1Q9CA

Crystal structure of the histone domain of son of sevenless
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
164
Chain Sequence
LPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIESLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Son of sevenless protein
publication title Tandem Histone Folds in the Structure of the N-terminal Segment of the Ras Activator Son of Sevenless
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 164
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2003-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1q9cA01
1P3KD 1ID3D 5AVBC 4WU9A 4R8PA 1M19B 3WAAD 4QLCC 5GT3C 5E5AB 4EO5B 3KXBD 2YFVA 5B0YD 3WA9A 1F66D 3R45A 5AV6D 3LZ0D 2NQBB 2AROC 3X1VC 3UT9C 1P3OC 1ID3A 5AV8D 3LELC 5B32G 3NQUB 3AZHD 4HGAC 3X1TA 3LELB 4ZUXC 3B0CW 1F1EA 1P34D 3MVDA 1F66A 3WKJC 5AV6A 3LZ0A 4X23C 4KUDA 2IO5B 5AV9C 4Z66A 4JJNA 2FJ7C 3AZHA 5GT0D 1P3BD 4WV4B 2YFWA 5B24A 3W99C 1TZYD 2BYKB 5B2IC 1EQZA 1HQ3B 3AZFD 3MNNC 2HUEB 5B40B 4WZSB 3AFAB 1P3GD 1P3LB 3LZ1C 1P3BA 3AZGC 3AYWB 5B1LC 3AV2A 5B31D 1M1AC 5F99D 4R8PC 4J8XB 1S32A 2BYMA 2HIOD 5G49A 3AZJD 4LD9C 4WU9B 3W96A 5AY8C 3V9RA 3O62A 3WA9C 3KWQD 1KX3D 3B0CT 5C3IC 1P3PB 5B2JA 1P3KC 1ID3C 5DNND 4J8UD 3R45B 1TAFA 3WAAC 3W97B 2HIOA 2PYOA 4NE6A 3KXBC 5GSUD 5B0YC 3KWQA 3X1TB 1N1JB 4Z2MG 1KX3A 3AZKD 1F66C 5AV6C 3LZ0C 3REHA 5B1MD 3MVDB 4KGCD 5AV8C 4J8UA 3REKD 3AZHC 4J8VD 4KUDB 3MGRD 4Z66B 4AWLC 4JJNB 3REID 5JRGD 1P3FD 4UUZA 1P34C 5GSUA 2YFWB 5B24B 3KUYD 1BH8A 5E5AD 3AZKA 3AZLD 1EQZB 5JA4B 5B1MA 5CPJD 3X1VA 1P3OA 4H9NA 2F8ND 5GT0C 1P3BC 1P3AD 3REIA 1WWIA 4E45A 5B0ZD 1TZYC 5BNXA 3KUYA 3X1UD 3AV2B 4ZBJB 3AZLA 1M18B 3AZFC 3WKJA 4NE5A 5CPIB 3X1SD 4X23A 1S32B 1P3GC 5G49B 5AV9A 4XZQB 3W96B 1BH9B 3V9RB 4WU8D 3O62B 1P3AA 3W99A 5B31C 5BO0A 5F99C 5B2JB 1U35D 2HIOC 3UTAD 3AZJC 5B33B 3C1BB 5BT1D 1TAFB 3X1SA 5GXQD 4YM6B 3MGPD 3KWQC 2PYOB 3B6GD 1KX3C 3MGQA 3C1CD 3LZ1A 1JFIA 3AZGA 3REJD 5B1LA 1KX5B 5DNNC 4J8UC 1M1AA 3REHB 5AVBB 3MGSD 3VH5T 3AV1A 5CP6D 4LD9A 5AY8A 5GSUC 4YS3D 5CPKD 4QLCB 5GT3B 3AZKC 1BH8B 1AOID 5B1MC 4KGCC 4H9PA 3REKC 1P3KA 3WTPD 4Z5TD 4J8VC 4CSRA 3MGRC 2AROB 5FUGB 3UT9B 3X1VB 1P3OB 4H9NB 5KDMA 3MGSA 3REIC 3WAAA 5JRGC 1P3FC 5DNMD 3KXBA 3KUYC 5B0YA 4HGAB 3AZLC 3W98D 4ZUXB 5BNXB 4J8WD 1BFMA 3B0DC 1KX4D 1AOIA 5CPJC 2CV5D 5AV8A 4Z5TA 3WKJB 1P3ID 4X23B 4XUJD 1P3AC 5AV9B 5B0ZC 3A6ND 2FJ7B 3LJAD 5AV5D 1P34A 3X1UC 3W99B 3W98A 4H9QA 4G92C 5BO0B 5B2IB 4J8WA 1KX4A 3X1SC 2CV5A 3MGQC 1ZLAD 4WU8C 4XUJA 5GT0A 4H9RA 3MNNB 1Q9CA 3A6NA 3UTBD 4H9SA 3LJAA 1TZYA 5AV5A 3LZ1B 3TU4D 1JFIB 3AZGB 5B1LB 1U35C 3UTAC 3AZMD 3AZFA 3AV1C 1M1AB 5BT1C 5GXQC 3MGPC 4R8PB 3B6GC 3AZND 1P3GA 3AV1B 3C1CC 1ZLAA 4LD9B 5AY8B 2YFVB 4DRBA 3AZED 3REJC 3WA9B 3UTBA 5C3IB 5B31A 2NZDD 1B67A 5AVCD 5F99A 4H9PB 3AZMA 5B32D 1P3KB 1ID3B 3MGSC 3AZJA 5CP6C 4CSRB 4YS3C 3RELD 3WAAB 5CPKC 5KDMB 3KXBB 1P3MD 5B0YB 3AZEA 1AOIC 3B6FD 4NE3A 3WTPC 2LY8A 3VH6W 5DNNA 1F66B 4Z5TC 5AV6B 5AVCA 3LZ0B 3AZID 3AN2D 5AV8B 5BNVA 5DNMC 3AZHB 3RELA 1M19D 1B6WA 4AWLB 1H3OA 1R4VA 3W98C 3WTPE 1P34B 4J8WC 3B0BA 1P3MA 1KX4C 4KHAA 1HTAA 2CV5C 4KGCA 3REKA 1P3IC 3AN2A 4H9OA 4Z2MH 4XUJC 3MGRA 4J8VA 2NQBD 3A6NC 4H9SC 5JRGA 5AV5C 3LJAC 1P3FA 5GT0B 4H9RB 1P3BB 3LELD 5E5AA 1TZYB 5CPJA 2BYMB 3AZFB 1ZLAC 2F8NA 1P3GB 5B0ZA 3UTBC 3TU4C 3KSYA 1WWSA 3X1UA 3AZMC 3VH6T 5B31B 5F99B 4G91C 3AZNC 2HIOB 1HQ3D 3AZJB 4WU8A 3AZEC 5B40D 2CWEA 3KWQB 3AFAD 1P3LD 1KX3B 4E44A 2NZDC 5BS7C 3AYWD 5AVCC 5B32C 1U35A 