2BYKA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords CHRAC-16
total genus 20
structure length 72
sequence length 72
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykA00
4G91B 3AZJB 3LZ0D 1P34A 3AYWC 1U35D 3W98A 2PYOC 2PYOD 1U35C 4J8VA 3UTBA 4J8UD 1P3AB 3REKC 4X23B 5AVCB 1M18B 5AVBC 2LY8A 1P3IB 3WAAC 5B2IC 2HIOA 5AV5A 4EO5B 4Z5TD 5B2IB 3WAAB 3AYWA 3MNND 2CV5B 2NQBD 3B6FA 3KUYB 5B24D 5DNMB 1P34D 3LELA 3UTBC 1P3GC 5GXQB 3O62D 3B0BA 5JRGB 4M6BA 2FJ7C 1S32C 1P3FC 3UTAC 3B0CT 5JA4B 3AZIB 4Z66B 3WAAA 1F66C 3AZNB 3W99C 1TAFB 3B6GD 3LZ0B 3AN2D 3VH6W 3MGRA 3KWQD 3REHC 5B1MA 1B67A 3B6GB 3AZKA 3MGSA 5CPKD 1P3OB 4KGCD 5B31C 5B0ZB 3AV2D 5B1MB 1P3AA 3AZLA 3MGSB 3NQUA 3UT9D 4J8UB 2YFVA 1TAFA 1P3LC 1KX3B 3LJAB 2BYKB 1ULYA 5GSUB 3X1VB 1KX4D 1KX5B 3C1BB 3LZ1D 4J8XD 5DNMA 2AROC 3RELA 4XUJC 3AZHA 3AV1B 1TZYD 4YM6B 4JJNB 3C1BD 3AZLC 3AZLD 5AVBA 5BNVA 3A6NC 4KUDD 3AZEC 3MGPA 3AZEB 1P3IA 1BH9B 4Z2MG 5B0ZD 2FJ7A 5KDMA 5AY8A 3AV2B 5AV8D 3AV1C 3REJD 1H3OB 4KGCC 3W98B 5GSUD 1P3BD 1KX5C 1HTAA 3MGQD 3MGPB 3AZEA 3VH5T 5B24A 3REIB 5DNNC 4LD9C 5B40D 3B6GC 5B32G 3REKB 5GT3C 5F99A 3X1SA 3LJAD 4CSRA 3MGSC 5GXQD 5B40B 4XZQA 5BO0B 1F1EA 1F66B 2RVQD 1N1JA 3UT9A 3X1TA 3AZFA 4UUZA 3AZLB 5B24C 1M19B 1M19D 4XUJB 4XUJD 3AZMD 3REIC 5DNMC 1P3PB 4WU8B 4XUJA 5AVBD 1KX3C 2NZDA 2JSSA 5JRGC 3W96C 1N1JB 4G92C 3C1CD 4KHAA 4J8WD 3W96D 3AZFC 5BS7A 3W97D 4ZUXC 1ZLAA 3REIA 4EO5C 4R8PA 1EQZA 3LZ1B 4J8XB 3VH6A 5JA4A 3AZIA 4R8PB 1EQZD 3W99D 1P3BA 5B2IA 1F66D 5GSUA 1ZLAB 1U35B 4Z66C 5E5AC 3B6FC 3B6FB 1P3PD 3AYWB 4AWLC 3LELC 5CP6C 5GT3D 3TU4A 3UTBD 5GT3A 3TU4D 1HQ3C 5B0YB 5B0ZA 4QLCB 5B40C 4J8VB 2CV5C 3MNNB 3MNNC 2CV5D 2NQBC 2NQBB 1P3BC 1KX5D 5B2ID 5DNNB 4LD9B 3B0CW 4KUDA 5BO0A 3KXBC 2CWEA 1P3PC 3AFAB 3MGRC 3WTPB 3AZID 3AZFD 3W97C 5E5AB 5CPID 5CP6A 5JRGD 3W99B 5CP6B 3AZNC 1P3KB 5GXQA 2NZDC 3W96A 3KWQB 2YFVB 3C1CA 4KUDC 3NQUB 4G91C 4H9QA 1BFMA 4CAYB 5B32C 4ZUXD 3AZKD 4R8PC 5AY8B 3LZ1C 4J8XC 5CPIC 5KDMB 3TU4B 3MGRD 3WA9C 1KX3D 4QLCA 5AY8D 2L5AA 5DNND 4LD9D 3WTPE 1KX4A 3MGPC 5FUGB 1WWSA 3MGQC 3LJAA 5CPKC 3AV1D 1R4VA 5B31B 3AZJC 1P3MD 3C1BA 4Z66D 3AV1A 2F8NH 3WKJA 3RELD 3AZHD 4YS3B 3A6NB 5B32B 5B33D 4H9NA 2BYMB 1ZLAD 5DNNA 4LD9A 5G49A 2FJ7D 5CHLB 3AZGD 1A7WA 4ZUXB 4J8UA 5F99C 3X1SC 4WV4B 5CPKB 1M1AB 5AV8B 1TZYC 2AROD 3VH6T 4E44A 1F66A 4J8WC 3LZ0A 3C1CC 1WWIA 3W99A 4H9NB 4WU9C 4H9RA 3KUYA 3X1TB 4WNNA 3X1UC 1EQZB 4NE6A 5DNMD 5B24B 4J8UC 3REID 3AZMC 4R8PD 4ZBJC 3A6ND 1AOIA 4CSRB 3R45B 4J8WA 4YM6C 5F99D 3X1SD 4JJNC 4DRAA 4KHAB 3KWQC 2IO5C 1ZLAC 1KX4C 5B1LA 3AV2A 3UTBB 1BH8B 5GT0A 3LJAC 4Z2MH 5B33B 3AZMA 5AVCD 1M18D 2AROA 3X1UB 4NFTA 3RELC 3AZHC 3AZIC 3V9RB 4NE3A 5AV8C 5AV6B 5E5AA 3REHD 3REJB 3MGPD 2PYOA 3AFAA 3X1VA 3O62A 1HQ3D 5B0YC 3TU4C 5AV9D 5CP6D 3LELD 5AY8C 1ID3C 3MNNA 2NQBA 3REKD 3B6FD 4KGCA 1P3OA 1S32D 2HIOD 5AV5D 1P3FD 4Z5TA 1KU5A 1KX5A 4KUDB 5AV8A 3MVDD 1P3GB 3REJA 2PYOB 5B32D 3KXBA 3AFAC 3MGRB 3X1VC 2F8NG 1P3KC 3B6GA 3MVDA 5B1LB 5B2JC 3WAAD 4J8VD 2NZDD 4QLCD 5GT3B 3NQJB 4X23D 3UT9C 3WA9B 2HUEB 2HUEC 3R45A 3AN2A 3AFAD 5FUGA 5C3IC 3MVDC 3RELB 3AZHB 1HQ3B 1P3AC 4DRBA 3LELB 1ID3D 5JRGA 1M19C 2RVQC 5BS7C 1ID3B 3AN2B 5B1LD 3MGQA 5G49B 4H9SC 1B6WA 3MGSD 5CPKA 3O62C 5BT1C 4HGAB 3MVDB 1P3GD 5B1MD 1EQZC 4WU8A 4H9QB 1AOID 3AZJA 3UT9B 4UUZB 3X1TD 1M19A 3WKJB 5AVBB 4X23C 5GSUC 2YFWB 1P34B 4YS3A 3W98C 4H9PB 3REJC 2BYMA 1P3ID 1M1AC 5B2JB 5B2JD 4Z5TB 1P3KA 5AV9A 4H9PA 5F99B 3X1SB 4NE5A 3X1VD 5B2JA 4WU8C 5B40A 5B0ZC 5CPJB 1KX4B 5BNXA 3AZED 2HIOC 5AV5C 1JFIA 1H3OA 1P3MB 4YS3C 4ZBJB 3X1UD 3AZKB 5GT0B 2F8NA 4WU9D 3W97A 1BH8A 3X1UA 5AV9C 5B33A 2AROB 3VH5W 5GT0D 1S32A 4H9OA 1P3FA 3WKJD 1M1AD 4XZQC 3AZNA 3C1CB 1AOIB 5GXQC 4H9OB 4CAYA 3X1TC 2F8NB 2F8ND 5B1MC 5BNVB 5B31D 5B33C 3AV2C 5BT1D 4H9RB 4WZSB 3LZ1A 4J8XA 4WNNB 1TZYB 3KUYD 4XZQD 3AZJD 2IO5B 1P3MC 3VH5A 3WA9A 2BYKA 4YM6D 4JJND 4X23A 3WTPA 1P3LA 4ZUXA 3AZGB 4YS3D 1M1AA 2YFWA 3UTAB 5AV6C 3AZGA 5B0YA 1ID3A 3WA9D 3C1BC 3A6NA 4WU8D 3WKJC 2F8NK 1P3OC 5C3IB 4Z5TC 1P3LB 1P3OD 4KGCB 3MGQB 1P3BB 4Z66A 1P3IC 1U35A 3W98D 1P3LD 4J8VC 5AV6A 3AZGC 4XZQB 5AV6D 3V9RA 1HQ3A 2HIOB 5AV5B 1P3KD 4AWLB 3AZND 2CV5A 5B31G 1TZYA 4HGAC 3AYWD 3NQJA 1S32B 1P3FB 3LZ0C 3AZMB 4WU9A 3AN2C 1P3PA 3KXBD 1BH9A 3KUYC 1P3GA 3KSYA 4WU9B 5B0YD 5AVCA 5CPJC 1M18A 2NZDB 3UTAA 2FJ7B 3KXBB 1JFIB 4J8WB 1P3AD 1P3MA 1AOIC 3UTAD 4YM6A 4JJNA 3WTPD 3AZFB 4E45A 3O62B 3WTPC 3W97B 3KWQA 4G92B 1P34C 3W96B 5AV9B 5B32A 5E5AD 5B1LC 3REHA 5CPIB 5GT0C 1Q9CA 4H9SA 5AVCC 5CPJA 1M18C 3AZKC 5CPJD 3REHB 5CPIA 5B31A 3REKA 5BNXB 1KX3A 3B0DC 3B0DB 4QLCC
