2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
b'MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
4LD9C 3AZKA 4WU9A 3KSYA 4YS3A 5B0ZA 5CPKD 2HIOA 5CP6A 3MGRB 3C1CA 1S32C 3VH5T 1EQZB 2IO5B 5AV9B 1M18B 1KX3D 3W97C 3UTAB 4CAYB 3MGSA 3AZNA 4X23A 1JFIA 3TU4A 5AY8C 4KHAB 5B40B 2PYOB 3MGQB 3WA9D 3AV2D 3LZ0B 1AOIC 3NQJA 3W96C 5BT1D 3MNNC 4AWLC 1ULYA 4G91C 4H9SC 1P3AD 3B6GD 1KX5D 5AV6D 1F66B 1BFMA 3AZMC 3LZ1A 1N1JA 3WTPE 1ZLAD 4HGAB 1HQ3A 5BS7C 1BH9B 5JRGD 5FUGA 4Z66D 3KWQD 3AFAA 3MGRC 3AZEB 5AV5A 1M18C 5B1MD 5B2JA 3REKA 5CPKA 1P34D 4H9NB 2JSSA 3C1BD 2FJ7B 4WU8A 5GXQD 1KX3A 3AZHB 5BO0A 5DNND 1P3BD 4ZUXC 3O62D 5B40C 4UUZA 5GT0B 3LZ0C 3A6ND 2CV5B 3AZGA 1P3FD 1H3OA 3KXBD 3X1TD 1F66C 3LJAD 4YM6D 3AV1B 4H9RA 3UTBC 5E5AA 3NQUA 3X1VB 4KGCD 4HGAC 4H9PB 4J8WB 3B6GA 3X1UD 5AV6A 1KX5A 1KX4A 1M1AD 3LELB 5AY8D 5JRGA 4ZBJB 1M19C 1P3IB 2YFWA 3WTPD 3AZHC 5B24A 3AZFA 5GT3A 3C1BA 4H9OA 5GSUB 1P3PB 3REHB 2CV5C 3KUYB 1ID3A 4QLCB 3O62A 3MGRD 3AV1C 3B0DB 1EQZD 4LD9A 5DNMA 5BNVB 3X1SB 4EO5C 5AV9D 1M18D 3X1VC 1BH8A 3UT9B 3UTAD 4R8PB 1S32A 3WA9C 3AV2C 3WAAB 5CPIB 4XZQB 3W97A 1TAFA 4ZBJC 1P3AC 5B40D 3MGPB 2PYOD 3MGQD 5KDMA 3LZ0D 5CPJB 5B1LB 1P3IC 1TZYB 5AY8A 4DRAA 1ZLAC 3AZIB 4Z66C 3KWQC 4G92C 2F8NA 1AOIA 1F66D 3W96A 4H9QB 1P3PC 3MNNA 5B1MC 4J8VB 3REHC 1P34C 4H9SA 4NE3A 2NZDB 2RVQD 1A7WA 4Z2MG 3AZMA 3AYWA 3AZED 3B0DC 5GXQC 5B0YB 3WKJA 3X1SC 1P3OB 5DNNC 1P3BC 1KU5A 5BS7A 3UT9C 3MGRA 1P3GB 4E44A 4J8UB 4M6BA 3AZJB 4JJNB 5BNXB 3WAAC 2FJ7D 3A6NC 1M18A 3AZHD 3AN2B 4CAYA 1P3FC 5AVBB 3KXBC 3MGPC 3X1TC 3LJAC 4YM6C 2NQBB 1TZYC 4XUJB 2CV5D 4KGCC 3RELB 4KHAA 5B40A 4ZUXA 3X1UC 3AZLB 3AV1D 2HUEB 1M1AC 3W99B 4J8VC 3X1VD 2AROB 4J8WD 1F66A 3UTBA 3WTPC 5B0YC 3MVDB 1P3OC 3LELD 3V9RB 5B31B 3B0BA 1P3GC 4J8UC 4JJNC 4WU9B 1P3ID 5B0ZB 2HIOB 5B31G 4H9NA 5CP6B 1Q9CA 4CSRA 4Z2MH 4WV4B 1M19A 4NE6A 4Z5TB 1EQZC 2IO5C 5GSUD 4XUJC 3AZHA 1P3PD 5AV9C 3REHD 3KUYD 4QLCD 3RELC 3UTAC 5AVCB 3TU4B 2LY8A 2HUEC 3X1SD 2CV5A 5F99B 3UT9D 2PYOC 3MGQC 4R8PD 3NQJB 3AV1A 3WAAD 5CPID 3X1VA 4XZQD 4H9PA 5B31C 3B6FB 3WA9A 3AV2A 3MGPD 3B0CW 3LZ1B 5CPJD 5B1LD 1TZYD 1HQ3B 3AZID 2RVQC 1P3AA 3AFAB 3AZEC 4Z5TC 1P3IA 5B2JB 3REKB 1U35B 1ZLAA 4J8VD 2YFVA 4Z66A 3KWQA 2NZDD 4WU8B 5AVCC 2FJ7C 3VH6A 1P3PA 5BO0B 5B0YD 5B1MA 1P3OD 1P34A 5F99C 1P3GD 1P3LB 4J8UD 5GT0C 3AZJD 5GXQA 4JJND 5BNVA 5DNNA 1P3BA 3AZGB 2L5AA 1H3OB 5B33B 3UT9A 5G49A 3AN2D 3B6FC 3VH6T 5AVBD 4H9RB 3WAAA 2NQBD 3A6NA 5E5AB 3NQUB 3REIB 4XUJD 5JA4A 4J8WC 3RELD 1P3FA 3KXBA 3MGPA 3X1TA 1KX4B 4J8XB 3LJAA 4YM6A 3AZLD 1TZYA 1HTAA 3W98B 1U35C 3LELC 4KGCA 3W99D 3X1UA 2AROD 3R45A 1M1AA 5B24B 3AZFB 3MVDD 4J8VA 5GT3B 5B31D 1P3LC 2BYKB 5B2IB 3WTPA 5B0YA 5GSUC 4WU9D 1P3OA 1ID3B 4WNNA 3KUYC 5B0ZD 4QLCC 2HIOD 4KUDB 5CP6D 5B33C 1P3GA 3VH6W 4JJNA 4Z5TD 5DNMB 5BNXA 4LD9B 1BH8B 3REIC 2BYMB 1S32B 4R8PC 4J8XC 1EQZA 3REJB 5AVCD 5CPIC 3W97B 4XUJA 3W98C 3TU4D 5AV9A 4XZQC 3RELA 3UTAA 5F99D 5KDMB 5GT0D 5CPJC 5B1LC 3AZIC 2F8NB 2PYOA 3MGQA 1AOIB 3B6FD 3LZ0A 3W96B 5B2IC 1P3MB 3MNNB 3LZ1D 4AWLB 1P3KB 2F8NG 5AV8B 1HQ3D 4KUDC 2NZDC 3AFAD 3AZMB 1WWSA 3AYWB 5B32B 3WKJB 5DNMC 5B2JD 3REKD 1U35D 1BH9A 5B32G 3AZEA 4Z5TA 3AZJC 3REJC 3B0CT 3AZKB 4WU8D 5CHLB 4YS3B 3AN2C 3C1CB 1B67A 4DRBA 5AVBC 5AVCA 1P3LD 2FJ7A 2NQBC 1WWIA 4ZUXB 5F99A 3MGSB 1B6WA 3AZGD 5B33D 3AZNB 5GT0A 4X23B 3AZLC 4NE5A 1JFIB 1P3MC 5E5AD 3REID 1P3KC 3W99C 5AV8C 2AROC 3B6FA 3AYWC 1KX4D 5B32C 4J8XD 3UTBB 3WKJC 3W98D 3MVDC 4NFTA 4J8WA 3VH5W 2F8NK 3AZKC 4WU9C 1N1JB 5B24D 1U35A 3LELA 3AZFD 2F8NH 4YS3C 5GT3D 5B0ZC 2HIOC 5FUGB 4CSRB 5CP6C 3C1CC 1M19B 5AV5B 5B2ID 5CPKB 1ID3D 4KUDD 3MGSC 3AZNC 1P3LA 4X23C 1KX3B 4LD9D 5GSUA 5DNMD 4WZSB 3TU4C 3REHA 5C3IB 3KUYA 4QLCA 5B33A 4UUZB 1S32D 3REJD 4EO5B 3X1SA 3REIA 3W97D 3WA9B 3AV2B 4R8PA 4J8XA 2CWEA 5CPIA 3LZ1C 3W98A 1R4VA 4XZQA 1P3AB 1HQ3C 3B6GB 1KX5B 5AV6B 2F8ND 3AFAC 5AV5C 1AOID 4E45A 5CPJA 5B1LA 3W96D 1P3MD 1ZLAB 3MNND 5B2JC 3REKC 2YFVB 4Z66B 5JRGB 3KWQB 4G92B 3AZIA 5AV8D 5CPKC 1P3KD 3AZMD 3AYWD 2BYKA 2YFWB 5B32D 5B2IA 4WU8C 1KX3C 3WKJD 5B1MB 4H9QA 1P34B 5C3IC 4KUDA 2NZDA 3C1BB 5GXQB 4H9OB 5DNNB 3AZKD 1P3BB 4YS3D 3O62B 5G49B 2BYMA 3AZGC 3C1CD 4J8UA 3AZJA 3REJA 3A6NB 5BT1C 5E5AC 5JA4B 1P3FB 3AN2A 3B6GC 4ZUXD 5AV6C 3KXBB 3MGSD 3X1TB 5AVBA 3LJAB 4YM6B 1KX5C 3AZND 1KX4C 2NQBA 4X23D 4KGCB 1TAFB 5JRGC 3X1UB 3R45B 3AZLA 1M1AB 3UTBD 1P3MA 5AY8B 5B24C 1P3KA 3AZFC 3W99A 5AV8A 5GT3C 2AROA 5B32A 3C1BC 3WTPB 3VH5A 1F1EA 4WNNB 3MVDA 1ID3C 4G91B 3V9RA 3O62C 5B31A 1M19D 5AV5D