2BYKA 5DNNB 4J8UB 3UTAA 2L5AA 5GXQA 3MGPA 3RELC 4J8XD 1HQ3A 3B6GA 4WU9D 3C1CA 4UUZB 5GSUB 1P3MC 3B6FC 5B40A 1P3LA 3AFAA 3REJA 3AZKB 3AZIC 4KHAB 3AN2C 2F8NK 1P3PD 5B1MB 4KGCB 3REKB 3NQJA 5CP6A 4H9OB 5B31G 4J8VB 3VH5A 3MGRB 4CAYA 1M19C 4YS3A 3W97D 5CPKA 3REIB 5E5AC 4EO5C 4WNNA 5JRGB 1P3FB 2RVQD 3X1TD 3KUYB 3AZLB 3WTPA 3B0DB 2NQBC 1P3PA 5CPJB 3MVDD 5DNMA 2F8NB 4KUDD 3W97A 4Z66D 1P3AB 5B0ZB 4JJND 1A7WA 1N1JA 5B24D 3X1UB 1EQZD 4G92B 1P3IA 3X1SB 2IO5C 3MGQB 4M6BA 4WU8B 4NFTA 3AV2D 1U35B 1M18D 1HQ3C 3UTAB 5JA4A 5CPID 5GXQB 3MGPB 1S32D 2HUEC 5B40C 1P3LC 3AFAC 3B6GB 4XZQD 3C1CB 3W96D 3TU4A 3AYWC 2F8NG 3O62D 3REJB 4J8XC 5B2JD 1M18A 3NQJB 3AZNA 3MGSB 4WU9C 5CP6B 5B33D 3C1BD 5CPIA 4YM6D 4CAYB 4YS3B 5CPKB 2PYOD 4XZQA 4WNNB 1BH9A 2NZDA 5BS7A 1P3PC 1AOIB 1KX5D 5B32A 3WTPB 4Z5TB 3REHD 3W97C 5AVBD 5B33A 3C1BA 5DNMB 4YM6A 2F8NH 2RVQC 3X1TC 3B6FA 4QLCD 5GT3D 3W98B 4H9QB 4J8WB 1KX4B 3AZIA 3MVDC 1KX5A 1ULYA 2CV5B 1P3IB 4KUDC 4XUJB 2AROD 4Z66C 3UT9D 3X1VD 1P3OD 4JJNC 5AVBA 1M19A 3A6NB 3LJAB 5AV5B 5B24C 4QLCA 5GT3A 2JSSA 1EQZC 4ZUXD 2NQBA 3WKJD 3NQUA 1ZLAB 4X23D 2AROA 5FUGA 3UT9A 5AV9D 3VH5W 3LELA 2FJ7D 3UTBB 3TU4B 3AV2C 4ZBJC 3W99D 1M18C 4ZUXA 3AZMB 5B2ID 5CPIC 1S32C 4G91B 3AZNB 4XZQC 3W96C 3MNND 3O62C 3AZEB 2FJ7A 3MGQD 3LZ1D 2NZDB 3VH6A 3AZGD 5AVCB 5B2JC 5B1LD 1KU5A 5B32B 5B2IA 5BNVB 5B33C 3C1BC 1M1AD 4YM6C 3RELB 4R8PD 2PYOC 1H3OB 3AV1D 4LD9D 5AY8D 3MNNA 1P3MB 3B6FB 5CHLB 3AYWA 3WA9D 1KX5C 4DRAA 3REHC 3AZIB 3AN2B 4J8XA
chains in the Genus database with same CATH superfamily
1P3KD 1ID3D 5AVBC 4WU9A 4R8PA 1M19B 3WAAD 4QLCC 5GT3C 5E5AB 4EO5B 1Z2CB 2G5HC 3KXBD 2YFVA 5B0YD 3WA9A 1F66D 3R45A 5AV6D 3LZ0D 2G5IC 2AROC 3X1VC 3UT9C 1P3OC 2NQBB 1W2EA 1ID3A 5AV8D 3LELC 5B32G 2ZY3A 3NQUB 2Y2MA 3AZHD 4HGAC 3X1TA 3LELB 4ZUXC 3B0CW 1F1EA 1P34D 3MVDA 1F66A 2DF4C 3WKJC 5AV6A 3LZ0A 4X23C 4KUDA 2IO5B 5AV9C 4Z66A 4JJNA 2FJ7C 3AZHA 5GT0D 1P3BD 4WV4B 2YFWA 5B24A 3W99C 1TZYD 2BYKB 5B2IC 1EQZA 1HQ3B 3AZFD 2JE5A 3MNNC 2HUEB 5B40B 4WZSB 3AFAB 1P3GD 1P3LB 3LZ1C 1P3BA 3AZGC 3AYWB 5B1LC 3AV2A 5B31D 3EPKA 1M1AC 5F99D 2BG1A 4R8PC 4J8XB 1S32A 2BYMA 2HIOD 5G49A 3AZJD 4LD9C 4WU9B 3W96A 5AY8C 3V9RA 3O62A 3F6TA 3KWQD 3WA9C 3FDDA 1KX3D 3B0CT 5C3IC 1P3PB 5B2JA 1P3KC 1ID3C 5DNND 4J8UD 3R45B 1TAFA 3WAAC 3W97B 2HIOA 2PYOA 4NE6A 3KXBC 5GSUD 5B0YC 3KWQA 3X1TB 1N1JB 4Z2MG 2ZY2A 1KX3A 3AZKD 1F66C 5AV6C 3LZ0C 3REHA 5B1MD 3MVDB 4KGCD 5AV8C 4J8UA 3REKD 3AZHC 4J8VD 4KUDB 3MGRD 4Z66B 4AWLC 4JJNB 3REID 5JRGD 1P3FD 4UUZA 1P34C 5GSUA 2YFWB 5B24B 3KUYD 1BH8A 5E5AD 3AZKA 3AZLD 1EQZB 5JA4B 2XD1A 5B1MA 5CPJD 3X1VA 1P3OA 4H9NA 2F8ND 5GT0C 1P3BC 1P3AD 3REIA 1WWIA 4E45A 5B0ZD 3A1IA 1TZYC 5BNXA 3KUYA 3X1UD 3AV2B 4ZBJB 3AZLA 1M18B 3AZFC 3WKJA 4NE5A 5CPIB 3X1SD 4X23A 1S32B 1P3GC 5G49B 5AV9A 4XZQB 3W96B 1BH9B 3V9RB 4WU8D 3O62B 1P3AA 3W99A 5B31C 5BO0A 5F99C 5B2JB 1U35D 2HIOC 3UTAD 3AZJC 5B33B 3C1BB 5BT1D 1TAFB 3X1SA 5GXQD 4YM6B 3MGPD 3KWQC 2PYOB 3B6GD 1KX3C 3MGQA 3C1CD 3LZ1A 3EPLA 1JFIA 3AZGA 3REJD 5B1LA 1KX5B 5DNNC 4J8UC 1M1AA 3REHB 5AVBB 3MGSD 3VH5T 3AV1A 5CP6D 4LD9A 5AY8A 5GSUC 1PZRA 4YS3D 5CPKD 4QLCB 5GT3B 3AZKC 1BH8B 1AOID 1T3UA 5B1MC 4KGCC 4H9PA 3REKC 1P3KA 3WTPD 4Z5TD 4J8VC 4CSRA 3MGRC 3P5JB 2AROB 5FUGB 3UT9B 3X1VB 1P3OB 4H9NB 5KDMA 3MGSA 3REIC 3WAAA 5JRGC 1P3FC 5DNMD 3KXBA 3KUYC 5B0YA 4HGAB 3AZLC 3W98D 4ZUXB 5BNXB 4J8WD 1BFMA 3B0DC 1KX4D 1AOIA 5CPJC 2CV5D 5AV8A 4Z5TA 3WKJB 1P3ID 4X23B 4XUJD 1P3AC 5AV9B 2VQRA 5B0ZC 3A6ND 2FJ7B 3LJAD 5AV5D 