1Q9CA

Crystal structure of the histone domain of son of sevenless
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
164
Chain Sequence
LPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIESLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Son of sevenless protein
publication title Tandem Histone Folds in the Structure of the N-terminal Segment of the Ras Activator Son of Sevenless
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 164
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1q9cA01
5JRGC 1P3MD 5B31A 4J8UA 1JFIB 4CSRB 1P3GD 5DNNC 3VH6T 3MGRA 5CPJA 4R8PC 1P3LC 1B67A 4KUDC 1M18A 5B1MB 2F8NA 3A6ND 3MNNA 5DNNB 5B0YA 5CP6C 3MGSC 5B32D 3UTAD 4YS3A 1KX5C 4R8PB 3AZHC 4XZQD 1M1AC 3B6GC 4Z66A 1P3PA 3AZIC 2NQBC 5CP6B 3O62C 3MGPA 1ZLAA 3MGSB 4KGCD 1KX5B 3AZLA 5B24D 3AZHB 3AZJC 3B6GB 2CV5D 4DRAA 5B1LC 3O62B 4NFTA 3C1BD 4J8VC 1P3IC 4X23A 5BNXB 1BH8B 3AZJB 3W99A 5AV5D 5F99B 3AZEC 5B40C 5B1LB 4J8VB 3AZFB 3UT9A 1P3IB 4J8WD 1HQ3D 3MGQD 3AFAA 3AZEB 5B40B 3B6FA 5AV6A 5CPIA 4WV4B 3LELA 5GT0D 5B2IC 3MGRD 5CPJD 2YFVB 4XUJB 5AV8A 1TAFA 2HIOD 1M18D 5AVBC 1S32C 2F8ND 3VH5A 2F8NH 5AY8A 3TU4B 1P3OC 4YS3D 1U35C 3LZ0B 5B2IB 1KX3A 1ID3C 3W98C 3REIA 3LZ1C 5AVBB 1S32B 4Z66D 1P3PD 3WA9C 1BH9A 3REHA 3WAAC 1P3OB 1U35B 3W98B 1ID3B 3LZ1B 3KWQA 3KXBA 3MVDA 2CWEA 4H9SC 3X1SD 3WAAB 4X23D 3C1CB 3NQUA 5CPKA 3KSYA 4ZBJC 1B6WA 2RVQC 3UTBC 3UT9D 5G49B 2BYKB 3AZMA 1P34D 1M19C 3WTPA 1R4VA 4DRBA 5DNMA 1TZYB 4ZBJB 4WU9A 5BS7A 5B31C 5BO0A 4J8UC 5CPID 3LELD 5GSUB 3AV1C 1M19B 3AN2A 1P3BC 4Z2MH 5AV8D 3AZGC 5B31B 4H9RB 2IO5B 4J8UB 1F66D 3MNNC 4G92B 4YM6A 3A6NA 5B0YC 3REJD 3AV1B 4UUZA 1P3BB 5BNVB 3AZGB 5B32A 3REID 2L5AA 3AZNC 4Z66C 3MNNB 5BT1D 4H9OA 5B0YB 3MGPC 1ZLAC 5B1MD 4WU8C 3AZLC 4H9NA 3KXBD 3MVDD 5B24A 3AZNB 2PYOA 2CV5A 4J8XA 3AV2A 1AOIC 1ZLAB 3WTPE 1P3KA 4LD9D 3C1BA 5CPKD 4WU8B 3AZLB 5JA4B 3W99C 3X1VC 4H9PA 5AV5A 1AOIB 5B0ZA 5GT3D 3AYWA 5B2JC 3AZMD 3WTPD 3KUYA 4J8WA 2AROC 3W97A 4WU9D 3X1VB 3W99B 4NE6A 1HQ3A 4QLCA 4WZSB 3AFAC 3MGQA 3B6FC 1F1EA 5AV6C 5CPIC 5B2JB 2FJ7C 5F99D 3AN2D 2AROB 5JRGB 3REKC 5GT0A 3AZFD 3B6FB 2HIOA 5B33A 1P3AA 4YM6D 4JJNA 5AY8C 2FJ7B 5B31G 1KX3C 3REKB 5AV9A 1P3LB 4KUDB 1N1JA 5CHLB 4KHAA 5GXQC 5AY8B 4XUJD 3REHC 4Z5TA 4G91C 3WKJC 3KWQC 5GXQB 1M1AB 3TU4D 4J8XD 3AV2D 2PYOD 3LZ0D 3AZIB 3AZKC 2NQBB 4WNNA 3W96A 1P3KD 3X1SA 4G91B 3WKJB 5E5AC 3AZKB 5B0ZD 3RELC 3V9RA 5AVCC 3AYWD 3KUYD 3NQJA 3W97D 3B0CW 5E5AB 1P34A 4ZUXD 4QLCD 5DNMC 5BS7C 1KX4A 2NZDA 3C1CD 1P3MC 3RELB 5AVCB 1A7WA 1P3GC 5FUGB 5DNMB 3X1TA 1EQZD 1Q9CA 1P3MB 3X1UA 5B33D 1P3AD 4JJND 1TZYD 2YFWA 3A6NC 1F66A 1P3GB 3REJA 5KDMB 5AV9D 5B32C 3UTAC 1JFIA 4XZQC 3A6NB 3VH5W 4Z5TD 4KGCC 4M6BA 3UTAB 5B1MA 5B24C 4XZQB 1KU5A 3WA9B 2CV5C 4H9OB 3W96D 4KGCB 4R8PA 5C3IC 4EO5C 3C1BC 4LD9A 5CP6A 5AV5C 3R45B 1KX5A 4EO5B 3AZHA 5GT3A 1P3FD 3B6GA 4J8WC 1KX4D 3O62A 1HQ3C 3MGQC 2NZDD 3UTBB 3LJAD 1BH8A 3AZJA 5F99A 3X1TD 5B1LA 5GT0C 3MGRC 4J8VA 3X1UD 5CPJC 3AZFA 2HIOC 2HUEC 1P3IA 1M18C 1P3AC 4JJNC 3AZEA 5B40A 4YS3C 3MGRB 5CPJB 2HUEB 1M18B 3VH6A 2F8NB 3VH5T 1P3PC 5JRGD 2YFVA 4XUJA 4YS3B 5DNND 4Z66B 5B32G 4H9QA 3TU4A 1P3PB 3LZ0A 5B2IA 3VH6W 1P3LD 4R8PD 3MGPB 3X1SC 4KUDD 5AVBA 1S32A 4X23C 5CP6D 3MGSD 1P3OA 3W98A 1KX5D 1ID3A 3AZHD 1M1AD 3UT9C 3B6GD 4X23B 4E44A 3AZID 1P34C 2NQBD 3O62D 4ZUXA 3WAAA 4AWLC 3C1CA 3AZJD 3UT9B 3LELC 5B1LD 3AFAB 4J8VD 5AV8C 4AWLB 1P3ID 5G49A 1EQZA 2BYKA 5AV6B 5CPIB 3LELB 1F66C 3AZED 1TZYA 5B40D 3REJC 5AV8B 1TAFB 3REIC 5GSUA 4HGAC 1M19A 2YFWB 1F66B 5BT1C 3REJB 1KX3B 2F8NG 4H9RA 5B1MC 3REIB 3KXBC 3MVDC 4HGAB 4CAYA 3AV1A 1BH9B 5B2ID 1P3BA 3REHB 5BNVA 3AZGA 1H3OA 5AVBD 1S32D 4LD9C 5CPKC 3KWQB 3KXBB 3MVDB 1WWSA 1P3OD 1U35D 3W98D 1ID3D 1WWIA 3B0BA 3LZ1D 5GT3C 4LD9B 3AZMC 3NQUB 3AZNA 5CPKB 3WTPC 1P3FA 3WA9D 4WU9C 3WAAD 4WU8A 3LJAA 5GT3B 5JA4A 3AZMB 3WTPB 5F99C 3AN2C 1BFMA 4WU9B 1AOIA 5BO0B 3AZFC 3X1VA 2BYMA 4YM6C 2LY8A 3AN2B 2RVQD 3UTBD 5GSUD 5B2JA 4CSRA 4Z2MG 1M19D 2AROA 4YM6B 5JRGA 4UUZB 3B0DC 5B31D 4XUJC 4J8UD 4E45A 5B32B 2JSSA 1HTAA 3AV1D 2FJ7A 5DNNA 1P3BD 2PYOC 3TU4C 4J8XC 3AZGD 3AV2C 3LZ0C 3REKA 3B0DB 1ULYA 1P3LA 4KUDA 1P3KC 3MNND 4H9NB 5B0YD 5B24B 2PYOB 4H9QB 4J8XB 3MGSA 3AV2B 2CV5B 5B0ZC 1P3KB 5C3IB 3AYWC 3C1BB 3AZND 3B0CT 5GXQA 1M1AA 3KUYC 3W97C 3AZIA 4H9PB 3MGPD 4ZUXC 4QLCC 5AV5B 1ZLAD 2NQBA 4WU8D 3C1CC 5B0ZB 3AZLD 5BNXA 3AYWB 3WKJA 4NE3A 3KUYB 4J8WB 3W97B 3AZKA 1AOID 4ZUXB 4QLCB 1HQ3B 3MGQB 1EQZC 3W99D 5B33C 3X1VD 5E5AA 1TZYC 5GT0B 3RELA 5AV9C 5B2JD 5AVCA 1EQZB 5GSUC 2HIOB 2AROD 5B33B 1P3AB 4JJNB 5FUGA 3AFAD 3B6FD 4Z5TC 1P3MA 2IO5C 5AV9B 5AV6D 1N1JB 2FJ7D 4G92C 4KHAB 1P3GA 4NE5A 3REKD 5KDMA 3W96C 4Z5TB 5AY8D 4CAYB 1KX3D 1U35A 4WNNB 3W96B 3UTAA 3X1SB 1H3OB 3LZ1A 5GXQD 4XZQA 1P3FC 3WA9A 3REHD 1KX4C 4KGCA 2NZDC 3V9RB 3WKJD 3KWQD 3LJAC 1P3FB 3NQJB 3AZKD 1P34B 3X1TC 4H9SA 3R45A 1KX4B 2NZDB 3X1UC 5E5AD 3LJAB 2F8NK 3RELD 3X1TB 3UTBA 5AVCD 3X1UB 5DNMD 2BYMB