chains in the Genus database with same CATH superfamily
4LD9C 3AZKA 4WU9A 3KSYA 4YS3A 5B0ZA 5CPKD 2HIOA 5CP6A 3MGRB 3C1CA 1S32C 3VH5T 1EQZB 3EPKA 2IO5B 5AV9B 1M18B 1KX3D 3W97C 3UTAB 4CAYB 3MGSA 3AZNA 4X23A 1JFIA 3TU4A 5AY8C 4KHAB 5B40B 2PYOB 3MGQB 3WA9D 3AV2D 3LZ0B 1AOIC 3NQJA 3W96C 5BT1D 3MNNC 4AWLC 1ULYA 4G91C 4H9SC 1P3AD 3B6GD 1KX5D 5AV6D 1F66B 1BFMA 3AZMC 2Y2PA 3LZ1A 1N1JA 3WTPE 1ZLAD 4HGAB 1HQ3A 5BS7C 1BH9B 5JRGD 5FUGA 4Z66D 3KWQD 3AFAA 3MGRC 3AZEB 5AV5A 3H0MC 1M18C 5B1MD 5B2JA 3REKA 5CPKA 1P34D 2Y2GA 4H9NB 2JSSA 3C1BD 4DQYB 2FJ7B 4WU8A 5GXQD 1KX3A 3AZHB 5BO0A 5DNND 1P3BD 4ZUXC 3O62D 5B40C 3EPLA 4UUZA 3H0RC 5GT0B 3LZ0C 3A6ND 2CV5B 3AZGA 1P3FD 1H3OA 3KXBD 3X1TD 1F66C 2DQNC 4YM6D 3LJAD 3AV1B 4H9RA 3UTBC 5E5AA 3NQUA 3X1VB 4KGCD 2ZY2A 4HGAC 4H9PB 4J8WB 3B6GA 3X1UD 5AV6A 1KX5A 3P5JB 1KX4A 1M1AD 3LELB 5AY8D 5JRGA 4ZBJB 3EPJA 1M19C 1P3IB 2YFWA 3WTPD 3AZHC 5B24A 3AZFA 3KFUG 5GT3A 3C1BA 4H9OA 5GSUB 1P3PB 3REHB 2CV5C 3KUYB 1ID3A 4QLCB 3O62A 3MGRD 3AV1C 3B0DB 1EQZD 4LD9A 5DNMA 5BNVB 3X1SB 4EO5C 5AV9D 1M18D 3X1VC 1BH8A 3EPHA 3UT9B 3UTAD 4R8PB 1S32A 3WA9C 3AV2C 3WAAB 5CPIB 4XZQB 3W97A 1TAFA 4ZBJC 1P3AC 5B40D 3MGPB 2PYOD 3MGQD 5KDMA 3LZ0D 5CPJB 5B1LB 1P3IC 1TZYB 5AY8A 4DRAA 1ZLAC 3AZIB 4Z66C 3KWQC 4G92C 2F8NA 1AOIA 1F66D 3W96A 4H9QB 1P3PC 3MNNA 5B1MC 4J8VB 3REHC 1P34C 4H9SA 4NE3A 2NZDB 2RVQD 1A7WA 4Z2MG 3AZMA 3AYWA 3AZED 3B0DC 5GXQC 3A1IA 5B0YB 3X1SC 1P3OB 3WKJA 2Y2LA 5DNNC 1P3BC 1KU5A 5BS7A 3UT9C 3MGRA 1P3GB 4E44A 4J8UB 4M6BA 3AZJB 4JJNB 5BNXB 3WAAC 2FJ7D 3A6NC 1M18A 3AZHD 3AN2B 3F6TA 4CAYA 1P3FC 5AVBB 4UPKA 3KXBC 3MGPC 3X1TC 3LJAC 4YM6C 2NQBB 2XD1A 1TZYC 4XUJB 2CV5D 4KGCC 3RELB 4KHAA 5B40A 4ZUXA 3X1UC 3AZLB 2RIQA 3AV1D 2HUEB 1M1AC 3W99B 4J8VC 3X1VD 2AROB 4J8WD 2Y2MA 1F66A 3UTBA 3WTPC 5B0YC 3MVDB 1P3OC 3LELD 3V9RB 2FFFB 5B31B 3B0BA 1P3GC 4J8UC 4JJNC 4WU9B 1P3ID 5B0ZB 2HIOB 5B31G 5CP6B 4H9NA 2JE5A 1Q9CA 4WJ3C 4CSRA 4Z2MH 4WV4B 1M19A 4NE6A 4Z5TB 1EQZC 2IO5C 5GSUD 4XUJC 3AZHA 1P3PD 5AV9C 3REHD 3KUYD 4QLCD 3RELC 3UTAC 5AVCB 3TU4B 2LY8A 2HUEC 3X1SD 2CV5A 1T3UA 2G5HC 5F99B 3UT9D 2PYOC 3MGQC 4R8PD 3NQJB 3AV1A 3WAAD 5CPID 3X1VA 4XZQD 4H9PA 5B31C 3B6FB 3WA9A 3AV2A 3MGPD 3B0CW 3LZ1B 5CPJD 5B1LD 1TZYD 1HQ3B 3AZID 2RVQC 1P3AA 3AFAB 3A1KA 3AZEC 4Z5TC 1P3IA 5B2JB 3REKB 1U35B 1ZLAA 4J8VD 2YFVA 4Z66A 3KWQA 2NZDD 3AL0C 5AVCC 4WU8B 2Y2IA 2FJ7C 3VH6A 1P3PA 5BO0B 5B0YD 5B1MA 1P3OD 1P34A 5F99C 2ZY3A 2Y2NA 1P3GD 1P3LB 4J8UD 5GT0C 3AZJD 5GXQA 4JJND 2XD5A 5BNVA 5DNNA 1P3BA 3AZGB 2L5AA 1H3OB 5B33B 3UT9A 5G49A 3AN2D 3B6FC 3VH6T 5AVBD 4H9RB 3WAAA 2NQBD 3A6NA 5E5AB 3NQUB 3REIB 4XUJD 5JA4A 4J8WC 3RELD 1P3FA 3KXBA 3MGPA 3X1TA 1KX4B 4J8XB 3LJAA 4YM6A 3AZLD 1TZYA 1HTAA 3W98B 1U35C 3LELC 4KGCA 3W99D 3X1UA 2AROD 3R45A 1M1AA 5B24B 3AZFB 3MVDD 4J8VA 2Y2KA 5GT3B 5B31D 3FDDA 1P3LC 2BYKB 5B2IB 3WTPA 5B0YA 5GSUC 4WU9D 1P3OA 1ID3B 4WNNA 3KUYC 5B0ZD 4QLCC 2HIOD 4KUDB 5CP6D 5B33C 1P3GA 3VH6W 4JJNA 4Z5TD 5DNMB 5BNXA 4LD9B 1BH8B 3REIC 2Y2QA 2UWXA 2BYMB 1S32B 2J8PA 4R8PC 4J8XC 1EQZA 3REJB 1PZRA 5AVCD 5CPIC 3W97B 4XUJA 2Y2JA 3TU4D 5AV9A 3W98C 4XZQC 3RELA 3UTAA 5F99D 5KDMB 5GT0D 5CPJC 5B1LC 3IP4C 3AZIC 2F8NB 2PYOA 3MGQA 1AOIB 3B6FD 3LZ0A 3W96B 5B2IC 1P3MB 3MNNB 3LZ1D 4AWLB 1P3KB 2F8NG 5AV8B 1HQ3D 4KUDC 2NZDC 3AFAD 3AZMB 1WWSA 3AYWB 5B32B 3WKJB 5DNMC 5B2JD 3REKD 1U35D 2JCHA 2ZM5A 1BH9A 5B32G 3AZEA 4Z5TA 3AZJC 3REJC 3B0CT 3AZKB 4WU8D 5CHLB 4YS3B 3AN2C 2Y2OA 3C1CB 3EG5B 1B67A 4DRBA 5AVBC 5AVCA 1P3LD 2FJ7A 2NQBC 1WWIA 4ZUXB 5F99A 3MGSB 1B6WA 3AZGD 5B33D 3AZNB 5GT0A 4X23B 3AZLC 4NE5A 1JFIB 1P3MC 5E5AD 3REID 1P3KC 3W99C 5AV8C 2DF4C 2AROC 3B6FA 3AYWC 1KX4D 5B32C 4J8XD 3UTBB 3WKJC 3W98D 3MVDC 4NFTA 4J8WA 3VH5W 2F8NK 3AZKC 1Z2CB 1N1JB 4WU9C 5B24D 1U35A 3LELA 3AZFD 2F8NH 4YS3C 5GT3D 5B0ZC 2HIOC 5FUGB 4CSRB 2ZY5A 5CP6C 3C1CC 1M19B 5AV5B 5B2ID 5CPKB 1ID3D 4KUDD 3MGSC 3AZNC 1P3LA 4X23C 1KX3B 4LD9D 5GSUA 5DNMD 4WZSB 3TU4C 3REHA 5C3IB 3KUYA 4QLCA 5B33A 4UUZB 1S32D 3REJD 4EO5B 3X1SA 3REIA 3W97D 3WA9B 3AV2B 2G5IC 2Y2HA 4R8PA 4J8XA 3H0LC 2CWEA 5CPIA 3LZ1C 3W98A 1R4VA 4XZQA 2VQRA 1P3AB 1HQ3C 3B6GB 1KX5B 5AV6B 2F8ND 3AFAC 5AV5C 1AOID 4E45A 2W8SA 5CPJA 5B1LA 3W96D 1P3MD 1ZLAB 3MNND 5B2JC 3REKC 2YFVB 4Z66B 5JRGB 3KWQB 4G92B 3AZIA 5AV8D 5CPKC 1P3KD 3AZMD 3AYWD 2BYKA 2YFWB 5B32D 5B2IA 4WU8C 1KX3C 3WKJD 5B1MB 4H9QA 1P34B 5C3IC 4KUDA 2NZDA 3C1BB 5GXQB 4H9OB 1W2EA 5DNNB 3AZKD 1P3BB 4YS3D 3O62B 5G49B 2BYMA 3AZGC 3C1CD 4J8UA 3AZJA 3REJA 3A6NB 5BT1C 5E5AC 5JA4B 1P3FB 3AN2A 3B6GC 4ZUXD 5AV6C 3KXBB 3MGSD 3X1TB 5AVBA 3LJAB 4YM6B 1KX5C 3AZND 1KX4C 2NQBA 4X23D 4KGCB 1TAFB 5JRGC 3X1UB 2BG1A 3R45B 3AZLA 1M1AB 3UTBD 1P3MA 5AY8B 2F2AC 5B24C 1P3KA 3AZFC 3W99A 5AV8A 5GT3C 2AROA 5B32A 3C1BC 2ZY4A 3WTPB 3VH5A 1F1EA 4WNNB 3MVDA 1ID3C 4G91B 3V9RA 3O62C 5B31A 1M19D 5AV5D