1P34A 3X1UC 3W99B 3W98A 4H9QA 4G92C 5BO0B 5B2IB 4J8WA 1KX4A 3X1SC 2CV5A 3MGQC 4UPKA 1ZLAD 4WU8C 4XUJA 5GT0A 4H9RA 3MNNB 1Q9CA 3A6NA 2XD5A 3UTBD 4H9SA 3LJAA 1TZYA 5AV5A 3LZ1B 3TU4D 1JFIB 3AZGB 5B1LB 1U35C 3UTAC 3AZMD 2F2AC 3AZFA 3AV1C 1M1AB 5BT1C 5GXQC 3MGPC 4R8PB 3B6GC 3AZND 1P3GA 3AV1B 3C1CC 1ZLAA 4LD9B 5AY8B 2YFVB 2ZY5A 4DRBA 3AZED 3REJC 3WA9B 3UTBA 5C3IB 5B31A 2NZDD 1B67A 5AVCD 5F99A 4H9PB 3AZMA 5B32D 1P3KB 1ID3B 3MGSC 3AZJA 5CP6C 4CSRB 2Y2KA 4YS3C 3RELD 3WAAB 5CPKC 5KDMB 2RIQA 3KXBB 1P3MD 5B0YB 3AZEA 1AOIC 3B6FD 2Y2OA 4NE3A 3WTPC 2LY8A 3VH6W 5DNNA 1F66B 4Z5TC 5AV6B 5AVCA 3LZ0B 3AZID 3AN2D 5AV8B 5BNVA 5DNMC 3AZHB 3RELA 2W8SA 1M19D 1B6WA 4AWLB 1H3OA 1R4VA 3W98C 3WTPE 1P34B 4J8WC 3B0BA 1P3MA 1KX4C 4KHAA 2Y2GA 1HTAA 2CV5C 4KGCA 2J8PA 3REKA 1P3IC 3EPHA 3AN2A 4H9OA 4Z2MH 4XUJC 3MGRA 4J8VA 2NQBD 3A6NC 4H9SC 5JRGA 5AV5C 3LJAC 1P3FA 5GT0B 4H9RB 2Y2IA 1P3BB 3LELD 5E5AA 1TZYB 5CPJA 2BYMB 3AZFB 1ZLAC 2F8NA 1P3GB 5B0ZA 3UTBC 3TU4C 3KSYA 1WWSA 3X1UA 3AZMC 3VH6T 5B31B 5F99B 4G91C 2Y2NA 4WJ3C 3AZNC 2HIOB 1HQ3D 3AZJB 4WU8A 3AZEC 5B40D 2CWEA 3KWQB 3AFAD 1P3LD 1KX3B 4E44A 2NZDC 5BS7C 3AYWD 5AVCC 5B32C 1U35A 2BYKA 5DNNB 4J8UB 3UTAA 2L5AA 5GXQA 3MGPA 3RELC 4J8XD 1HQ3A 3B6GA 4WU9D 3C1CA 4UUZB 5GSUB 1P3MC 3B6FC 5B40A 1P3LA 3AFAA 3REJA 3AZKB 3AZIC 4KHAB 3AN2C 2F8NK 1P3PD 5B1MB 4KGCB 3REKB 3NQJA 5CP6A 4H9OB 5B31G 4J8VB 3VH5A 3MGRB 4CAYA 1M19C 4YS3A 3W97D 5CPKA 3REIB 5E5AC 4EO5C 4WNNA 5JRGB 1P3FB 2RVQD 3X1TD 3KUYB 2Y2HA 3AZLB 3WTPA 3B0DB 2NQBC 1P3PA 5CPJB 3MVDD 5DNMA 2F8NB 4KUDD 3W97A 4Z66D 1P3AB 3KFUG 5B0ZB 4JJND 1A7WA 1N1JA 5B24D 3IP4C 3X1UB 1EQZD 4G92B 1P3IA 3A1KA 3X1SB 2UWXA 2IO5C 3MGQB 4M6BA 4WU8B 2Y2LA 4NFTA 3AV2D 1U35B 1M18D 1HQ3C 3UTAB 5JA4A 5CPID 5GXQB 3MGPB 1S32D 2HUEC 5B40C 1P3LC 3AFAC 3B6GB 4XZQD 3C1CB 3W96D 3TU4A 3AYWC 2F8NG 3O62D 3REJB 4J8XC 5B2JD 2FFFB 1M18A 3NQJB 3AZNA 2Y2JA 3MGSB 4WU9C 5CP6B 5B33D 3C1BD 5CPIA 4YM6D 4CAYB 4YS3B 5CPKB 2PYOD 4XZQA 2ZY4A 4WNNB 2JCHA 1BH9A 2NZDA 5BS7A 1P3PC 1AOIB 3H0RC 1KX5D 5B32A 3WTPB 4Z5TB 3REHD 2DQNC 3W97C 5AVBD 5B33A 3C1BA 5DNMB 4YM6A 2F8NH 2RVQC 3X1TC 3B6FA 4QLCD 5GT3D 3W98B 4H9QB 4DQYB 4J8WB 1KX4B 3AZIA 3MVDC 1KX5A 1ULYA 2CV5B 4J8XA 1P3IB 4KUDC 4XUJB 2AROD 4Z66C 3UT9D 3X1VD 1P3OD 4JJNC 5AVBA 1M19A 3A6NB 3LJAB 5AV5B 5B24C 4QLCA 5GT3A 2JSSA 1EQZC 4ZUXD 3EG5B 2Y2PA 2NQBA 3WKJD 3NQUA 1ZLAB 4X23D 2AROA 5FUGA 3UT9A 5AV9D 3VH5W 3LELA 2FJ7D 3UTBB 3TU4B 3AV2C 4ZBJC 3W99D 1M18C 4ZUXA 3AZMB 5B2ID 3EPJA 5CPIC 1S32C 4G91B 3AZNB 4XZQC 3W96C 3AL0C 3MNND 3O62C 3AZEB 2FJ7A 3MGQD 3LZ1D 2NZDB 3VH6A 3AZGD 5AVCB 5B2JC 5B1LD 1KU5A 5B32B 5B2IA 5BNVB 5B33C 3C1BC 1M1AD 4YM6C 3RELB 4R8PD 2PYOC 2ZM5A 1H3OB 3AV1D 4LD9D 5AY8D 3MNNA 1P3MB 3B6FB 5CHLB 3AYWA 3H0LC 3WA9D 3H0MC 1KX5C 4DRAA 3REHC 3AZIB 3AN2B 2Y2QA
chains in the Genus database with same CATH topology
1P3KD 1ID3D 5AVBC 4WU9A 4R8PA 1M19B 3WAAD 4QLCC 5GT3C 5E5AB 4EO5B 1Z2CB 2G5HC 3KXBD 2YFVA 5B0YD 3WA9A 1F66D 3R45A 5AV6D 3LZ0D 2G5IC 2AROC 3X1VC 3UT9C 1P3OC 2NQBB 1W2EA 1ID3A 5AV8D 3LELC 5B32G 2ZY3A 3NQUB 2Y2MA 3AZHD 4HGAC 3X1TA 3LELB 4ZUXC 3B0CW 1F1EA 1P34D 3MVDA 1F66A 2DF4C 3WKJC 5AV6A 3LZ0A 4X23C 4KUDA 2IO5B 5AV9C 4Z66A 4JJNA 2FJ7C 3AZHA 5GT0D 1P3BD 4WV4B 2YFWA 5B24A 3W99C 1TZYD 2BYKB 5B2IC 1EQZA 1HQ3B 3AZFD 2JE5A 3MNNC 2HUEB 5B40B 4WZSB 3AFAB 1P3GD 1P3LB 3LZ1C 1P3BA 3AZGC 3AYWB 5B1LC 3AV2A 5B31D 3EPKA 1M1AC 5F99D 2BG1A 4R8PC 4J8XB 1S32A 2BYMA 2HIOD 5G49A 3AZJD 4LD9C 4WU9B 3W96A 5AY8C 3V9RA 3O62A 