chains in the Genus database with same CATH superfamily
3H0LC 4G91B 3AZJB 3LZ0D 1P34A 3AYWC 1U35D 3W98A 2PYOC 2PYOD 1U35C 4J8VA 3UTBA 4J8UD 1P3AB 3A1IA 3REKC 4X23B 5AVCB 1M18B 5AVBC 1W2EA 2LY8A 1P3IB 3WAAC 5B2IC 2HIOA 5AV5A 4EO5B 4Z5TD 5B2IB 3WAAB 3AYWA 3MNND 2CV5B 2NQBD 3B6FA 3KUYB 5B24D 5DNMB 1P34D 3LELA 3UTBC 1P3GC 5GXQB 3O62D 3B0BA 5JRGB 4M6BA 2FJ7C 1S32C 1P3FC 3UTAC 3B0CT 2Y2QA 5JA4B 3AZIB 4Z66B 3WAAA 1F66C 3AZNB 3W99C 1TAFB 3B6GD 3LZ0B 3AN2D 3VH6W 3MGRA 3KWQD 3REHC 2G5HC 5B1MA 1B67A 2Y2PA 3B6GB 4DQYB 3AZKA 3MGSA 5CPKD 2XD5A 1P3OB 5B31C 5B0ZB 3AV2D 5B1MB 1P3AA 4KGCD 3AZLA 3MGSB 3NQUA 3UT9D 4J8UB 2YFVA 1TAFA 1P3LC 1KX3B 3LJAB 2BYKB 1ULYA 5GSUB 3X1VB 1KX4D 1KX5B 3C1BB 3LZ1D 4J8XD 5DNMA 2AROC 3RELA 4XUJC 3AZHA 3AV1B 2ZY3A 1TZYD 4YM6B 4JJNB 3C1BD 3AZLC 3AZLD 5AVBA 5BNVA 3A6NC 4KUDD 4UPKA 3AZEC 3MGPA 3AZEB 1P3IA 1BH9B 4Z2MG 5B0ZD 2FJ7A 2RIQA 5KDMA 5AY8A 3AV2B 5AV8D 3AV1C 3REJD 1H3OB 4KGCC 3W98B 5GSUD 1P3BD 1KX5C 1HTAA 3MGQD 3MGPB 3AZEA 3VH5T 3KFUG 5B24A 3REIB 5DNNC 4LD9C 5B40D 3B6GC 5B32G 3REKB 5GT3C 5F99A 2Y2GA 2Y2MA 3X1SA 4CSRA 3LJAD 3MGSC 5GXQD 5B40B 4XZQA 5BO0B 1F1EA 1F66B 2RVQD 1N1JA 3UT9A 3X1TA 3AZFA 4UUZA 3AZLB 5B24C 1M19B 1M19D 2JE5A 4XUJB 4XUJD 3AZMD 3REIC 5DNMC 1P3PB 4WU8B 4XUJA 5AVBD 1KX3C 2NZDA 2JSSA 5JRGC 3W96C 1N1JB 4G92C 3C1CD 4KHAA 4J8WD 3W96D 3AZFC 5BS7A 3W97D 4ZUXC 3IP4C 1ZLAA 1PZRA 3REIA 4EO5C 4R8PA 2DF4C 1EQZA 3LZ1B 4J8XB 3VH6A 5JA4A 3AZIA 4R8PB 1EQZD 3W99D 1P3BA 2ZY4A 5B2IA 5GSUA 1F66D 1ZLAB 1U35B 3F6TA 4Z66C 2FFFB 5E5AC 3B6FC 3B6FB 1P3PD 3AYWB 4AWLC 3LELC 5CP6C 5GT3D 3TU4A 3UTBD 5GT3A 3TU4D 1HQ3C 5B0YB 5B0ZA 4QLCB 5B40C 4J8VB 2CV5C 3MNNB 3MNNC 2CV5D 2NQBC 2NQBB 1P3BC 2VQRA 1KX5D 5B2ID 5DNNB 4LD9B 3B0CW 4KUDA 5BO0A 3KXBC 2CWEA 1P3PC 3AFAB 2Y2HA 3WTPB 3MGRC 3AZID 3AZFD 5E5AB 5CPID 3W97C 5CP6A 5JRGD 2DQNC 3W99B 2Y2NA 5CP6B 3AZNC 1P3KB 5GXQA 2NZDC 3W96A 3KWQB 2YFVB 3C1CA 4KUDC 3NQUB 4G91C 4H9QA 1BFMA 4CAYB 5B32C 2Y2IA 4ZUXD 3AZKD 4R8PC 5AY8B 1Z2CB 3LZ1C 4J8XC 5CPIC 5KDMB 3TU4B 3MGRD 3WA9C 1KX3D 4QLCA 5AY8D 2L5AA 5DNND 4LD9D 3WTPE 1KX4A 3EPLA 3MGPC 5FUGB 1WWSA 3MGQC 3LJAA 5CPKC 3AV1D 1R4VA 3EG5B 2XD1A 5B31B 3AZJC 1P3MD 3C1BA 4Z66D 3AV1A 3EPKA 2F8NH 3WKJA 3RELD 3AZHD 4YS3B 3A6NB 5B32B 5B33D 4H9NA 2BYMB 1T3UA 1ZLAD 2UWXA 5DNNA 4LD9A 5G49A 2FJ7D 5CHLB 3AZGD 1A7WA 4ZUXB 4J8UA 5F99C 3X1SC 4WV4B 5CPKB 1M1AB 5AV8B 1TZYC 2AROD 3VH6T 4E44A 1F66A 4J8WC 3LZ0A 3C1CC 1WWIA 3W99A 4H9NB 4WU9C 4H9RA 3KUYA 3X1TB 4WNNA 3X1UC 1EQZB 4NE6A 5DNMD 5B24B 4J8UC 3REID 3AZMC 4R8PD 4ZBJC 3A6ND 1AOIA 4CSRB 3R45B 4J8WA 4YM6C 3X1SD 5F99D 4JJNC 4DRAA 4KHAB 3KWQC 2IO5C 1ZLAC 1KX4C 5B1LA 3AV2A 3UTBB 1BH8B 5GT0A 3LJAC 4Z2MH 5B33B 3AZMA 5AVCD 1M18D 2AROA 2F2AC 4NFTA 3X1UB 3RELC 3AZHC 3AZIC 3P5JB 2ZM5A 3AL0C 3V9RB 4NE3A 5AV8C 5AV6B 5E5AA 3REHD 3REJB 3MGPD 2PYOA 3AFAA 3EPHA 3X1VA 3O62A 1HQ3D 2ZY2A 5B0YC 3TU4C 5AV9D 5CP6D 3LELD 5AY8C 1ID3C 3MNNA 2NQBA 3REKD 3B6FD 4KGCA 1P3OA 1S32D 2HIOD 5AV5D 1P3FD 4Z5TA 1KU5A 1KX5A 4KUDB 5AV8A 3MVDD 1P3GB 3REJA 2PYOB 5B32D 3KXBA 3AFAC 3MGRB 3X1VC 2F8NG 1P3KC 3B6GA 3MVDA 5B1LB 4WJ3C 5B2JC 3WAAD 4J8VD 2NZDD 4QLCD 5GT3B 3NQJB 4X23D 3UT9C 2Y2JA 3WA9B 2Y2LA 2HUEB 2HUEC 3R45A 3AFAD 5FUGA 3AN2A 5C3IC 3MVDC 2J8PA 3H0RC 3RELB 3AZHB 1HQ3B 1P3AC 4DRBA 3LELB 1ID3D 5JRGA 1M19C 2RVQC 5BS7C 1ID3B 2Y2KA 3AN2B 5B1LD 3MGQA 3EPJA 5G49B 4H9SC 1B6WA 3MGSD 5CPKA 3O62C 5BT1C 4HGAB 3MVDB 1P3GD 5B1MD 1EQZC 4WU8A 4H9QB 1AOID 3AZJA 3UT9B 3X1TD 4UUZB 1M19A 3WKJB 5AVBB 3H0MC 2Y2OA 4X23C 5GSUC 2YFWB 1P34B 4YS3A 3W98C 4H9PB 3REJC 2BYMA 1P3ID 1M1AC 5B2JB 5B2JD 4Z5TB 1P3KA 5AV9A 4H9PA 5F99B 3X1SB 4NE5A 3X1VD 5B2JA 4WU8C 5B40A 5B0ZC 5CPJB 1KX4B 2W8SA 5BNXA 3AZED 2HIOC 5AV5C 1JFIA 1H3OA 1P3MB 4YS3C 4ZBJB 3X1UD 3AZKB 5GT0B 2F8NA 4WU9D 3W97A 1BH8A 3X1UA 5AV9C 5B33A 2AROB 3VH5W 3A1KA 5GT0D 4H9OA 1S32A 1P3FA 3WKJD 1M1AD 4XZQC 3AZNA 3C1CB 1AOIB 5GXQC 4H9OB 4CAYA 3X1TC 2F8NB 2F8ND 5B1MC 5BNVB 5B31D 5B33C 3AV2C 5BT1D 2ZY5A 4H9RB 4WZSB 3LZ1A 4J8XA 4WNNB 1TZYB 3KUYD 4XZQD 3AZJD 2IO5B 1P3MC 3VH5A 3WA9A 2BYKA 4YM6D 4JJND 4X23A 3WTPA 1P3LA 4ZUXA 3AZGB 4YS3D 1M1AA 2YFWA 3FDDA 3UTAB 5AV6C 3AZGA 5B0YA 1ID3A 3WA9D 3C1BC 3A6NA 4WU8D 3WKJC 2F8NK 1P3OC 5C3IB 4Z5TC 1P3LB 1P3OD 4KGCB 3MGQB 1P3BB 4Z66A 1P3IC 1U35A 3W98D 1P3LD 4J8VC 5AV6A 3AZGC 4XZQB 5AV6D 3V9RA 1HQ3A 2HIOB 5AV5B 1P3KD 4AWLB 3AZND 2CV5A 5B31G 1TZYA 4HGAC 3AYWD 3NQJA 1S32B 1P3FB 3LZ0C 3AZMB 4WU9A 3AN2C 1P3PA 3KXBD 1BH9A 3KUYC 1P3GA 3KSYA 4WU9B 5B0YD 5AVCA 5CPJC 1M18A 2NZDB 3UTAA 2FJ7B 3KXBB 1JFIB 4J8WB 1P3AD 1P3MA 1AOIC 3UTAD 2BG1A 4YM6A 4JJNA 3WTPD 3AZFB 4E45A 3O62B 3WTPC 3W97B 3KWQA 4G92B 1P34C 3W96B 5AV9B 5B32A 5E5AD 5B1LC 3REHA 5CPIB 2G5IC 5GT0C 1Q9CA 4H9SA 5AVCC 5CPJA 1M18C 3AZKC 2JCHA 5CPJD 3REHB 5CPIA 5B31A 3REKA 5BNXB 1KX3A 3B0DC 3B0DB 4QLCC
