1Q9CA

Crystal structure of the histone domain of son of sevenless
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
164
Chain Sequence
LPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIESLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Son of sevenless protein
publication title Tandem Histone Folds in the Structure of the N-terminal Segment of the Ras Activator Son of Sevenless
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 164
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1q9cA01
2BYKA 5BO0A 3AN2A 1KU5A 3REIC 1AOIB 3REJB 3C1CC 4Z5TA 5B32C 1P3MA 1JFIB 2YFVA 3AZMA 3X1TC 3AZND 3MGPB 2FJ7C 3W97D 3W96D 2NZDB 5B1MC 3RELA 5B0YC 3B6FA 3B0CT 3LJAC 3X1VC 3B0DB 1BH8B 4Z2MH 3NQUA 2NQBD 4CSRB 4H9SC 3W98B 2JSSA 3MGQC 5B1LD 1ID3A 1P34A 3KUYB 3R45B 4J8XD 2YFWB 1H3OB 3W96C 3W97C 3AZNC 3REIA 5AVCB 3AV1C 3C1CA 3WAAB 4KHAA 3X1TA 3AV2B 5CPKB 2FJ7A 5GT3D 5B1MA 5B0YA 4ZUXB 3LJAA 3X1VA 4UUZB 5B1LC 1P3BB 3AZHD 3MVDB 3AZKD 5AY8D 4J8XC 4H9SA 1M19C 3MGQA 4XZQB 1WWSA 4H9NA 5F99D 4G92B 5AVBB 3W96A 3W97A 4J8WD 3AZNA 5GSUB 3REHC 5B40C 5B2ID 4YS3B 3V9RB 5C3IB 3AZHC 1TAFA 5DNNB 3AZKC 5AY8C 5AV6D 4E44A 5B1LA 5BNXB 3LZ0B 4J8XA 5F99C 3AZID 4J8WC 1A7WA 5AV8B 5B2IC 3AZED 3MNND 3LELD 5GT3A 4WNNA 5AV6C 1M1AB 5AV9D 3AZHA 3AZKA 4G91C 5AY8A 4KUDB 3B6GB 3AZIC 5E5AD 4LD9D 4KGCB 3UTAB 3VH5W 3C1BD 1P3OD 2AROC 3WKJD 5FUGB 5F99A 5GT0C 3AZEC 3MNNC 3W99B 5B2JD 3LELC 4J8WA 4QLCD 1HQ3C 4JJNB 1F66B 5B2IA 5B0ZB 1ZLAB 3KSYA 5AV9C 4HGAC 1P3IB 5AV6A 1AOID 1BH9A 3REJD 5E5AC 2NZDD 3MGPD 3NQJA 3AZIA 3AFAB 5B2JC 4WV4B 2AROA 3AZEA 3MNNA 3LZ1B 3LELA 1TZYB 3W98D 4Z66B 3KUYD 5CP6C 1AOIC 4NE5A 5AV9A 3UTBB 2NZDC 3MGPC 3WA9B 5CPJB 5AVCD 3WAAD 5E5AA 4LD9A 3B0DC 3AV2D 5CPKD 1P3OA 4Z5TC 4XUJB 4ZUXD 5B2JA 1F1EA 4QLCA 3W98C 3MGRB 1P3BD 5GXQB 4H9QB 3B0CW 3MVDD 1P3KB 1Q9CA 4XZQD 2PYOB 5CP6A 1EQZB 1AOIA 5AVCC 3WAAC 5AVBD 3AZGB 1JFIA 1KX4B 2NZDA 3AV2C 3MGPA 2HIOB 5CPKC 3AZLD 4WU9B 5GSUD 2LY8A 3KWQC 4YS3D 1BH8A 1P3BC 5DNND 4R8PB 3MVDC 4CSRA 3W98A 4H9PB 4XZQC 3TU4B 1M18B 3LZ0D 3R45A 3A6NB 4G92C 1H3OA 5AV5B 2F8NB 5B33B 3AZLC 5CPIB 3VH6T 5AV8D 5AVCA 3WAAA 1P3GB 4YS3C 3AV2A 5CPKA 5C3IC 5DNNC 4H9OA 3VH5A 4ZBJC 4ZUXA 3KWQA 2HUEB 4UUZA 1P3BA 4YM6B 1M1AD 4AWLC 3MVDA 3LZ0C 4KUDD 2L5AA 3B6GD 1HTAA 2NQBC 4XZQA 4NFTA 4KGCD 3UTAD 5B24B 1N1JB 3W99D 5AVBA 3AZLA 4JJND 5GSUA 1F66D 1P3LB 4DRBA 5B0ZD 4YS3A 1ZLAD 3V9RA 1M1AC 5BT1D 4J8UB 5DNNA 1S32B 1P3ID 4KUDC 5GT3C 3B6GC 5BNXA 4KGCC 3UTAC 3LZ0A 3WTPB 2NQBA 3W99C 3AFAD 4NE6A 1P3AB 1P3FB 4JJNC 1F66C 5B32B 4KHAB 3LZ1D 2CV5B 1ZLAC 1TZYD 5DNMB 5BT1C 4WU8B 4Z66D 5B31B 1ULYA 1P3IC 1M1AA 3UTBD 1KX5B 4KUDA 3WA9D 5CPJD 3B6GA 3AFAC 4KGCA 3UTAA 5FUGA 4XUJD 3W99A 3LZ1C 3AZJB 3MGRD 3AV1B 3B0BA 4JJNA 4Z66C 1F66A 5GXQD 1P3KD 1ZLAA 2PYOD 1P3IA 3WA9C 1EQZD 3AZGD 2F8NK 1KX4D 1M19B 2HIOD 4WU9D 3REKB 4XUJC 5BNVB 3AFAA 5CHLB 3MGRC 3AYWB 4LD9C 5GXQC 4R8PD 3C1BC 1P3OC 5BS7C 3LZ1A 1P3KC 3WKJC 1TZYA 3X1SB 5B40B 3REHB 4WNNB 4Z66A 4QLCC 3TU4D 1M18D 4NE3A 1P3PB 4X23B 3O62B 1EQZC 1KX3B 3A6ND 5AV5D 1KX4C 2F8ND 2HIOC 5B33D 4WU9C 4H9RB 5CPID 3WA9A 1P3GD 2F8NG 3REJC 4CAYA 5G49B 4XUJA 3X1UB 3MGRA 4YM6D 3TU4C 5GXQA 4H9QA 2BYMB 3C1BA 5BS7A 1P3KA 3WKJA 3A6NC 2PYOA 5AV5C 5B24D 5CPIC 1EQZA 5JRGB 3KUYC 1KX4A 2HIOA 4WU9A 3MGSB 1P3LD 2AROB 3REJA 3VH6W 5GT0B 4YM6C 4J8UD 1S32D 1HQ3B 4H9PA 5JA4B 4ZUXC 3TU4A 5B24C 5AV9B 4HGAB 3WTPD 3A6NA 5KDMB 1P3AD 5AV5A 2F8NA 1P3FD 3UT9B 5CPIA 4DRAA 2RVQD 3KUYA 5B32D 1P3LC 3AZFB 4EO5B 2CV5D 2YFWA 5DNMD 5AVBC 5B32G 4WU8D 1S32C 5B31D 5GSUC 5B31G 4YM6A 4J8VB 1KX5D 2IO5B 3WTPC 1U35B 1P3AC 1B6WA 5CP6B 1P3FC 5B24A 3KXBB 2RVQC 1N1JA 1B67A 2BYKB 5BO0B 3AZJD 3AN2B 2CV5C 5DNMC 3AV1D 4WU8C 5B31C 1P3LA 4Z5TB 5AV8C 1P3MB 2YFVB 3AZMB 4J8UA 1S32A 3RELB 1KX5C 3B6FB 4Z2MG 3NQUB 1M19D 3REKD 3WTPA 1P3AA 3AZJC 1P34B 1P3FA 1ID3B 3AYWD 5B32A 1WWIA 2CV5A 4H9OB 3X1SD 4E45A 5B40D 5DNMA 4WU8A 3KWQB 3REHD 5B31A 3REIB 3C1CB 1P3PD 5AV8A 4X23D 3O62D 1KX3D 3X1TB 5B0ZC 2FJ7B 5B1MB 1KX5A 5B0YB 3REKC 3LJAB 3X1VB 3AYWC 3MGQB 3AZLB 3AZJA 3X1SC 3X1UD 3AV1A 4H9NB 1P3PC 4X23C 3O62C 1KX3C 3W97B 3W96B 3AZNB 4ZBJB 4M6BA 1TZYC 3VH6A 5JRGD 4AWLB 5B0ZA 1TAFB 1M19A 3UTBC 3REKA 2NQBB 3MGSD 5BNVA 5CPJC 5B1LB 2AROD 3X1UC 3AYWA 5GT0D 4J8XB 1HQ3D 2CWEA 3X1SA 5B40A 3REHA 1P3PA 5JRGC 4X23A 3O62A 1KX3A 5GT3B 3UT9D 4H9RA 2PYOC 3MGSC 3AZFD 3AZHB 3UTBA 5G49A 5AY8B 3AZGC 3AZKB 2F8NH 5CPJA 3X1UA 4WZSB 4J8VD 2BYMA 5F99B 4R8PC 1U35D 4J8WB 5CP6D 3UT9C 5B2IB 3KXBD 5JRGA 1M18C 3AZFC 4EO5C 3AN2D 3VH5T 3MGSA 5AV6B 5B33C 1BH9B 4Z5TD 1P3MD 3AZMD 5GT0A 1P3GC 4J8VC 4G91B 3AZGA 3NQJB 3RELD 1HQ3A 3AZIB 2IO5C 3B6FD 1U35C 5JA4A 2HUEC 1BFMA 3KXBC 3AZEB 3MNNB 4R8PA 3LELB 5KDMA 1ID3D 1P34D 3AN2C 3UT9A 1M18A 3AZFA 4CAYB 1P3MC 3AZMC 3KWQD 3RELC 5B33A 3REID 3C1CD 3B6FC 5E5AB 4LD9B 3X1TD 3C1BB 1P3GA 3WTPE 4J8VA 1P3OB 2FJ7D 3WKJB 5B1MD 5B0YD 4J8UC 5B2JB 1U35A 4QLCB 3LJAD 3X1VD 1R4VA 1ID3C 1P34C 3KXBA 3MGQD