3F6TA 3KWQD 3WA9C 3FDDA 1KX3D 3B0CT 5C3IC 1P3PB 5B2JA 1P3KC 1ID3C 5DNND 4J8UD 3R45B 1TAFA 3WAAC 3W97B 2HIOA 2PYOA 4NE6A 3KXBC 5GSUD 5B0YC 3KWQA 3X1TB 1N1JB 4Z2MG 2ZY2A 1KX3A 3AZKD 1F66C 5AV6C 3LZ0C 3REHA 5B1MD 3MVDB 4KGCD 5AV8C 4J8UA 3REKD 3AZHC 4J8VD 4KUDB 3MGRD 4Z66B 4AWLC 4JJNB 3REID 5JRGD 1P3FD 4UUZA 1P34C 5GSUA 2YFWB 5B24B 3KUYD 1BH8A 5E5AD 3AZKA 3AZLD 1EQZB 5JA4B 2XD1A 5B1MA 5CPJD 3X1VA 1P3OA 4H9NA 2F8ND 5GT0C 1P3BC 1P3AD 3REIA 1WWIA 4E45A 5B0ZD 3A1IA 1TZYC 5BNXA 3KUYA 3X1UD 3AV2B 4ZBJB 3AZLA 1M18B 3AZFC 3WKJA 4NE5A 5CPIB 3X1SD 4X23A 1S32B 1P3GC 5G49B 5AV9A 4XZQB 3W96B 1BH9B 3V9RB 4WU8D 3O62B 1P3AA 3W99A 5B31C 5BO0A 5F99C 5B2JB 1U35D 2HIOC 3UTAD 3AZJC 5B33B 3C1BB 5BT1D 1TAFB 3X1SA 5GXQD 4YM6B 3MGPD 3KWQC 2PYOB 3B6GD 1KX3C 3MGQA 3C1CD 3LZ1A 3EPLA 1JFIA 3AZGA 3REJD 5B1LA 1KX5B 5DNNC 4J8UC 1M1AA 3REHB 5AVBB 3MGSD 3VH5T 3AV1A 5CP6D 4LD9A 5AY8A 5GSUC 1PZRA 4YS3D 5CPKD 4QLCB 5GT3B 3AZKC 1BH8B 1AOID 1T3UA 5B1MC 4KGCC 4H9PA 3REKC 1P3KA 3WTPD 4Z5TD 4J8VC 4CSRA 3MGRC 3P5JB 2AROB 5FUGB 3UT9B 3X1VB 1P3OB 4H9NB 5KDMA 3MGSA 3REIC 3WAAA 5JRGC 1P3FC 5DNMD 3KXBA 3KUYC 5B0YA 4HGAB 3AZLC 3W98D 4ZUXB 5BNXB 4J8WD 1BFMA 3B0DC 1KX4D 1AOIA 5CPJC 2CV5D 5AV8A 4Z5TA 3WKJB 1P3ID 4X23B 4XUJD 1P3AC 5AV9B 2VQRA 5B0ZC 3A6ND 2FJ7B 3LJAD 5AV5D 1P34A 3X1UC 3W99B 3W98A 4H9QA 4G92C 5BO0B 5B2IB 4J8WA 1KX4A 3X1SC 2CV5A 3MGQC 4UPKA 1ZLAD 4WU8C 4XUJA 5GT0A 4H9RA 3MNNB 1Q9CA 3A6NA 2XD5A 3UTBD 4H9SA 3LJAA 1TZYA 5AV5A 3LZ1B 3TU4D 1JFIB 3AZGB 5B1LB 1U35C 3UTAC 3AZMD 2F2AC 3AZFA 3AV1C 1M1AB 5BT1C 5GXQC 3MGPC 4R8PB 3B6GC 3AZND 1P3GA 3AV1B 3C1CC 1ZLAA 4LD9B 5AY8B 2YFVB 2ZY5A 4DRBA 3AZED 3REJC 3WA9B 3UTBA 5C3IB 5B31A 2NZDD 1B67A 5AVCD 5F99A 4H9PB 3AZMA 5B32D 1P3KB 1ID3B 3MGSC 3AZJA 5CP6C 4CSRB 2Y2KA 4YS3C 3RELD 3WAAB 5CPKC 5KDMB 2RIQA 3KXBB 1P3MD 5B0YB 3AZEA 1AOIC 3B6FD 2Y2OA 4NE3A 3WTPC 2LY8A 3VH6W 5DNNA 1F66B 4Z5TC 5AV6B 5AVCA 3LZ0B 3AZID 3AN2D 5AV8B 5BNVA 5DNMC 3AZHB 3RELA 2W8SA 1M19D 1B6WA 4AWLB 1H3OA 1R4VA 3W98C 3WTPE 1P34B 4J8WC 3B0BA 1P3MA 1KX4C 4KHAA 2Y2GA 1HTAA 2CV5C 4KGCA 2J8PA 3REKA 1P3IC 3EPHA 3AN2A 4H9OA 4Z2MH 4XUJC 3MGRA 4J8VA 2NQBD 3A6NC 4H9SC 5JRGA 5AV5C 3LJAC 1P3FA 5GT0B 4H9RB 2Y2IA 1P3BB 3LELD 5E5AA 1TZYB 5CPJA 2BYMB 3AZFB 1ZLAC 2F8NA 1P3GB 5B0ZA 3UTBC 3TU4C 3KSYA 1WWSA 3X1UA 3AZMC 3VH6T 5B31B 5F99B 4G91C 2Y2NA 4WJ3C 3AZNC 2HIOB 1HQ3D 3AZJB 4WU8A 3AZEC 5B40D 2CWEA 3KWQB 3AFAD 1P3LD 1KX3B 4E44A 2NZDC 5BS7C 3AYWD 5AVCC 5B32C 1U35A 2BYKA 5DNNB 4J8UB 3UTAA 2L5AA 5GXQA 3MGPA 3RELC 4J8XD 1HQ3A 3B6GA 4WU9D 3C1CA 4UUZB 5GSUB 1P3MC 3B6FC 5B40A 1P3LA 3AFAA 3REJA 3AZKB 3AZIC 4KHAB 3AN2C 2F8NK 1P3PD 5B1MB 4KGCB 3REKB 3NQJA 5CP6A 4H9OB 5B31G 4J8VB 3VH5A 3MGRB 4CAYA 1M19C 4YS3A 3W97D 5CPKA 3REIB 5E5AC 4EO5C 4WNNA 5JRGB 1P3FB 2RVQD 3X1TD 3KUYB 2Y2HA 3AZLB 3WTPA 3B0DB 2NQBC 1P3PA 5CPJB 3MVDD 5DNMA 2F8NB 4KUDD 3W97A 4Z66D 1P3AB 3KFUG 5B0ZB 4JJND 1A7WA 1N1JA 5B24D 3IP4C 3X1UB 1EQZD 4G92B 1P3IA 3A1KA 3X1SB 2UWXA 2IO5C 3MGQB 4M6BA 4WU8B 2Y2LA 4NFTA 3AV2D 1U35B 1M18D 1HQ3C 3UTAB 5JA4A 5CPID 5GXQB 3MGPB 1S32D 2HUEC 5B40C 1P3LC 3AFAC 3B6GB 4XZQD 3C1CB 3W96D 3TU4A 3AYWC 2F8NG 3O62D 3REJB 4J8XC 5B2JD 2FFFB 1M18A 3NQJB 3AZNA 2Y2JA 3MGSB 4WU9C 5CP6B 5B33D 3C1BD 5CPIA 4YM6D 4CAYB 4YS3B 5CPKB 2PYOD 4XZQA 2ZY4A 4WNNB 2JCHA 1BH9A 2NZDA 5BS7A 1P3PC 1AOIB 3H0RC 1KX5D 5B32A 3WTPB 4Z5TB 3REHD 2DQNC 3W97C 5AVBD 5B33A 3C1BA 5DNMB 4YM6A 2F8NH 2RVQC 3X1TC 3B6FA 4QLCD 5GT3D 3W98B 4H9QB 4DQYB 4J8WB 1KX4B 3AZIA 3MVDC 1KX5A 1ULYA 