chains in the Genus database with same CATH superfamily
2DQNC 5JRGC 1P3MD 5B31A 4J8UA 1JFIB 3P5JB 4CSRB 1P3GD 2Y2MA 5DNNC 3VH6T 3MGRA 5CPJA 4R8PC 1P3LC 1B67A 4KUDC 1M18A 5B1MB 2F8NA 3A6ND 3MNNA 5DNNB 5B0YA 5CP6C 3MGSC 5B32D 3UTAD 4YS3A 1KX5C 4R8PB 3AZHC 4XZQD 1M1AC 3B6GC 4Z66A 1P3PA 3AZIC 2NQBC 5CP6B 3O62C 3MGPA 1ZLAA 3MGSB 4KGCD 1KX5B 3AZLA 5B24D 3AZHB 3AZJC 3B6GB 2CV5D 4DRAA 5B1LC 3O62B 4NFTA 3C1BD 4J8VC 2JCHA 1P3IC 4X23A 5BNXB 1BH8B 3AZJB 3W99A 5AV5D 5F99B 3AZEC 5B40C 5B1LB 4J8VB 3AZFB 3UT9A 1P3IB 4J8WD 3H0MC 1HQ3D 3MGQD 3AFAA 3AZEB 5B40B 3B6FA 5AV6A 5CPIA 4WV4B 3LELA 3EG5B 2ZM5A 5GT0D 5B2IC 3MGRD 5CPJD 2YFVB 4XUJB 5AV8A 1TAFA 2HIOD 1M18D 5AVBC 1S32C 2F8ND 3VH5A 2F8NH 5AY8A 3TU4B 1P3OC 4YS3D 1U35C 3LZ0B 5B2IB 1KX3A 1ID3C 2XD5A 3W98C 3REIA 3LZ1C 5AVBB 1S32B 4Z66D 1P3PD 3WA9C 1BH9A 3REHA 3WAAC 1P3OB 1U35B 3W98B 1ID3B 3LZ1B 3KWQA 3KXBA 3MVDA 2CWEA 4H9SC 3X1SD 3WAAB 4X23D 3C1CB 3NQUA 5CPKA 3KFUG 3KSYA 4ZBJC 1B6WA 2RVQC 3UTBC 3UT9D 5G49B 2BYKB 3AZMA 1P34D 1M19C 3WTPA 1R4VA 4DRBA 5DNMA 1TZYB 4ZBJB 4WU9A 5BS7A 5B31C 5BO0A 4J8UC 2VQRA 5CPID 3LELD 5GSUB 3AV1C 1M19B 3AN2A 1P3BC 4Z2MH 4WJ3C 5AV8D 3AZGC 5B31B 4H9RB 1W2EA 2IO5B 4J8UB 1F66D 3MNNC 4G92B 4YM6A 3A6NA 5B0YC 3REJD 3AV1B 4UUZA 1P3BB 2ZY2A 5BNVB 3AZGB 5B32A 3REID 2L5AA 3AZNC 4Z66C 3MNNB 5BT1D 4H9OA 5B0YB 3MGPC 1ZLAC 5B1MD 4WU8C 3AZLC 4H9NA 3KXBD 3MVDD 5B24A 3AZNB 2PYOA 2CV5A 4J8XA 3AV2A 1AOIC 1ZLAB 3WTPE 1P3KA 4LD9D 3C1BA 5CPKD 4WU8B 3AZLB 5JA4B 3W99C 3X1VC 4H9PA 5AV5A 1AOIB 5B0ZA 5GT3D 3AYWA 5B2JC 3AZMD 3WTPD 3A1KA 3KUYA 4J8WA 2AROC 3W97A 4WU9D 3X1VB 3W99B 4NE6A 1HQ3A 4QLCA 4WZSB 3AFAC 3MGQA 3B6FC 1F1EA 5AV6C 5CPIC 5B2JB 2XD1A 2FJ7C 5F99D 3AN2D 2AROB 5JRGB 3REKC 5GT0A 3AZFD 3B6FB 2HIOA 5B33A 1P3AA 4YM6D 4JJNA 5AY8C 2FJ7B 5B31G 2ZY4A 1KX3C 3REKB 2Y2QA 5AV9A 1P3LB 4KUDB 1N1JA 5CHLB 4KHAA 5GXQC 5AY8B 4XUJD 3REHC 4Z5TA 4G91C 3WKJC 3KWQC 2RIQA 5GXQB 1M1AB 3TU4D 4J8XD 3AV2D 2PYOD 3LZ0D 3AZIB 3AZKC 2NQBB 4WNNA 3W96A 1P3KD 3X1SA 4G91B 2W8SA 3EPKA 3WKJB 5E5AC 3AZKB 2G5IC 5B0ZD 3RELC 3V9RA 5AVCC 3AYWD 3KUYD 3NQJA 3W97D 3B0CW 5E5AB 1P34A 4ZUXD 4QLCD 5DNMC 5BS7C 1KX4A 2NZDA 3C1CD 1P3MC 3RELB 5AVCB 1A7WA 1P3GC 5FUGB 5DNMB 3X1TA 1EQZD 1Q9CA 3H0RC 1P3MB 3X1UA 5B33D 1P3AD 4JJND 3AL0C 1TZYD 2YFWA 3A6NC 1F66A 1P3GB 3REJA 5KDMB 5AV9D 5B32C 3UTAC 1JFIA 4XZQC 4UPKA 3A6NB 3VH5W 4Z5TD 4KGCC 2Y2HA 4M6BA 3UTAB 5B1MA 2G5HC 5B24C 4XZQB 1KU5A 3WA9B 2CV5C 4H9OB 3W96D 4KGCB 4R8PA 5C3IC 4EO5C 3C1BC 4LD9A 2BG1A 3IP4C 5CP6A 5AV5C 4DQYB 3R45B 1KX5A 4EO5B 3AZHA 5GT3A 1P3FD 3B6GA 4J8WC 1KX4D 3O62A 1HQ3C 3MGQC 2NZDD 3UTBB 3LJAD 1BH8A 3AZJA 5F99A 3X1TD 5B1LA 5GT0C 3EPJA 3MGRC 4J8VA 3X1UD 5CPJC 3AZFA 2HIOC 2HUEC 1P3IA 1M18C 1P3AC 4JJNC 3AZEA 5B40A 4YS3C 3MGRB 5CPJB 2HUEB 1M18B 3VH6A 2F8NB 3VH5T 1P3PC 5JRGD 2YFVA 4XUJA 4YS3B 5DNND 4Z66B 2Y2LA 5B32G 4H9QA 3TU4A 1P3PB 3LZ0A 5B2IA 3VH6W 1P3LD 4R8PD 3MGPB 3X1SC 4KUDD 5AVBA 1S32A 4X23C 1PZRA 5CP6D 3MGSD 1P3OA 3W98A 2F2AC 1KX5D 1ID3A 3AZHD 1M1AD 3UT9C 3EPLA 4X23B 3B6GD 4E44A 3AZID 1P34C 2NQBD 3O62D 4ZUXA 3WAAA 4AWLC 3C1CA 3AZJD 3UT9B 3LELC 5B1LD 3EPHA 2Y2GA 2Y2JA 3AFAB 4J8VD 5AV8C 4AWLB 1P3ID 5G49A 1EQZA 2BYKA 2ZY3A 5AV6B 5CPIB 3LELB 1F66C 3AZED 1TZYA 5B40D 3REJC 2J8PA 5AV8B 1TAFB 3REIC 5GSUA 4HGAC 2JE5A 1M19A 2YFWB 1F66B 5BT1C 1T3UA 3REJB 1KX3B 2F8NG 4H9RA 5B1MC 3REIB 3KXBC 3MVDC 4HGAB 4CAYA 3AV1A 1BH9B 5B2ID 1P3BA 3REHB 5BNVA 3AZGA 1H3OA 5AVBD 1S32D 4LD9C 5CPKC 3KWQB 3KXBB 3MVDB 1WWSA 1P3OD 1U35D 3W98D 1ID3D 1WWIA 3B0BA 3LZ1D 5GT3C 4LD9B 3AZMC 3NQUB 3AZNA 5CPKB 3WTPC 1P3FA 3WA9D 3H0LC 2UWXA 4WU9C 3WAAD 2FFFB 4WU8A 3LJAA 5GT3B 5JA4A 3AZMB 3WTPB 5F99C 3AN2C 1BFMA 4WU9B 1AOIA 5BO0B 3AZFC 3X1VA 2BYMA 4YM6C 2LY8A 3AN2B 2RVQD 3UTBD 5GSUD 5B2JA 4CSRA 4Z2MG 1M19D 2AROA 4YM6B 5JRGA 4UUZB 3B0DC 5B31D 4XUJC 4J8UD 4E45A 5B32B 2JSSA 1HTAA 3AV1D 2FJ7A 5DNNA 1P3BD 2PYOC 3TU4C 4J8XC 3AZGD 3AV2C 3LZ0C 3REKA 3B0DB 1ULYA 1P3LA 4KUDA 1P3KC 2DF4C 