chains in the Genus database with same CATH superfamily
2BYKA 5BO0A 3AN2A 1KU5A 2FFFB 3REIC 1AOIB 3REJB 3C1CC 4Z5TA 5B32C 1P3MA 1JFIB 2YFVA 3AZMA 3X1TC 3AZND 3MGPB 2FJ7C 2XD5A 3W97D 3W96D 2NZDB 5B1MC 3RELA 5B0YC 3B6FA 2ZY3A 3B0CT 3LJAC 3X1VC 3B0DB 1BH8B 4Z2MH 3NQUA 2NQBD 4CSRB 4H9SC 3W98B 2JSSA 3MGQC 5B1LD 1ID3A 1P34A 3KUYB 3R45B 4J8XD 2YFWB 1H3OB 3A1KA 1W2EA 3W96C 3W97C 3AZNC 2Y2QA 3REIA 5AVCB 3AV1C 3C1CA 3WAAB 4KHAA 3X1TA 3AV2B 5CPKB 2FJ7A 5GT3D 5B1MA 5B0YA 4ZUXB 2J8PA 3LJAA 3X1VA 4UUZB 5B1LC 1P3BB 3AZHD 3MVDB 3AZKD 5AY8D 3EPJA 4J8XC 4H9SA 1M19C 3MGQA 4XZQB 1WWSA 2BG1A 3H0RC 4H9NA 5F99D 4G92B 5AVBB 3W96A 3W97A 4J8WD 3AZNA 5GSUB 3REHC 5B40C 5B2ID 2XD1A 4YS3B 3V9RB 5C3IB 3AZHC 1TAFA 5DNNB 3AZKC 5AY8C 5AV6D 4E44A 5B1LA 2UWXA 5BNXB 3LZ0B 4J8XA 5F99C 3AZID 4J8WC 1A7WA 5AV8B 5B2IC 3AZED 3MNND 3LELD 5GT3A 4WJ3C 4WNNA 5AV6C 1M1AB 5AV9D 3AZHA 3AZKA 4G91C 5AY8A 3EPLA 3B6GB 4KUDB 3AZIC 5E5AD 4LD9D 4KGCB 3EG5B 2Y2IA 3VH5W 3C1BD 3UTAB 1P3OD 2AROC 3WKJD 5FUGB 5F99A 5GT0C 3AZEC 3MNNC 3W99B 5B2JD 3LELC 3FDDA 4QLCD 1HQ3C 4J8WA 4JJNB 1F66B 5B2IA 5B0ZB 1ZLAB 3KSYA 5AV9C 4HGAC 1P3IB 5AV6A 1AOID 1BH9A 3REJD 5E5AC 2NZDD 3MGPD 3NQJA 3AZIA 3AFAB 5B2JC 4WV4B 4DQYB 2AROA 3AZEA 3MNNA 3LZ1B 3LELA 1TZYB 3W98D 4Z66B 3KUYD 5CP6C 1AOIC 4NE5A 5AV9A 3UTBB 2NZDC 3MGPC 3WA9B 5CPJB 5AVCD 3WAAD 5E5AA 4LD9A 3B0DC 3AV2D 5CPKD 1P3OA 4Z5TC 4XUJB 4ZUXD 5B2JA 1F1EA 4QLCA 3W98C 3MGRB 1P3BD 5GXQB 2ZY4A 3B0CW 4H9QB 3MVDD 1P3KB 1T3UA 1Q9CA 4XZQD 2PYOB 5CP6A 1EQZB 1AOIA 5AVCC 3WAAC 2Y2NA 5AVBD 3AZGB 1JFIA 1KX4B 2NZDA 3AV2C 3MGPA 2HIOB 5CPKC 3AZLD 4WU9B 2Y2GA 5GSUD 2LY8A 3KWQC 4YS3D 1BH8A 1P3BC 5DNND 4R8PB 3MVDC 4CSRA 3W98A 4H9PB 4XZQC 3TU4B 1M18B 3LZ0D 3R45A 1PZRA 3A6NB 4G92C 1H3OA 5AV5B 2F8NB 2DF4C 5B33B 3AZLC 5CPIB 3VH6T 5AV8D 5AVCA 3WAAA 4UPKA 1P3GB 4YS3C 3AV2A 5CPKA 5C3IC 5DNNC 4H9OA 3VH5A 4ZBJC 4ZUXA 3KWQA 2HUEB 4UUZA 1P3BA 4YM6B 1M1AD 4AWLC 3MVDA 3LZ0C 2Y2KA 4KUDD 2L5AA 3B6GD 1HTAA 2NQBC 4XZQA 4NFTA 4KGCD 3UTAD 5B24B 1N1JB 3W99D 5AVBA 3AZLA 4JJND 5GSUA 1F66D 1P3LB 4DRBA 5B0ZD 4YS3A 1ZLAD 3V9RA 1M1AC 5BT1D 4J8UB 5DNNA 1S32B 1P3ID 4KUDC 5GT3C 3B6GC 5BNXA 4KGCC 3UTAC 3LZ0A 3WTPB 2NQBA 1Z2CB 3W99C 3AFAD 4NE6A 1P3AB 1P3FB 2F2AC 4JJNC 1F66C 5B32B 4KHAB 3LZ1D 2CV5B 1ZLAC 1TZYD 5DNMB 5BT1C 4WU8B 3H0MC 4Z66D 5B31B 1ULYA 1P3IC 2JE5A 1M1AA 3UTBD 2G5IC 1KX5B 4KUDA 2Y2LA 3WA9D 5CPJD 3B6GA 3AFAC 4KGCA 3UTAA 5FUGA 4XUJD 3A1IA 3W99A 3LZ1C 3AZJB 3MGRD 3AV1B 3B0BA 4JJNA 4Z66C 1F66A 5GXQD 1P3KD 1ZLAA 2PYOD 1P3IA 3WA9C 1EQZD 3AZGD 2F8NK 1KX4D 1M19B 2HIOD 4WU9D 3REKB 4XUJC 5BNVB 3AFAA 5CHLB 3MGRC 3AYWB 4LD9C 5GXQC 4R8PD 3C1BC 1P3OC 5BS7C 3LZ1A 1P3KC 3WKJC 1TZYA 3X1SB 2ZM5A 5B40B 3REHB 2G5HC 4WNNB 4Z66A 4QLCC 3TU4D 1M18D 4NE3A 2RIQA 4X23B 3O62B 1P3PB 1EQZC 1KX3B 3A6ND 2Y2OA 5AV5D 1KX4C 2F8ND 2HIOC 5B33D 4WU9C 4H9RB 5CPID 3WA9A 1P3GD 2F8NG 3REJC 4CAYA 5G49B 4XUJA 3X1UB 3MGRA 4YM6D 3TU4C 5GXQA 4H9QA 2BYMB 3C1BA 5BS7A 1P3KA 3WKJA 3A6NC 2PYOA 5AV5C 5B24D 5CPIC 2DQNC 1EQZA 5JRGB 3KUYC 1KX4A 2HIOA 4WU9A 3MGSB 1P3LD 2AROB 3REJA 3VH6W 5GT0B 4YM6C 4J8UD 1S32D 1HQ3B 4H9PA 5JA4B 4ZUXC 3TU4A 5B24C 5AV9B 4HGAB 3AL0C 3WTPD 3A6NA 5KDMB 1P3AD 5AV5A 2F8NA 1P3FD 3UT9B 5CPIA 4DRAA 2RVQD 3KUYA 5B32D 1P3LC 3AZFB 4EO5B 2CV5D 2YFWA 5DNMD 5AVBC 5B32G 4WU8D 1S32C 5B31D 5GSUC 5B31G 4YM6A 4J8VB 1KX5D 2IO5B 3WTPC 1U35B 1P3AC 1B6WA 5CP6B 1P3FC 5B24A 3KXBB 2RVQC 1N1JA 1B67A 2ZY2A 2BYKB 5BO0B 3AZJD 3AN2B 2CV5C 5DNMC 3AV1D 4WU8C 5B31C 1P3LA 4Z5TB 5AV8C 1P3MB 2YFVB 3AZMB 4J8UA 1S32A 3RELB 1KX5C 3B6FB 4Z2MG 3NQUB 1M19D 3REKD 3IP4C 3WTPA 2VQRA 3F6TA 2W8SA 1P3AA 3AZJC 1P34B 1P3FA 1ID3B 3AYWD 5B32A 1WWIA 2CV5A 4H9OB 3X1SD 4E45A 5B40D 5DNMA 4WU8A 3KWQB 3REHD 5B31A 3REIB 3C1CB 1P3PD 5AV8A 4X23D 3O62D 1KX3D 3X1TB 5B0ZC 2FJ7B 5B1MB 1KX5A 5B0YB 3REKC 2Y2JA 3LJAB 3X1VB 3KFUG 3AYWC 3MGQB 3AZLB 3AZJA 3X1SC 3X1UD 2ZY5A 3AV1A 4H9NB 1P3PC 4X23C 3O62C 1KX3C 3W97B 3W96B 3AZNB 4ZBJB 2JCHA 4M6BA 