chains in the Genus database with same CATH topology
3H0LC 4G91B 3AZJB 3LZ0D 1P34A 3AYWC 1U35D 3W98A 2PYOC 2PYOD 1U35C 4J8VA 3UTBA 4J8UD 1P3AB 3A1IA 3REKC 4X23B 5AVCB 1M18B 5AVBC 1W2EA 2LY8A 1P3IB 3WAAC 5B2IC 2HIOA 5AV5A 4EO5B 4Z5TD 5B2IB 3WAAB 3AYWA 3MNND 2CV5B 2NQBD 3B6FA 3KUYB 5B24D 5DNMB 1P34D 3LELA 3UTBC 1P3GC 5GXQB 3O62D 3B0BA 5JRGB 4M6BA 2FJ7C 1S32C 1P3FC 3UTAC 3B0CT 2Y2QA 5JA4B 3AZIB 4Z66B 3WAAA 1F66C 3AZNB 3W99C 1TAFB 3B6GD 3LZ0B 3AN2D 3VH6W 3MGRA 3KWQD 3REHC 2G5HC 5B1MA 1B67A 2Y2PA 3B6GB 4DQYB 3AZKA 3MGSA 5CPKD 2XD5A 1P3OB 5B31C 5B0ZB 3AV2D 5B1MB 1P3AA 4KGCD 3AZLA 3MGSB 3NQUA 3UT9D 4J8UB 2YFVA 1TAFA 1P3LC 1KX3B 3LJAB 2BYKB 1ULYA 5GSUB 3X1VB 1KX4D 1KX5B 3C1BB 3LZ1D 4J8XD 5DNMA 2AROC 3RELA 4XUJC 3AZHA 3AV1B 2ZY3A 1TZYD 4YM6B 4JJNB 3C1BD 3AZLC 3AZLD 5AVBA 5BNVA 3A6NC 4KUDD 4UPKA 3AZEC 3MGPA 3AZEB 1P3IA 1BH9B 4Z2MG 5B0ZD 2FJ7A 2RIQA 5KDMA 5AY8A 3AV2B 5AV8D 3AV1C 3REJD 1H3OB 4KGCC 3W98B 5GSUD 1P3BD 1KX5C 1HTAA 3MGQD 3MGPB 3AZEA 3VH5T 3KFUG 5B24A 3REIB 5DNNC 4LD9C 5B40D 3B6GC 5B32G 3REKB 5GT3C 5F99A 2Y2GA 2Y2MA 3X1SA 4CSRA 3LJAD 3MGSC 5GXQD 5B40B 4XZQA 5BO0B 1F1EA 1F66B 2RVQD 1N1JA 3UT9A 3X1TA 3AZFA 4UUZA 3AZLB 5B24C 1M19B 1M19D 2JE5A 4XUJB 4XUJD 3AZMD 3REIC 5DNMC 1P3PB 4WU8B 4XUJA 5AVBD 1KX3C 2NZDA 2JSSA 5JRGC 3W96C 1N1JB 4G92C 3C1CD 4KHAA 4J8WD 3W96D 3AZFC 5BS7A 3W97D 4ZUXC 3IP4C 1ZLAA 1PZRA 3REIA 4EO5C 4R8PA 2DF4C 1EQZA 3LZ1B 4J8XB 3VH6A 5JA4A 3AZIA 4R8PB 1EQZD 3W99D 1P3BA 2ZY4A 5B2IA 5GSUA 1F66D 1ZLAB 1U35B 3F6TA 4Z66C 2FFFB 5E5AC 3B6FC 3B6FB 1P3PD 3AYWB 4AWLC 3LELC 5CP6C 5GT3D 3TU4A 3UTBD 5GT3A 3TU4D 1HQ3C 5B0YB 5B0ZA 4QLCB 5B40C 4J8VB 2CV5C 3MNNB 3MNNC 2CV5D 2NQBC 2NQBB 1P3BC 2VQRA 1KX5D 5B2ID 5DNNB 4LD9B 3B0CW 4KUDA 5BO0A 3KXBC 2CWEA 1P3PC 3AFAB 2Y2HA 3WTPB 3MGRC 3AZID 3AZFD 5E5AB 5CPID 3W97C 5CP6A 5JRGD 2DQNC 3W99B 2Y2NA 5CP6B 3AZNC 1P3KB 5GXQA 2NZDC 3W96A 3KWQB 2YFVB 3C1CA 4KUDC 3NQUB 4G91C 4H9QA 1BFMA 4CAYB 5B32C 2Y2IA 4ZUXD 3AZKD 4R8PC 5AY8B 1Z2CB 3LZ1C 4J8XC 5CPIC 5KDMB 3TU4B 3MGRD 3WA9C 1KX3D 4QLCA 5AY8D 2L5AA 5DNND 4LD9D 3WTPE 1KX4A 3EPLA 3MGPC 5FUGB 1WWSA 3MGQC 3LJAA 5CPKC 3AV1D 1R4VA 3EG5B 2XD1A 5B31B 3AZJC 1P3MD 3C1BA 4Z66D 3AV1A 3EPKA 2F8NH 3WKJA 3RELD 3AZHD 4YS3B 3A6NB 5B32B 5B33D 4H9NA 2BYMB 1T3UA 1ZLAD 2UWXA 5DNNA 4LD9A 5G49A 2FJ7D 5CHLB 3AZGD 1A7WA 4ZUXB 4J8UA 5F99C 3X1SC 4WV4B 5CPKB 1M1AB 5AV8B 1TZYC 2AROD 3VH6T 4E44A 1F66A 4J8WC 3LZ0A 3C1CC 1WWIA 3W99A 4H9NB 4WU9C 4H9RA 3KUYA 3X1TB 4WNNA 3X1UC 1EQZB 4NE6A 5DNMD 5B24B 4J8UC 3REID 3AZMC 4R8PD 4ZBJC 3A6ND 1AOIA 4CSRB 3R45B 4J8WA 4YM6C 3X1SD 5F99D 4JJNC 4DRAA 4KHAB 3KWQC 2IO5C 1ZLAC 1KX4C 5B1LA 3AV2A 3UTBB 1BH8B 5GT0A 3LJAC 4Z2MH 5B33B 3AZMA 5AVCD 1M18D 2AROA 2F2AC 4NFTA 3X1UB 3RELC 3AZHC 3AZIC 3P5JB 2ZM5A 3AL0C 3V9RB 4NE3A 5AV8C 5AV6B 5E5AA 3REHD 3REJB 3MGPD 2PYOA 3AFAA 3EPHA 3X1VA 3O62A 1HQ3D 2ZY2A 5B0YC 3TU4C 5AV9D 5CP6D 3LELD 5AY8C 1ID3C 3MNNA 2NQBA 3REKD 3B6FD 4KGCA 1P3OA 1S32D 2HIOD 5AV5D 1P3FD 4Z5TA 1KU5A 1KX5A 4KUDB 5AV8A 3MVDD 1P3GB 3REJA 2PYOB 5B32D 3KXBA 3AFAC 3MGRB 3X1VC 2F8NG 1P3KC 3B6GA 3MVDA 5B1LB 4WJ3C 5B2JC 3WAAD 4J8VD 2NZDD 4QLCD 5GT3B 3NQJB 4X23D 3UT9C 2Y2JA 3WA9B 2Y2LA 2HUEB 2HUEC 3R45A 3AFAD 5FUGA 3AN2A 5C3IC 3MVDC 2J8PA 3H0RC 3RELB 3AZHB 1HQ3B 1P3AC 4DRBA 3LELB 1ID3D 5JRGA 1M19C 2RVQC 5BS7C 1ID3B 2Y2KA 3AN2B 5B1LD 3MGQA 3EPJA 5G49B 4H9SC 1B6WA 3MGSD 5CPKA 3O62C 5BT1C 4HGAB 3MVDB 1P3GD 5B1MD 1EQZC 4WU8A 4H9QB 1AOID 3AZJA 3UT9B 3X1TD 4UUZB 1M19A 3WKJB 5AVBB 3H0MC 2Y2OA 4X23C 5GSUC 2YFWB 1P34B 4YS3A 3W98C 4H9PB 3REJC 2BYMA 1P3ID 1M1AC 5B2JB 5B2JD 4Z5TB 1P3KA 5AV9A 4H9PA 5F99B 3X1SB 4NE5A 3X1VD 5B2JA 4WU8C 5B40A 5B0ZC 5CPJB 1KX4B 2W8SA 5BNXA 3AZED 2HIOC 5AV5C 1JFIA 1H3OA 1P3MB 4YS3C 4ZBJB 3X1UD 3AZKB 5GT0B 2F8NA 4WU9D 3W97A 1BH8A 3X1UA 5AV9C 5B33A 2AROB 3VH5W 3A1KA 