2Y2OA 3MNND 4H9NB 5B0YD 5B24B 2Y2IA 2PYOB 4H9QB 4J8XB 3MGSA 3AV2B 2CV5B 5B0ZC 1P3KB 5C3IB 2ZY5A 3C1BB 3AYWC 3AZND 3B0CT 5GXQA 1M1AA 3KUYC 3W97C 3AZIA 4H9PB 3MGPD 4ZUXC 4QLCC 5AV5B 1ZLAD 2NQBA 4WU8D 3C1CC 5B0ZB 3AZLD 5BNXA 3AYWB 3WKJA 4NE3A 3KUYB 4J8WB 3W97B 3AZKA 1AOID 4ZUXB 4QLCB 1HQ3B 3MGQB 1EQZC 3W99D 5B33C 3X1VD 5E5AA 1TZYC 2Y2PA 5GT0B 3RELA 5AV9C 5B2JD 5AVCA 1EQZB 5GSUC 2HIOB 2AROD 5B33B 1P3AB 4JJNB 5FUGA 3AFAD 3B6FD 4Z5TC 1P3MA 2IO5C 5AV9B 5AV6D 1N1JB 2FJ7D 4G92C 4KHAB 3A1IA 1P3GA 4NE5A 3REKD 5KDMA 3W96C 4Z5TB 5AY8D 4CAYB 3FDDA 1KX3D 1U35A 4WNNB 3W96B 3UTAA 3X1SB 1H3OB 3LZ1A 5GXQD 4XZQA 2Y2KA 1P3FC 3WA9A 3REHD 1KX4C 4KGCA 2NZDC 3V9RB 3WKJD 3KWQD 3LJAC 3F6TA 1P3FB 3NQJB 3AZKD 1P34B 3X1TC 4H9SA 3R45A 1KX4B 2NZDB 3X1UC 5E5AD 3LJAB 2F8NK 3RELD 3X1TB 3UTBA 5AVCD 3X1UB 2Y2NA 5DNMD 2BYMB 1Z2CB
chains in the Genus database with same CATH topology
2DQNC 5JRGC 1P3MD 5B31A 4J8UA 1JFIB 3P5JB 4CSRB 1P3GD 2Y2MA 5DNNC 3VH6T 3MGRA 5CPJA 4R8PC 1P3LC 1B67A 4KUDC 1M18A 5B1MB 2F8NA 3A6ND 3MNNA 5DNNB 5B0YA 5CP6C 3MGSC 5B32D 3UTAD 4YS3A 1KX5C 4R8PB 3AZHC 4XZQD 1M1AC 3B6GC 4Z66A 1P3PA 3AZIC 2NQBC 5CP6B 3O62C 3MGPA 1ZLAA 3MGSB 4KGCD 1KX5B 3AZLA 5B24D 3AZHB 3AZJC 3B6GB 2CV5D 4DRAA 5B1LC 3O62B 4NFTA 3C1BD 4J8VC 2JCHA 1P3IC 4X23A 5BNXB 1BH8B 3AZJB 3W99A 5AV5D 5F99B 3AZEC 5B40C 5B1LB 4J8VB 3AZFB 3UT9A 1P3IB 4J8WD 3H0MC 1HQ3D 3MGQD 3AFAA 3AZEB 5B40B 3B6FA 5AV6A 5CPIA 4WV4B 3LELA 3EG5B 2ZM5A 5GT0D 5B2IC 3MGRD 5CPJD 2YFVB 4XUJB 5AV8A 1TAFA 2HIOD 1M18D 5AVBC 1S32C 2F8ND 3VH5A 2F8NH 5AY8A 3TU4B 1P3OC 4YS3D 1U35C 3LZ0B 5B2IB 1KX3A 1ID3C 2XD5A 3W98C 3REIA 3LZ1C 5AVBB 1S32B 4Z66D 1P3PD 3WA9C 1BH9A 3REHA 3WAAC 1P3OB 1U35B 3W98B 1ID3B 3LZ1B 3KWQA 3KXBA 3MVDA 2CWEA 4H9SC 3X1SD 3WAAB 4X23D 3C1CB 3NQUA 5CPKA 3KFUG 3KSYA 4ZBJC 1B6WA 2RVQC 3UTBC 3UT9D 5G49B 2BYKB 3AZMA 1P34D 1M19C 3WTPA 1R4VA 4DRBA 5DNMA 1TZYB 4ZBJB 4WU9A 5BS7A 5B31C 5BO0A 4J8UC 2VQRA 5CPID 3LELD 5GSUB 3AV1C 1M19B 3AN2A 1P3BC 4Z2MH 4WJ3C 5AV8D 3AZGC 5B31B 4H9RB 1W2EA 2IO5B 4J8UB 1F66D 3MNNC 4G92B 4YM6A 3A6NA 5B0YC 3REJD 3AV1B 4UUZA 1P3BB 2ZY2A 5BNVB 3AZGB 5B32A 3REID 2L5AA 3AZNC 4Z66C 3MNNB 5BT1D 4H9OA 5B0YB 3MGPC 1ZLAC 5B1MD 4WU8C 3AZLC 4H9NA 3KXBD 3MVDD 5B24A 3AZNB 2PYOA 2CV5A 4J8XA 3AV2A 1AOIC 1ZLAB 3WTPE 1P3KA 4LD9D 3C1BA 5CPKD 4WU8B 3AZLB 5JA4B 3W99C 3X1VC 4H9PA 5AV5A 1AOIB 5B0ZA 5GT3D 3AYWA 5B2JC 3AZMD 3WTPD 3A1KA 3KUYA 4J8WA 2AROC 3W97A 4WU9D 3X1VB 3W99B 4NE6A 1HQ3A 4QLCA 4WZSB 3AFAC 3MGQA 3B6FC 1F1EA 5AV6C 5CPIC 5B2JB 2XD1A 2FJ7C 5F99D 3AN2D 2AROB 5JRGB 3REKC 5GT0A 3AZFD 3B6FB 2HIOA 5B33A 1P3AA 4YM6D 4JJNA 5AY8C 2FJ7B 5B31G 2ZY4A 1KX3C 3REKB 2Y2QA 5AV9A 1P3LB 4KUDB 1N1JA 5CHLB 4KHAA 5GXQC 5AY8B 4XUJD 3REHC 4Z5TA 4G91C 3WKJC 3KWQC 2RIQA 5GXQB 1M1AB 3TU4D 4J8XD 3AV2D 2PYOD 3LZ0D 3AZIB 3AZKC 2NQBB 4WNNA 3W96A 1P3KD 3X1SA 4G91B 2W8SA 3EPKA 3WKJB 5E5AC 3AZKB 2G5IC 5B0ZD 3RELC 3V9RA 5AVCC 3AYWD 3KUYD 3NQJA 3W97D 3B0CW 5E5AB 1P34A 4ZUXD 4QLCD 5DNMC 5BS7C 1KX4A 2NZDA 3C1CD 1P3MC 3RELB 5AVCB 1A7WA 1P3GC 5FUGB 5DNMB 3X1TA 1EQZD 1Q9CA 3H0RC 1P3MB 3X1UA 5B33D 1P3AD 4JJND 3AL0C 1TZYD 2YFWA 3A6NC 1F66A 1P3GB 3REJA 5KDMB 5AV9D 5B32C 3UTAC 1JFIA 4XZQC 4UPKA 3A6NB 3VH5W 4Z5TD 4KGCC 2Y2HA 4M6BA 3UTAB 5B1MA 2G5HC 5B24C 4XZQB 1KU5A 3WA9B 2CV5C 4H9OB 3W96D 4KGCB 4R8PA 5C3IC 4EO5C 3C1BC 4LD9A 2BG1A 3IP4C 5CP6A 5AV5C 4DQYB 3R45B 1KX5A 4EO5B 3AZHA 5GT3A 1P3FD 3B6GA 4J8WC 1KX4D 3O62A 1HQ3C 3MGQC 2NZDD 3UTBB 3LJAD 1BH8A 3AZJA 5F99A 3X1TD 5B1LA 5GT0C 3EPJA 3MGRC 4J8VA 3X1UD 5CPJC 3AZFA 2HIOC 2HUEC 1P3IA 1M18C 1P3AC 4JJNC 3AZEA 5B40A 4YS3C 3MGRB 5CPJB 2HUEB 1M18B 3VH6A 2F8NB 3VH5T 1P3PC 5JRGD 2YFVA 4XUJA 4YS3B 5DNND 4Z66B 2Y2LA 5B32G 4H9QA 3TU4A 1P3PB 3LZ0A 5B2IA 3VH6W 1P3LD 4R8PD 3MGPB 3X1SC 4KUDD 5AVBA 1S32A 4X23C 1PZRA 5CP6D 3MGSD 1P3OA 3W98A 2F2AC 1KX5D 1ID3A 3AZHD 1M1AD 3UT9C 3EPLA 4X23B 3B6GD 4E44A 3AZID 1P34C 2NQBD 3O62D 4ZUXA 3WAAA 4AWLC 3C1CA 3AZJD 3UT9B 3LELC 5B1LD 3EPHA 2Y2GA 2Y2JA 3AFAB 4J8VD 5AV8C 4AWLB 1P3ID 5G49A 1EQZA 2BYKA 2ZY3A 5AV6B 5CPIB 3LELB 1F66C 3AZED 1TZYA 5B40D 3REJC 2J8PA 5AV8B 1TAFB 3REIC 5GSUA 4HGAC 2JE5A 1M19A 2YFWB 1F66B 5BT1C 1T3UA 3REJB 1KX3B 2F8NG 4H9RA 5B1MC 3REIB 3KXBC 3MVDC 4HGAB 4CAYA 3AV1A 1BH9B 5B2ID 1P3BA 3REHB 5BNVA 3AZGA 1H3OA 5AVBD 1S32D 4LD9C 5CPKC 3KWQB 3KXBB 3MVDB 1WWSA 1P3OD 1U35D 3W98D 1ID3D 1WWIA 3B0BA 3LZ1D 5GT3C 4LD9B 3AZMC 3NQUB 3AZNA 5CPKB 3WTPC 1P3FA 3WA9D 3H0LC 2UWXA 4WU9C 3WAAD 