2CV5B 4J8XA 1P3IB 4KUDC 4XUJB 2AROD 4Z66C 3UT9D 3X1VD 1P3OD 4JJNC 5AVBA 1M19A 3A6NB 3LJAB 5AV5B 5B24C 4QLCA 5GT3A 2JSSA 1EQZC 4ZUXD 3EG5B 2Y2PA 2NQBA 3WKJD 3NQUA 1ZLAB 4X23D 2AROA 5FUGA 3UT9A 5AV9D 3VH5W 3LELA 2FJ7D 3UTBB 3TU4B 3AV2C 4ZBJC 3W99D 1M18C 4ZUXA 3AZMB 5B2ID 3EPJA 5CPIC 1S32C 4G91B 3AZNB 4XZQC 3W96C 3AL0C 3MNND 3O62C 3AZEB 2FJ7A 3MGQD 3LZ1D 2NZDB 3VH6A 3AZGD 5AVCB 5B2JC 5B1LD 1KU5A 5B32B 5B2IA 5BNVB 5B33C 3C1BC 1M1AD 4YM6C 3RELB 4R8PD 2PYOC 2ZM5A 1H3OB 3AV1D 4LD9D 5AY8D 3MNNA 1P3MB 3B6FB 5CHLB 3AYWA 3H0LC 3WA9D 3H0MC 1KX5C 4DRAA 3REHC 3AZIB 3AN2B 2Y2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K D;  1ID3 D;  5AVB C;  4WU9 A;  4R8P A;  1M19 B;  3WAA D;  4QLC C;  5GT3 C;  5E5A B;  4EO5 B;  3KXB D;  2YFV A;  5B0Y D;  3WA9 A;  1F66 D;  3R45 A;  5AV6 D;  3LZ0 D;  2NQB B;  2ARO C;  3X1V C;  3UT9 C;  1P3O C;  1ID3 A;  5AV8 D;  3LEL C;  5B32 G;  3NQU B;  3AZH D;  4HGA C;  3X1T A;  3LEL B;  4ZUX C;  3B0C W;  1F1E A;  1P34 D;  3MVD A;  1F66 A;  3WKJ C;  5AV6 A;  3LZ0 A;  4X23 C;  4KUD A;  2IO5 B;  5AV9 C;  4Z66 A;  4JJN A;  2FJ7 C;  3AZH A;  5GT0 D;  1P3B D;  4WV4 B;  2YFW A;  5B24 A;  3W99 C;  1TZY D;  2BYK B;  5B2I C;  1EQZ A;  1HQ3 B;  3AZF D;  3MNN C;  2HUE B;  5B40 B;  4WZS B;  3AFA B;  1P3G D;  1P3L B;  3LZ1 C;  1P3B A;  3AZG C;  3AYW B;  5B1L C;  3AV2 A;  5B31 D;  1M1A C;  5F99 D;  4R8P C;  4J8X B;  1S32 A;  2BYM A;  2HIO D;  5G49 A;  3AZJ D;  4LD9 C;  4WU9 B;  3W96 A;  5AY8 C;  3V9R A;  3O62 A;  3WA9 C;  3KWQ D;  1KX3 D;  3B0C T;  5C3I C;  1P3P B;  5B2J A;  1P3K C;  1ID3 C;  5DNN D;  4J8U D;  3R45 B;  1TAF A;  3WAA C;  3W97 B;  2HIO A;  2PYO A;  4NE6 A;  3KXB C;  5GSU D;  5B0Y C;  3KWQ A;  3X1T B;  1N1J B;  4Z2M G;  1KX3 A;  3AZK D;  1F66 C;  5AV6 C;  3LZ0 C;  3REH A;  5B1M D;  3MVD B;  4KGC D;  5AV8 C;  4J8U A;  3REK D;  3AZH C;  4J8V D;  4KUD B;  3MGR D;  4Z66 B;  4AWL C;  4JJN B;  3REI D;  5JRG D;  1P3F D;  4UUZ A;  1P34 C;  5GSU A;  2YFW B;  5B24 B;  3KUY D;  1BH8 A;  5E5A D;  3AZK A;  3AZL D;  1EQZ B;  5JA4 B;  5B1M A;  5CPJ D;  3X1V A;  1P3O A;  4H9N A;  2F8N D;  5GT0 C;  1P3B C;  1P3A D;  3REI A;  1WWI A;  4E45 A;  5B0Z D;  1TZY C;  5BNX A;  3KUY A;  3X1U D;  3AV2 B;  4ZBJ B;  3AZL A;  1M18 B;  3AZF C;  3WKJ A;  4NE5 A;  5CPI B;  3X1S D;  4X23 A;  1S32 B;  1P3G C;  5G49 B;  5AV9 A;  4XZQ B;  3W96 B;  1BH9 B;  3V9R B;  4WU8 D;  3O62 B;  1P3A A;  3W99 A;  5B31 C;  5BO0 A;  5F99 C;  5B2J B;  1U35 D;  2HIO C;  3UTA D;  3AZJ C;  5B33 B;  3C1B B;  5BT1 D;  1TAF B;  3X1S A;  5GXQ D;  4YM6 B;  3MGP D;  3KWQ C;  2PYO B;  3B6G D;  1KX3 C;  3MGQ A;  3C1C D;  3LZ1 A;  1JFI A;  3AZG A;  3REJ D;  5B1L A;  1KX5 B;  5DNN C;  4J8U C;  1M1A A;  3REH B;  5AVB B;  3MGS D;  3VH5 T;  3AV1 A;  5CP6 D;  4LD9 A;  5AY8 A;  5GSU C;  4YS3 D;  5CPK D;  4QLC B;  5GT3 B;  3AZK C;  1BH8 B;  1AOI D;  5B1M C;  4KGC C;  4H9P A;  3REK C;  1P3K A;  3WTP D;  4Z5T D;  4J8V C;  4CSR A;  3MGR C;  2ARO B;  5FUG B;  3UT9 B;  3X1V B;  1P3O B;  4H9N B;  5KDM A;  3MGS A;  3REI C;  3WAA A;  5JRG C;  1P3F C;  5DNM D;  3KXB A;  3KUY C;  5B0Y A;  4HGA B;  3AZL C;  3W98 D;  4ZUX B;  5BNX B;  4J8W D;  1BFM A;  3B0D C;  1KX4 D;  1AOI A;  5CPJ C;  2CV5 D;  5AV8 A;  4Z5T A;  3WKJ B;  1P3I D;  4X23 B;  4XUJ D;  1P3A C;  5AV9 B;  5B0Z C;  3A6N D;  2FJ7 B;  3LJA D;  5AV5 D;  1P34 A;  3X1U C;  3W99 B;  3W98 A;  4H9Q A;  4G92 C;  5BO0 B;  5B2I B;  4J8W A;  1KX4 A;  3X1S C;  2CV5 A;  3MGQ C;  