5GT0D 4H9OA 1S32A 1P3FA 3WKJD 1M1AD 4XZQC 3AZNA 3C1CB 1AOIB 5GXQC 4H9OB 4CAYA 3X1TC 2F8NB 2F8ND 5B1MC 5BNVB 5B31D 5B33C 3AV2C 5BT1D 2ZY5A 4H9RB 4WZSB 3LZ1A 4J8XA 4WNNB 1TZYB 3KUYD 4XZQD 3AZJD 2IO5B 1P3MC 3VH5A 3WA9A 2BYKA 4YM6D 4JJND 4X23A 3WTPA 1P3LA 4ZUXA 3AZGB 4YS3D 1M1AA 2YFWA 3FDDA 3UTAB 5AV6C 3AZGA 5B0YA 1ID3A 3WA9D 3C1BC 3A6NA 4WU8D 3WKJC 2F8NK 1P3OC 5C3IB 4Z5TC 1P3LB 1P3OD 4KGCB 3MGQB 1P3BB 4Z66A 1P3IC 1U35A 3W98D 1P3LD 4J8VC 5AV6A 3AZGC 4XZQB 5AV6D 3V9RA 1HQ3A 2HIOB 5AV5B 1P3KD 4AWLB 3AZND 2CV5A 5B31G 1TZYA 4HGAC 3AYWD 3NQJA 1S32B 1P3FB 3LZ0C 3AZMB 4WU9A 3AN2C 1P3PA 3KXBD 1BH9A 3KUYC 1P3GA 3KSYA 4WU9B 5B0YD 5AVCA 5CPJC 1M18A 2NZDB 3UTAA 2FJ7B 3KXBB 1JFIB 4J8WB 1P3AD 1P3MA 1AOIC 3UTAD 2BG1A 4YM6A 4JJNA 3WTPD 3AZFB 4E45A 3O62B 3WTPC 3W97B 3KWQA 4G92B 1P34C 3W96B 5AV9B 5B32A 5E5AD 5B1LC 3REHA 5CPIB 2G5IC 5GT0C 1Q9CA 4H9SA 5AVCC 5CPJA 1M18C 3AZKC 2JCHA 5CPJD 3REHB 5CPIA 5B31A 3REKA 5BNXB 1KX3A 3B0DC 3B0DB 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G91 B;  3AZJ B;  3LZ0 D;  1P34 A;  3AYW C;  1U35 D;  3W98 A;  2PYO C;  2PYO D;  1U35 C;  4J8V A;  3UTB A;  4J8U D;  1P3A B;  3REK C;  4X23 B;  5AVC B;  1M18 B;  5AVB C;  2LY8 A;  1P3I B;  3WAA C;  5B2I C;  2HIO A;  5AV5 A;  4EO5 B;  4Z5T D;  5B2I B;  3WAA B;  3AYW A;  3MNN D;  2CV5 B;  2NQB D;  3B6F A;  3KUY B;  5B24 D;  5DNM B;  1P34 D;  3LEL A;  3UTB C;  1P3G C;  5GXQ B;  3O62 D;  3B0B A;  5JRG B;  4M6B A;  2FJ7 C;  1S32 C;  1P3F C;  3UTA C;  3B0C T;  5JA4 B;  3AZI B;  4Z66 B;  3WAA A;  1F66 C;  3AZN B;  3W99 C;  1TAF B;  3B6G D;  3LZ0 B;  3AN2 D;  3VH6 W;  3MGR A;  3KWQ D;  3REH C;  5B1M A;  1B67 A;  3B6G B;  3AZK A;  3MGS A;  5CPK D;  1P3O B;  4KGC D;  5B31 C;  5B0Z B;  3AV2 D;  5B1M B;  1P3A A;  3AZL A;  3MGS B;  3NQU A;  3UT9 D;  4J8U B;  2YFV A;  1TAF A;  1P3L C;  1KX3 B;  3LJA B;  2BYK B;  1ULY A;  5GSU B;  3X1V B;  1KX4 D;  1KX5 B;  3C1B B;  3LZ1 D;  4J8X D;  5DNM A;  2ARO C;  3REL A;  4XUJ C;  3AZH A;  3AV1 B;  1TZY D;  4YM6 B;  4JJN B;  3C1B D;  3AZL C;  3AZL D;  5AVB A;  5BNV A;  3A6N C;  4KUD D;  3AZE C;  3MGP A;  3AZE B;  1P3I A;  1BH9 B;  4Z2M G;  5B0Z D;  2FJ7 A;  5KDM A;  5AY8 A;  3AV2 B;  5AV8 D;  3AV1 C;  3REJ D;  1H3O B;  4KGC C;  3W98 B;  5GSU D;  1P3B D;  1KX5 C;  1HTA A;  3MGQ D;  3MGP B;  3AZE A;  3VH5 T;  5B24 A;  3REI B;  5DNN C;  4LD9 C;  5B40 D;  3B6G C;  5B32 G;  3REK B;  5GT3 C;  5F99 A;  3X1S A;  3LJA D;  4CSR A;  3MGS C;  5GXQ D;  5B40 B;  4XZQ A;  5BO0 B;  1F1E A;  1F66 B;  2RVQ D;  1N1J A;  3UT9 A;  3X1T A;  3AZF A;  4UUZ A;  3AZL B;  5B24 C;  1M19 B;  1M19 D;  4XUJ B;  4XUJ D;  3AZM D;  3REI C;  5DNM C;  1P3P B;  4WU8 B;  4XUJ A;  5AVB D;  1KX3 C;  2NZD A;  2JSS A;  5JRG C;  3W96 C;  1N1J B;  4G92 C;  3C1C D;  4KHA A;  4J8W D;  3W96 D;  3AZF C;  5BS7 A;  3W97 D;  4ZUX C;  1ZLA A;  3REI A;  4EO5 C;  4R8P A;  1EQZ A;  3LZ1 B;  4J8X B;  3VH6 A;  5JA4 A;  3AZI A;  4R8P B;  1EQZ D;  3W99 D;  1P3B A;  5B2I A;  1F66 D;  5GSU A;  1ZLA B;  1U35 B;  4Z66 C;  5E5A C;  3B6F C;  3B6F B;  1P3P D;  3AYW B;  4AWL C;  3LEL C;  5CP6 C;  5GT3 D;  3TU4 A;  3UTB D;  5GT3 A;  3TU4 D;  1HQ3 C;  5B0Y B;  5B0Z A;  4QLC B;  5B40 C;  4J8V B;  2CV5 C;  3MNN B;  3MNN C;  2CV5 D;  2NQB C;  2NQB B;  1P3B C;  1KX5 D;  5B2I D;  5DNN B;  4LD9 B;  3B0C W;  4KUD A;  5BO0 A;  3KXB C;  2CWE A;  1P3P C;  3AFA B;  3MGR C;  3WTP B;  3AZI D;  3AZF D;  3W97 C;  5E5A B;  5CPI D;  5CP6 A;  5JRG D;  3W99 B;  5CP6 B;  3AZN C;  1P3K B;  5GXQ A;  2NZD C;  3W96 A;  3KWQ B;  2YFV B;  3C1C A;  4KUD C;  3NQU B;  4G91 C;  4H9Q A;  1BFM A;  4CAY B;  5B32 C;  4ZUX D;  3AZK D;  4R8P C;  5AY8 B;  3LZ1 C;  4J8X C;  5CPI C;  5KDM B;  3TU4 B;  3MGR D;  3WA9 C;  1KX3 D;  4QLC A;  5AY8 D;  2L5A A;  5DNN D;  4LD9 D;  3WTP E;  1KX4 A;  3MGP C;  5FUG B;  1WWS A;  3MGQ C;  3LJA A;  5CPK C;  3AV1 D;  1R4V A;  5B31 B;  3AZJ C;  1P3M D;  3C1B A;  4Z66 D;  3AV1 A;  2F8N H;  3WKJ A;  3REL D;  3AZH D;  4YS3 B;  3A6N B;  5B32 B;  5B33 D;  4H9N A;  2BYM B;  1ZLA D;  5DNN A;  4LD9 A;  5G49 A;  2FJ7 D;  5CHL B;  3AZG D;  1A7W A;  4ZUX B;  4J8U A;  5F99 C;  3X1S C;  4WV4 B;  5CPK B;  1M1A B;  5AV8 B;  1TZY C;  2ARO D;  3VH6 T;  4E44 A;  1F66 A;  4J8W C;  3LZ0 A;  3C1C C;  1WWI A;  3W99 A;  4H9N B;  4WU9 C;  4H9R A;  3KUY A;  3X1T B;  4WNN A;  3X1U C;  1EQZ B;  4NE6 A;  5DNM D;  5B24 