2FFFB 4WU8A 3LJAA 5GT3B 5JA4A 3AZMB 3WTPB 5F99C 3AN2C 1BFMA 4WU9B 1AOIA 5BO0B 3AZFC 3X1VA 2BYMA 4YM6C 2LY8A 3AN2B 2RVQD 3UTBD 5GSUD 5B2JA 4CSRA 4Z2MG 1M19D 2AROA 4YM6B 5JRGA 4UUZB 3B0DC 5B31D 4XUJC 4J8UD 4E45A 5B32B 2JSSA 1HTAA 3AV1D 2FJ7A 5DNNA 1P3BD 2PYOC 3TU4C 4J8XC 3AZGD 3AV2C 3LZ0C 3REKA 3B0DB 1ULYA 1P3LA 4KUDA 1P3KC 2DF4C 2Y2OA 3MNND 4H9NB 5B0YD 5B24B 2Y2IA 2PYOB 4H9QB 4J8XB 3MGSA 3AV2B 2CV5B 5B0ZC 1P3KB 5C3IB 2ZY5A 3C1BB 3AYWC 3AZND 3B0CT 5GXQA 1M1AA 3KUYC 3W97C 3AZIA 4H9PB 3MGPD 4ZUXC 4QLCC 5AV5B 1ZLAD 2NQBA 4WU8D 3C1CC 5B0ZB 3AZLD 5BNXA 3AYWB 3WKJA 4NE3A 3KUYB 4J8WB 3W97B 3AZKA 1AOID 4ZUXB 4QLCB 1HQ3B 3MGQB 1EQZC 3W99D 5B33C 3X1VD 5E5AA 1TZYC 2Y2PA 5GT0B 3RELA 5AV9C 5B2JD 5AVCA 1EQZB 5GSUC 2HIOB 2AROD 5B33B 1P3AB 4JJNB 5FUGA 3AFAD 3B6FD 4Z5TC 1P3MA 2IO5C 5AV9B 5AV6D 1N1JB 2FJ7D 4G92C 4KHAB 3A1IA 1P3GA 4NE5A 3REKD 5KDMA 3W96C 4Z5TB 5AY8D 4CAYB 3FDDA 1KX3D 1U35A 4WNNB 3W96B 3UTAA 3X1SB 1H3OB 3LZ1A 5GXQD 4XZQA 2Y2KA 1P3FC 3WA9A 3REHD 1KX4C 4KGCA 2NZDC 3V9RB 3WKJD 3KWQD 3LJAC 3F6TA 1P3FB 3NQJB 3AZKD 1P34B 3X1TC 4H9SA 3R45A 1KX4B 2NZDB 3X1UC 5E5AD 3LJAB 2F8NK 3RELD 3X1TB 3UTBA 5AVCD 3X1UB 2Y2NA 5DNMD 2BYMB 1Z2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG C;  1P3M D;  5B31 A;  4J8U A;  1JFI B;  4CSR B;  1P3G D;  5DNN C;  3VH6 T;  3MGR A;  5CPJ A;  4R8P C;  1P3L C;  1B67 A;  4KUD C;  1M18 A;  5B1M B;  2F8N A;  3A6N D;  3MNN A;  5DNN B;  5B0Y A;  5CP6 C;  3MGS C;  5B32 D;  3UTA D;  4YS3 A;  1KX5 C;  4R8P B;  3AZH C;  4XZQ D;  1M1A C;  3B6G C;  4Z66 A;  1P3P A;  3AZI C;  2NQB C;  5CP6 B;  3O62 C;  3MGP A;  1ZLA A;  3MGS B;  4KGC D;  1KX5 B;  3AZL A;  5B24 D;  3AZH B;  3AZJ C;  3B6G B;  2CV5 D;  4DRA A;  5B1L C;  3O62 B;  4NFT A;  3C1B D;  4J8V C;  1P3I C;  4X23 A;  5BNX B;  1BH8 B;  3AZJ B;  3W99 A;  5AV5 D;  5F99 B;  3AZE C;  5B40 C;  5B1L B;  4J8V B;  3AZF B;  3UT9 A;  1P3I B;  4J8W D;  1HQ3 D;  3MGQ D;  3AFA A;  3AZE B;  5B40 B;  3B6F A;  5AV6 A;  5CPI A;  4WV4 B;  3LEL A;  5GT0 D;  5B2I C;  3MGR D;  5CPJ D;  2YFV B;  4XUJ B;  5AV8 A;  1TAF A;  2HIO D;  1M18 D;  5AVB C;  1S32 C;  2F8N D;  3VH5 A;  2F8N H;  5AY8 A;  3TU4 B;  1P3O C;  4YS3 D;  1U35 C;  3LZ0 B;  5B2I B;  1KX3 A;  1ID3 C;  3W98 C;  3REI A;  3LZ1 C;  5AVB B;  1S32 B;  4Z66 D;  1P3P D;  3WA9 C;  1BH9 A;  3REH A;  3WAA C;  1P3O B;  1U35 B;  3W98 B;  1ID3 B;  3LZ1 B;  3KWQ A;  3KXB A;  3MVD A;  2CWE A;  4H9S C;  3X1S D;  3WAA B;  4X23 D;  3C1C B;  3NQU A;  5CPK A;  3KSY A;  4ZBJ C;  1B6W A;  2RVQ C;  3UTB C;  3UT9 D;  5G49 B;  2BYK B;  3AZM A;  1P34 D;  1M19 C;  3WTP A;  1R4V A;  4DRB A;  5DNM A;  1TZY B;  4ZBJ B;  4WU9 A;  5BS7 A;  5B31 C;  5BO0 A;  4J8U C;  5CPI D;  3LEL D;  5GSU B;  3AV1 C;  1M19 B;  3AN2 A;  1P3B C;  4Z2M H;  5AV8 D;  3AZG C;  5B31 B;  4H9R B;  2IO5 B;  4J8U B;  1F66 D;  3MNN C;  4G92 B;  4YM6 A;  3A6N A;  5B0Y C;  3REJ D;  3AV1 B;  4UUZ A;  1P3B B;  5BNV B;  3AZG B;  5B32 A;  3REI D;  2L5A A;  3AZN C;  4Z66 C;  3MNN B;  5BT1 D;  4H9O A;  5B0Y B;  3MGP C;  1ZLA C;  5B1M D;  4WU8 C;  3AZL C;  4H9N A;  3KXB D;  3MVD D;  5B24 A;  3AZN B;  2PYO A;  2CV5 A;  4J8X A;  3AV2 A;  1AOI C;  1ZLA B;  3WTP E;  1P3K A;  4LD9 D;  3C1B A;  5CPK D;  4WU8 B;  3AZL B;  5JA4 B;  3W99 C;  3X1V C;  4H9P A;  5AV5 A;  1AOI B;  5B0Z A;  5GT3 D;  3AYW A;  5B2J C;  3AZM D;  3WTP D;  3KUY A;  4J8W A;  2ARO C;  3W97 A;  4WU9 D;  3X1V B;  3W99 B;  4NE6 A;  1HQ3 A;  4QLC A;  4WZS B;  3AFA C;  3MGQ A;  3B6F C;  1F1E A;  5AV6 C;  5CPI C;  5B2J B;  2FJ7 C;  5F99 D;  3AN2 D;  2ARO B;  5JRG B;  3REK C;  5GT0 A;  3AZF D;  3B6F B;  2HIO A;  5B33 A;  1P3A A;  4YM6 D;  4JJN A;  5AY8 C;  2FJ7 B;  5B31 G;  1KX3 C;  3REK B;  5AV9 A;  1P3L B;  4KUD B;  1N1J A;  5CHL B;  4KHA A;  5GXQ C;  5AY8 B;  4XUJ D;  3REH C;  4Z5T A;  4G91 C;  3WKJ C;  3KWQ C;  5GXQ B;  1M1A B;  3TU4 D;  4J8X D;  3AV2 D;  2PYO D;  3LZ0 D;  3AZI B;  3AZK C;  2NQB B;  4WNN A;  3W96 A;  1P3K D;  3X1S A;  4G91 B;  3WKJ B;  5E5A C;  3AZK B;  5B0Z D;  3REL C;  3V9R A;  5AVC C;  3AYW D;  3KUY D;  3NQJ A;  3W97 D;  3B0C W;  5E5A B;  1P34 A;  4ZUX D;  4QLC D;  5DNM C;  5BS7 C;  1KX4 A;  2NZD A;  3C1C D;  1P3M C;  3REL B;  5AVC B;  1A7W A;  1P3G C;  5FUG B;  5DNM B;  3X1T A;  1EQZ D;  1Q9C A;  1P3M B;  3X1U A;  5B33 D;  1P3A D;  4JJN D;  1TZY D;  2YFW A;  3A6N C;  1F66 A;  1P3G B;  3REJ A;  5KDM B;  5AV9 D;  5B32 C;  3UTA C;  1JFI