1TZYC 3P5JB 3VH6A 5JRGD 4AWLB 5B0ZA 1TAFB 1M19A 3EPHA 3UTBC 3REKA 2NQBB 3MGSD 5BNVA 5CPJC 5B1LB 2AROD 3X1UC 3AYWA 5GT0D 4J8XB 1HQ3D 2CWEA 3X1SA 5B40A 3REHA 1P3PA 5JRGC 4X23A 3O62A 1KX3A 5GT3B 3UT9D 4H9RA 2PYOC 3MGSC 3AZFD 3AZHB 3UTBA 5G49A 5AY8B 3H0LC 3AZGC 3AZKB 2F8NH 5CPJA 3X1UA 4WZSB 4J8VD 2BYMA 5F99B 2Y2HA 4R8PC 1U35D 4J8WB 5CP6D 3UT9C 5B2IB 3KXBD 5JRGA 1M18C 3AZFC 4EO5C 3AN2D 3VH5T 3MGSA 5AV6B 5B33C 1BH9B 4Z5TD 2Y2PA 1P3MD 3AZMD 5GT0A 1P3GC 4J8VC 4G91B 3AZGA 3NQJB 3RELD 1HQ3A 3AZIB 2IO5C 3B6FD 1U35C 5JA4A 2HUEC 1BFMA 3KXBC 3AZEB 3MNNB 4R8PA 3LELB 5KDMA 1ID3D 1P34D 3AN2C 3UT9A 1M18A 3AZFA 4CAYB 1P3MC 3AZMC 3KWQD 3RELC 5B33A 3REID 2Y2MA 3C1CD 3B6FC 5E5AB 4LD9B 3X1TD 3C1BB 1P3GA 3WTPE 4J8VA 1P3OB 2FJ7D 3WKJB 5B1MD 5B0YD 3EPKA 4J8UC 5B2JB 1U35A 4QLCB 3LJAD 3X1VD 1R4VA 1ID3C 1P34C 3KXBA 3MGQD
chains in the Genus database with same CATH topology
2BYKA 5BO0A 3AN2A 1KU5A 2FFFB 3REIC 1AOIB 3REJB 3C1CC 4Z5TA 5B32C 1P3MA 1JFIB 2YFVA 3AZMA 3X1TC 3AZND 3MGPB 2FJ7C 2XD5A 3W97D 3W96D 2NZDB 5B1MC 3RELA 5B0YC 3B6FA 2ZY3A 3B0CT 3LJAC 3X1VC 3B0DB 1BH8B 4Z2MH 3NQUA 2NQBD 4CSRB 4H9SC 3W98B 2JSSA 3MGQC 5B1LD 1ID3A 1P34A 3KUYB 3R45B 4J8XD 2YFWB 1H3OB 3A1KA 1W2EA 3W96C 3W97C 3AZNC 2Y2QA 3REIA 5AVCB 3AV1C 3C1CA 3WAAB 4KHAA 3X1TA 3AV2B 5CPKB 2FJ7A 5GT3D 5B1MA 5B0YA 4ZUXB 2J8PA 3LJAA 3X1VA 4UUZB 5B1LC 1P3BB 3AZHD 3MVDB 3AZKD 5AY8D 3EPJA 4J8XC 4H9SA 1M19C 3MGQA 4XZQB 1WWSA 2BG1A 3H0RC 4H9NA 5F99D 4G92B 5AVBB 3W96A 3W97A 4J8WD 3AZNA 5GSUB 3REHC 5B40C 5B2ID 2XD1A 4YS3B 3V9RB 5C3IB 3AZHC 1TAFA 5DNNB 3AZKC 5AY8C 5AV6D 4E44A 5B1LA 2UWXA 5BNXB 3LZ0B 4J8XA 5F99C 3AZID 4J8WC 1A7WA 5AV8B 5B2IC 3AZED 3MNND 3LELD 5GT3A 4WJ3C 4WNNA 5AV6C 1M1AB 5AV9D 3AZHA 3AZKA 4G91C 5AY8A 3EPLA 3B6GB 4KUDB 3AZIC 5E5AD 4LD9D 4KGCB 3EG5B 2Y2IA 3VH5W 3C1BD 3UTAB 1P3OD 2AROC 3WKJD 5FUGB 5F99A 5GT0C 3AZEC 3MNNC 3W99B 5B2JD 3LELC 3FDDA 4QLCD 1HQ3C 4J8WA 4JJNB 1F66B 5B2IA 5B0ZB 1ZLAB 3KSYA 5AV9C 4HGAC 1P3IB 5AV6A 1AOID 1BH9A 3REJD 5E5AC 2NZDD 3MGPD 3NQJA 3AZIA 3AFAB 5B2JC 4WV4B 4DQYB 2AROA 3AZEA 3MNNA 3LZ1B 3LELA 1TZYB 3W98D 4Z66B 3KUYD 5CP6C 1AOIC 4NE5A 5AV9A 3UTBB 2NZDC 3MGPC 3WA9B 5CPJB 5AVCD 3WAAD 5E5AA 4LD9A 3B0DC 3AV2D 5CPKD 1P3OA 4Z5TC 4XUJB 4ZUXD 5B2JA 1F1EA 4QLCA 3W98C 3MGRB 1P3BD 5GXQB 2ZY4A 3B0CW 4H9QB 3MVDD 1P3KB 1T3UA 1Q9CA 4XZQD 2PYOB 5CP6A 1EQZB 1AOIA 5AVCC 3WAAC 2Y2NA 5AVBD 3AZGB 1JFIA 1KX4B 2NZDA 3AV2C 3MGPA 2HIOB 5CPKC 3AZLD 4WU9B 2Y2GA 5GSUD 2LY8A 3KWQC 4YS3D 1BH8A 1P3BC 5DNND 4R8PB 3MVDC 4CSRA 3W98A 4H9PB 4XZQC 3TU4B 1M18B 3LZ0D 3R45A 1PZRA 3A6NB 4G92C 1H3OA 5AV5B 2F8NB 2DF4C 5B33B 3AZLC 5CPIB 3VH6T 5AV8D 5AVCA 3WAAA 4UPKA 1P3GB 4YS3C 3AV2A 5CPKA 5C3IC 5DNNC 4H9OA 3VH5A 4ZBJC 4ZUXA 3KWQA 2HUEB 4UUZA 1P3BA 4YM6B 1M1AD 4AWLC 3MVDA 3LZ0C 2Y2KA 4KUDD 2L5AA 3B6GD 1HTAA 2NQBC 4XZQA 4NFTA 4KGCD 3UTAD 5B24B 1N1JB 3W99D 5AVBA 3AZLA 4JJND 5GSUA 1F66D 1P3LB 4DRBA 5B0ZD 4YS3A 1ZLAD 3V9RA 1M1AC 5BT1D 4J8UB 5DNNA 1S32B 1P3ID 4KUDC 5GT3C 3B6GC 5BNXA 4KGCC 3UTAC 3LZ0A 3WTPB 2NQBA 1Z2CB 3W99C 3AFAD 4NE6A 1P3AB 1P3FB 2F2AC 4JJNC 1F66C 5B32B 4KHAB 3LZ1D 2CV5B 1ZLAC 1TZYD 5DNMB 5BT1C 4WU8B 3H0MC 4Z66D 5B31B 1ULYA 1P3IC 2JE5A 1M1AA 3UTBD 2G5IC 1KX5B 4KUDA 2Y2LA 3WA9D 5CPJD 3B6GA 3AFAC 4KGCA 3UTAA 5FUGA 4XUJD 3A1IA 3W99A 3LZ1C 3AZJB 3MGRD 3AV1B 3B0BA 4JJNA 4Z66C 1F66A 5GXQD 1P3KD 1ZLAA 2PYOD 1P3IA 3WA9C 1EQZD 3AZGD 2F8NK 1KX4D 1M19B 2HIOD 4WU9D 3REKB 4XUJC 5BNVB 3AFAA 5CHLB 3MGRC 3AYWB 4LD9C 5GXQC 4R8PD 3C1BC 1P3OC 5BS7C 3LZ1A 1P3KC 3WKJC 1TZYA 3X1SB 2ZM5A 5B40B 3REHB 2G5HC 4WNNB 4Z66A 4QLCC 3TU4D 1M18D 4NE3A 2RIQA 4X23B 3O62B 1P3PB 1EQZC 1KX3B 3A6ND 2Y2OA 5AV5D 1KX4C 2F8ND 2HIOC 5B33D 4WU9C 4H9RB 5CPID 3WA9A 1P3GD 2F8NG 3REJC 4CAYA 5G49B 4XUJA 3X1UB 3MGRA 4YM6D 3TU4C 5GXQA 4H9QA 2BYMB 3C1BA 5BS7A 1P3KA 3WKJA 3A6NC 2PYOA 5AV5C 5B24D 5CPIC 2DQNC 1EQZA 5JRGB 3KUYC 1KX4A 2HIOA 4WU9A 3MGSB 1P3LD 2AROB 3REJA 3VH6W 5GT0B 4YM6C 4J8UD 1S32D 1HQ3B 4H9PA 5JA4B 4ZUXC 3TU4A 5B24C 5AV9B 4HGAB 3AL0C 3WTPD 3A6NA 5KDMB 1P3AD 5AV5A 2F8NA 1P3FD 3UT9B 5CPIA 4DRAA 2RVQD 3KUYA 5B32D 1P3LC 3AZFB 4EO5B 2CV5D 2YFWA 5DNMD 5AVBC 5B32G 4WU8D 1S32C 5B31D 5GSUC 5B31G 4YM6A 4J8VB 1KX5D 2IO5B 3WTPC 1U35B 1P3AC 1B6WA 5CP6B 1P3FC 5B24A 3KXBB 2RVQC 1N1JA 1B67A 2ZY2A 2BYKB 5BO0B 3AZJD 3AN2B 2CV5C 5DNMC 3AV1D 4WU8C 5B31C 1P3LA 4Z5TB 5AV8C 1P3MB 2YFVB 3AZMB 4J8UA 1S32A 3RELB 1KX5C 3B6FB 4Z2MG 3NQUB 1M19D 3REKD 3IP4C 3WTPA 2VQRA 3F6TA 