJ A;  3AZF D;  1P3O B;  3MGS A;  4H9S A;  3AZH B;  3AV2 C;  1P3P B;  5F99 D;  5B33 A;  2LY8 A;  1KX4 C;  5B0Y B;  1HTA A;  5E5A B;  5B24 B;  3AZE C;  2W8S A;  2JE5 A;  2NZD C;  3F6T A;  3MGR C;  5GT0 A;  1ID3 D;  4QLC B;  3KXB C;  1S32 A;  4WNN B;  3V9R B;  5JRG A;  3AZE D;  4J8V B;  2FJ7 A;  5CP6 A;  4J8U A;  3MNN A;  1KX3 A;  3KXB D;  5C3I C;  4LD9 B;  1AOI D;  1P3I B;  5B1M C;  5AVC D;  2Y2K A;  3REK D;  3AZI D;  3AN2 A;  1P3B C;  3KWQ B;  2G5H C;  1R4V A;  5B0Z A;  5B2I B;  1P3G B;  1M1A B;  1M18 D;  2RVQ C;  5AVB A;  5CPJ B;  3MVD D;  4CSR B;  3AZN C;  3EPK A;  3WA9 B;  1P3M B;  1BH9 B;  1EQZ A;  4HGA B;  5B2J B;  4WU9 B;  1P3K C;  1ZLA D;  2NQB A;  4Z2M G;  5FUG B;  5AV9 A;  3WAA C;  4WU8 C;  3AZL B;  3NQJ A;  5B40 A;  4AWL B;  3NQU A;  4NE3 A;  5CPK B;  2F8N D;  1P3O C;  3REH D;  3B0C T;  4X23 A;  3AZH C;  1P3P C;  1PZR A;  5JA4 B;  5B0Y C;  3R45 A;  1N1J B;  5E5A C;  5B24 C;  4YS3 D;  4WU8 D;  4QLC C;  1TZY B;  3AZK D;  2BG1 A;  1F66 B;  3MGQ A;  5B24 D;  4G91 C;  4J8V C;  3AZM B;  3UTB C;  1U35 A;  3A6N A;  3AZJ D;  3UT9 A;  3AZF B;  1KX5 B;  3AYW A;  3LZ1 D;  2DF4 C;  4LD9 C;  1P3I C;  5B1L D;  4Z5T C;  3KWQ C;  2VQR A;  3LZ0 B;  3UTB D;  2F8N H;  1ID3 B;  4J8W A;  1P3G C;  5B2I C;  5GSU A;  5AV6 D;  2PYO A;  3X1S A;  3UTA C;  2Y2J A;  5CPJ C;  5CPI D;  1JFI B;  1A7W A;  4Z5T D;  5BNX B;  3AZE B;  3KWQ D;  3WA9 C;  1P3M C;  5F99 A;  4HGA C;  5DNM B;  3UTA D;  3O62 C;  5B2J C;  4WU9 C;  2ARO A;  5CPJ D;  1AOI B;  5AVC B;  3REK B;  3AZI B;  3AV2 A;  3X1V D;  3WA9 D;  1HQ3 D;  4EO5 B;  1KX4 A;  1WWI A;  3TU4 D;  3AZL C;  2NZD A;  3W97 B;  3O62 D;  3MGR A;  4AWL C;  5BO0 A;  5GT3 D;  1M18 B;  2ZM5 A;  3MVD B;  3KXB A;  5CPK C;  1P34 D;  3AZL D;  4ZUX B;  3B0B A;  4H9O B;  3VH6 T;  5CPK D;  3EPH A;  5AV8 B;  2BYK B;  1ZLA B;  2Y2P A;  4Z66 D;  1TZY C;  3AV1 A;  3WKJ C;  2Y2L A;  2F2A C;  5B1M A;  5B32 D;  1P3A B;  1F66 C;  1P3B A;  3C1B D;  5AV5 B;  3AZM C;  4UUZ B;  4R8P D;  1KX5 C;  3VH5 T;  4CAY A;  3AZF C;  3WKJ D;  3REH B;  3AZN A;  4WU8 B;  3LEL B;  4YS3 B;  4YM6 D;  3AZM D;  3LZ0 C;  2XD5 A;  1ID3 C;  3B0C W;  4J8X B;  1KX5 D;  5BS7 C;  3AZK B;  1P3K A;  2F8N A;  3X1U D;  4KUD D;  2ZY2 A;  2CWE A;  4WV4 B;  3LZ0 D;  3W98 C;  4WJ3 C;  3WAA A;  5B31 B;  3KFU G;  3AZJ B;  5DNM C;  3LZ1 B;  2F8N K;  3LJA B;  1AOI C;  4KGC D;  5AVC C;  5B1L B;  3AZG D;  1P3O A;  4G91 B;  3REK C;  3AZI C;  3AZH A;  1P3P A;  3W98 D;  3UTB B;  4EO5 C;  4E45 A;  5B0Y A;  2L5A A;  5E5A A;  5B24 A;  5DNM D;  1B67 A;  5AV6 B;  3W97 C;  1M18 C;  2ZY4 A;  4QLC A;  3MVD C;  5CPI B;  4Z5T B;  4WNN A;  3V9R A;  2ZY3 A;  4J8V A;  3W97 D;  4ZUX C;  3UTA B;  3H0L C;  5AV8 C;  1ZLA C;  4LD9 A;  4XZQ D;  2YFW B;  1HQ3 B;  3X1V B;  1P3I A;  1P3A C;  3B0D B;  3TU4 B;  2G5I C;  3KWQ A;  5BT1 D;  5DNN B;  4ZUX D;  5AV5 C;  4KHA B;  3O62 B;  2HIO C;  5GT3 B;  1P3G A;  5B2I A;  5AV8 D;  1M1A A;  1KU5 A;  1P34 B;  3REH C;  4H9N B;  1Z2C B;  3MGP D;  5CPJ A;  2CV5 B;  1P3A D;  4CSR A;  3P5J B;  3REL B;  3LEL C;  4YS3 C;  5AV5 D;  3WA9 A;  1P3M A;  1BH9 A;  2HIO D;  4JJN C;  4J8X C;  3WTP B;  5B2J A;  4WU9 A;  4Z66 B;  3AZK C;  2YFV B;  5B32 B;  3LEL D;  1T3U A;  3C1B B;  3VH6 W;  2F8N G;  4R8P B;  4JJN D;  3B6G B;  5FUG A;  3REI D;  5AY8 D;  3KUY D;  5B31 C;  4J8X D;  3AZL A;  1P3F D;  3AZJ C;  2JSS A;  5CHL B;  3AFA B;  3LZ1 C;  3WKJ B;  3LJA C;  5CPK A;  5B1L C;  4YM6 B;  3B6F B;  1Q9C A;  5GXQ D;  3VH5 W;  3REJ D;  4H9P B;  5JA4 A;  5B31 D;  1N1J A;  3MGS D;  1H3O B;  5AV6 C;  3LJA D;  5CPI C;  1BH8 B;  3X1U B;  1TZY A;  4KUD B;  1P3L B;  5GT0 D;  2Y2G A;  5BNV B;  3VH6 A;  1ULY A;  1F66 A;  3AZM A;  2XD1 A;  5JRG D;  4H9Q B;  4KGC B;  1KX5 A;  3AZF A;  3AZG B;  2FJ7 D;  4Z2M H;  5CP6 D;  3W96 B;  3X1V C;  3W98 B;  1HQ3 C;  3MNN D;  1KX3 D;  3B0D C;  3VH5 A;  3TU4 C;  5DNN C;  3EG5 B;  3LZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...