1ZLA D;  4WU8 C;  4XUJ A;  5GT0 A;  4H9R A;  3MNN B;  1Q9C A;  3A6N A;  3UTB D;  4H9S A;  3LJA A;  1TZY A;  5AV5 A;  3LZ1 B;  3TU4 D;  1JFI B;  3AZG B;  5B1L B;  1U35 C;  3UTA C;  3AZM D;  3AZF A;  3AV1 C;  1M1A B;  5BT1 C;  5GXQ C;  3MGP C;  4R8P B;  3B6G C;  3AZN D;  1P3G A;  3AV1 B;  3C1C C;  1ZLA A;  4LD9 B;  5AY8 B;  2YFV B;  4DRB A;  3AZE D;  3REJ C;  3WA9 B;  3UTB A;  5C3I B;  5B31 A;  2NZD D;  1B67 A;  5AVC D;  5F99 A;  4H9P B;  3AZM A;  5B32 D;  1P3K B;  1ID3 B;  3MGS C;  3AZJ A;  5CP6 C;  4CSR B;  4YS3 C;  3REL D;  3WAA B;  5CPK C;  5KDM B;  3KXB B;  1P3M D;  5B0Y B;  3AZE A;  1AOI C;  3B6F D;  4NE3 A;  3WTP C;  2LY8 A;  3VH6 W;  5DNN A;  1F66 B;  4Z5T C;  5AV6 B;  5AVC A;  3LZ0 B;  3AZI D;  3AN2 D;  5AV8 B;  5BNV A;  5DNM C;  3AZH B;  3REL A;  1M19 D;  1B6W A;  4AWL B;  1H3O A;  1R4V A;  3W98 C;  3WTP E;  1P34 B;  4J8W C;  3B0B A;  1P3M A;  1KX4 C;  4KHA A;  1HTA A;  2CV5 C;  4KGC A;  3REK A;  1P3I C;  3AN2 A;  4H9O A;  4Z2M H;  4XUJ C;  3MGR A;  4J8V A;  2NQB D;  3A6N C;  4H9S C;  5JRG A;  5AV5 C;  3LJA C;  1P3F A;  5GT0 B;  4H9R B;  1P3B B;  3LEL D;  5E5A A;  1TZY B;  5CPJ A;  2BYM B;  3AZF B;  1ZLA C;  2F8N A;  1P3G B;  5B0Z A;  3UTB C;  3TU4 C;  3KSY A;  1WWS A;  3X1U A;  3AZM C;  3VH6 T;  5B31 B;  5F99 B;  4G91 C;  3AZN C;  2HIO B;  1HQ3 D;  3AZJ B;  4WU8 A;  3AZE C;  5B40 D;  2CWE A;  3KWQ B;  3AFA D;  1P3L D;  1KX3 B;  4E44 A;  2NZD C;  5BS7 C;  3AYW D;  5AVC C;  5B32 C;  1U35 A;  2BYK A;  5DNN B;  4J8U B;  3UTA A;  2L5A A;  5GXQ A;  3MGP A;  3REL C;  4J8X D;  1HQ3 A;  3B6G A;  4WU9 D;  3C1C A;  4UUZ B;  5GSU B;  1P3M C;  3B6F C;  5B40 A;  1P3L A;  3AFA A;  3REJ A;  3AZK B;  3AZI C;  4KHA B;  3AN2 C;  2F8N K;  1P3P D;  5B1M B;  4KGC B;  3REK B;  3NQJ A;  5CP6 A;  4H9O B;  5B31 G;  4J8V B;  3VH5 A;  3MGR B;  4CAY A;  1M19 C;  4YS3 A;  3W97 D;  5CPK A;  3REI B;  5E5A C;  4EO5 C;  4WNN A;  5JRG B;  1P3F B;  2RVQ D;  3X1T D;  3KUY B;  3AZL B;  3WTP A;  3B0D B;  2NQB C;  1P3P A;  5CPJ B;  3MVD D;  5DNM A;  2F8N B;  4KUD D;  3W97 A;  4Z66 D;  1P3A B;  5B0Z B;  4JJN D;  1A7W A;  1N1J A;  5B24 D;  3X1U B;  1EQZ D;  4G92 B;  1P3I A;  3X1S B;  2IO5 C;  3MGQ B;  4M6B A;  4WU8 B;  4NFT A;  3AV2 D;  1U35 B;  1M18 D;  1HQ3 C;  3UTA B;  5JA4 A;  5CPI D;  5GXQ B;  3MGP B;  1S32 D;  2HUE C;  5B40 C;  1P3L C;  3AFA C;  3B6G B;  4XZQ D;  3C1C B;  3W96 D;  3TU4 A;  3AYW C;  2F8N G;  3O62 D;  3REJ B;  4J8X C;  5B2J D;  1M18 A;  3NQJ B;  3AZN A;  3MGS B;  4WU9 C;  5CP6 B;  5B33 D;  3C1B D;  5CPI A;  4YM6 D;  4CAY B;  4YS3 B;  5CPK B;  2PYO D;  4XZQ A;  4WNN B;  1BH9 A;  2NZD A;  5BS7 A;  1P3P C;  1AOI B;  1KX5 D;  5B32 A;  3WTP B;  4Z5T B;  3REH D;  3W97 C;  5AVB D;  5B33 A;  3C1B A;  5DNM B;  4YM6 A;  2F8N H;  2RVQ C;  3X1T C;  3B6F A;  4QLC D;  5GT3 D;  3W98 B;  4H9Q B;  4J8W B;  1KX4 B;  3AZI A;  3MVD C;  1KX5 A;  1ULY A;  2CV5 B;  1P3I B;  4KUD C;  4XUJ B;  2ARO D;  4Z66 C;  3UT9 D;  3X1V D;  1P3O D;  4JJN C;  5AVB A;  1M19 A;  3A6N B;  3LJA B;  5AV5 B;  5B24 C;  4QLC A;  5GT3 A;  2JSS A;  1EQZ C;  4ZUX D;  2NQB A;  3WKJ D;  3NQU A;  1ZLA B;  4X23 D;  2ARO A;  5FUG A;  3UT9 A;  5AV9 D;  3VH5 W;  3LEL A;  2FJ7 D;  3UTB B;  3TU4 B;  3AV2 C;  4ZBJ C;  3W99 D;  1M18 C;  4ZUX A;  3AZM B;  5B2I D;  5CPI C;  1S32 C;  4G91 B;  3AZN B;  4XZQ C;  3W96 C;  3MNN D;  3O62 C;  3AZE B;  2FJ7 A;  3MGQ D;  3LZ1 D;  2NZD B;  3VH6 A;  3AZG D;  5AVC B;  5B2J C;  5B1L D;  1KU5 A;  5B32 B;  5B2I A;  5BNV B;  5B33 C;  3C1B C;  1M1A D;  4YM6 C;  3REL B;  4R8P D;  2PYO C;  1H3O B;  3AV1 D;  4LD9 D;  5AY8 D;  3MNN A;  1P3M B;  3B6F B;  5CHL B;  3AYW A;  3WA9 D;  1KX5 C;  4DRA A;  3REH C;  3AZI B;  3AN2 B;  4J8X A; 