chains in the Genus database with same CATH topology
4LD9C 3AZKA 4WU9A 3KSYA 4YS3A 5B0ZA 5CPKD 2HIOA 5CP6A 3MGRB 3C1CA 1S32C 3VH5T 1EQZB 3EPKA 2IO5B 5AV9B 1M18B 1KX3D 3W97C 3UTAB 4CAYB 3MGSA 3AZNA 4X23A 1JFIA 3TU4A 5AY8C 4KHAB 5B40B 2PYOB 3MGQB 3WA9D 3AV2D 3LZ0B 1AOIC 3NQJA 3W96C 5BT1D 3MNNC 4AWLC 1ULYA 4G91C 4H9SC 1P3AD 3B6GD 1KX5D 5AV6D 1F66B 1BFMA 3AZMC 2Y2PA 3LZ1A 1N1JA 3WTPE 1ZLAD 4HGAB 1HQ3A 5BS7C 1BH9B 5JRGD 5FUGA 4Z66D 3KWQD 3AFAA 3MGRC 3AZEB 5AV5A 3H0MC 1M18C 5B1MD 5B2JA 3REKA 5CPKA 1P34D 2Y2GA 4H9NB 2JSSA 3C1BD 4DQYB 2FJ7B 4WU8A 5GXQD 1KX3A 3AZHB 5BO0A 5DNND 1P3BD 4ZUXC 3O62D 5B40C 3EPLA 4UUZA 3H0RC 5GT0B 3LZ0C 3A6ND 2CV5B 3AZGA 1P3FD 1H3OA 3KXBD 3X1TD 1F66C 2DQNC 4YM6D 3LJAD 3AV1B 4H9RA 3UTBC 5E5AA 3NQUA 3X1VB 4KGCD 2ZY2A 4HGAC 4H9PB 4J8WB 3B6GA 3X1UD 5AV6A 1KX5A 3P5JB 1KX4A 1M1AD 3LELB 5AY8D 5JRGA 4ZBJB 3EPJA 1M19C 1P3IB 2YFWA 3WTPD 3AZHC 5B24A 3AZFA 3KFUG 5GT3A 3C1BA 4H9OA 5GSUB 1P3PB 3REHB 2CV5C 3KUYB 1ID3A 4QLCB 3O62A 3MGRD 3AV1C 3B0DB 1EQZD 4LD9A 5DNMA 5BNVB 3X1SB 4EO5C 5AV9D 1M18D 3X1VC 1BH8A 3EPHA 3UT9B 3UTAD 4R8PB 1S32A 3WA9C 3AV2C 3WAAB 5CPIB 4XZQB 3W97A 1TAFA 4ZBJC 1P3AC 5B40D 3MGPB 2PYOD 3MGQD 5KDMA 3LZ0D 5CPJB 5B1LB 1P3IC 1TZYB 5AY8A 4DRAA 1ZLAC 3AZIB 4Z66C 3KWQC 4G92C 2F8NA 1AOIA 1F66D 3W96A 4H9QB 1P3PC 3MNNA 5B1MC 4J8VB 3REHC 1P34C 4H9SA 4NE3A 2NZDB 2RVQD 1A7WA 4Z2MG 3AZMA 3AYWA 3AZED 3B0DC 5GXQC 3A1IA 5B0YB 3X1SC 1P3OB 3WKJA 2Y2LA 5DNNC 1P3BC 1KU5A 5BS7A 3UT9C 3MGRA 1P3GB 4E44A 4J8UB 4M6BA 3AZJB 4JJNB 5BNXB 3WAAC 2FJ7D 3A6NC 1M18A 3AZHD 3AN2B 3F6TA 4CAYA 1P3FC 5AVBB 4UPKA 3KXBC 3MGPC 3X1TC 3LJAC 4YM6C 2NQBB 2XD1A 1TZYC 4XUJB 2CV5D 4KGCC 3RELB 4KHAA 5B40A 4ZUXA 3X1UC 3AZLB 2RIQA 3AV1D 2HUEB 1M1AC 3W99B 4J8VC 3X1VD 2AROB 4J8WD 2Y2MA 1F66A 3UTBA 3WTPC 5B0YC 3MVDB 1P3OC 3LELD 3V9RB 2FFFB 5B31B 3B0BA 1P3GC 4J8UC 4JJNC 4WU9B 1P3ID 5B0ZB 2HIOB 5B31G 5CP6B 4H9NA 2JE5A 1Q9CA 4WJ3C 4CSRA 4Z2MH 4WV4B 1M19A 4NE6A 4Z5TB 1EQZC 2IO5C 5GSUD 4XUJC 3AZHA 1P3PD 5AV9C 3REHD 3KUYD 4QLCD 3RELC 3UTAC 5AVCB 3TU4B 2LY8A 2HUEC 3X1SD 2CV5A 1T3UA 2G5HC 5F99B 3UT9D 2PYOC 3MGQC 4R8PD 3NQJB 3AV1A 3WAAD 5CPID 3X1VA 4XZQD 4H9PA 5B31C 3B6FB 3WA9A 3AV2A 3MGPD 3B0CW 3LZ1B 5CPJD 5B1LD 1TZYD 1HQ3B 3AZID 2RVQC 1P3AA 3AFAB 3A1KA 3AZEC 4Z5TC 1P3IA 5B2JB 3REKB 1U35B 1ZLAA 4J8VD 2YFVA 4Z66A 3KWQA 2NZDD 3AL0C 5AVCC 4WU8B 2Y2IA 2FJ7C 3VH6A 1P3PA 5BO0B 5B0YD 5B1MA 1P3OD 1P34A 5F99C 2ZY3A 2Y2NA 1P3GD 1P3LB 4J8UD 5GT0C 3AZJD 5GXQA 4JJND 2XD5A 5BNVA 5DNNA 1P3BA 3AZGB 2L5AA 1H3OB 5B33B 3UT9A 5G49A 3AN2D 3B6FC 3VH6T 5AVBD 4H9RB 3WAAA 2NQBD 3A6NA 5E5AB 3NQUB 3REIB 4XUJD 5JA4A 4J8WC 3RELD 1P3FA 3KXBA 3MGPA 3X1TA 1KX4B 4J8XB 3LJAA 4YM6A 3AZLD 1TZYA 1HTAA 3W98B 1U35C 3LELC 4KGCA 3W99D 3X1UA 2AROD 3R45A 1M1AA 5B24B 3AZFB 3MVDD 4J8VA 2Y2KA 5GT3B 5B31D 3FDDA 1P3LC 2BYKB 5B2IB 3WTPA 5B0YA 5GSUC 4WU9D 1P3OA 1ID3B 4WNNA 3KUYC 5B0ZD 4QLCC 2HIOD 4KUDB 5CP6D 5B33C 1P3GA 3VH6W 4JJNA 4Z5TD 5DNMB 5BNXA 4LD9B 1BH8B 3REIC 2Y2QA 2UWXA 2BYMB 1S32B 2J8PA 4R8PC 4J8XC 1EQZA 3REJB 1PZRA 5AVCD 5CPIC 3W97B 4XUJA 2Y2JA 3TU4D 5AV9A 3W98C 4XZQC 3RELA 3UTAA 5F99D 5KDMB 5GT0D 5CPJC 5B1LC 3IP4C 3AZIC 2F8NB 2PYOA 3MGQA 1AOIB 3B6FD 3LZ0A 3W96B 5B2IC 1P3MB 3MNNB 3LZ1D 4AWLB 1P3KB 2F8NG 5AV8B 1HQ3D 4KUDC 2NZDC 3AFAD 3AZMB 1WWSA 3AYWB 5B32B 3WKJB 5DNMC 5B2JD 3REKD 1U35D 2JCHA 2ZM5A 1BH9A 5B32G 3AZEA 4Z5TA 3AZJC 3REJC 3B0CT 3AZKB 4WU8D 5CHLB 4YS3B 3AN2C 2Y2OA 3C1CB 3EG5B 1B67A 4DRBA 5AVBC 5AVCA 1P3LD 2FJ7A 2NQBC 1WWIA 4ZUXB 5F99A 3MGSB 1B6WA 3AZGD 5B33D 3AZNB 5GT0A 4X23B 3AZLC 4NE5A 1JFIB 1P3MC 5E5AD 3REID 1P3KC 3W99C 5AV8C 2DF4C 2AROC 3B6FA 3AYWC 1KX4D 5B32C 4J8XD 3UTBB 3WKJC 3W98D 3MVDC 4NFTA 4J8WA 3VH5W 2F8NK 3AZKC 1Z2CB 1N1JB 4WU9C 5B24D 1U35A 3LELA 3AZFD 2F8NH 4YS3C 5GT3D 5B0ZC 2HIOC 5FUGB 4CSRB 2ZY5A 5CP6C 3C1CC 1M19B 5AV5B 5B2ID 5CPKB 1ID3D 4KUDD 3MGSC 3AZNC 