A;  4XZQ C;  3A6N B;  3VH5 W;  4Z5T D;  4KGC C;  4M6B A;  3UTA B;  5B1M A;  5B24 C;  4XZQ B;  1KU5 A;  3WA9 B;  2CV5 C;  4H9O B;  3W96 D;  4KGC B;  4R8P A;  5C3I C;  4EO5 C;  3C1B C;  4LD9 A;  5CP6 A;  5AV5 C;  3R45 B;  1KX5 A;  4EO5 B;  3AZH A;  5GT3 A;  1P3F D;  3B6G A;  4J8W C;  1KX4 D;  3O62 A;  1HQ3 C;  3MGQ C;  2NZD D;  3UTB B;  3LJA D;  1BH8 A;  3AZJ A;  5F99 A;  3X1T D;  5B1L A;  5GT0 C;  3MGR C;  4J8V A;  3X1U D;  5CPJ C;  3AZF A;  2HIO C;  2HUE C;  1P3I A;  1M18 C;  1P3A C;  4JJN C;  3AZE A;  5B40 A;  4YS3 C;  3MGR B;  5CPJ B;  2HUE B;  1M18 B;  3VH6 A;  2F8N B;  3VH5 T;  1P3P C;  5JRG D;  2YFV A;  4XUJ A;  4YS3 B;  5DNN D;  4Z66 B;  5B32 G;  4H9Q A;  3TU4 A;  1P3P B;  3LZ0 A;  5B2I A;  3VH6 W;  1P3L D;  4R8P D;  3MGP B;  3X1S C;  4KUD D;  5AVB A;  1S32 A;  4X23 C;  5CP6 D;  3MGS D;  1P3O A;  3W98 A;  1KX5 D;  1ID3 A;  3AZH D;  1M1A D;  3UT9 C;  3B6G D;  4X23 B;  4E44 A;  3AZI D;  1P34 C;  2NQB D;  3O62 D;  4ZUX A;  3WAA A;  4AWL C;  3C1C A;  3AZJ D;  3UT9 B;  3LEL C;  5B1L D;  3AFA B;  4J8V D;  5AV8 C;  4AWL B;  1P3I D;  5G49 A;  1EQZ A;  2BYK A;  5AV6 B;  5CPI B;  3LEL B;  1F66 C;  3AZE D;  1TZY A;  5B40 D;  3REJ C;  5AV8 B;  1TAF B;  3REI C;  5GSU A;  4HGA C;  1M19 A;  2YFW B;  1F66 B;  5BT1 C;  3REJ B;  1KX3 B;  2F8N G;  4H9R A;  5B1M C;  3REI B;  3KXB C;  3MVD C;  4HGA B;  4CAY A;  3AV1 A;  1BH9 B;  5B2I D;  1P3B A;  3REH B;  5BNV A;  3AZG A;  1H3O A;  5AVB D;  1S32 D;  4LD9 C;  5CPK C;  3KWQ B;  3KXB B;  3MVD B;  1WWS A;  1P3O D;  1U35 D;  3W98 D;  1ID3 D;  1WWI A;  3B0B A;  3LZ1 D;  5GT3 C;  4LD9 B;  3AZM C;  3NQU B;  3AZN A;  5CPK B;  3WTP C;  1P3F A;  3WA9 D;  4WU9 C;  3WAA D;  4WU8 A;  3LJA A;  5GT3 B;  5JA4 A;  3AZM B;  3WTP B;  5F99 C;  3AN2 C;  1BFM A;  4WU9 B;  1AOI A;  5BO0 B;  3AZF C;  3X1V A;  2BYM A;  4YM6 C;  2LY8 A;  3AN2 B;  2RVQ D;  3UTB D;  5GSU D;  5B2J A;  4CSR A;  4Z2M G;  1M19 D;  2ARO A;  4YM6 B;  5JRG A;  4UUZ B;  3B0D C;  5B31 D;  4XUJ C;  4J8U D;  4E45 A;  5B32 B;  2JSS A;  1HTA A;  3AV1 D;  2FJ7 A;  5DNN A;  1P3B D;  2PYO C;  3TU4 C;  4J8X C;  3AZG D;  3AV2 C;  3LZ0 C;  3REK A;  3B0D B;  1ULY A;  1P3L A;  4KUD A;  1P3K C;  3MNN D;  4H9N B;  5B0Y D;  5B24 B;  2PYO B;  4H9Q B;  4J8X B;  3MGS A;  3AV2 B;  2CV5 B;  5B0Z C;  1P3K B;  5C3I B;  3AYW C;  3C1B B;  3AZN D;  3B0C T;  5GXQ A;  1M1A A;  3KUY C;  3W97 C;  3AZI A;  4H9P B;  3MGP D;  4ZUX C;  4QLC C;  5AV5 B;  1ZLA D;  2NQB A;  4WU8 D;  3C1C C;  5B0Z B;  3AZL D;  5BNX A;  3AYW B;  3WKJ A;  4NE3 A;  3KUY B;  4J8W B;  3W97 B;  3AZK A;  1AOI D;  4ZUX B;  4QLC B;  1HQ3 B;  3MGQ B;  1EQZ C;  3W99 D;  5B33 C;  3X1V D;  5E5A A;  1TZY C;  5GT0 B;  3REL A;  5AV9 C;  5B2J D;  5AVC A;  1EQZ B;  5GSU C;  2HIO B;  2ARO D;  5B33 B;  1P3A B;  4JJN B;  5FUG A;  3AFA D;  3B6F D;  4Z5T C;  1P3M A;  2IO5 C;  5AV9 B;  5AV6 D;  1N1J B;  2FJ7 D;  4G92 C;  4KHA B;  1P3G A;  4NE5 A;  3REK D;  5KDM A;  3W96 C;  4Z5T B;  5AY8 D;  4CAY B;  1KX3 D;  1U35 A;  4WNN B;  3W96 B;  3UTA A;  3X1S B;  1H3O B;  3LZ1 A;  5GXQ D;  4XZQ A;  1P3F C;  3WA9 A;  3REH D;  1KX4 C;  4KGC A;  2NZD C;  3V9R B;  3WKJ D;  3KWQ D;  3LJA C;  1P3F B;  3NQJ B;  3AZK D;  1P34 B;  3X1T C;  4H9S A;  3R45 A;  1KX4 B;  2NZD B;  3X1U C;  5E5A D;  3LJA B;  2F8N K;  3REL D;  3X1T B;  3UTB A;  5AVC D;  3X1U B;  5DNM D;  2BYM B; 
#chains in the Genus database with same CATH topology
 2DQN C;  5JRG C;  1P3M D;  5B31 A;  4J8U A;  1JFI B;  3P5J B;  4CSR B;  1P3G D;  2Y2M A;  5DNN C;  3VH6 T;  3MGR A;  5CPJ A;  4R8P C;  1P3L C;  1B67 A;  4KUD C;  1M18 A;  5B1M B;  2F8N A;  3A6N D;  3MNN A;  5DNN B;  5B0Y A;  5CP6 C;  3MGS C;  5B32 D;  3UTA D;  4YS3 A;  1KX5 C;  4R8P B;  3AZH C;  4XZQ D;  1M1A C;  3B6G C;  4Z66 A;  1P3P A;  3AZI C;  2NQB C;  5CP6 B;  3O62 C;  3MGP A;  1ZLA A;  3MGS B;  4KGC D;  1KX5 B;  3AZL A;  5B24 D;  3AZH B;  3AZJ C;  3B6G B;  2CV5 D;  4DRA A;  5B1L C;  3O62 B;  4NFT A;  3C1B D;  4J8V C;  2JCH A;  1P3I C;  4X23 A;  5BNX B;  1BH8 B;  3AZJ B;  3W99 A;  5AV5 D;  5F99 B;  3AZE C;  5B40 C;  5B1L B;  4J8V B;  3AZF B;  3UT9 A;  1P3I B;  4J8W D;  3H0M C;  1HQ3 D;  3MGQ D;  3AFA A;  3AZE B;  5B40 B;  3B6F A;  5AV6 A;  5CPI A;  4WV4 B;  3LEL A;  3EG5 B;  2ZM5 A;  5GT0 D;  5B2I C;  3MGR D;  5CPJ D;  2YFV B;  4XUJ B;  5AV8 A;  1TAF A;  2HIO D;  1M18 D;  5AVB C;  1S32 C;  2F8N D;  3VH5 A;  2F8N H;  5AY8 A;  