#chains in the Genus database with same CATH topology
 1P3K D;  1ID3 D;  5AVB C;  4WU9 A;  4R8P A;  1M19 B;  3WAA D;  4QLC C;  5GT3 C;  5E5A B;  4EO5 B;  1Z2C B;  2G5H C;  3KXB D;  2YFV A;  5B0Y D;  3WA9 A;  1F66 D;  3R45 A;  5AV6 D;  3LZ0 D;  2G5I C;  2ARO C;  3X1V C;  3UT9 C;  1P3O C;  2NQB B;  1W2E A;  1ID3 A;  5AV8 D;  3LEL C;  5B32 G;  2ZY3 A;  3NQU B;  2Y2M A;  3AZH D;  4HGA C;  3X1T A;  3LEL B;  4ZUX C;  3B0C W;  1F1E A;  1P34 D;  3MVD A;  1F66 A;  2DF4 C;  3WKJ C;  5AV6 A;  3LZ0 A;  4X23 C;  4KUD A;  2IO5 B;  5AV9 C;  4Z66 A;  4JJN A;  2FJ7 C;  3AZH A;  5GT0 D;  1P3B D;  4WV4 B;  2YFW A;  5B24 A;  3W99 C;  1TZY D;  2BYK B;  5B2I C;  1EQZ A;  1HQ3 B;  3AZF D;  2JE5 A;  3MNN C;  2HUE B;  5B40 B;  4WZS B;  3AFA B;  1P3G D;  1P3L B;  3LZ1 C;  1P3B A;  3AZG C;  3AYW B;  5B1L C;  3AV2 A;  5B31 D;  3EPK A;  1M1A C;  5F99 D;  2BG1 A;  4R8P C;  4J8X B;  1S32 A;  2BYM A;  2HIO D;  5G49 A;  3AZJ D;  4LD9 C;  4WU9 B;  3W96 A;  5AY8 C;  3V9R A;  3O62 A;  3F6T A;  3KWQ D;  3WA9 C;  3FDD A;  1KX3 D;  3B0C T;  5C3I C;  1P3P B;  5B2J A;  1P3K C;  1ID3 C;  5DNN D;  4J8U D;  3R45 B;  1TAF A;  3WAA C;  3W97 B;  2HIO A;  2PYO A;  4NE6 A;  3KXB C;  5GSU D;  5B0Y C;  3KWQ A;  3X1T B;  1N1J B;  4Z2M G;  2ZY2 A;  1KX3 A;  3AZK D;  1F66 C;  5AV6 C;  3LZ0 C;  3REH A;  5B1M D;  3MVD B;  4KGC D;  5AV8 C;  4J8U A;  3REK D;  3AZH C;  4J8V D;  4KUD B;  3MGR D;  4Z66 B;  4AWL C;  4JJN B;  3REI D;  5JRG D;  1P3F D;  4UUZ A;  1P34 C;  5GSU A;  2YFW B;  5B24 B;  3KUY D;  1BH8 A;  5E5A D;  3AZK A;  3AZL D;  1EQZ B;  5JA4 B;  2XD1 A;  5B1M A;  5CPJ D;  3X1V A;  1P3O A;  4H9N A;  2F8N D;  5GT0 C;  1P3B C;  1P3A D;  3REI A;  1WWI A;  4E45 A;  5B0Z D;  3A1I A;  1TZY C;  5BNX A;  3KUY A;  3X1U D;  3AV2 B;  4ZBJ B;  3AZL A;  1M18 B;  3AZF C;  3WKJ A;  4NE5 A;  5CPI B;  3X1S D;  4X23 A;  1S32 B;  1P3G C;  5G49 B;  5AV9 A;  4XZQ B;  3W96 B;  1BH9 B;  3V9R B;  4WU8 D;  3O62 B;  1P3A A;  3W99 A;  5B31 C;  5BO0 A;  5F99 C;  5B2J B;  1U35 D;  2HIO C;  3UTA D;  3AZJ C;  5B33 B;  3C1B B;  5BT1 D;  1TAF B;  3X1S A;  5GXQ D;  4YM6 B;  3MGP D;  3KWQ C;  2PYO B;  3B6G D;  1KX3 C;  3MGQ A;  3C1C D;  3LZ1 A;  3EPL A;  1JFI A;  3AZG A;  3REJ D;  5B1L A;  1KX5 B;  5DNN C;  4J8U C;  1M1A A;  3REH B;  5AVB B;  3MGS D;  3VH5 T;  3AV1 A;  5CP6 D;  4LD9 A;  5AY8 A;  5GSU C;  1PZR A;  4YS3 D;  5CPK D;  4QLC B;  5GT3 B;  3AZK C;  1BH8 B;  1AOI D;  1T3U A;  5B1M C;  4KGC C;  4H9P A;  3REK C;  1P3K A;  3WTP D;  4Z5T D;  4J8V C;  4CSR A;  3MGR C;  3P5J B;  2ARO B;  5FUG B;  3UT9 B;  3X1V B;  1P3O B;  4H9N B;  5KDM A;  3MGS A;  3REI C;  3WAA A;  5JRG C;  1P3F C;  5DNM D;  3KXB A;  3KUY C;  5B0Y A;  4HGA B;  3AZL C;  3W98 D;  4ZUX B;  5BNX B;  4J8W D;  1BFM A;  3B0D C;  1KX4 D;  1AOI A;  5CPJ C;  2CV5 D;  5AV8 A;  4Z5T A;  3WKJ B;  1P3I D;  4X23 B;  4XUJ D;  1P3A C;  5AV9 B;  2VQR A;  5B0Z C;  3A6N D;  2FJ7 B;  3LJA D;  5AV5 D;  1P34 A;  3X1U C;  3W99 B;  3W98 A;  4H9Q A;  4G92 C;  5BO0 B;  5B2I B;  4J8W A;  1KX4 A;  3X1S C;  2CV5 A;  3MGQ C;  4UPK A;  1ZLA D;  4WU8 C;  4XUJ A;  5GT0 A;  4H9R A;  3MNN B;  1Q9C A;  3A6N A;  2XD5 A;  3UTB D;  4H9S A;  3LJA A;  1TZY A;  5AV5 A;  3LZ1 B;  3TU4 