2W8SA 1P3AA 3AZJC 1P34B 1P3FA 1ID3B 3AYWD 5B32A 1WWIA 2CV5A 4H9OB 3X1SD 4E45A 5B40D 5DNMA 4WU8A 3KWQB 3REHD 5B31A 3REIB 3C1CB 1P3PD 5AV8A 4X23D 3O62D 1KX3D 3X1TB 5B0ZC 2FJ7B 5B1MB 1KX5A 5B0YB 3REKC 2Y2JA 3LJAB 3X1VB 3KFUG 3AYWC 3MGQB 3AZLB 3AZJA 3X1SC 3X1UD 2ZY5A 3AV1A 4H9NB 1P3PC 4X23C 3O62C 1KX3C 3W97B 3W96B 3AZNB 4ZBJB 2JCHA 4M6BA 1TZYC 3P5JB 3VH6A 5JRGD 4AWLB 5B0ZA 1TAFB 1M19A 3EPHA 3UTBC 3REKA 2NQBB 3MGSD 5BNVA 5CPJC 5B1LB 2AROD 3X1UC 3AYWA 5GT0D 4J8XB 1HQ3D 2CWEA 3X1SA 5B40A 3REHA 1P3PA 5JRGC 4X23A 3O62A 1KX3A 5GT3B 3UT9D 4H9RA 2PYOC 3MGSC 3AZFD 3AZHB 3UTBA 5G49A 5AY8B 3H0LC 3AZGC 3AZKB 2F8NH 5CPJA 3X1UA 4WZSB 4J8VD 2BYMA 5F99B 2Y2HA 4R8PC 1U35D 4J8WB 5CP6D 3UT9C 5B2IB 3KXBD 5JRGA 1M18C 3AZFC 4EO5C 3AN2D 3VH5T 3MGSA 5AV6B 5B33C 1BH9B 4Z5TD 2Y2PA 1P3MD 3AZMD 5GT0A 1P3GC 4J8VC 4G91B 3AZGA 3NQJB 3RELD 1HQ3A 3AZIB 2IO5C 3B6FD 1U35C 5JA4A 2HUEC 1BFMA 3KXBC 3AZEB 3MNNB 4R8PA 3LELB 5KDMA 1ID3D 1P34D 3AN2C 3UT9A 1M18A 3AZFA 4CAYB 1P3MC 3AZMC 3KWQD 3RELC 5B33A 3REID 2Y2MA 3C1CD 3B6FC 5E5AB 4LD9B 3X1TD 3C1BB 1P3GA 3WTPE 4J8VA 1P3OB 2FJ7D 3WKJB 5B1MD 5B0YD 3EPKA 4J8UC 5B2JB 1U35A 4QLCB 3LJAD 3X1VD 1R4VA 1ID3C 1P34C 3KXBA 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK A;  5BO0 A;  3AN2 A;  1KU5 A;  3REI C;  1AOI B;  3REJ B;  3C1C C;  4Z5T A;  5B32 C;  1P3M A;  1JFI B;  2YFV A;  3AZM A;  3X1T C;  3AZN D;  3MGP B;  2FJ7 C;  3W97 D;  3W96 D;  2NZD B;  5B1M C;  3REL A;  5B0Y C;  3B6F A;  3B0C T;  3LJA C;  3X1V C;  3B0D B;  1BH8 B;  4Z2M H;  3NQU A;  2NQB D;  4CSR B;  4H9S C;  3W98 B;  2JSS A;  3MGQ C;  5B1L D;  1ID3 A;  1P34 A;  3KUY B;  3R45 B;  4J8X D;  2YFW B;  1H3O B;  3W96 C;  3W97 C;  3AZN C;  3REI A;  5AVC B;  3AV1 C;  3C1C A;  3WAA B;  4KHA A;  3X1T A;  3AV2 B;  5CPK B;  2FJ7 A;  5GT3 D;  5B1M A;  5B0Y A;  4ZUX B;  3LJA A;  3X1V A;  4UUZ B;  5B1L C;  1P3B B;  3AZH D;  3MVD B;  3AZK D;  5AY8 D;  4J8X C;  4H9S A;  1M19 C;  3MGQ A;  4XZQ B;  1WWS A;  4H9N A;  5F99 D;  4G92 B;  5AVB B;  3W96 A;  3W97 A;  4J8W D;  3AZN A;  5GSU B;  3REH C;  5B40 C;  5B2I D;  4YS3 B;  3V9R B;  5C3I B;  3AZH C;  1TAF A;  5DNN B;  3AZK C;  5AY8 C;  5AV6 D;  4E44 A;  5B1L A;  5BNX B;  3LZ0 B;  4J8X A;  5F99 C;  3AZI D;  4J8W C;  1A7W A;  5AV8 B;  5B2I C;  3AZE D;  3MNN D;  3LEL D;  5GT3 A;  4WNN A;  5AV6 C;  1M1A B;  5AV9 D;  3AZH A;  3AZK A;  4G91 C;  5AY8 A;  4KUD B;  3B6G B;  3AZI C;  5E5A D;  4LD9 D;  4KGC B;  3UTA B;  3VH5 W;  3C1B D;  1P3O D;  2ARO C;  3WKJ D;  5FUG B;  5F99 A;  5GT0 C;  3AZE C;  3MNN C;  3W99 B;  5B2J D;  3LEL C;  4J8W A;  4QLC D;  1HQ3 C;  4JJN B;  1F66 B;  5B2I A;  5B0Z B;  1ZLA B;  3KSY A;  5AV9 C;  4HGA C;  1P3I B;  5AV6 A;  1AOI D;  1BH9 A;  3REJ D;  5E5A C;  2NZD D;  3MGP D;  3NQJ A;  3AZI A;  3AFA B;  5B2J C;  4WV4 B;  2ARO A;  3AZE A;  3MNN A;  3LZ1 B;  3LEL A;  1TZY B;  3W98 D;  4Z66 B;  3KUY D;  5CP6 C;  1AOI C;  4NE5 A;  5AV9 A;  3UTB B;  2NZD C;  3MGP C;  3WA9 B;  5CPJ B;  5AVC D;  3WAA D;  5E5A A;  4LD9 A;  3B0D C;  3AV2 D;  5CPK D;  1P3O A;  4Z5T C;  4XUJ B;  4ZUX D;  5B2J A;  1F1E A;  4QLC A;  3W98 C;  3MGR B;  1P3B D;  5GXQ B;  4H9Q B;  3B0C W;  3MVD D;  1P3K B;  1Q9C A;  4XZQ D;  2PYO B;  5CP6 A;  1EQZ B;  1AOI A;  5AVC C;  3WAA C;  5AVB D;  3AZG B;  1JFI A;  1KX4 B;  2NZD A;  3AV2 C;  3MGP A;  2HIO B;  5CPK C;  3AZL D;  4WU9 B;  5GSU D;  2LY8 A;  3KWQ C;  4YS3 D;  1BH8 A;  1P3B C;  5DNN D;  4R8P B;  3MVD C;  4CSR A;  3W98 A;  4H9P B;  4XZQ C;  3TU4 B;  1M18 B;  3LZ0 D;  3R45 A;  3A6N B;  4G92 C;  1H3O A;  5AV5 B;  2F8N B;  5B33 B;  3AZL C;  5CPI B;  3VH6 T;  5AV8 D;  5AVC A;  3WAA A;  1P3G B;  4YS3 C;  3AV2 A;  5CPK A;  5C3I C;  5DNN C;  4H9O A;  3VH5 A;  4ZBJ C;  4ZUX A;  3KWQ A;  2HUE B;  4UUZ A;  1P3B A;  4YM6 B;  1M1A D;  4AWL C;  3MVD A;  3LZ0 C;  4KUD D;  2L5A A;  3B6G D;  1HTA A;  2NQB C;  4XZQ A;  4NFT A;  4KGC D;  3UTA D;  5B24 B;  1N1J B;  3W99 D;  5AVB A;  3AZL A;  4JJN D;  5GSU A;  1F66 D;  1P3L B;  4DRB A;  5B0Z D;  4YS3 A;  1ZLA D;  3V9R A;  1M1A C;  5BT1 D;  4J8U B;  5DNN A;  1S32 B;  1P3I D;  4KUD C;  5GT3 C;  3B6G C;  5BNX A;  4KGC C;  3UTA C;  3LZ0 A;  3WTP B;  2NQB A;  3W99 C;  3AFA D;  4NE6 A;  1P3A B;  1P3F B;  4JJN C;  1F66 C;  5B32 B;  4KHA B;  3LZ1 D;  2CV5 B;  1ZLA C;  1TZY D;  5DNM B;  5BT1 C;  4WU8 B;  4Z66 D;  5B31 B;  1ULY A;  1P3I C;  1M1A A;  3UTB D;  1KX5 B;  4KUD A;  3WA9 D;  5CPJ D;  