1P3LA 4X23C 1KX3B 4LD9D 5GSUA 5DNMD 4WZSB 3TU4C 3REHA 5C3IB 3KUYA 4QLCA 5B33A 4UUZB 1S32D 3REJD 4EO5B 3X1SA 3REIA 3W97D 3WA9B 3AV2B 2G5IC 2Y2HA 4R8PA 4J8XA 3H0LC 2CWEA 5CPIA 3LZ1C 3W98A 1R4VA 4XZQA 2VQRA 1P3AB 1HQ3C 3B6GB 1KX5B 5AV6B 2F8ND 3AFAC 5AV5C 1AOID 4E45A 2W8SA 5CPJA 5B1LA 3W96D 1P3MD 1ZLAB 3MNND 5B2JC 3REKC 2YFVB 4Z66B 5JRGB 3KWQB 4G92B 3AZIA 5AV8D 5CPKC 1P3KD 3AZMD 3AYWD 2BYKA 2YFWB 5B32D 5B2IA 4WU8C 1KX3C 3WKJD 5B1MB 4H9QA 1P34B 5C3IC 4KUDA 2NZDA 3C1BB 5GXQB 4H9OB 1W2EA 5DNNB 3AZKD 1P3BB 4YS3D 3O62B 5G49B 2BYMA 3AZGC 3C1CD 4J8UA 3AZJA 3REJA 3A6NB 5BT1C 5E5AC 5JA4B 1P3FB 3AN2A 3B6GC 4ZUXD 5AV6C 3KXBB 3MGSD 3X1TB 5AVBA 3LJAB 4YM6B 1KX5C 3AZND 1KX4C 2NQBA 4X23D 4KGCB 1TAFB 5JRGC 3X1UB 2BG1A 3R45B 3AZLA 1M1AB 3UTBD 1P3MA 5AY8B 2F2AC 5B24C 1P3KA 3AZFC 3W99A 5AV8A 5GT3C 2AROA 5B32A 3C1BC 2ZY4A 3WTPB 3VH5A 1F1EA 4WNNB 3MVDA 1ID3C 4G91B 3V9RA 3O62C 5B31A 1M19D 5AV5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 C;  3AZK A;  4WU9 A;  3KSY A;  4YS3 A;  5B0Z A;  5CPK D;  2HIO A;  5CP6 A;  3MGR B;  3C1C A;  1S32 C;  3VH5 T;  1EQZ B;  2IO5 B;  5AV9 B;  1M18 B;  1KX3 D;  3W97 C;  3UTA B;  4CAY B;  3MGS A;  3AZN A;  4X23 A;  1JFI A;  3TU4 A;  5AY8 C;  4KHA B;  5B40 B;  2PYO B;  3MGQ B;  3WA9 D;  3AV2 D;  3LZ0 B;  1AOI C;  3NQJ A;  3W96 C;  5BT1 D;  3MNN C;  4AWL C;  1ULY A;  4G91 C;  4H9S C;  1P3A D;  3B6G D;  1KX5 D;  5AV6 D;  1F66 B;  1BFM A;  3AZM C;  3LZ1 A;  1N1J A;  3WTP E;  1ZLA D;  4HGA B;  1HQ3 A;  5BS7 C;  1BH9 B;  5JRG D;  5FUG A;  4Z66 D;  3KWQ D;  3AFA A;  3MGR C;  3AZE B;  5AV5 A;  1M18 C;  5B1M D;  5B2J A;  3REK A;  5CPK A;  1P34 D;  4H9N B;  2JSS A;  3C1B D;  2FJ7 B;  4WU8 A;  5GXQ D;  1KX3 A;  3AZH B;  5BO0 A;  5DNN D;  1P3B D;  4ZUX C;  3O62 D;  5B40 C;  4UUZ A;  5GT0 B;  3LZ0 C;  3A6N D;  2CV5 B;  3AZG A;  1P3F D;  1H3O A;  3KXB D;  3X1T D;  1F66 C;  3LJA D;  4YM6 D;  3AV1 B;  4H9R A;  3UTB C;  5E5A A;  3NQU A;  3X1V B;  4KGC D;  4HGA C;  4H9P B;  4J8W B;  3B6G A;  3X1U D;  5AV6 A;  1KX5 A;  1KX4 A;  1M1A D;  3LEL B;  5AY8 D;  5JRG A;  4ZBJ B;  1M19 C;  1P3I B;  2YFW A;  3WTP D;  3AZH C;  5B24 A;  3AZF A;  5GT3 A;  3C1B A;  4H9O A;  5GSU B;  1P3P B;  3REH B;  2CV5 C;  3KUY B;  1ID3 A;  4QLC B;  3O62 A;  3MGR D;  3AV1 C;  3B0D B;  1EQZ D;  4LD9 A;  5DNM A;  5BNV B;  3X1S B;  4EO5 C;  5AV9 D;  1M18 D;  3X1V C;  1BH8 A;  3UT9 B;  3UTA D;  4R8P B;  1S32 A;  3WA9 C;  3AV2 C;  3WAA B;  5CPI B;  4XZQ B;  3W97 A;  1TAF A;  4ZBJ C;  1P3A C;  5B40 D;  3MGP B;  2PYO D;  3MGQ D;  5KDM A;  3LZ0 D;  5CPJ B;  5B1L B;  1P3I C;  1TZY B;  5AY8 A;  4DRA A;  1ZLA C;  3AZI B;  4Z66 C;  3KWQ C;  4G92 C;  2F8N A;  1AOI A;  1F66 D;  3W96 A;  4H9Q B;  1P3P C;  3MNN A;  5B1M C;  4J8V B;  3REH C;  1P34 C;  4H9S A;  4NE3 A;  2NZD B;  2RVQ D;  1A7W A;  4Z2M G;  3AZM A;  3AYW A;  3AZE D;  3B0D C;  5GXQ C;  5B0Y B;  3WKJ A;  3X1S C;  1P3O B;  5DNN C;  1P3B C;  1KU5 A;  5BS7 A;  3UT9 C;  3MGR A;  1P3G B;  4E44 A;  4J8U B;  4M6B A;  3AZJ B;  4JJN B;  5BNX B;  3WAA C;  2FJ7 D;  3A6N C;  1M18 A;  3AZH D;  3AN2 B;  4CAY A;  1P3F C;  5AVB B;  3KXB C;  3MGP C;  3X1T C;  3LJA C;  4YM6 C;  2NQB B;  1TZY C;  4XUJ B;  2CV5 D;  4KGC C;  3REL B;  4KHA A;  5B40 A;  4ZUX A;  3X1U C;  3AZL B;  3AV1 D;  2HUE B;  1M1A C;  3W99 B;  4J8V C;  3X1V D;  2ARO B;  4J8W D;  1F66 A;  3UTB A;  3WTP C;  5B0Y C;  3MVD B;  1P3O C;  3LEL D;  3V9R B;  5B31 B;  3B0B A;  1P3G C;  4J8U C;  4JJN C;  4WU9 B;  1P3I D;  5B0Z B;  2HIO B;  5B31 G;  4H9N A;  5CP6 B;  1Q9C A;  4CSR A;  4Z2M H;  4WV4 B;  1M19 A;  4NE6 A;  4Z5T B;  1EQZ C;  2IO5 C;  5GSU D;  4XUJ C;  3AZH A;  1P3P D;  5AV9 C;  3REH D;  3KUY D;  4QLC D;  3REL C;  3UTA C;  5AVC B;  3TU4 B;  2LY8 A;  2HUE C;  3X1S D;  2CV5 A;  5F99 B;  3UT9 D;  2PYO C;  3MGQ C;  4R8P D;  3NQJ B;  3AV1 A;  3WAA D;  5CPI D;  3X1V A;  4XZQ D;  4H9P A;  5B31 C;  3B6F B;  3WA9 A;  3AV2 A;  3MGP D;  3B0C W;  3LZ1 B;  5CPJ D;  5B1L D;  1TZY D;  1HQ3 B;  3AZI D;  2RVQ C;  1P3A A;  3AFA B;  3AZE C;  4Z5T C;  1P3I A;  5B2J B;  3REK B;  1U35 B;  1ZLA A;  4J8V D;  2YFV A;  4Z66 A;  3KWQ A;  2NZD D;  4WU8 B;  5AVC C;  2FJ7 C;  3VH6 A;  1P3P A;  5BO0 B;  5B0Y D;  5B1M A;  1P3O D;  1P34 A;  5F99 C;  1P3G D;  1P3L B;  4J8U D;  5GT0 C;  3AZJ D;  5GXQ A;  4JJN D;  5BNV A;  5DNN A;  1P3B A;  3AZG B;  2L5A A;  1H3O B;  