3TU4 B;  1P3O C;  4YS3 D;  1U35 C;  3LZ0 B;  5B2I B;  1KX3 A;  1ID3 C;  2XD5 A;  3W98 C;  3REI A;  3LZ1 C;  5AVB B;  1S32 B;  4Z66 D;  1P3P D;  3WA9 C;  1BH9 A;  3REH A;  3WAA C;  1P3O B;  1U35 B;  3W98 B;  1ID3 B;  3LZ1 B;  3KWQ A;  3KXB A;  3MVD A;  2CWE A;  4H9S C;  3X1S D;  3WAA B;  4X23 D;  3C1C B;  3NQU A;  5CPK A;  3KFU G;  3KSY A;  4ZBJ C;  1B6W A;  2RVQ C;  3UTB C;  3UT9 D;  5G49 B;  2BYK B;  3AZM A;  1P34 D;  1M19 C;  3WTP A;  1R4V A;  4DRB A;  5DNM A;  1TZY B;  4ZBJ B;  4WU9 A;  5BS7 A;  5B31 C;  5BO0 A;  4J8U C;  2VQR A;  5CPI D;  3LEL D;  5GSU B;  3AV1 C;  1M19 B;  3AN2 A;  1P3B C;  4Z2M H;  4WJ3 C;  5AV8 D;  3AZG C;  5B31 B;  4H9R B;  1W2E A;  2IO5 B;  4J8U B;  1F66 D;  3MNN C;  4G92 B;  4YM6 A;  3A6N A;  5B0Y C;  3REJ D;  3AV1 B;  4UUZ A;  1P3B B;  2ZY2 A;  5BNV B;  3AZG B;  5B32 A;  3REI D;  2L5A A;  3AZN C;  4Z66 C;  3MNN B;  5BT1 D;  4H9O A;  5B0Y B;  3MGP C;  1ZLA C;  5B1M D;  4WU8 C;  3AZL C;  4H9N A;  3KXB D;  3MVD D;  5B24 A;  3AZN B;  2PYO A;  2CV5 A;  4J8X A;  3AV2 A;  1AOI C;  1ZLA B;  3WTP E;  1P3K A;  4LD9 D;  3C1B A;  5CPK D;  4WU8 B;  3AZL B;  5JA4 B;  3W99 C;  3X1V C;  4H9P A;  5AV5 A;  1AOI B;  5B0Z A;  5GT3 D;  3AYW A;  5B2J C;  3AZM D;  3WTP D;  3A1K A;  3KUY A;  4J8W A;  2ARO C;  3W97 A;  4WU9 D;  3X1V B;  3W99 B;  4NE6 A;  1HQ3 A;  4QLC A;  4WZS B;  3AFA C;  3MGQ A;  3B6F C;  1F1E A;  5AV6 C;  5CPI C;  5B2J B;  2XD1 A;  2FJ7 C;  5F99 D;  3AN2 D;  2ARO B;  5JRG B;  3REK C;  5GT0 A;  3AZF D;  3B6F B;  2HIO A;  5B33 A;  1P3A A;  4YM6 D;  4JJN A;  5AY8 C;  2FJ7 B;  5B31 G;  2ZY4 A;  1KX3 C;  3REK B;  2Y2Q A;  5AV9 A;  1P3L B;  4KUD B;  1N1J A;  5CHL B;  4KHA A;  5GXQ C;  5AY8 B;  4XUJ D;  3REH C;  4Z5T A;  4G91 C;  3WKJ C;  3KWQ C;  2RIQ A;  5GXQ B;  1M1A B;  3TU4 D;  4J8X D;  3AV2 D;  2PYO D;  3LZ0 D;  3AZI B;  3AZK C;  2NQB B;  4WNN A;  3W96 A;  1P3K D;  3X1S A;  4G91 B;  2W8S A;  3EPK A;  3WKJ B;  5E5A C;  3AZK B;  2G5I C;  5B0Z D;  3REL C;  3V9R A;  5AVC C;  3AYW D;  3KUY D;  3NQJ A;  3W97 D;  3B0C W;  5E5A B;  1P34 A;  4ZUX D;  4QLC D;  5DNM C;  5BS7 C;  1KX4 A;  2NZD A;  3C1C D;  1P3M C;  3REL B;  5AVC B;  1A7W A;  1P3G C;  5FUG B;  5DNM B;  3X1T A;  1EQZ D;  1Q9C A;  3H0R C;  1P3M B;  3X1U A;  5B33 D;  1P3A D;  4JJN D;  3AL0 C;  1TZY D;  2YFW A;  3A6N C;  1F66 A;  1P3G B;  3REJ A;  5KDM B;  5AV9 D;  5B32 C;  3UTA C;  1JFI A;  4XZQ C;  4UPK A;  3A6N B;  3VH5 W;  4Z5T D;  4KGC C;  2Y2H A;  4M6B A;  3UTA B;  5B1M A;  2G5H C;  5B24 C;  4XZQ B;  1KU5 A;  3WA9 B;  2CV5 C;  4H9O B;  3W96 D;  4KGC B;  4R8P A;  5C3I C;  4EO5 C;  3C1B C;  4LD9 A;  2BG1 A;  3IP4 C;  5CP6 A;  5AV5 C;  4DQY B;  3R45 B;  1KX5 A;  4EO5 B;  3AZH A;  5GT3 A;  1P3F D;  3B6G A;  4J8W C;  1KX4 D;  3O62 A;  1HQ3 C;  3MGQ C;  2NZD D;  3UTB B;  3LJA D;  1BH8 A;  3AZJ A;  5F99 A;  3X1T D;  5B1L A;  5GT0 C;  3EPJ A;  3MGR C;  4J8V A;  3X1U D;  5CPJ C;  3AZF A;  2HIO C;  2HUE C;  1P3I A;  1M18 C;  1P3A C;  4JJN C;  3AZE A;  5B40 A;  4YS3 C;  3MGR B;  5CPJ B;  2HUE B;  1M18 B;  3VH6 A;  2F8N B;  3VH5 T;  1P3P C;  5JRG D;  2YFV A;  4XUJ A;  4YS3 B;  5DNN D;  4Z66 B;  2Y2L A;  5B32 G;  4H9Q A;  3TU4 A;  1P3P B;  3LZ0 A;  5B2I A;  3VH6 W;  1P3L D;  4R8P D;  3MGP B;  3X1S C;  4KUD D;  5AVB A;  1S32 A;  4X23 C;  1PZR A;  5CP6 D;  3MGS D;  1P3O A;  3W98 A;  2F2A C;  1KX5 D;  1ID3 A;  3AZH D;  1M1A D;  3UT9 C;  3EPL A;  4X23 B;  3B6G D;  4E44 A;  3AZI D;  1P34 C;  2NQB D;  3O62 D;  4ZUX A;  3WAA A;  4AWL C;  3C1C A;  3AZJ D;  3UT9 B;  3LEL C;  5B1L D;  3EPH A;  2Y2G A;  2Y2J A;  3AFA B;  4J8V D;  5AV8 C;  4AWL B;  1P3I D;  5G49 A;  1EQZ A;  2BYK A;  2ZY3 A;  5AV6 B;  5CPI B;  3LEL B;  1F66 C;  3AZE D;  1TZY A;  5B40 D;  3REJ C;  2J8P A;  5AV8 B;  1TAF B;  3REI C;  5GSU A;  4HGA C;  2JE5 A;  1M19 A;  2YFW B;  1F66 B;  5BT1 C;  1T3U A;  3REJ B;  1KX3 B;  2F8N G;  4H9R A;  5B1M C;  3REI B;  3KXB C;  3MVD C;  4HGA B;  4CAY A;  3AV1 A;  1BH9 B;  5B2I D;  1P3B A;  3REH B;  5BNV A;  3AZG A;  1H3O A;  5AVB D;  1S32 D;  4LD9 C;  5CPK C;  3KWQ B;  3KXB B;  3MVD B;  1WWS A;  1P3O D;  1U35 D;  3W98 D;  1ID3 D;  1WWI A;  3B0B A;  3LZ1 D;  5GT3 C;  4LD9 B;  3AZM C;  3NQU B;  3AZN A;  5CPK B;  3WTP C;  1P3F A;  3WA9 D;  3H0L C;  2UWX A;  4WU9 C;  3WAA D;  2FFF B;  4WU8 A;  3LJA A;  5GT3 B;  5JA4 A;  3AZM B;  3WTP B;  5F99 C;  3AN2 C;  1BFM A;  4WU9 B;  1AOI A;  5BO0 B;  