3B6G A;  3AFA C;  4KGC A;  3UTA A;  5FUG A;  4XUJ D;  3W99 A;  3LZ1 C;  3AZJ B;  3MGR D;  3AV1 B;  3B0B A;  4JJN A;  4Z66 C;  1F66 A;  5GXQ D;  1P3K D;  1ZLA A;  2PYO D;  1P3I A;  3WA9 C;  1EQZ D;  3AZG D;  2F8N K;  1KX4 D;  1M19 B;  2HIO D;  4WU9 D;  3REK B;  4XUJ C;  5BNV B;  3AFA A;  5CHL B;  3MGR C;  3AYW B;  4LD9 C;  5GXQ C;  4R8P D;  3C1B C;  1P3O C;  5BS7 C;  3LZ1 A;  1P3K C;  3WKJ C;  1TZY A;  3X1S B;  5B40 B;  3REH B;  4WNN B;  4Z66 A;  4QLC C;  3TU4 D;  1M18 D;  4NE3 A;  1P3P B;  4X23 B;  3O62 B;  1EQZ C;  1KX3 B;  3A6N D;  5AV5 D;  1KX4 C;  2F8N D;  2HIO C;  5B33 D;  4WU9 C;  4H9R B;  5CPI D;  3WA9 A;  1P3G D;  2F8N G;  3REJ C;  4CAY A;  5G49 B;  4XUJ A;  3X1U B;  3MGR A;  4YM6 D;  3TU4 C;  5GXQ A;  4H9Q A;  2BYM B;  3C1B A;  5BS7 A;  1P3K A;  3WKJ A;  3A6N C;  2PYO A;  5AV5 C;  5B24 D;  5CPI C;  1EQZ A;  5JRG B;  3KUY C;  1KX4 A;  2HIO A;  4WU9 A;  3MGS B;  1P3L D;  2ARO B;  3REJ A;  3VH6 W;  5GT0 B;  4YM6 C;  4J8U D;  1S32 D;  1HQ3 B;  4H9P A;  5JA4 B;  4ZUX C;  3TU4 A;  5B24 C;  5AV9 B;  4HGA B;  3WTP D;  3A6N A;  5KDM B;  1P3A D;  5AV5 A;  2F8N A;  1P3F D;  3UT9 B;  5CPI A;  4DRA A;  2RVQ D;  3KUY A;  5B32 D;  1P3L C;  3AZF B;  4EO5 B;  2CV5 D;  2YFW A;  5DNM D;  5AVB C;  5B32 G;  4WU8 D;  1S32 C;  5B31 D;  5GSU C;  5B31 G;  4YM6 A;  4J8V B;  1KX5 D;  2IO5 B;  3WTP C;  1U35 B;  1P3A C;  1B6W A;  5CP6 B;  1P3F C;  5B24 A;  3KXB B;  2RVQ C;  1N1J A;  1B67 A;  2BYK B;  5BO0 B;  3AZJ D;  3AN2 B;  2CV5 C;  5DNM C;  3AV1 D;  4WU8 C;  5B31 C;  1P3L A;  4Z5T B;  5AV8 C;  1P3M B;  2YFV B;  3AZM B;  4J8U A;  1S32 A;  3REL B;  1KX5 C;  3B6F B;  4Z2M G;  3NQU B;  1M19 D;  3REK D;  3WTP A;  1P3A A;  3AZJ C;  1P34 B;  1P3F A;  1ID3 B;  3AYW D;  5B32 A;  1WWI A;  2CV5 A;  4H9O B;  3X1S D;  4E45 A;  5B40 D;  5DNM A;  4WU8 A;  3KWQ B;  3REH D;  5B31 A;  3REI B;  3C1C B;  1P3P D;  5AV8 A;  4X23 D;  3O62 D;  1KX3 D;  3X1T B;  5B0Z C;  2FJ7 B;  5B1M B;  1KX5 A;  5B0Y B;  3REK C;  3LJA B;  3X1V B;  3AYW C;  3MGQ B;  3AZL B;  3AZJ A;  3X1S C;  3X1U D;  3AV1 A;  4H9N B;  1P3P C;  4X23 C;  3O62 C;  1KX3 C;  3W97 B;  3W96 B;  3AZN B;  4ZBJ B;  4M6B A;  1TZY C;  3VH6 A;  5JRG D;  4AWL B;  5B0Z A;  1TAF B;  1M19 A;  3UTB C;  3REK A;  2NQB B;  3MGS D;  5BNV A;  5CPJ C;  5B1L B;  2ARO D;  3X1U C;  3AYW A;  5GT0 D;  4J8X B;  1HQ3 D;  2CWE A;  3X1S A;  5B40 A;  3REH A;  1P3P A;  5JRG C;  4X23 A;  3O62 A;  1KX3 A;  5GT3 B;  3UT9 D;  4H9R A;  2PYO C;  3MGS C;  3AZF D;  3AZH B;  3UTB A;  5G49 A;  5AY8 B;  3AZG C;  3AZK B;  2F8N H;  5CPJ A;  3X1U A;  4WZS B;  4J8V D;  2BYM A;  5F99 B;  4R8P C;  1U35 D;  4J8W B;  5CP6 D;  3UT9 C;  5B2I B;  3KXB D;  5JRG A;  1M18 C;  3AZF C;  4EO5 C;  3AN2 D;  3VH5 T;  3MGS A;  5AV6 B;  5B33 C;  1BH9 B;  4Z5T D;  1P3M D;  3AZM D;  5GT0 A;  1P3G C;  4J8V C;  4G91 B;  3AZG A;  3NQJ B;  3REL D;  1HQ3 A;  3AZI B;  2IO5 C;  3B6F D;  1U35 C;  5JA4 A;  2HUE C;  1BFM A;  3KXB C;  3AZE B;  3MNN B;  4R8P A;  3LEL B;  5KDM A;  1ID3 D;  1P34 D;  3AN2 C;  3UT9 A;  1M18 A;  3AZF A;  4CAY B;  1P3M C;  3AZM C;  3KWQ D;  3REL C;  5B33 A;  3REI D;  3C1C D;  3B6F C;  5E5A B;  4LD9 B;  3X1T D;  3C1B B;  1P3G A;  3WTP E;  4J8V A;  1P3O B;  2FJ7 D;  3WKJ B;  5B1M D;  5B0Y D;  4J8U C;  5B2J B;  1U35 A;  4QLC B;  3LJA D;  3X1V D;  1R4V A;  1ID3 C;  1P34 C;  3KXB A;  3MGQ D; 
#chains in the Genus database with same CATH topology
 2BYK A;  5BO0 A;  3AN2 A;  1KU5 A;  2FFF B;  3REI C;  1AOI B;  3REJ B;  3C1C C;  4Z5T A;  5B32 C;  1P3M A;  1JFI B;  2YFV A;  3AZM A;  3X1T C;  3AZN D;  3MGP B;  2FJ7 C;  2XD5 A;  3W97 D;  3W96 D;  2NZD B;  5B1M C;  3REL A;  5B0Y C;  3B6F A;  2ZY3 A;  3B0C T;  3LJA C;  3X1V C;  3B0D B;  1BH8 B;  4Z2M H;  3NQU A;  2NQB D;  4CSR B;  4H9S C;  3W98 B;  2JSS A;  3MGQ C;  5B1L D;  1ID3 A;  1P34 A;  3KUY B;  3R45 B;  4J8X D;  2YFW B;  1H3O B;  3A1K A;  1W2E A;  3W96 C;  3W97 C;  3AZN C;  2Y2Q A;  3REI A;  5AVC B;  3AV1 C;  3C1C A;  3WAA B;  4KHA A;  3X1T A;  3AV2 B;  5CPK B;  2FJ7 A;  5GT3 D;  5B1M A;  5B0Y A;  4ZUX B;  2J8P A;  3LJA A;  3X1V A;  4UUZ B;  5B1L C;  1P3B B;  3AZH D;  3MVD B;  3AZK D;  5AY8 D;  3EPJ A;  4J8X C;  4H9S A;  1M19 C;  3MGQ A;  4XZQ B;  1WWS A;  2BG1 A;  3H0R C;  4H9N A;  5F99 D;  4G92 B;  5AVB B;  3W96 A;  3W97 A;  4J8W D;  3AZN A;  5GSU B;  3REH C;  5B40 C;  5B2I D;  2XD1 A;  4YS3 B;  3V9R B;  5C3I B;  3AZH C;  