B;  4J8U C;  3REI D;  3AZM C;  4R8P D;  4ZBJ C;  3A6N D;  1AOI A;  4CSR B;  3R45 B;  4J8W A;  4YM6 C;  5F99 D;  3X1S D;  4JJN C;  4DRA A;  4KHA B;  3KWQ C;  2IO5 C;  1ZLA C;  1KX4 C;  5B1L A;  3AV2 A;  3UTB B;  1BH8 B;  5GT0 A;  3LJA C;  4Z2M H;  5B33 B;  3AZM A;  5AVC D;  1M18 D;  2ARO A;  3X1U B;  4NFT A;  3REL C;  3AZH C;  3AZI C;  3V9R B;  4NE3 A;  5AV8 C;  5AV6 B;  5E5A A;  3REH D;  3REJ B;  3MGP D;  2PYO A;  3AFA A;  3X1V A;  3O62 A;  1HQ3 D;  5B0Y C;  3TU4 C;  5AV9 D;  5CP6 D;  3LEL D;  5AY8 C;  1ID3 C;  3MNN A;  2NQB A;  3REK D;  3B6F D;  4KGC A;  1P3O A;  1S32 D;  2HIO D;  5AV5 D;  1P3F D;  4Z5T A;  1KU5 A;  1KX5 A;  4KUD B;  5AV8 A;  3MVD D;  1P3G B;  3REJ A;  2PYO B;  5B32 D;  3KXB A;  3AFA C;  3MGR B;  3X1V C;  2F8N G;  1P3K C;  3B6G A;  3MVD A;  5B1L B;  5B2J C;  3WAA D;  4J8V D;  2NZD D;  4QLC D;  5GT3 B;  3NQJ B;  4X23 D;  3UT9 C;  3WA9 B;  2HUE B;  2HUE C;  3R45 A;  3AN2 A;  3AFA D;  5FUG A;  5C3I C;  3MVD C;  3REL B;  3AZH B;  1HQ3 B;  1P3A C;  4DRB A;  3LEL B;  1ID3 D;  5JRG A;  1M19 C;  2RVQ C;  5BS7 C;  1ID3 B;  3AN2 B;  5B1L D;  3MGQ A;  5G49 B;  4H9S C;  1B6W A;  3MGS D;  5CPK A;  3O62 C;  5BT1 C;  4HGA B;  3MVD B;  1P3G D;  5B1M D;  1EQZ C;  4WU8 A;  4H9Q B;  1AOI D;  3AZJ A;  3UT9 B;  4UUZ B;  3X1T D;  1M19 A;  3WKJ B;  5AVB B;  4X23 C;  5GSU C;  2YFW B;  1P34 B;  4YS3 A;  3W98 C;  4H9P B;  3REJ C;  2BYM A;  1P3I D;  1M1A C;  5B2J B;  5B2J D;  4Z5T B;  1P3K A;  5AV9 A;  4H9P A;  5F99 B;  3X1S B;  4NE5 A;  3X1V D;  5B2J A;  4WU8 C;  5B40 A;  5B0Z C;  5CPJ B;  1KX4 B;  5BNX A;  3AZE D;  2HIO C;  5AV5 C;  1JFI A;  1H3O A;  1P3M B;  4YS3 C;  4ZBJ B;  3X1U D;  3AZK B;  5GT0 B;  2F8N A;  4WU9 D;  3W97 A;  1BH8 A;  3X1U A;  5AV9 C;  5B33 A;  2ARO B;  3VH5 W;  5GT0 D;  1S32 A;  4H9O A;  1P3F A;  3WKJ D;  1M1A D;  4XZQ C;  3AZN A;  3C1C B;  1AOI B;  5GXQ C;  4H9O B;  4CAY A;  3X1T C;  2F8N B;  2F8N D;  5B1M C;  5BNV B;  5B31 D;  5B33 C;  3AV2 C;  5BT1 D;  4H9R B;  4WZS B;  3LZ1 A;  4J8X A;  4WNN B;  1TZY B;  3KUY D;  4XZQ D;  3AZJ D;  2IO5 B;  1P3M C;  3VH5 A;  3WA9 A;  2BYK A;  4YM6 D;  4JJN D;  4X23 A;  3WTP A;  1P3L A;  4ZUX A;  3AZG B;  4YS3 D;  1M1A A;  2YFW A;  3UTA B;  5AV6 C;  3AZG A;  5B0Y A;  1ID3 A;  3WA9 D;  3C1B C;  3A6N A;  4WU8 D;  3WKJ C;  2F8N K;  1P3O C;  5C3I B;  4Z5T C;  1P3L B;  1P3O D;  4KGC B;  3MGQ B;  1P3B B;  4Z66 A;  1P3I C;  1U35 A;  3W98 D;  1P3L D;  4J8V C;  5AV6 A;  3AZG C;  4XZQ B;  5AV6 D;  3V9R A;  1HQ3 A;  2HIO B;  5AV5 B;  1P3K D;  4AWL B;  3AZN D;  2CV5 A;  5B31 G;  1TZY A;  4HGA C;  3AYW D;  3NQJ A;  1S32 B;  1P3F B;  3LZ0 C;  3AZM B;  4WU9 A;  3AN2 C;  1P3P A;  3KXB D;  1BH9 A;  3KUY C;  1P3G A;  3KSY A;  4WU9 B;  5B0Y D;  5AVC A;  5CPJ C;  1M18 A;  2NZD B;  3UTA A;  2FJ7 B;  3KXB B;  1JFI B;  4J8W B;  1P3A D;  1P3M A;  1AOI C;  3UTA D;  4YM6 A;  4JJN A;  3WTP D;  3AZF B;  4E45 A;  3O62 B;  3WTP C;  3W97 B;  3KWQ A;  4G92 B;  1P34 C;  3W96 B;  5AV9 B;  5B32 A;  5E5A D;  5B1L C;  3REH A;  5CPI B;  5GT0 C;  1Q9C A;  4H9S A;  5AVC C;  5CPJ A;  1M18 C;  3AZK C;  5CPJ D;  3REH B;  5CPI A;  5B31 A;  3REK A;  5BNX B;  1KX3 A;  3B0D C;  3B0D B;  4QLC C; 
#chains in the Genus database with same CATH topology
 3H0L C;  4G91 B;  3AZJ B;  3LZ0 D;  1P34 A;  3AYW C;  1U35 D;  3W98 A;  2PYO C;  2PYO D;  1U35 C;  4J8V A;  3UTB A;  4J8U D;  1P3A B;  3A1I A;  3REK C;  4X23 B;  5AVC B;  1M18 B;  5AVB C;  1W2E A;  2LY8 A;  1P3I B;  3WAA C;  5B2I C;  2HIO A;  5AV5 A;  4EO5 B;  4Z5T D;  5B2I B;  3WAA B;  3AYW A;  3MNN D;  2CV5 B;  2NQB D;  3B6F A;  3KUY B;  5B24 D;  5DNM B;  1P34 D;  3LEL A;  3UTB C;  1P3G C;  5GXQ B;  3O62 D;  3B0B A;  5JRG B;  4M6B A;  2FJ7 C;  1S32 C;  1P3F C;  3UTA C;  3B0C T;  2Y2Q A;  5JA4 B;  3AZI B;  4Z66 B;  3WAA A;  1F66 C;  3AZN B;  3W99 C;  1TAF B;  3B6G D;  3LZ0 B;  3AN2 D;  3VH6 W;  3MGR A;  3KWQ D;  3REH C;  2G5H C;  5B1M A;  1B67 A;  2Y2P A;  3B6G B;  4DQY B;  3AZK A;  3MGS A;  5CPK D;  2XD5 A;  1P3O B;  5B31 C;  5B0Z B;  3AV2 D;  5B1M B;  1P3A A;  4KGC D;  3AZL A;  3MGS B;  3NQU A;  3UT9 D;  4J8U B;  2YFV A;  1TAF A;  1P3L C;  1KX3 B;  3LJA B;  2BYK B;  1ULY A;  5GSU B;  3X1V B;  1KX4 D;  1KX5 B;  3C1B B;  3LZ1 D;  4J8X D;  5DNM A;  2ARO C;  3REL A;  4XUJ C;  3AZH A;  3AV1 B;  2ZY3 A;  1TZY D;  4YM6 B;  4JJN B;  3C1B D;  3AZL C;  3AZL