5B33 B;  3UT9 A;  5G49 A;  3AN2 D;  3B6F C;  3VH6 T;  5AVB D;  4H9R B;  3WAA A;  2NQB D;  3A6N A;  5E5A B;  3NQU B;  3REI B;  4XUJ D;  5JA4 A;  4J8W C;  3REL D;  1P3F A;  3KXB A;  3MGP A;  3X1T A;  1KX4 B;  4J8X B;  3LJA A;  4YM6 A;  3AZL D;  1TZY A;  1HTA A;  3W98 B;  1U35 C;  3LEL C;  4KGC A;  3W99 D;  3X1U A;  2ARO D;  3R45 A;  1M1A A;  5B24 B;  3AZF B;  3MVD D;  4J8V A;  5GT3 B;  5B31 D;  1P3L C;  2BYK B;  5B2I B;  3WTP A;  5B0Y A;  5GSU C;  4WU9 D;  1P3O A;  1ID3 B;  4WNN A;  3KUY C;  5B0Z D;  4QLC C;  2HIO D;  4KUD B;  5CP6 D;  5B33 C;  1P3G A;  3VH6 W;  4JJN A;  4Z5T D;  5DNM B;  5BNX A;  4LD9 B;  1BH8 B;  3REI C;  2BYM B;  1S32 B;  4R8P C;  4J8X C;  1EQZ A;  3REJ B;  5AVC D;  5CPI C;  3W97 B;  4XUJ A;  3W98 C;  3TU4 D;  5AV9 A;  4XZQ C;  3REL A;  3UTA A;  5F99 D;  5KDM B;  5GT0 D;  5CPJ C;  5B1L C;  3AZI C;  2F8N B;  2PYO A;  3MGQ A;  1AOI B;  3B6F D;  3LZ0 A;  3W96 B;  5B2I C;  1P3M B;  3MNN B;  3LZ1 D;  4AWL B;  1P3K B;  2F8N G;  5AV8 B;  1HQ3 D;  4KUD C;  2NZD C;  3AFA D;  3AZM B;  1WWS A;  3AYW B;  5B32 B;  3WKJ B;  5DNM C;  5B2J D;  3REK D;  1U35 D;  1BH9 A;  5B32 G;  3AZE A;  4Z5T A;  3AZJ C;  3REJ C;  3B0C T;  3AZK B;  4WU8 D;  5CHL B;  4YS3 B;  3AN2 C;  3C1C B;  1B67 A;  4DRB A;  5AVB C;  5AVC A;  1P3L D;  2FJ7 A;  2NQB C;  1WWI A;  4ZUX B;  5F99 A;  3MGS B;  1B6W A;  3AZG D;  5B33 D;  3AZN B;  5GT0 A;  4X23 B;  3AZL C;  4NE5 A;  1JFI B;  1P3M C;  5E5A D;  3REI D;  1P3K C;  3W99 C;  5AV8 C;  2ARO C;  3B6F A;  3AYW C;  1KX4 D;  5B32 C;  4J8X D;  3UTB B;  3WKJ C;  3W98 D;  3MVD C;  4NFT A;  4J8W A;  3VH5 W;  2F8N K;  3AZK C;  4WU9 C;  1N1J B;  5B24 D;  1U35 A;  3LEL A;  3AZF D;  2F8N H;  4YS3 C;  5GT3 D;  5B0Z C;  2HIO C;  5FUG B;  4CSR B;  5CP6 C;  3C1C C;  1M19 B;  5AV5 B;  5B2I D;  5CPK B;  1ID3 D;  4KUD D;  3MGS C;  3AZN C;  1P3L A;  4X23 C;  1KX3 B;  4LD9 D;  5GSU A;  5DNM D;  4WZS B;  3TU4 C;  3REH A;  5C3I B;  3KUY A;  4QLC A;  5B33 A;  4UUZ B;  1S32 D;  3REJ D;  4EO5 B;  3X1S A;  3REI A;  3W97 D;  3WA9 B;  3AV2 B;  4R8P A;  4J8X A;  2CWE A;  5CPI A;  3LZ1 C;  3W98 A;  1R4V A;  4XZQ A;  1P3A B;  1HQ3 C;  3B6G B;  1KX5 B;  5AV6 B;  2F8N D;  3AFA C;  5AV5 C;  1AOI D;  4E45 A;  5CPJ A;  5B1L A;  3W96 D;  1P3M D;  1ZLA B;  3MNN D;  5B2J C;  3REK C;  2YFV B;  4Z66 B;  5JRG B;  3KWQ B;  4G92 B;  3AZI A;  5AV8 D;  5CPK C;  1P3K D;  3AZM D;  3AYW D;  2BYK A;  2YFW B;  5B32 D;  5B2I A;  4WU8 C;  1KX3 C;  3WKJ D;  5B1M B;  4H9Q A;  1P34 B;  5C3I C;  4KUD A;  2NZD A;  3C1B B;  5GXQ B;  4H9O B;  5DNN B;  3AZK D;  1P3B B;  4YS3 D;  3O62 B;  5G49 B;  2BYM A;  3AZG C;  3C1C D;  4J8U A;  3AZJ A;  3REJ A;  3A6N B;  5BT1 C;  5E5A C;  5JA4 B;  1P3F B;  3AN2 A;  3B6G C;  4ZUX D;  5AV6 C;  3KXB B;  3MGS D;  3X1T B;  5AVB A;  3LJA B;  4YM6 B;  1KX5 C;  3AZN D;  1KX4 C;  2NQB A;  4X23 D;  4KGC B;  1TAF B;  5JRG C;  3X1U B;  3R45 B;  3AZL A;  1M1A B;  3UTB D;  1P3M A;  5AY8 B;  5B24 C;  1P3K A;  3AZF C;  3W99 A;  5AV8 A;  5GT3 C;  2ARO A;  5B32 A;  3C1B C;  3WTP B;  3VH5 A;  1F1E A;  4WNN B;  3MVD A;  1ID3 C;  4G91 B;  3V9R A;  3O62 C;  5B31 A;  1M19 D;  5AV5 D; 
#chains in the Genus database with same CATH topology
 4LD9 C;  3AZK A;  4WU9 A;  3KSY A;  4YS3 A;  5B0Z A;  5CPK D;  2HIO A;  5CP6 A;  3MGR B;  3C1C A;  1S32 C;  3VH5 T;  1EQZ B;  3EPK A;  2IO5 B;  5AV9 B;  1M18 B;  1KX3 D;  3W97 C;  3UTA B;  4CAY B;  3MGS A;  3AZN A;  4X23 A;  1JFI A;  3TU4 A;  5AY8 C;  4KHA B;  5B40 B;  2PYO B;  3MGQ B;  3WA9 D;  3AV2 D;  3LZ0 B;  1AOI C;  3NQJ A;  3W96 C;  5BT1 D;  3MNN C;  4AWL C;  1ULY A;  4G91 C;  4H9S C;  1P3A D;  3B6G D;  1KX5 D;  5AV6 D;  1F66 B;  1BFM A;  3AZM C;  2Y2P A;  3LZ1 A;  1N1J A;  3WTP E;  1ZLA D;  4HGA B;  1HQ3 A;  5BS7 C;  1BH9 B;  5JRG D;  5FUG A;  4Z66 D;  3KWQ D;  3AFA A;  3MGR C;  3AZE B;  5AV5 A;  3H0M C;  1M18 C;  5B1M D;  5B2J A;  3REK A;  5CPK A;  1P34 D;  2Y2G A;  4H9N B;  2JSS A;  3C1B D;  4DQY B;  2FJ7 B;  4WU8 A;  5GXQ D;  1KX3 A;  3AZH B;  5BO0 A;  5DNN D;  1P3B D;  4ZUX C;  3O62 D;  5B40 C;  3EPL A;  4UUZ A;  3H0R C;  5GT0 B;  3LZ0 C;  3A6N D;  2CV5 B;  3AZG A;  1P3F D;  1H3O A;  3KXB D;  3X1T D;  1F66 C;  2DQN C;  4YM6 D;  3LJA D;  3AV1 B;  4H9R A;  3UTB C;  5E5A A;  3NQU A;  3X1V B;  4KGC D;  2ZY2 A;  4HGA C;  4H9P B;  4J8W B;  3B6G A;  3X1U D;  5AV6 A;  1KX5 A;  