1TAF A;  5DNN B;  3AZK C;  5AY8 C;  5AV6 D;  4E44 A;  5B1L A;  2UWX A;  5BNX B;  3LZ0 B;  4J8X A;  5F99 C;  3AZI D;  4J8W C;  1A7W A;  5AV8 B;  5B2I C;  3AZE D;  3MNN D;  3LEL D;  5GT3 A;  4WJ3 C;  4WNN A;  5AV6 C;  1M1A B;  5AV9 D;  3AZH A;  3AZK A;  4G91 C;  5AY8 A;  3EPL A;  3B6G B;  4KUD B;  3AZI C;  5E5A D;  4LD9 D;  4KGC B;  3EG5 B;  2Y2I A;  3VH5 W;  3C1B D;  3UTA B;  1P3O D;  2ARO C;  3WKJ D;  5FUG B;  5F99 A;  5GT0 C;  3AZE C;  3MNN C;  3W99 B;  5B2J D;  3LEL C;  3FDD A;  4QLC D;  1HQ3 C;  4J8W A;  4JJN B;  1F66 B;  5B2I A;  5B0Z B;  1ZLA B;  3KSY A;  5AV9 C;  4HGA C;  1P3I B;  5AV6 A;  1AOI D;  1BH9 A;  3REJ D;  5E5A C;  2NZD D;  3MGP D;  3NQJ A;  3AZI A;  3AFA B;  5B2J C;  4WV4 B;  4DQY B;  2ARO A;  3AZE A;  3MNN A;  3LZ1 B;  3LEL A;  1TZY B;  3W98 D;  4Z66 B;  3KUY D;  5CP6 C;  1AOI C;  4NE5 A;  5AV9 A;  3UTB B;  2NZD C;  3MGP C;  3WA9 B;  5CPJ B;  5AVC D;  3WAA D;  5E5A A;  4LD9 A;  3B0D C;  3AV2 D;  5CPK D;  1P3O A;  4Z5T C;  4XUJ B;  4ZUX D;  5B2J A;  1F1E A;  4QLC A;  3W98 C;  3MGR B;  1P3B D;  5GXQ B;  2ZY4 A;  3B0C W;  4H9Q B;  3MVD D;  1P3K B;  1T3U A;  1Q9C A;  4XZQ D;  2PYO B;  5CP6 A;  1EQZ B;  1AOI A;  5AVC C;  3WAA C;  2Y2N A;  5AVB D;  3AZG B;  1JFI A;  1KX4 B;  2NZD A;  3AV2 C;  3MGP A;  2HIO B;  5CPK C;  3AZL D;  4WU9 B;  2Y2G A;  5GSU D;  2LY8 A;  3KWQ C;  4YS3 D;  1BH8 A;  1P3B C;  5DNN D;  4R8P B;  3MVD C;  4CSR A;  3W98 A;  4H9P B;  4XZQ C;  3TU4 B;  1M18 B;  3LZ0 D;  3R45 A;  1PZR A;  3A6N B;  4G92 C;  1H3O A;  5AV5 B;  2F8N B;  2DF4 C;  5B33 B;  3AZL C;  5CPI B;  3VH6 T;  5AV8 D;  5AVC A;  3WAA A;  4UPK A;  1P3G B;  4YS3 C;  3AV2 A;  5CPK A;  5C3I C;  5DNN C;  4H9O A;  3VH5 A;  4ZBJ C;  4ZUX A;  3KWQ A;  2HUE B;  4UUZ A;  1P3B A;  4YM6 B;  1M1A D;  4AWL C;  3MVD A;  3LZ0 C;  2Y2K A;  4KUD D;  2L5A A;  3B6G D;  1HTA A;  2NQB C;  4XZQ A;  4NFT A;  4KGC D;  3UTA D;  5B24 B;  1N1J B;  3W99 D;  5AVB A;  3AZL A;  4JJN D;  5GSU A;  1F66 D;  1P3L B;  4DRB A;  5B0Z D;  4YS3 A;  1ZLA D;  3V9R A;  1M1A C;  5BT1 D;  4J8U B;  5DNN A;  1S32 B;  1P3I D;  4KUD C;  5GT3 C;  3B6G C;  5BNX A;  4KGC C;  3UTA C;  3LZ0 A;  3WTP B;  2NQB A;  1Z2C B;  3W99 C;  3AFA D;  4NE6 A;  1P3A B;  1P3F B;  2F2A C;  4JJN C;  1F66 C;  5B32 B;  4KHA B;  3LZ1 D;  2CV5 B;  1ZLA C;  1TZY D;  5DNM B;  5BT1 C;  4WU8 B;  3H0M C;  4Z66 D;  5B31 B;  1ULY A;  1P3I C;  2JE5 A;  1M1A A;  3UTB D;  2G5I C;  1KX5 B;  4KUD A;  2Y2L A;  3WA9 D;  5CPJ D;  3B6G A;  3AFA C;  4KGC A;  3UTA A;  5FUG A;  4XUJ D;  3A1I A;  3W99 A;  3LZ1 C;  3AZJ B;  3MGR D;  3AV1 B;  3B0B A;  4JJN A;  4Z66 C;  1F66 A;  5GXQ D;  1P3K D;  1ZLA A;  2PYO D;  1P3I A;  3WA9 C;  1EQZ D;  3AZG D;  2F8N K;  1KX4 D;  1M19 B;  2HIO D;  4WU9 D;  3REK B;  4XUJ C;  5BNV B;  3AFA A;  5CHL B;  3MGR C;  3AYW B;  4LD9 C;  5GXQ C;  4R8P D;  3C1B C;  1P3O C;  5BS7 C;  3LZ1 A;  1P3K C;  3WKJ C;  1TZY A;  3X1S B;  2ZM5 A;  5B40 B;  3REH B;  2G5H C;  4WNN B;  4Z66 A;  4QLC C;  3TU4 D;  1M18 D;  4NE3 A;  2RIQ A;  4X23 B;  3O62 B;  1P3P B;  1EQZ C;  1KX3 B;  3A6N D;  2Y2O A;  5AV5 D;  1KX4 C;  2F8N D;  2HIO C;  5B33 D;  4WU9 C;  4H9R B;  5CPI D;  3WA9 A;  1P3G D;  2F8N G;  3REJ C;  4CAY A;  5G49 B;  4XUJ A;  3X1U B;  3MGR A;  4YM6 D;  3TU4 C;  5GXQ A;  4H9Q A;  2BYM B;  3C1B A;  5BS7 A;  1P3K A;  3WKJ A;  3A6N C;  2PYO A;  5AV5 C;  5B24 D;  5CPI C;  2DQN C;  1EQZ A;  5JRG B;  3KUY C;  1KX4 A;  2HIO A;  4WU9 A;  3MGS B;  1P3L D;  2ARO B;  3REJ A;  3VH6 W;  5GT0 B;  4YM6 C;  4J8U D;  1S32 D;  1HQ3 B;  4H9P A;  5JA4 B;  4ZUX C;  3TU4 A;  5B24 C;  5AV9 B;  4HGA B;  3AL0 C;  3WTP D;  3A6N A;  5KDM B;  1P3A D;  5AV5 A;  2F8N A;  1P3F D;  3UT9 B;  5CPI A;  4DRA A;  2RVQ D;  3KUY A;  5B32 D;  1P3L C;  3AZF B;  4EO5 B;  2CV5 D;  2YFW A;  5DNM D;  5AVB C;  5B32 G;  4WU8 D;  1S32 C;  5B31 D;  5GSU C;  5B31 G;  4YM6 A;  4J8V B;  1KX5 D;  2IO5 B;  3WTP C;  1U35 B;  1P3A C;  1B6W A;  5CP6 B;  1P3F C;  5B24 A;  3KXB B;  2RVQ C;  1N1J A;  1B67 A;  2ZY2 A;  2BYK B;  5BO0 B;  3AZJ D;  3AN2 B;  2CV5 C;  5DNM C;  3AV1 D;  4WU8 C;  5B31 C;  1P3L A;  4Z5T B;  5AV8 C;  1P3M B;  2YFV B;  3AZM B;  4J8U A;  1S32 A;  3REL B;  1KX5 C;  3B6F B;  4Z2M G;  3NQU B;  1M19 D;  3REK D;  3IP4 C;  3WTP A;  2VQR A;  3F6T A;  2W8S A;  1P3A A;  3AZJ C;  1P34 B;  1P3F A;  1ID3 B;  3AYW D;  5B32 A;  1WWI A;  2CV5 A;  4H9O B;  3X1S D;  4E45 A;  5B40 