3AZF C;  3X1V A;  2BYM A;  4YM6 C;  2LY8 A;  3AN2 B;  2RVQ D;  3UTB D;  5GSU D;  5B2J A;  4CSR A;  4Z2M G;  1M19 D;  2ARO A;  4YM6 B;  5JRG A;  4UUZ B;  3B0D C;  5B31 D;  4XUJ C;  4J8U D;  4E45 A;  5B32 B;  2JSS A;  1HTA A;  3AV1 D;  2FJ7 A;  5DNN A;  1P3B D;  2PYO C;  3TU4 C;  4J8X C;  3AZG D;  3AV2 C;  3LZ0 C;  3REK A;  3B0D B;  1ULY A;  1P3L A;  4KUD A;  1P3K C;  2DF4 C;  2Y2O A;  3MNN D;  4H9N B;  5B0Y D;  5B24 B;  2Y2I A;  2PYO B;  4H9Q B;  4J8X B;  3MGS A;  3AV2 B;  2CV5 B;  5B0Z C;  1P3K B;  5C3I B;  2ZY5 A;  3C1B B;  3AYW C;  3AZN D;  3B0C T;  5GXQ A;  1M1A A;  3KUY C;  3W97 C;  3AZI A;  4H9P B;  3MGP D;  4ZUX C;  4QLC C;  5AV5 B;  1ZLA D;  2NQB A;  4WU8 D;  3C1C C;  5B0Z B;  3AZL D;  5BNX A;  3AYW B;  3WKJ A;  4NE3 A;  3KUY B;  4J8W B;  3W97 B;  3AZK A;  1AOI D;  4ZUX B;  4QLC B;  1HQ3 B;  3MGQ B;  1EQZ C;  3W99 D;  5B33 C;  3X1V D;  5E5A A;  1TZY C;  2Y2P A;  5GT0 B;  3REL A;  5AV9 C;  5B2J D;  5AVC A;  1EQZ B;  5GSU C;  2HIO B;  2ARO D;  5B33 B;  1P3A B;  4JJN B;  5FUG A;  3AFA D;  3B6F D;  4Z5T C;  1P3M A;  2IO5 C;  5AV9 B;  5AV6 D;  1N1J B;  2FJ7 D;  4G92 C;  4KHA B;  3A1I A;  1P3G A;  4NE5 A;  3REK D;  5KDM A;  3W96 C;  4Z5T B;  5AY8 D;  4CAY B;  3FDD A;  1KX3 D;  1U35 A;  4WNN B;  3W96 B;  3UTA A;  3X1S B;  1H3O B;  3LZ1 A;  5GXQ D;  4XZQ A;  2Y2K A;  1P3F C;  3WA9 A;  3REH D;  1KX4 C;  4KGC A;  2NZD C;  3V9R B;  3WKJ D;  3KWQ D;  3LJA C;  3F6T A;  1P3F B;  3NQJ B;  3AZK D;  1P34 B;  3X1T C;  4H9S A;  3R45 A;  1KX4 B;  2NZD B;  3X1U C;  5E5A D;  3LJA B;  2F8N K;  3REL D;  3X1T B;  3UTB A;  5AVC D;  3X1U B;  2Y2N A;  5DNM D;  2BYM B;  1Z2C B; 
#chains in the Genus database with same CATH homology
 2DQN C;  5JRG C;  1P3M D;  5B31 A;  4J8U A;  1JFI B;  3P5J B;  4CSR B;  1P3G D;  2Y2M A;  5DNN C;  3VH6 T;  3MGR A;  5CPJ A;  4R8P C;  1P3L C;  1B67 A;  4KUD C;  1M18 A;  5B1M B;  2F8N A;  3A6N D;  3MNN A;  5DNN B;  5B0Y A;  5CP6 C;  3MGS C;  5B32 D;  3UTA D;  4YS3 A;  1KX5 C;  4R8P B;  3AZH C;  4XZQ D;  1M1A C;  3B6G C;  4Z66 A;  1P3P A;  3AZI C;  2NQB C;  5CP6 B;  3O62 C;  3MGP A;  1ZLA A;  3MGS B;  4KGC D;  1KX5 B;  3AZL A;  5B24 D;  3AZH B;  3AZJ C;  3B6G B;  2CV5 D;  4DRA A;  5B1L C;  3O62 B;  4NFT A;  3C1B D;  4J8V C;  2JCH A;  1P3I C;  4X23 A;  5BNX B;  1BH8 B;  3AZJ B;  3W99 A;  5AV5 D;  5F99 B;  3AZE C;  5B40 C;  5B1L B;  4J8V B;  3AZF B;  3UT9 A;  1P3I B;  4J8W D;  3H0M C;  1HQ3 D;  3MGQ D;  3AFA A;  3AZE B;  5B40 B;  3B6F A;  5AV6 A;  5CPI A;  4WV4 B;  3LEL A;  3EG5 B;  2ZM5 A;  5GT0 D;  5B2I C;  3MGR D;  5CPJ D;  2YFV B;  4XUJ B;  5AV8 A;  1TAF A;  2HIO D;  1M18 D;  5AVB C;  1S32 C;  2F8N D;  3VH5 A;  2F8N H;  5AY8 A;  3TU4 B;  1P3O C;  4YS3 D;  1U35 C;  3LZ0 B;  5B2I B;  1KX3 A;  1ID3 C;  2XD5 A;  3W98 C;  3REI A;  3LZ1 C;  5AVB B;  1S32 B;  4Z66 D;  1P3P D;  3WA9 C;  1BH9 A;  3REH A;  3WAA C;  1P3O B;  1U35 B;  3W98 B;  1ID3 B;  3LZ1 B;  3KWQ A;  3KXB A;  3MVD A;  2CWE A;  4H9S C;  3X1S D;  3WAA B;  4X23 D;  3C1C B;  3NQU A;  5CPK A;  3KFU G;  3KSY A;  4ZBJ C;  1B6W A;  2RVQ C;  3UTB C;  3UT9 D;  5G49 B;  2BYK B;  3AZM A;  1P34 D;  1M19 C;  3WTP A;  1R4V A;  4DRB A;  5DNM A;  1TZY B;  4ZBJ B;  4WU9 A;  5BS7 A;  5B31 C;  5BO0 A;  4J8U C;  2VQR A;  5CPI D;  3LEL D;  5GSU B;  3AV1 C;  1M19 B;  3AN2 A;  1P3B C;  4Z2M H;  4WJ3 C;  5AV8 D;  3AZG C;  5B31 B;  4H9R B;  1W2E A;  2IO5 B;  4J8U B;  1F66 D;  3MNN C;  4G92 B;  4YM6 A;  3A6N A;  5B0Y C;  3REJ D;  3AV1 B;  4UUZ A;  1P3B B;  2ZY2 A;  5BNV B;  3AZG B;  5B32 A;  3REI D;  2L5A A;  3AZN C;  4Z66 C;  3MNN B;  5BT1 D;  4H9O A;  5B0Y B;  3MGP C;  1ZLA C;  5B1M D;  4WU8 C;  3AZL C;  4H9N A;  3KXB D;  3MVD D;  5B24 A;  3AZN B;  2PYO A;  2CV5 A;  4J8X A;  3AV2 A;  1AOI C;  1ZLA B;  3WTP E;  1P3K A;  4LD9 D;  3C1B A;  5CPK D;  4WU8 B;  3AZL B;  5JA4 B;  3W99 C;  3X1V C;  4H9P A;  5AV5 A;  1AOI B;  5B0Z A;  5GT3 D;  3AYW A;  5B2J C;  3AZM D;  3WTP D;  3A1K A;  3KUY A;  4J8W A;  2ARO C;  3W97 A;  4WU9 D;  3X1V B;  3W99 B;  4NE6 A;  1HQ3 A;  4QLC A;  4WZS B;  3AFA C;  3MGQ A;  3B6F C;  1F1E A;  5AV6 C;  5CPI C;  5B2J B;  2XD1 A;  2FJ7 C;  5F99 D;  3AN2 D;  2ARO B;  5JRG B;  3REK C;  5GT0 A;  3AZF D;  3B6F B;  2HIO A;  5B33 A;  1P3A A;  4YM6 D;  4JJN A;  5AY8 C;  2FJ7 B;  5B31 G;  2ZY4 A;  1KX3 C;  3REK B;  2Y2Q A;  5AV9 A;  1P3L B;  4KUD B;  1N1J A;  5CHL B;  4KHA A;  5GXQ C;  5AY8 