3P5J B;  1KX4 A;  1M1A D;  3LEL B;  5AY8 D;  5JRG A;  4ZBJ B;  3EPJ A;  1M19 C;  1P3I B;  2YFW A;  3WTP D;  3AZH C;  5B24 A;  3AZF A;  3KFU G;  5GT3 A;  3C1B A;  4H9O A;  5GSU B;  1P3P B;  3REH B;  2CV5 C;  3KUY B;  1ID3 A;  4QLC B;  3O62 A;  3MGR D;  3AV1 C;  3B0D B;  1EQZ D;  4LD9 A;  5DNM A;  5BNV B;  3X1S B;  4EO5 C;  5AV9 D;  1M18 D;  3X1V C;  1BH8 A;  3EPH A;  3UT9 B;  3UTA D;  4R8P B;  1S32 A;  3WA9 C;  3AV2 C;  3WAA B;  5CPI B;  4XZQ B;  3W97 A;  1TAF A;  4ZBJ C;  1P3A C;  5B40 D;  3MGP B;  2PYO D;  3MGQ D;  5KDM A;  3LZ0 D;  5CPJ B;  5B1L B;  1P3I C;  1TZY B;  5AY8 A;  4DRA A;  1ZLA C;  3AZI B;  4Z66 C;  3KWQ C;  4G92 C;  2F8N A;  1AOI A;  1F66 D;  3W96 A;  4H9Q B;  1P3P C;  3MNN A;  5B1M C;  4J8V B;  3REH C;  1P34 C;  4H9S A;  4NE3 A;  2NZD B;  2RVQ D;  1A7W A;  4Z2M G;  3AZM A;  3AYW A;  3AZE D;  3B0D C;  5GXQ C;  3A1I A;  5B0Y B;  3X1S C;  1P3O B;  3WKJ A;  2Y2L A;  5DNN C;  1P3B C;  1KU5 A;  5BS7 A;  3UT9 C;  3MGR A;  1P3G B;  4E44 A;  4J8U B;  4M6B A;  3AZJ B;  4JJN B;  5BNX B;  3WAA C;  2FJ7 D;  3A6N C;  1M18 A;  3AZH D;  3AN2 B;  3F6T A;  4CAY A;  1P3F C;  5AVB B;  4UPK A;  3KXB C;  3MGP C;  3X1T C;  3LJA C;  4YM6 C;  2NQB B;  2XD1 A;  1TZY C;  4XUJ B;  2CV5 D;  4KGC C;  3REL B;  4KHA A;  5B40 A;  4ZUX A;  3X1U C;  3AZL B;  2RIQ A;  3AV1 D;  2HUE B;  1M1A C;  3W99 B;  4J8V C;  3X1V D;  2ARO B;  4J8W D;  2Y2M A;  1F66 A;  3UTB A;  3WTP C;  5B0Y C;  3MVD B;  1P3O C;  3LEL D;  3V9R B;  2FFF B;  5B31 B;  3B0B A;  1P3G C;  4J8U C;  4JJN C;  4WU9 B;  1P3I D;  5B0Z B;  2HIO B;  5B31 G;  5CP6 B;  4H9N A;  2JE5 A;  1Q9C A;  4WJ3 C;  4CSR A;  4Z2M H;  4WV4 B;  1M19 A;  4NE6 A;  4Z5T B;  1EQZ C;  2IO5 C;  5GSU D;  4XUJ C;  3AZH A;  1P3P D;  5AV9 C;  3REH D;  3KUY D;  4QLC D;  3REL C;  3UTA C;  5AVC B;  3TU4 B;  2LY8 A;  2HUE C;  3X1S D;  2CV5 A;  1T3U A;  2G5H C;  5F99 B;  3UT9 D;  2PYO C;  3MGQ C;  4R8P D;  3NQJ B;  3AV1 A;  3WAA D;  5CPI D;  3X1V A;  4XZQ D;  4H9P A;  5B31 C;  3B6F B;  3WA9 A;  3AV2 A;  3MGP D;  3B0C W;  3LZ1 B;  5CPJ D;  5B1L D;  1TZY D;  1HQ3 B;  3AZI D;  2RVQ C;  1P3A A;  3AFA B;  3A1K A;  3AZE C;  4Z5T C;  1P3I A;  5B2J B;  3REK B;  1U35 B;  1ZLA A;  4J8V D;  2YFV A;  4Z66 A;  3KWQ A;  2NZD D;  3AL0 C;  5AVC C;  4WU8 B;  2Y2I A;  2FJ7 C;  3VH6 A;  1P3P A;  5BO0 B;  5B0Y D;  5B1M A;  1P3O D;  1P34 A;  5F99 C;  2ZY3 A;  2Y2N A;  1P3G D;  1P3L B;  4J8U D;  5GT0 C;  3AZJ D;  5GXQ A;  4JJN D;  2XD5 A;  5BNV A;  5DNN A;  1P3B A;  3AZG B;  2L5A A;  1H3O B;  5B33 B;  3UT9 A;  5G49 A;  3AN2 D;  3B6F C;  3VH6 T;  5AVB D;  4H9R B;  3WAA A;  2NQB D;  3A6N A;  5E5A B;  3NQU B;  3REI B;  4XUJ D;  5JA4 A;  4J8W C;  3REL D;  1P3F A;  3KXB A;  3MGP A;  3X1T A;  1KX4 B;  4J8X B;  3LJA A;  4YM6 A;  3AZL D;  1TZY A;  1HTA A;  3W98 B;  1U35 C;  3LEL C;  4KGC A;  3W99 D;  3X1U A;  2ARO D;  3R45 A;  1M1A A;  5B24 B;  3AZF B;  3MVD D;  4J8V A;  2Y2K A;  5GT3 B;  5B31 D;  3FDD A;  1P3L C;  2BYK B;  5B2I B;  3WTP A;  5B0Y A;  5GSU C;  4WU9 D;  1P3O A;  1ID3 B;  4WNN A;  3KUY C;  5B0Z D;  4QLC C;  2HIO D;  4KUD B;  5CP6 D;  5B33 C;  1P3G A;  3VH6 W;  4JJN A;  4Z5T D;  5DNM B;  5BNX A;  4LD9 B;  1BH8 B;  3REI C;  2Y2Q A;  2UWX A;  2BYM B;  1S32 B;  2J8P A;  4R8P C;  4J8X C;  1EQZ A;  3REJ B;  1PZR A;  5AVC D;  5CPI C;  3W97 B;  4XUJ A;  2Y2J A;  3TU4 D;  5AV9 A;  3W98 C;  4XZQ C;  3REL A;  3UTA A;  5F99 D;  5KDM B;  5GT0 D;  5CPJ C;  5B1L C;  3IP4 C;  3AZI C;  2F8N B;  2PYO A;  3MGQ A;  1AOI B;  3B6F D;  3LZ0 A;  3W96 B;  5B2I C;  1P3M B;  3MNN B;  3LZ1 D;  4AWL B;  1P3K B;  2F8N G;  5AV8 B;  1HQ3 D;  4KUD C;  2NZD C;  3AFA D;  3AZM B;  1WWS A;  3AYW B;  5B32 B;  3WKJ B;  5DNM C;  5B2J D;  3REK D;  1U35 D;  2JCH A;  2ZM5 A;  1BH9 A;  5B32 G;  3AZE A;  4Z5T A;  3AZJ C;  3REJ C;  3B0C T;  3AZK B;  4WU8 D;  5CHL B;  4YS3 B;  3AN2 C;  2Y2O A;  3C1C B;  3EG5 B;  1B67 A;  4DRB A;  5AVB C;  5AVC A;  1P3L D;  2FJ7 A;  2NQB C;  1WWI A;  4ZUX B;  5F99 A;  3MGS B;  1B6W A;  3AZG D;  5B33 D;  3AZN B;  5GT0 A;  4X23 B;  3AZL C;  4NE5 A;  1JFI B;  1P3M C;  5E5A D;  3REI D;  1P3K C;  3W99 C;  5AV8 C;  2DF4 C;  2ARO C;  3B6F A;  3AYW C;  1KX4 D;  5B32 C;  4J8X D;  3UTB B;  3WKJ C;  3W98 D;  3MVD C;  4NFT A;  4J8W A;  3VH5 W;  2F8N K;  3AZK C;  1Z2C B;  1N1J B;  4WU9 C;  5B24 D;  1U35 A;  3LEL A;  3AZF D;  