D;  5DNM A;  4WU8 A;  3KWQ B;  3REH D;  5B31 A;  3REI B;  3C1C B;  1P3P D;  5AV8 A;  4X23 D;  3O62 D;  1KX3 D;  3X1T B;  5B0Z C;  2FJ7 B;  5B1M B;  1KX5 A;  5B0Y B;  3REK C;  2Y2J A;  3LJA B;  3X1V B;  3KFU G;  3AYW C;  3MGQ B;  3AZL B;  3AZJ A;  3X1S C;  3X1U D;  2ZY5 A;  3AV1 A;  4H9N B;  1P3P C;  4X23 C;  3O62 C;  1KX3 C;  3W97 B;  3W96 B;  3AZN B;  4ZBJ B;  2JCH A;  4M6B A;  1TZY C;  3P5J B;  3VH6 A;  5JRG D;  4AWL B;  5B0Z A;  1TAF B;  1M19 A;  3EPH A;  3UTB C;  3REK A;  2NQB B;  3MGS D;  5BNV A;  5CPJ C;  5B1L B;  2ARO D;  3X1U C;  3AYW A;  5GT0 D;  4J8X B;  1HQ3 D;  2CWE A;  3X1S A;  5B40 A;  3REH A;  1P3P A;  5JRG C;  4X23 A;  3O62 A;  1KX3 A;  5GT3 B;  3UT9 D;  4H9R A;  2PYO C;  3MGS C;  3AZF D;  3AZH B;  3UTB A;  5G49 A;  5AY8 B;  3H0L C;  3AZG C;  3AZK B;  2F8N H;  5CPJ A;  3X1U A;  4WZS B;  4J8V D;  2BYM A;  5F99 B;  2Y2H A;  4R8P C;  1U35 D;  4J8W B;  5CP6 D;  3UT9 C;  5B2I B;  3KXB D;  5JRG A;  1M18 C;  3AZF C;  4EO5 C;  3AN2 D;  3VH5 T;  3MGS A;  5AV6 B;  5B33 C;  1BH9 B;  4Z5T D;  2Y2P A;  1P3M D;  3AZM D;  5GT0 A;  1P3G C;  4J8V C;  4G91 B;  3AZG A;  3NQJ B;  3REL D;  1HQ3 A;  3AZI B;  2IO5 C;  3B6F D;  1U35 C;  5JA4 A;  2HUE C;  1BFM A;  3KXB C;  3AZE B;  3MNN B;  4R8P A;  3LEL B;  5KDM A;  1ID3 D;  1P34 D;  3AN2 C;  3UT9 A;  1M18 A;  3AZF A;  4CAY B;  1P3M C;  3AZM C;  3KWQ D;  3REL C;  5B33 A;  3REI D;  2Y2M A;  3C1C D;  3B6F C;  5E5A B;  4LD9 B;  3X1T D;  3C1B B;  1P3G A;  3WTP E;  4J8V A;  1P3O B;  2FJ7 D;  3WKJ B;  5B1M D;  5B0Y D;  3EPK A;  4J8U C;  5B2J B;  1U35 A;  4QLC B;  3LJA D;  3X1V D;  1R4V A;  1ID3 C;  1P34 C;  3KXB A;  3MGQ D; 
#chains in the Genus database with same CATH homology
 2BYK A;  5BO0 A;  3AN2 A;  1KU5 A;  2FFF B;  3REI C;  1AOI B;  3REJ B;  3C1C C;  4Z5T A;  5B32 C;  1P3M A;  1JFI B;  2YFV A;  3AZM A;  3X1T C;  3AZN D;  3MGP B;  2FJ7 C;  2XD5 A;  3W97 D;  3W96 D;  2NZD B;  5B1M C;  3REL A;  5B0Y C;  3B6F A;  2ZY3 A;  3B0C T;  3LJA C;  3X1V C;  3B0D B;  1BH8 B;  4Z2M H;  3NQU A;  2NQB D;  4CSR B;  4H9S C;  3W98 B;  2JSS A;  3MGQ C;  5B1L D;  1ID3 A;  1P34 A;  3KUY B;  3R45 B;  4J8X D;  2YFW B;  1H3O B;  3A1K A;  1W2E A;  3W96 C;  3W97 C;  3AZN C;  2Y2Q A;  3REI A;  5AVC B;  3AV1 C;  3C1C A;  3WAA B;  4KHA A;  3X1T A;  3AV2 B;  5CPK B;  2FJ7 A;  5GT3 D;  5B1M A;  5B0Y A;  4ZUX B;  2J8P A;  3LJA A;  3X1V A;  4UUZ B;  5B1L C;  1P3B B;  3AZH D;  3MVD B;  3AZK D;  5AY8 D;  3EPJ A;  4J8X C;  4H9S A;  1M19 C;  3MGQ A;  4XZQ B;  1WWS A;  2BG1 A;  3H0R C;  4H9N A;  5F99 D;  4G92 B;  5AVB B;  3W96 A;  3W97 A;  4J8W D;  3AZN A;  5GSU B;  3REH C;  5B40 C;  5B2I D;  2XD1 A;  4YS3 B;  3V9R B;  5C3I B;  3AZH C;  1TAF A;  5DNN B;  3AZK C;  5AY8 C;  5AV6 D;  4E44 A;  5B1L A;  2UWX A;  5BNX B;  3LZ0 B;  4J8X A;  5F99 C;  3AZI D;  4J8W C;  1A7W A;  5AV8 B;  5B2I C;  3AZE D;  3MNN D;  3LEL D;  5GT3 A;  4WJ3 C;  4WNN A;  5AV6 C;  1M1A B;  5AV9 D;  3AZH A;  3AZK A;  4G91 C;  5AY8 A;  3EPL A;  3B6G B;  4KUD B;  3AZI C;  5E5A D;  4LD9 D;  4KGC B;  3EG5 B;  2Y2I A;  3VH5 W;  3C1B D;  3UTA B;  1P3O D;  2ARO C;  3WKJ D;  5FUG B;  5F99 A;  5GT0 C;  3AZE C;  3MNN C;  3W99 B;  5B2J D;  3LEL C;  3FDD A;  4QLC D;  1HQ3 C;  4J8W A;  4JJN B;  1F66 B;  5B2I A;  5B0Z B;  1ZLA B;  3KSY A;  5AV9 C;  4HGA C;  1P3I B;  5AV6 A;  1AOI D;  1BH9 A;  3REJ D;  5E5A C;  2NZD D;  3MGP D;  3NQJ A;  3AZI A;  3AFA B;  5B2J C;  4WV4 B;  4DQY B;  2ARO A;  3AZE A;  3MNN A;  3LZ1 B;  3LEL A;  1TZY B;  3W98 D;  4Z66 B;  3KUY D;  5CP6 C;  1AOI C;  4NE5 A;  5AV9 A;  3UTB B;  2NZD C;  3MGP C;  3WA9 B;  5CPJ B;  5AVC D;  3WAA D;  5E5A A;  4LD9 A;  3B0D C;  3AV2 D;  5CPK D;  1P3O A;  4Z5T C;  4XUJ B;  4ZUX D;  5B2J A;  1F1E A;  4QLC A;  3W98 C;  3MGR B;  1P3B D;  5GXQ B;  2ZY4 A;  3B0C W;  4H9Q B;  3MVD D;  1P3K B;  1T3U A;  1Q9C A;  4XZQ D;  2PYO B;  5CP6 A;  1EQZ B;  1AOI A;  5AVC C;  3WAA C;  2Y2N A;  5AVB D;  3AZG B;  1JFI A;  1KX4 B;  2NZD A;  3AV2 C;  3MGP A;  2HIO B;  5CPK C;  3AZL D;  4WU9 B;  2Y2G A;  5GSU D;  2LY8 A;  3KWQ C;  4YS3 D;  1BH8 A;  1P3B C;  5DNN D;  4R8P B;  3MVD C;  4CSR A;  3W98 A;  4H9P B;  4XZQ C;  3TU4 B;  1M18 B;  3LZ0 D;  3R45 A;  1PZR A;  3A6N B;  4G92 C;  1H3O A;  5AV5 B;  2F8N B;  2DF4 C;  5B33 B;  3AZL C;  5CPI B;  3VH6 T;  5AV8 D;  5AVC A;  3WAA A;  4UPK A;  1P3G B;  4YS3 C;  3AV2 A;  5CPK A;  5C3I C;  5DNN C;  4H9O A;  