B;  4XUJ D;  3REH C;  4Z5T A;  4G91 C;  3WKJ C;  3KWQ C;  2RIQ A;  5GXQ B;  1M1A B;  3TU4 D;  4J8X D;  3AV2 D;  2PYO D;  3LZ0 D;  3AZI B;  3AZK C;  2NQB B;  4WNN A;  3W96 A;  1P3K D;  3X1S A;  4G91 B;  2W8S A;  3EPK A;  3WKJ B;  5E5A C;  3AZK B;  2G5I C;  5B0Z D;  3REL C;  3V9R A;  5AVC C;  3AYW D;  3KUY D;  3NQJ A;  3W97 D;  3B0C W;  5E5A B;  1P34 A;  4ZUX D;  4QLC D;  5DNM C;  5BS7 C;  1KX4 A;  2NZD A;  3C1C D;  1P3M C;  3REL B;  5AVC B;  1A7W A;  1P3G C;  5FUG B;  5DNM B;  3X1T A;  1EQZ D;  1Q9C A;  3H0R C;  1P3M B;  3X1U A;  5B33 D;  1P3A D;  4JJN D;  3AL0 C;  1TZY D;  2YFW A;  3A6N C;  1F66 A;  1P3G B;  3REJ A;  5KDM B;  5AV9 D;  5B32 C;  3UTA C;  1JFI A;  4XZQ C;  4UPK A;  3A6N B;  3VH5 W;  4Z5T D;  4KGC C;  2Y2H A;  4M6B A;  3UTA B;  5B1M A;  2G5H C;  5B24 C;  4XZQ B;  1KU5 A;  3WA9 B;  2CV5 C;  4H9O B;  3W96 D;  4KGC B;  4R8P A;  5C3I C;  4EO5 C;  3C1B C;  4LD9 A;  2BG1 A;  3IP4 C;  5CP6 A;  5AV5 C;  4DQY B;  3R45 B;  1KX5 A;  4EO5 B;  3AZH A;  5GT3 A;  1P3F D;  3B6G A;  4J8W C;  1KX4 D;  3O62 A;  1HQ3 C;  3MGQ C;  2NZD D;  3UTB B;  3LJA D;  1BH8 A;  3AZJ A;  5F99 A;  3X1T D;  5B1L A;  5GT0 C;  3EPJ A;  3MGR C;  4J8V A;  3X1U D;  5CPJ C;  3AZF A;  2HIO C;  2HUE C;  1P3I A;  1M18 C;  1P3A C;  4JJN C;  3AZE A;  5B40 A;  4YS3 C;  3MGR B;  5CPJ B;  2HUE B;  1M18 B;  3VH6 A;  2F8N B;  3VH5 T;  1P3P C;  5JRG D;  2YFV A;  4XUJ A;  4YS3 B;  5DNN D;  4Z66 B;  2Y2L A;  5B32 G;  4H9Q A;  3TU4 A;  1P3P B;  3LZ0 A;  5B2I A;  3VH6 W;  1P3L D;  4R8P D;  3MGP B;  3X1S C;  4KUD D;  5AVB A;  1S32 A;  4X23 C;  1PZR A;  5CP6 D;  3MGS D;  1P3O A;  3W98 A;  2F2A C;  1KX5 D;  1ID3 A;  3AZH D;  1M1A D;  3UT9 C;  3EPL A;  4X23 B;  3B6G D;  4E44 A;  3AZI D;  1P34 C;  2NQB D;  3O62 D;  4ZUX A;  3WAA A;  4AWL C;  3C1C A;  3AZJ D;  3UT9 B;  3LEL C;  5B1L D;  3EPH A;  2Y2G A;  2Y2J A;  3AFA B;  4J8V D;  5AV8 C;  4AWL B;  1P3I D;  5G49 A;  1EQZ A;  2BYK A;  2ZY3 A;  5AV6 B;  5CPI B;  3LEL B;  1F66 C;  3AZE D;  1TZY A;  5B40 D;  3REJ C;  2J8P A;  5AV8 B;  1TAF B;  3REI C;  5GSU A;  4HGA C;  2JE5 A;  1M19 A;  2YFW B;  1F66 B;  5BT1 C;  1T3U A;  3REJ B;  1KX3 B;  2F8N G;  4H9R A;  5B1M C;  3REI B;  3KXB C;  3MVD C;  4HGA B;  4CAY A;  3AV1 A;  1BH9 B;  5B2I D;  1P3B A;  3REH B;  5BNV A;  3AZG A;  1H3O A;  5AVB D;  1S32 D;  4LD9 C;  5CPK C;  3KWQ B;  3KXB B;  3MVD B;  1WWS A;  1P3O D;  1U35 D;  3W98 D;  1ID3 D;  1WWI A;  3B0B A;  3LZ1 D;  5GT3 C;  4LD9 B;  3AZM C;  3NQU B;  3AZN A;  5CPK B;  3WTP C;  1P3F A;  3WA9 D;  3H0L C;  2UWX A;  4WU9 C;  3WAA D;  2FFF B;  4WU8 A;  3LJA A;  5GT3 B;  5JA4 A;  3AZM B;  3WTP B;  5F99 C;  3AN2 C;  1BFM A;  4WU9 B;  1AOI A;  5BO0 B;  3AZF C;  3X1V A;  2BYM A;  4YM6 C;  2LY8 A;  3AN2 B;  2RVQ D;  3UTB D;  5GSU D;  5B2J A;  4CSR A;  4Z2M G;  1M19 D;  2ARO A;  4YM6 B;  5JRG A;  4UUZ B;  3B0D C;  5B31 D;  4XUJ C;  4J8U D;  4E45 A;  5B32 B;  2JSS A;  1HTA A;  3AV1 D;  2FJ7 A;  5DNN A;  1P3B D;  2PYO C;  3TU4 C;  4J8X C;  3AZG D;  3AV2 C;  3LZ0 C;  3REK A;  3B0D B;  1ULY A;  1P3L A;  4KUD A;  1P3K C;  2DF4 C;  2Y2O A;  3MNN D;  4H9N B;  5B0Y D;  5B24 B;  2Y2I A;  2PYO B;  4H9Q B;  4J8X B;  3MGS A;  3AV2 B;  2CV5 B;  5B0Z C;  1P3K B;  5C3I B;  2ZY5 A;  3C1B B;  3AYW C;  3AZN D;  3B0C T;  5GXQ A;  1M1A A;  3KUY C;  3W97 C;  3AZI A;  4H9P B;  3MGP D;  4ZUX C;  4QLC C;  5AV5 B;  1ZLA D;  2NQB A;  4WU8 D;  3C1C C;  5B0Z B;  3AZL D;  5BNX A;  3AYW B;  3WKJ A;  4NE3 A;  3KUY B;  4J8W B;  3W97 B;  3AZK A;  1AOI D;  4ZUX B;  4QLC B;  1HQ3 B;  3MGQ B;  1EQZ C;  3W99 D;  5B33 C;  3X1V D;  5E5A A;  1TZY C;  2Y2P A;  5GT0 B;  3REL A;  5AV9 C;  5B2J D;  5AVC A;  1EQZ B;  5GSU C;  2HIO B;  2ARO D;  5B33 B;  1P3A B;  4JJN B;  5FUG A;  3AFA D;  3B6F D;  4Z5T C;  1P3M A;  2IO5 C;  5AV9 B;  5AV6 D;  1N1J B;  2FJ7 D;  4G92 C;  4KHA B;  3A1I A;  1P3G A;  4NE5 A;  3REK D;  5KDM A;  3W96 C;  4Z5T B;  5AY8 D;  4CAY B;  3FDD A;  1KX3 D;  1U35 A;  4WNN B;  3W96 B;  3UTA A;  3X1S B;  1H3O B;  3LZ1 A;  5GXQ D;  4XZQ A;  2Y2K A;  1P3F C;  3WA9 A;  3REH D;  1KX4 C;  4KGC A;  2NZD C;  3V9R B;  3WKJ D;  3KWQ D;  3LJA C;  3F6T A;  1P3F B;  3NQJ B;  3AZK D;  1P34 B;  3X1T C;  4H9S A;  3R45 A;  1KX4 B;  2NZD B;  3X1U C;  5E5A D;  3LJA B;  2F8N K;  3REL D;  3X1T B;  3UTB A;  5AVC D;  3X1U B;  2Y2N A;  5DNM D;  2BYM B;  1Z2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...