2F8N H;  4YS3 C;  5GT3 D;  5B0Z C;  2HIO C;  5FUG B;  4CSR B;  2ZY5 A;  5CP6 C;  3C1C C;  1M19 B;  5AV5 B;  5B2I D;  5CPK B;  1ID3 D;  4KUD D;  3MGS C;  3AZN C;  1P3L A;  4X23 C;  1KX3 B;  4LD9 D;  5GSU A;  5DNM D;  4WZS B;  3TU4 C;  3REH A;  5C3I B;  3KUY A;  4QLC A;  5B33 A;  4UUZ B;  1S32 D;  3REJ D;  4EO5 B;  3X1S A;  3REI A;  3W97 D;  3WA9 B;  3AV2 B;  2G5I C;  2Y2H A;  4R8P A;  4J8X A;  3H0L C;  2CWE A;  5CPI A;  3LZ1 C;  3W98 A;  1R4V A;  4XZQ A;  2VQR A;  1P3A B;  1HQ3 C;  3B6G B;  1KX5 B;  5AV6 B;  2F8N D;  3AFA C;  5AV5 C;  1AOI D;  4E45 A;  2W8S A;  5CPJ A;  5B1L A;  3W96 D;  1P3M D;  1ZLA B;  3MNN D;  5B2J C;  3REK C;  2YFV B;  4Z66 B;  5JRG B;  3KWQ B;  4G92 B;  3AZI A;  5AV8 D;  5CPK C;  1P3K D;  3AZM D;  3AYW D;  2BYK A;  2YFW B;  5B32 D;  5B2I A;  4WU8 C;  1KX3 C;  3WKJ D;  5B1M B;  4H9Q A;  1P34 B;  5C3I C;  4KUD A;  2NZD A;  3C1B B;  5GXQ B;  4H9O B;  1W2E A;  5DNN B;  3AZK D;  1P3B B;  4YS3 D;  3O62 B;  5G49 B;  2BYM A;  3AZG C;  3C1C D;  4J8U A;  3AZJ A;  3REJ A;  3A6N B;  5BT1 C;  5E5A C;  5JA4 B;  1P3F B;  3AN2 A;  3B6G C;  4ZUX D;  5AV6 C;  3KXB B;  3MGS D;  3X1T B;  5AVB A;  3LJA B;  4YM6 B;  1KX5 C;  3AZN D;  1KX4 C;  2NQB A;  4X23 D;  4KGC B;  1TAF B;  5JRG C;  3X1U B;  2BG1 A;  3R45 B;  3AZL A;  1M1A B;  3UTB D;  1P3M A;  5AY8 B;  2F2A C;  5B24 C;  1P3K A;  3AZF C;  3W99 A;  5AV8 A;  5GT3 C;  2ARO A;  5B32 A;  3C1B C;  2ZY4 A;  3WTP B;  3VH5 A;  1F1E A;  4WNN B;  3MVD A;  1ID3 C;  4G91 B;  3V9R A;  3O62 C;  5B31 A;  1M19 D;  5AV5 D; 
#chains in the Genus database with same CATH homology
 4LD9 C;  3AZK A;  4WU9 A;  3KSY A;  4YS3 A;  5B0Z A;  5CPK D;  2HIO A;  5CP6 A;  3MGR B;  3C1C A;  1S32 C;  3VH5 T;  1EQZ B;  3EPK A;  2IO5 B;  5AV9 B;  1M18 B;  1KX3 D;  3W97 C;  3UTA B;  4CAY B;  3MGS A;  3AZN A;  4X23 A;  1JFI A;  3TU4 A;  5AY8 C;  4KHA B;  5B40 B;  2PYO B;  3MGQ B;  3WA9 D;  3AV2 D;  3LZ0 B;  1AOI C;  3NQJ A;  3W96 C;  5BT1 D;  3MNN C;  4AWL C;  1ULY A;  4G91 C;  4H9S C;  1P3A D;  3B6G D;  1KX5 D;  5AV6 D;  1F66 B;  1BFM A;  3AZM C;  2Y2P A;  3LZ1 A;  1N1J A;  3WTP E;  1ZLA D;  4HGA B;  1HQ3 A;  5BS7 C;  1BH9 B;  5JRG D;  5FUG A;  4Z66 D;  3KWQ D;  3AFA A;  3MGR C;  3AZE B;  5AV5 A;  3H0M C;  1M18 C;  5B1M D;  5B2J A;  3REK A;  5CPK A;  1P34 D;  2Y2G A;  4H9N B;  2JSS A;  3C1B D;  4DQY B;  2FJ7 B;  4WU8 A;  5GXQ D;  1KX3 A;  3AZH B;  5BO0 A;  5DNN D;  1P3B D;  4ZUX C;  3O62 D;  5B40 C;  3EPL A;  4UUZ A;  3H0R C;  5GT0 B;  3LZ0 C;  3A6N D;  2CV5 B;  3AZG A;  1P3F D;  1H3O A;  3KXB D;  3X1T D;  1F66 C;  2DQN C;  4YM6 D;  3LJA D;  3AV1 B;  4H9R A;  3UTB C;  5E5A A;  3NQU A;  3X1V B;  4KGC D;  2ZY2 A;  4HGA C;  4H9P B;  4J8W B;  3B6G A;  3X1U D;  5AV6 A;  1KX5 A;  3P5J B;  1KX4 A;  1M1A D;  3LEL B;  5AY8 D;  5JRG A;  4ZBJ B;  3EPJ A;  1M19 C;  1P3I B;  2YFW A;  3WTP D;  3AZH C;  5B24 A;  3AZF A;  3KFU G;  5GT3 A;  3C1B A;  4H9O A;  5GSU B;  1P3P B;  3REH B;  2CV5 C;  3KUY B;  1ID3 A;  4QLC B;  3O62 A;  3MGR D;  3AV1 C;  3B0D B;  1EQZ D;  4LD9 A;  5DNM A;  5BNV B;  3X1S B;  4EO5 C;  5AV9 D;  1M18 D;  3X1V C;  1BH8 A;  3EPH A;  3UT9 B;  3UTA D;  4R8P B;  1S32 A;  3WA9 C;  3AV2 C;  3WAA B;  5CPI B;  4XZQ B;  3W97 A;  1TAF A;  4ZBJ C;  1P3A C;  5B40 D;  3MGP B;  2PYO D;  3MGQ D;  5KDM A;  3LZ0 D;  5CPJ B;  5B1L B;  1P3I C;  1TZY B;  5AY8 A;  4DRA A;  1ZLA C;  3AZI B;  4Z66 C;  3KWQ C;  4G92 C;  2F8N A;  1AOI A;  1F66 D;  3W96 A;  4H9Q B;  1P3P C;  3MNN A;  5B1M C;  4J8V B;  3REH C;  1P34 C;  4H9S A;  4NE3 A;  2NZD B;  2RVQ D;  1A7W A;  4Z2M G;  3AZM A;  3AYW A;  3AZE D;  3B0D C;  5GXQ C;  3A1I A;  5B0Y B;  3X1S C;  1P3O B;  3WKJ A;  2Y2L A;  5DNN C;  1P3B C;  1KU5 A;  5BS7 A;  3UT9 C;  3MGR A;  1P3G B;  4E44 A;  4J8U B;  4M6B A;  3AZJ B;  4JJN B;  5BNX B;  3WAA C;  2FJ7 D;  3A6N C;  1M18 A;  3AZH D;  3AN2 B;  3F6T A;  4CAY A;  1P3F C;  5AVB B;  4UPK A;  3KXB C;  3MGP C;  3X1T C;  3LJA C;  4YM6 C;  2NQB B;  2XD1 A;  1TZY C;  4XUJ B;  2CV5 D;  4KGC C;  3REL B;  4KHA A;  5B40 A;  4ZUX A;  3X1U C;  3AZL B;  2RIQ A;  3AV1 D;  2HUE B;  1M1A C;  3W99 B;  4J8V C;  3X1V D;  2ARO B;  4J8W D;  2Y2M A;  1F66 A;  3UTB A;  3WTP C;  5B0Y C;  3MVD B;  1P3O C;  3LEL D;  3V9R B;  2FFF B;  5B31 B;  3B0B A;  1P3G C;  4J8U C;  4JJN C;  4WU9 B;  1P3I D;  5B0Z B;  2HIO B;  5B31 G;  5CP6 B;  4H9N