3VH5 A;  4ZBJ C;  4ZUX A;  3KWQ A;  2HUE B;  4UUZ A;  1P3B A;  4YM6 B;  1M1A D;  4AWL C;  3MVD A;  3LZ0 C;  2Y2K A;  4KUD D;  2L5A A;  3B6G D;  1HTA A;  2NQB C;  4XZQ A;  4NFT A;  4KGC D;  3UTA D;  5B24 B;  1N1J B;  3W99 D;  5AVB A;  3AZL A;  4JJN D;  5GSU A;  1F66 D;  1P3L B;  4DRB A;  5B0Z D;  4YS3 A;  1ZLA D;  3V9R A;  1M1A C;  5BT1 D;  4J8U B;  5DNN A;  1S32 B;  1P3I D;  4KUD C;  5GT3 C;  3B6G C;  5BNX A;  4KGC C;  3UTA C;  3LZ0 A;  3WTP B;  2NQB A;  1Z2C B;  3W99 C;  3AFA D;  4NE6 A;  1P3A B;  1P3F B;  2F2A C;  4JJN C;  1F66 C;  5B32 B;  4KHA B;  3LZ1 D;  2CV5 B;  1ZLA C;  1TZY D;  5DNM B;  5BT1 C;  4WU8 B;  3H0M C;  4Z66 D;  5B31 B;  1ULY A;  1P3I C;  2JE5 A;  1M1A A;  3UTB D;  2G5I C;  1KX5 B;  4KUD A;  2Y2L A;  3WA9 D;  5CPJ D;  3B6G A;  3AFA C;  4KGC A;  3UTA A;  5FUG A;  4XUJ D;  3A1I A;  3W99 A;  3LZ1 C;  3AZJ B;  3MGR D;  3AV1 B;  3B0B A;  4JJN A;  4Z66 C;  1F66 A;  5GXQ D;  1P3K D;  1ZLA A;  2PYO D;  1P3I A;  3WA9 C;  1EQZ D;  3AZG D;  2F8N K;  1KX4 D;  1M19 B;  2HIO D;  4WU9 D;  3REK B;  4XUJ C;  5BNV B;  3AFA A;  5CHL B;  3MGR C;  3AYW B;  4LD9 C;  5GXQ C;  4R8P D;  3C1B C;  1P3O C;  5BS7 C;  3LZ1 A;  1P3K C;  3WKJ C;  1TZY A;  3X1S B;  2ZM5 A;  5B40 B;  3REH B;  2G5H C;  4WNN B;  4Z66 A;  4QLC C;  3TU4 D;  1M18 D;  4NE3 A;  2RIQ A;  4X23 B;  3O62 B;  1P3P B;  1EQZ C;  1KX3 B;  3A6N D;  2Y2O A;  5AV5 D;  1KX4 C;  2F8N D;  2HIO C;  5B33 D;  4WU9 C;  4H9R B;  5CPI D;  3WA9 A;  1P3G D;  2F8N G;  3REJ C;  4CAY A;  5G49 B;  4XUJ A;  3X1U B;  3MGR A;  4YM6 D;  3TU4 C;  5GXQ A;  4H9Q A;  2BYM B;  3C1B A;  5BS7 A;  1P3K A;  3WKJ A;  3A6N C;  2PYO A;  5AV5 C;  5B24 D;  5CPI C;  2DQN C;  1EQZ A;  5JRG B;  3KUY C;  1KX4 A;  2HIO A;  4WU9 A;  3MGS B;  1P3L D;  2ARO B;  3REJ A;  3VH6 W;  5GT0 B;  4YM6 C;  4J8U D;  1S32 D;  1HQ3 B;  4H9P A;  5JA4 B;  4ZUX C;  3TU4 A;  5B24 C;  5AV9 B;  4HGA B;  3AL0 C;  3WTP D;  3A6N A;  5KDM B;  1P3A D;  5AV5 A;  2F8N A;  1P3F D;  3UT9 B;  5CPI A;  4DRA A;  2RVQ D;  3KUY A;  5B32 D;  1P3L C;  3AZF B;  4EO5 B;  2CV5 D;  2YFW A;  5DNM D;  5AVB C;  5B32 G;  4WU8 D;  1S32 C;  5B31 D;  5GSU C;  5B31 G;  4YM6 A;  4J8V B;  1KX5 D;  2IO5 B;  3WTP C;  1U35 B;  1P3A C;  1B6W A;  5CP6 B;  1P3F C;  5B24 A;  3KXB B;  2RVQ C;  1N1J A;  1B67 A;  2ZY2 A;  2BYK B;  5BO0 B;  3AZJ D;  3AN2 B;  2CV5 C;  5DNM C;  3AV1 D;  4WU8 C;  5B31 C;  1P3L A;  4Z5T B;  5AV8 C;  1P3M B;  2YFV B;  3AZM B;  4J8U A;  1S32 A;  3REL B;  1KX5 C;  3B6F B;  4Z2M G;  3NQU B;  1M19 D;  3REK D;  3IP4 C;  3WTP A;  2VQR A;  3F6T A;  2W8S A;  1P3A A;  3AZJ C;  1P34 B;  1P3F A;  1ID3 B;  3AYW D;  5B32 A;  1WWI A;  2CV5 A;  4H9O B;  3X1S D;  4E45 A;  5B40 D;  5DNM A;  4WU8 A;  3KWQ B;  3REH D;  5B31 A;  3REI B;  3C1C B;  1P3P D;  5AV8 A;  4X23 D;  3O62 D;  1KX3 D;  3X1T B;  5B0Z C;  2FJ7 B;  5B1M B;  1KX5 A;  5B0Y B;  3REK C;  2Y2J A;  3LJA B;  3X1V B;  3KFU G;  3AYW C;  3MGQ B;  3AZL B;  3AZJ A;  3X1S C;  3X1U D;  2ZY5 A;  3AV1 A;  4H9N B;  1P3P C;  4X23 C;  3O62 C;  1KX3 C;  3W97 B;  3W96 B;  3AZN B;  4ZBJ B;  2JCH A;  4M6B A;  1TZY C;  3P5J B;  3VH6 A;  5JRG D;  4AWL B;  5B0Z A;  1TAF B;  1M19 A;  3EPH A;  3UTB C;  3REK A;  2NQB B;  3MGS D;  5BNV A;  5CPJ C;  5B1L B;  2ARO D;  3X1U C;  3AYW A;  5GT0 D;  4J8X B;  1HQ3 D;  2CWE A;  3X1S A;  5B40 A;  3REH A;  1P3P A;  5JRG C;  4X23 A;  3O62 A;  1KX3 A;  5GT3 B;  3UT9 D;  4H9R A;  2PYO C;  3MGS C;  3AZF D;  3AZH B;  3UTB A;  5G49 A;  5AY8 B;  3H0L C;  3AZG C;  3AZK B;  2F8N H;  5CPJ A;  3X1U A;  4WZS B;  4J8V D;  2BYM A;  5F99 B;  2Y2H A;  4R8P C;  1U35 D;  4J8W B;  5CP6 D;  3UT9 C;  5B2I B;  3KXB D;  5JRG A;  1M18 C;  3AZF C;  4EO5 C;  3AN2 D;  3VH5 T;  3MGS A;  5AV6 B;  5B33 C;  1BH9 B;  4Z5T D;  2Y2P A;  1P3M D;  3AZM D;  5GT0 A;  1P3G C;  4J8V C;  4G91 B;  3AZG A;  3NQJ B;  3REL D;  1HQ3 A;  3AZI B;  2IO5 C;  3B6F D;  1U35 C;  5JA4 A;  2HUE C;  1BFM A;  3KXB C;  3AZE B;  3MNN B;  4R8P A;  3LEL B;  5KDM A;  1ID3 D;  1P34 D;  3AN2 C;  3UT9 A;  1M18 A;  3AZF A;  4CAY B;  1P3M C;  3AZM C;  3KWQ D;  3REL C;  5B33 A;  3REI D;  2Y2M A;  3C1C D;  3B6F C;  5E5A B;  4LD9 B;  3X1T D;  3C1B B;  1P3G A;  3WTP E;  4J8V A;  1P3O B;  2FJ7 D;  3WKJ B;  5B1M D;  5B0Y D;  3EPK A;  4J8U C;  5B2J B;  1U35 A;  4QLC B;  3LJA D;  3X1V D;  1R4V A;  1ID3 C;  1P34 C;  3KXB A;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...