D;  5AVB A;  5BNV A;  3A6N C;  4KUD D;  4UPK A;  3AZE C;  3MGP A;  3AZE B;  1P3I A;  1BH9 B;  4Z2M G;  5B0Z D;  2FJ7 A;  2RIQ A;  5KDM A;  5AY8 A;  3AV2 B;  5AV8 D;  3AV1 C;  3REJ D;  1H3O B;  4KGC C;  3W98 B;  5GSU D;  1P3B D;  1KX5 C;  1HTA A;  3MGQ D;  3MGP B;  3AZE A;  3VH5 T;  3KFU G;  5B24 A;  3REI B;  5DNN C;  4LD9 C;  5B40 D;  3B6G C;  5B32 G;  3REK B;  5GT3 C;  5F99 A;  2Y2G A;  2Y2M A;  3X1S A;  4CSR A;  3LJA D;  3MGS C;  5GXQ D;  5B40 B;  4XZQ A;  5BO0 B;  1F1E A;  1F66 B;  2RVQ D;  1N1J A;  3UT9 A;  3X1T A;  3AZF A;  4UUZ A;  3AZL B;  5B24 C;  1M19 B;  1M19 D;  2JE5 A;  4XUJ B;  4XUJ D;  3AZM D;  3REI C;  5DNM C;  1P3P B;  4WU8 B;  4XUJ A;  5AVB D;  1KX3 C;  2NZD A;  2JSS A;  5JRG C;  3W96 C;  1N1J B;  4G92 C;  3C1C D;  4KHA A;  4J8W D;  3W96 D;  3AZF C;  5BS7 A;  3W97 D;  4ZUX C;  3IP4 C;  1ZLA A;  1PZR A;  3REI A;  4EO5 C;  4R8P A;  2DF4 C;  1EQZ A;  3LZ1 B;  4J8X B;  3VH6 A;  5JA4 A;  3AZI A;  4R8P B;  1EQZ D;  3W99 D;  1P3B A;  2ZY4 A;  5B2I A;  5GSU A;  1F66 D;  1ZLA B;  1U35 B;  3F6T A;  4Z66 C;  2FFF B;  5E5A C;  3B6F C;  3B6F B;  1P3P D;  3AYW B;  4AWL C;  3LEL C;  5CP6 C;  5GT3 D;  3TU4 A;  3UTB D;  5GT3 A;  3TU4 D;  1HQ3 C;  5B0Y B;  5B0Z A;  4QLC B;  5B40 C;  4J8V B;  2CV5 C;  3MNN B;  3MNN C;  2CV5 D;  2NQB C;  2NQB B;  1P3B C;  2VQR A;  1KX5 D;  5B2I D;  5DNN B;  4LD9 B;  3B0C W;  4KUD A;  5BO0 A;  3KXB C;  2CWE A;  1P3P C;  3AFA B;  2Y2H A;  3WTP B;  3MGR C;  3AZI D;  3AZF D;  5E5A B;  5CPI D;  3W97 C;  5CP6 A;  5JRG D;  2DQN C;  3W99 B;  2Y2N A;  5CP6 B;  3AZN C;  1P3K B;  5GXQ A;  2NZD C;  3W96 A;  3KWQ B;  2YFV B;  3C1C A;  4KUD C;  3NQU B;  4G91 C;  4H9Q A;  1BFM A;  4CAY B;  5B32 C;  2Y2I A;  4ZUX D;  3AZK D;  4R8P C;  5AY8 B;  1Z2C B;  3LZ1 C;  4J8X C;  5CPI C;  5KDM B;  3TU4 B;  3MGR D;  3WA9 C;  1KX3 D;  4QLC A;  5AY8 D;  2L5A A;  5DNN D;  4LD9 D;  3WTP E;  1KX4 A;  3EPL A;  3MGP C;  5FUG B;  1WWS A;  3MGQ C;  3LJA A;  5CPK C;  3AV1 D;  1R4V A;  3EG5 B;  2XD1 A;  5B31 B;  3AZJ C;  1P3M D;  3C1B A;  4Z66 D;  3AV1 A;  3EPK A;  2F8N H;  3WKJ A;  3REL D;  3AZH D;  4YS3 B;  3A6N B;  5B32 B;  5B33 D;  4H9N A;  2BYM B;  1T3U A;  1ZLA D;  2UWX A;  5DNN A;  4LD9 A;  5G49 A;  2FJ7 D;  5CHL B;  3AZG D;  1A7W A;  4ZUX B;  4J8U A;  5F99 C;  3X1S C;  4WV4 B;  5CPK B;  1M1A B;  5AV8 B;  1TZY C;  2ARO D;  3VH6 T;  4E44 A;  1F66 A;  4J8W C;  3LZ0 A;  3C1C C;  1WWI A;  3W99 A;  4H9N B;  4WU9 C;  4H9R A;  3KUY A;  3X1T B;  4WNN A;  3X1U C;  1EQZ B;  4NE6 A;  5DNM D;  5B24 B;  4J8U C;  3REI D;  3AZM C;  4R8P D;  4ZBJ C;  3A6N D;  1AOI A;  4CSR B;  3R45 B;  4J8W A;  4YM6 C;  3X1S D;  5F99 D;  4JJN C;  4DRA A;  4KHA B;  3KWQ C;  2IO5 C;  1ZLA C;  1KX4 C;  5B1L A;  3AV2 A;  3UTB B;  1BH8 B;  5GT0 A;  3LJA C;  4Z2M H;  5B33 B;  3AZM A;  5AVC D;  1M18 D;  2ARO A;  2F2A C;  4NFT A;  3X1U B;  3REL C;  3AZH C;  3AZI C;  3P5J B;  2ZM5 A;  3AL0 C;  3V9R B;  4NE3 A;  5AV8 C;  5AV6 B;  5E5A A;  3REH D;  3REJ B;  3MGP D;  2PYO A;  3AFA A;  3EPH A;  3X1V A;  3O62 A;  1HQ3 D;  2ZY2 A;  5B0Y C;  3TU4 C;  5AV9 D;  5CP6 D;  3LEL D;  5AY8 C;  1ID3 C;  3MNN A;  2NQB A;  3REK D;  3B6F D;  4KGC A;  1P3O A;  1S32 D;  2HIO D;  5AV5 D;  1P3F D;  4Z5T A;  1KU5 A;  1KX5 A;  4KUD B;  5AV8 A;  3MVD D;  1P3G B;  3REJ A;  2PYO B;  5B32 D;  3KXB A;  3AFA C;  3MGR B;  3X1V C;  2F8N G;  1P3K C;  3B6G A;  3MVD A;  5B1L B;  4WJ3 C;  5B2J C;  3WAA D;  4J8V D;  2NZD D;  4QLC D;  5GT3 B;  3NQJ B;  4X23 D;  3UT9 C;  2Y2J A;  3WA9 B;  2Y2L A;  2HUE B;  2HUE C;  3R45 A;  3AFA D;  5FUG A;  3AN2 A;  5C3I C;  3MVD C;  2J8P A;  3H0R C;  3REL B;  3AZH B;  1HQ3 B;  1P3A C;  4DRB A;  3LEL B;  1ID3 D;  5JRG A;  1M19 C;  2RVQ C;  5BS7 C;  1ID3 B;  2Y2K A;  3AN2 B;  5B1L D;  3MGQ A;  3EPJ A;  5G49 B;  4H9S C;  1B6W A;  3MGS D;  5CPK A;  3O62 C;  5BT1 C;  4HGA B;  3MVD B;  1P3G D;  5B1M D;  1EQZ C;  4WU8 A;  4H9Q B;  1AOI D;  3AZJ A;  3UT9 B;  3X1T D;  4UUZ B;  1M19 A;  3WKJ B;  5AVB B;  3H0M C;  2Y2O A;  4X23 C;  5GSU C;  2YFW B;  1P34 B;  4YS3 A;  3W98 C;  4H9P B;  3REJ C;  2BYM A;  1P3I D;  1M1A C;  5B2J B;  5B2J D;  4Z5T B;  1P3K A;  5AV9 A;  4H9P A;  5F99 B;  3X1S B;  4NE5 A;  3X1V D;  5B2J A;  4WU8 C;  5B40 A;  5B0Z C;  5CPJ B;  1KX4 B;  2W8S A;  5BNX A;  3AZE D;  2HIO C;  5AV5 C;  1JFI A;  1H3O A;  1P3M B;  4YS3 C;  4ZBJ B;  3X1U