A;  2JE5 A;  1Q9C A;  4WJ3 C;  4CSR A;  4Z2M H;  4WV4 B;  1M19 A;  4NE6 A;  4Z5T B;  1EQZ C;  2IO5 C;  5GSU D;  4XUJ C;  3AZH A;  1P3P D;  5AV9 C;  3REH D;  3KUY D;  4QLC D;  3REL C;  3UTA C;  5AVC B;  3TU4 B;  2LY8 A;  2HUE C;  3X1S D;  2CV5 A;  1T3U A;  2G5H C;  5F99 B;  3UT9 D;  2PYO C;  3MGQ C;  4R8P D;  3NQJ B;  3AV1 A;  3WAA D;  5CPI D;  3X1V A;  4XZQ D;  4H9P A;  5B31 C;  3B6F B;  3WA9 A;  3AV2 A;  3MGP D;  3B0C W;  3LZ1 B;  5CPJ D;  5B1L D;  1TZY D;  1HQ3 B;  3AZI D;  2RVQ C;  1P3A A;  3AFA B;  3A1K A;  3AZE C;  4Z5T C;  1P3I A;  5B2J B;  3REK B;  1U35 B;  1ZLA A;  4J8V D;  2YFV A;  4Z66 A;  3KWQ A;  2NZD D;  3AL0 C;  5AVC C;  4WU8 B;  2Y2I A;  2FJ7 C;  3VH6 A;  1P3P A;  5BO0 B;  5B0Y D;  5B1M A;  1P3O D;  1P34 A;  5F99 C;  2ZY3 A;  2Y2N A;  1P3G D;  1P3L B;  4J8U D;  5GT0 C;  3AZJ D;  5GXQ A;  4JJN D;  2XD5 A;  5BNV A;  5DNN A;  1P3B A;  3AZG B;  2L5A A;  1H3O B;  5B33 B;  3UT9 A;  5G49 A;  3AN2 D;  3B6F C;  3VH6 T;  5AVB D;  4H9R B;  3WAA A;  2NQB D;  3A6N A;  5E5A B;  3NQU B;  3REI B;  4XUJ D;  5JA4 A;  4J8W C;  3REL D;  1P3F A;  3KXB A;  3MGP A;  3X1T A;  1KX4 B;  4J8X B;  3LJA A;  4YM6 A;  3AZL D;  1TZY A;  1HTA A;  3W98 B;  1U35 C;  3LEL C;  4KGC A;  3W99 D;  3X1U A;  2ARO D;  3R45 A;  1M1A A;  5B24 B;  3AZF B;  3MVD D;  4J8V A;  2Y2K A;  5GT3 B;  5B31 D;  3FDD A;  1P3L C;  2BYK B;  5B2I B;  3WTP A;  5B0Y A;  5GSU C;  4WU9 D;  1P3O A;  1ID3 B;  4WNN A;  3KUY C;  5B0Z D;  4QLC C;  2HIO D;  4KUD B;  5CP6 D;  5B33 C;  1P3G A;  3VH6 W;  4JJN A;  4Z5T D;  5DNM B;  5BNX A;  4LD9 B;  1BH8 B;  3REI C;  2Y2Q A;  2UWX A;  2BYM B;  1S32 B;  2J8P A;  4R8P C;  4J8X C;  1EQZ A;  3REJ B;  1PZR A;  5AVC D;  5CPI C;  3W97 B;  4XUJ A;  2Y2J A;  3TU4 D;  5AV9 A;  3W98 C;  4XZQ C;  3REL A;  3UTA A;  5F99 D;  5KDM B;  5GT0 D;  5CPJ C;  5B1L C;  3IP4 C;  3AZI C;  2F8N B;  2PYO A;  3MGQ A;  1AOI B;  3B6F D;  3LZ0 A;  3W96 B;  5B2I C;  1P3M B;  3MNN B;  3LZ1 D;  4AWL B;  1P3K B;  2F8N G;  5AV8 B;  1HQ3 D;  4KUD C;  2NZD C;  3AFA D;  3AZM B;  1WWS A;  3AYW B;  5B32 B;  3WKJ B;  5DNM C;  5B2J D;  3REK D;  1U35 D;  2JCH A;  2ZM5 A;  1BH9 A;  5B32 G;  3AZE A;  4Z5T A;  3AZJ C;  3REJ C;  3B0C T;  3AZK B;  4WU8 D;  5CHL B;  4YS3 B;  3AN2 C;  2Y2O A;  3C1C B;  3EG5 B;  1B67 A;  4DRB A;  5AVB C;  5AVC A;  1P3L D;  2FJ7 A;  2NQB C;  1WWI A;  4ZUX B;  5F99 A;  3MGS B;  1B6W A;  3AZG D;  5B33 D;  3AZN B;  5GT0 A;  4X23 B;  3AZL C;  4NE5 A;  1JFI B;  1P3M C;  5E5A D;  3REI D;  1P3K C;  3W99 C;  5AV8 C;  2DF4 C;  2ARO C;  3B6F A;  3AYW C;  1KX4 D;  5B32 C;  4J8X D;  3UTB B;  3WKJ C;  3W98 D;  3MVD C;  4NFT A;  4J8W A;  3VH5 W;  2F8N K;  3AZK C;  1Z2C B;  1N1J B;  4WU9 C;  5B24 D;  1U35 A;  3LEL A;  3AZF D;  2F8N H;  4YS3 C;  5GT3 D;  5B0Z C;  2HIO C;  5FUG B;  4CSR B;  2ZY5 A;  5CP6 C;  3C1C C;  1M19 B;  5AV5 B;  5B2I D;  5CPK B;  1ID3 D;  4KUD D;  3MGS C;  3AZN C;  1P3L A;  4X23 C;  1KX3 B;  4LD9 D;  5GSU A;  5DNM D;  4WZS B;  3TU4 C;  3REH A;  5C3I B;  3KUY A;  4QLC A;  5B33 A;  4UUZ B;  1S32 D;  3REJ D;  4EO5 B;  3X1S A;  3REI A;  3W97 D;  3WA9 B;  3AV2 B;  2G5I C;  2Y2H A;  4R8P A;  4J8X A;  3H0L C;  2CWE A;  5CPI A;  3LZ1 C;  3W98 A;  1R4V A;  4XZQ A;  2VQR A;  1P3A B;  1HQ3 C;  3B6G B;  1KX5 B;  5AV6 B;  2F8N D;  3AFA C;  5AV5 C;  1AOI D;  4E45 A;  2W8S A;  5CPJ A;  5B1L A;  3W96 D;  1P3M D;  1ZLA B;  3MNN D;  5B2J C;  3REK C;  2YFV B;  4Z66 B;  5JRG B;  3KWQ B;  4G92 B;  3AZI A;  5AV8 D;  5CPK C;  1P3K D;  3AZM D;  3AYW D;  2BYK A;  2YFW B;  5B32 D;  5B2I A;  4WU8 C;  1KX3 C;  3WKJ D;  5B1M B;  4H9Q A;  1P34 B;  5C3I C;  4KUD A;  2NZD A;  3C1B B;  5GXQ B;  4H9O B;  1W2E A;  5DNN B;  3AZK D;  1P3B B;  4YS3 D;  3O62 B;  5G49 B;  2BYM A;  3AZG C;  3C1C D;  4J8U A;  3AZJ A;  3REJ A;  3A6N B;  5BT1 C;  5E5A C;  5JA4 B;  1P3F B;  3AN2 A;  3B6G C;  4ZUX D;  5AV6 C;  3KXB B;  3MGS D;  3X1T B;  5AVB A;  3LJA B;  4YM6 B;  1KX5 C;  3AZN D;  1KX4 C;  2NQB A;  4X23 D;  4KGC B;  1TAF B;  5JRG C;  3X1U B;  2BG1 A;  3R45 B;  3AZL A;  1M1A B;  3UTB D;  1P3M A;  5AY8 B;  2F2A C;  5B24 C;  1P3K A;  3AZF C;  3W99 A;  5AV8 A;  5GT3 C;  2ARO A;  5B32 A;  3C1B C;  2ZY4 A;  3WTP B;  3VH5 A;  1F1E A;  4WNN B;  3MVD A;  1ID3 C;  4G91 B;  3V9R A;  3O62 C;  5B31 A;  1M19 D;  5AV5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...