D;  3AZK B;  5GT0 B;  2F8N A;  4WU9 D;  3W97 A;  1BH8 A;  3X1U A;  5AV9 C;  5B33 A;  2ARO B;  3VH5 W;  3A1K A;  5GT0 D;  4H9O A;  1S32 A;  1P3F A;  3WKJ D;  1M1A D;  4XZQ C;  3AZN A;  3C1C B;  1AOI B;  5GXQ C;  4H9O B;  4CAY A;  3X1T C;  2F8N B;  2F8N D;  5B1M C;  5BNV B;  5B31 D;  5B33 C;  3AV2 C;  5BT1 D;  2ZY5 A;  4H9R B;  4WZS B;  3LZ1 A;  4J8X A;  4WNN B;  1TZY B;  3KUY D;  4XZQ D;  3AZJ D;  2IO5 B;  1P3M C;  3VH5 A;  3WA9 A;  2BYK A;  4YM6 D;  4JJN D;  4X23 A;  3WTP A;  1P3L A;  4ZUX A;  3AZG B;  4YS3 D;  1M1A A;  2YFW A;  3FDD A;  3UTA B;  5AV6 C;  3AZG A;  5B0Y A;  1ID3 A;  3WA9 D;  3C1B C;  3A6N A;  4WU8 D;  3WKJ C;  2F8N K;  1P3O C;  5C3I B;  4Z5T C;  1P3L B;  1P3O D;  4KGC B;  3MGQ B;  1P3B B;  4Z66 A;  1P3I C;  1U35 A;  3W98 D;  1P3L D;  4J8V C;  5AV6 A;  3AZG C;  4XZQ B;  5AV6 D;  3V9R A;  1HQ3 A;  2HIO B;  5AV5 B;  1P3K D;  4AWL B;  3AZN D;  2CV5 A;  5B31 G;  1TZY A;  4HGA C;  3AYW D;  3NQJ A;  1S32 B;  1P3F B;  3LZ0 C;  3AZM B;  4WU9 A;  3AN2 C;  1P3P A;  3KXB D;  1BH9 A;  3KUY C;  1P3G A;  3KSY A;  4WU9 B;  5B0Y D;  5AVC A;  5CPJ C;  1M18 A;  2NZD B;  3UTA A;  2FJ7 B;  3KXB B;  1JFI B;  4J8W B;  1P3A D;  1P3M A;  1AOI C;  3UTA D;  2BG1 A;  4YM6 A;  4JJN A;  3WTP D;  3AZF B;  4E45 A;  3O62 B;  3WTP C;  3W97 B;  3KWQ A;  4G92 B;  1P34 C;  3W96 B;  5AV9 B;  5B32 A;  5E5A D;  5B1L C;  3REH A;  5CPI B;  2G5I C;  5GT0 C;  1Q9C A;  4H9S A;  5AVC C;  5CPJ A;  1M18 C;  3AZK C;  2JCH A;  5CPJ D;  3REH B;  5CPI A;  5B31 A;  3REK A;  5BNX B;  1KX3 A;  3B0D C;  3B0D B;  4QLC C; 
#chains in the Genus database with same CATH homology
 3H0L C;  4G91 B;  3AZJ B;  3LZ0 D;  1P34 A;  3AYW C;  1U35 D;  3W98 A;  2PYO C;  2PYO D;  1U35 C;  4J8V A;  3UTB A;  4J8U D;  1P3A B;  3A1I A;  3REK C;  4X23 B;  5AVC B;  1M18 B;  5AVB C;  1W2E A;  2LY8 A;  1P3I B;  3WAA C;  5B2I C;  2HIO A;  5AV5 A;  4EO5 B;  4Z5T D;  5B2I B;  3WAA B;  3AYW A;  3MNN D;  2CV5 B;  2NQB D;  3B6F A;  3KUY B;  5B24 D;  5DNM B;  1P34 D;  3LEL A;  3UTB C;  1P3G C;  5GXQ B;  3O62 D;  3B0B A;  5JRG B;  4M6B A;  2FJ7 C;  1S32 C;  1P3F C;  3UTA C;  3B0C T;  2Y2Q A;  5JA4 B;  3AZI B;  4Z66 B;  3WAA A;  1F66 C;  3AZN B;  3W99 C;  1TAF B;  3B6G D;  3LZ0 B;  3AN2 D;  3VH6 W;  3MGR A;  3KWQ D;  3REH C;  2G5H C;  5B1M A;  1B67 A;  2Y2P A;  3B6G B;  4DQY B;  3AZK A;  3MGS A;  5CPK D;  2XD5 A;  1P3O B;  5B31 C;  5B0Z B;  3AV2 D;  5B1M B;  1P3A A;  4KGC D;  3AZL A;  3MGS B;  3NQU A;  3UT9 D;  4J8U B;  2YFV A;  1TAF A;  1P3L C;  1KX3 B;  3LJA B;  2BYK B;  1ULY A;  5GSU B;  3X1V B;  1KX4 D;  1KX5 B;  3C1B B;  3LZ1 D;  4J8X D;  5DNM A;  2ARO C;  3REL A;  4XUJ C;  3AZH A;  3AV1 B;  2ZY3 A;  1TZY D;  4YM6 B;  4JJN B;  3C1B D;  3AZL C;  3AZL D;  5AVB A;  5BNV A;  3A6N C;  4KUD D;  4UPK A;  3AZE C;  3MGP A;  3AZE B;  1P3I A;  1BH9 B;  4Z2M G;  5B0Z D;  2FJ7 A;  2RIQ A;  5KDM A;  5AY8 A;  3AV2 B;  5AV8 D;  3AV1 C;  3REJ D;  1H3O B;  4KGC C;  3W98 B;  5GSU D;  1P3B D;  1KX5 C;  1HTA A;  3MGQ D;  3MGP B;  3AZE A;  3VH5 T;  3KFU G;  5B24 A;  3REI B;  5DNN C;  4LD9 C;  5B40 D;  3B6G C;  5B32 G;  3REK B;  5GT3 C;  5F99 A;  2Y2G A;  2Y2M A;  3X1S A;  4CSR A;  3LJA D;  3MGS C;  5GXQ D;  5B40 B;  4XZQ A;  5BO0 B;  1F1E A;  1F66 B;  2RVQ D;  1N1J A;  3UT9 A;  3X1T A;  3AZF A;  4UUZ A;  3AZL B;  5B24 C;  1M19 B;  1M19 D;  2JE5 A;  4XUJ B;  4XUJ D;  3AZM D;  3REI C;  5DNM C;  1P3P B;  4WU8 B;  4XUJ A;  5AVB D;  1KX3 C;  2NZD A;  2JSS A;  5JRG C;  3W96 C;  1N1J B;  4G92 C;  3C1C D;  4KHA A;  4J8W D;  3W96 D;  3AZF C;  5BS7 A;  3W97 D;  4ZUX C;  3IP4 C;  1ZLA A;  1PZR A;  3REI A;  4EO5 C;  4R8P A;  2DF4 C;  1EQZ A;  3LZ1 B;  4J8X B;  3VH6 A;  5JA4 A;  3AZI A;  4R8P B;  1EQZ D;  3W99 D;  1P3B A;  2ZY4 A;  5B2I A;  5GSU A;  1F66 D;  1ZLA B;  1U35 B;  3F6T A;  4Z66 C;  2FFF B;  5E5A C;  3B6F C;  3B6F B;  1P3P D;  3AYW B;  4AWL C;  3LEL C;  5CP6 C;  5GT3 D;  3TU4 A;  3UTB D;  5GT3 A;  3TU4 D;  1HQ3 C;  5B0Y B;  5B0Z A;  4QLC B;  5B40 C;  4J8V B;  2CV5 C;  3MNN B;  3MNN C;  2CV5 D;  2NQB C;  2NQB B;  1P3B C;  2VQR A;  1KX5 D;  5B2I D;  5DNN B;  4LD9 B;  3B0C W;  4KUD A;  5BO0 A;  3KXB C;  2CWE A;  1P3P C;  3AFA B;  2Y2H A;  3WTP B;  3MGR C;  3AZI D;  3AZF D;  5E5A B;  5CPI D;  3W97 C;  5CP6 A;  5JRG D;  2DQN C;  3W99 B;  2Y2N A;  5CP6 B;  3AZN C;  1P3K B;  5GXQ A;  2NZD C;  3W96 A;  3KWQ B;  2YFV B;  3C1C A;  4KUD C;  3NQU B;  4G91 C;  4H9Q A;  1BFM A;  4CAY B;  5B32 C;  2Y2I A;  4ZUX D;  3AZK D;  4R8P C;  5AY8 B;  1Z2C B;  3LZ1 C;  4J8X C;  5CPI C;  5KDM B;  3TU4 B;  3MGR D;  3WA9 C;  1KX3 D;  4QLC A;  5AY8 D;  2L5A A;  5DNN D;  4LD9 D;  3WTP E;  1KX4 A;  3EPL A;  3MGP C;  5FUG B;  1WWS A;  3MGQ C;  3LJA A;  5CPK C;  3AV1 D;  1R4V A;  3EG5 B;  2XD1 A;  5B31 B;  3AZJ C;  1P3M D;  3C1B A;  4Z66 D;  3AV1 A;  3EPK A;  2F8N H;  3WKJ A;  3REL D;  3AZH D;  4YS3 B;  3A6N B;  5B32 B;  5B33 D;  4H9N A;  2BYM B;  1T3U A;  1ZLA D;  2UWX A;  5DNN A;  4LD9 A;  5G49 A;  2FJ7 D;  5CHL B;  3AZG D;  1A7W A;  4ZUX B;  4J8U A;  5F99 C;  3X1S C;  4WV4 B;  5CPK B;  1M1A B;  5AV8 B;  1TZY C;  2ARO D;  3VH6 T;  4E44 A;  1F66 A;  4J8W C;  3LZ0 A;  3C1C C;  1WWI A;  3W99 A;  4H9N B;  4WU9 C;  4H9R A;  3KUY A;  3X1T B;  4WNN A;  3X1U C;  1EQZ B;  4NE6 A;  5DNM D;  5B24 B;  4J8U C;  3REI D;  3AZM C;  4R8P D;  4ZBJ C;  3A6N D;  1AOI A;  4CSR B;  3R45 B;  4J8W A;  4YM6 C;  3X1S D;  5F99 D;  4JJN C;  4DRA A;  4KHA B;  3KWQ C;  2IO5 C;  1ZLA C;  1KX4 C;  5B1L A;  3AV2 A;  3UTB B;  1BH8 B;  5GT0 A;  3LJA C;  4Z2M H;  5B33 B;  3AZM A;  5AVC D;  1M18 D;  2ARO A;  2F2A C;  4NFT A;  3X1U B;  3REL C;  3AZH C;  3AZI C;  3P5J B;  2ZM5 A;  3AL0 C;  3V9R B;  4NE3 A;  5AV8 C;  5AV6 B;  5E5A A;  3REH D;  3REJ B;  3MGP D;  2PYO A;  3AFA A;  3EPH A;  3X1V A;  3O62 A;  1HQ3 D;  2ZY2 A;  5B0Y C;  3TU4 C;  5AV9 D;  5CP6 D;  3LEL D;  5AY8 C;  1ID3 C;  3MNN A;  2NQB A;  3REK D;  3B6F D;  4KGC A;  1P3O A;  1S32 D;  2HIO D;  5AV5 D;  1P3F D;  4Z5T A;  1KU5 A;  1KX5 A;  4KUD B;  5AV8 A;  3MVD D;  1P3G B;  3REJ A;  2PYO B;  5B32 D;  3KXB A;  3AFA C;  3MGR B;  3X1V C;  2F8N G;  1P3K C;  3B6G A;  3MVD A;  5B1L B;  4WJ3 C;  5B2J C;  3WAA D;  4J8V D;  2NZD D;  4QLC D;  5GT3 B;  3NQJ B;  4X23 D;  3UT9 C;  2Y2J A;  3WA9 B;  2Y2L A;  2HUE B;  2HUE C;  3R45 A;  3AFA D;  5FUG A;  3AN2 A;  5C3I C;  3MVD C;  2J8P A;  3H0R C;  3REL B;  3AZH B;  1HQ3 B;  1P3A C;  4DRB A;  3LEL B;  1ID3 D;  5JRG A;  1M19 C;  2RVQ C;  5BS7 C;  1ID3 B;  2Y2K A;  3AN2 B;  5B1L D;  3MGQ A;  3EPJ A;  5G49 B;  4H9S C;  1B6W A;  3MGS D;  5CPK A;  3O62 C;  5BT1 C;  4HGA B;  3MVD B;  1P3G D;  5B1M D;  1EQZ C;  4WU8 A;  4H9Q B;  1AOI D;  3AZJ A;  3UT9 B;  3X1T D;  4UUZ B;  1M19 A;  3WKJ B;  5AVB B;  3H0M C;  2Y2O A;  4X23 C;  5GSU C;  2YFW B;  1P34 B;  4YS3 A;  3W98 C;  4H9P B;  3REJ C;  2BYM A;  1P3I D;  1M1A C;  5B2J B;  5B2J D;  4Z5T B;  1P3K A;  5AV9 A;  4H9P A;  5F99 B;  3X1S B;  4NE5 A;  3X1V D;  5B2J A;  4WU8 C;  5B40 A;  5B0Z C;  5CPJ B;  1KX4 B;  2W8S A;  5BNX A;  3AZE D;  2HIO C;  5AV5 C;  1JFI A;  1H3O A;  1P3M B;  4YS3 C;  4ZBJ B;  3X1U D;  3AZK B;  5GT0 B;  2F8N A;  4WU9 D;  3W97 A;  1BH8 A;  3X1U A;  5AV9 C;  5B33 A;  2ARO B;  3VH5 W;  3A1K A;  5GT0 D;  4H9O A;  1S32 A;  1P3F A;  3WKJ D;  1M1A D;  4XZQ C;  3AZN A;  3C1C B;  1AOI B;  5GXQ C;  4H9O B;  4CAY A;  3X1T C;  2F8N B;  2F8N D;  5B1M C;  5BNV B;  5B31 D;  5B33 C;  3AV2 C;  5BT1 D;  2ZY5 A;  4H9R B;  4WZS B;  3LZ1 A;  4J8X A;  4WNN B;  1TZY B;  3KUY D;  4XZQ D;  3AZJ D;  2IO5 B;  1P3M C;  3VH5 A;  3WA9 A;  2BYK A;  4YM6 D;  4JJN D;  4X23 A;  3WTP A;  1P3L A;  4ZUX A;  3AZG B;  4YS3 D;  1M1A A;  2YFW A;  3FDD A;  3UTA B;  5AV6 C;  3AZG A;  5B0Y A;  1ID3 A;  3WA9 D;  3C1B C;  3A6N A;  4WU8 D;  3WKJ C;  2F8N K;  1P3O C;  5C3I B;  4Z5T C;  1P3L B;  1P3O D;  4KGC B;  3MGQ B;  1P3B B;  4Z66 A;  1P3I C;  1U35 A;  3W98 D;  1P3L D;  4J8V C;  5AV6 A;  3AZG C;  4XZQ B;  5AV6 D;  3V9R A;  1HQ3 A;  2HIO B;  5AV5 B;  1P3K D;  4AWL B;  3AZN D;  2CV5 A;  5B31 G;  1TZY A;  4HGA C;  3AYW D;  3NQJ A;  1S32 B;  1P3F B;  3LZ0 C;  3AZM B;  4WU9 A;  3AN2 C;  1P3P A;  3KXB D;  1BH9 A;  3KUY C;  1P3G A;  3KSY A;  4WU9 B;  5B0Y D;  5AVC A;  5CPJ C;  1M18 A;  2NZD B;  3UTA A;  2FJ7 B;  3KXB B;  1JFI B;  4J8W B;  1P3A D;  1P3M A;  1AOI C;  3UTA D;  2BG1 A;  4YM6 A;  4JJN A;  3WTP D;  3AZF B;  4E45 A;  3O62 B;  3WTP C;  3W97 B;  3KWQ A;  4G92 B;  1P34 C;  3W96 B;  5AV9 B;  5B32 A;  5E5A D;  5B1L C;  3REH A;  5CPI B;  2G5I C;  5GT0 C;  1Q9C A;  4H9S A;  5AVC C;  5CPJ A;  1M18 C;  3AZK C;  2JCH A;  5CPJ D;  3REH B;  5CPI A;  5B31 A;  3REK A;  5BNX B;  1KX3 A;  3B0D C;  3B0D B;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...