D;  1JFI B;  3AZG B;  5B1L B;  1U35 C;  3UTA C;  3AZM D;  2F2A C;  3AZF A;  3AV1 C;  1M1A B;  5BT1 C;  5GXQ C;  3MGP C;  4R8P B;  3B6G C;  3AZN D;  1P3G A;  3AV1 B;  3C1C C;  1ZLA A;  4LD9 B;  5AY8 B;  2YFV B;  2ZY5 A;  4DRB A;  3AZE D;  3REJ C;  3WA9 B;  3UTB A;  5C3I B;  5B31 A;  2NZD D;  1B67 A;  5AVC D;  5F99 A;  4H9P B;  3AZM A;  5B32 D;  1P3K B;  1ID3 B;  3MGS C;  3AZJ A;  5CP6 C;  4CSR B;  2Y2K A;  4YS3 C;  3REL D;  3WAA B;  5CPK C;  5KDM B;  2RIQ A;  3KXB B;  1P3M D;  5B0Y B;  3AZE A;  1AOI C;  3B6F D;  2Y2O A;  4NE3 A;  3WTP C;  2LY8 A;  3VH6 W;  5DNN A;  1F66 B;  4Z5T C;  5AV6 B;  5AVC A;  3LZ0 B;  3AZI D;  3AN2 D;  5AV8 B;  5BNV A;  5DNM C;  3AZH B;  3REL A;  2W8S A;  1M19 D;  1B6W A;  4AWL B;  1H3O A;  1R4V A;  3W98 C;  3WTP E;  1P34 B;  4J8W C;  3B0B A;  1P3M A;  1KX4 C;  4KHA A;  2Y2G A;  1HTA A;  2CV5 C;  4KGC A;  2J8P A;  3REK A;  1P3I C;  3EPH A;  3AN2 A;  4H9O A;  4Z2M H;  4XUJ C;  3MGR A;  4J8V A;  2NQB D;  3A6N C;  4H9S C;  5JRG A;  5AV5 C;  3LJA C;  1P3F A;  5GT0 B;  4H9R B;  2Y2I A;  1P3B B;  3LEL D;  5E5A A;  1TZY B;  5CPJ A;  2BYM B;  3AZF B;  1ZLA C;  2F8N A;  1P3G B;  5B0Z A;  3UTB C;  3TU4 C;  3KSY A;  1WWS A;  3X1U A;  3AZM C;  3VH6 T;  5B31 B;  5F99 B;  4G91 C;  2Y2N A;  4WJ3 C;  3AZN C;  2HIO B;  1HQ3 D;  3AZJ B;  4WU8 A;  3AZE C;  5B40 D;  2CWE A;  3KWQ B;  3AFA D;  1P3L D;  1KX3 B;  4E44 A;  2NZD C;  5BS7 C;  3AYW D;  5AVC C;  5B32 C;  1U35 A;  2BYK A;  5DNN B;  4J8U B;  3UTA A;  2L5A A;  5GXQ A;  3MGP A;  3REL C;  4J8X D;  1HQ3 A;  3B6G A;  4WU9 D;  3C1C A;  4UUZ B;  5GSU B;  1P3M C;  3B6F C;  5B40 A;  1P3L A;  3AFA A;  3REJ A;  3AZK B;  3AZI C;  4KHA B;  3AN2 C;  2F8N K;  1P3P D;  5B1M B;  4KGC B;  3REK B;  3NQJ A;  5CP6 A;  4H9O B;  5B31 G;  4J8V B;  3VH5 A;  3MGR B;  4CAY A;  1M19 C;  4YS3 A;  3W97 D;  5CPK A;  3REI B;  5E5A C;  4EO5 C;  4WNN A;  5JRG B;  1P3F B;  2RVQ D;  3X1T D;  3KUY B;  2Y2H A;  3AZL B;  3WTP A;  3B0D B;  2NQB C;  1P3P A;  5CPJ B;  3MVD D;  5DNM A;  2F8N B;  4KUD D;  3W97 A;  4Z66 D;  1P3A B;  3KFU G;  5B0Z B;  4JJN D;  1A7W A;  1N1J A;  5B24 D;  3IP4 C;  3X1U B;  1EQZ D;  4G92 B;  1P3I A;  3A1K A;  3X1S B;  2UWX A;  2IO5 C;  3MGQ B;  4M6B A;  4WU8 B;  2Y2L A;  4NFT A;  3AV2 D;  1U35 B;  1M18 D;  1HQ3 C;  3UTA B;  5JA4 A;  5CPI D;  5GXQ B;  3MGP B;  1S32 D;  2HUE C;  5B40 C;  1P3L C;  3AFA C;  3B6G B;  4XZQ D;  3C1C B;  3W96 D;  3TU4 A;  3AYW C;  2F8N G;  3O62 D;  3REJ B;  4J8X C;  5B2J D;  2FFF B;  1M18 A;  3NQJ B;  3AZN A;  2Y2J A;  3MGS B;  4WU9 C;  5CP6 B;  5B33 D;  3C1B D;  5CPI A;  4YM6 D;  4CAY B;  4YS3 B;  5CPK B;  2PYO D;  4XZQ A;  2ZY4 A;  4WNN B;  2JCH A;  1BH9 A;  2NZD A;  5BS7 A;  1P3P C;  1AOI B;  3H0R C;  1KX5 D;  5B32 A;  3WTP B;  4Z5T B;  3REH D;  2DQN C;  3W97 C;  5AVB D;  5B33 A;  3C1B A;  5DNM B;  4YM6 A;  2F8N H;  2RVQ C;  3X1T C;  3B6F A;  4QLC D;  5GT3 D;  3W98 B;  4H9Q B;  4DQY B;  4J8W B;  1KX4 B;  3AZI A;  3MVD C;  1KX5 A;  1ULY A;  2CV5 B;  4J8X A;  1P3I B;  4KUD C;  4XUJ B;  2ARO D;  4Z66 C;  3UT9 D;  3X1V D;  1P3O D;  4JJN C;  5AVB A;  1M19 A;  3A6N B;  3LJA B;  5AV5 B;  5B24 C;  4QLC A;  5GT3 A;  2JSS A;  1EQZ C;  4ZUX D;  3EG5 B;  2Y2P A;  2NQB A;  3WKJ D;  3NQU A;  1ZLA B;  4X23 D;  2ARO A;  5FUG A;  3UT9 A;  5AV9 D;  3VH5 W;  3LEL A;  2FJ7 D;  3UTB B;  3TU4 B;  3AV2 C;  4ZBJ C;  3W99 D;  1M18 C;  4ZUX A;  3AZM B;  5B2I D;  3EPJ A;  5CPI C;  1S32 C;  4G91 B;  3AZN B;  4XZQ C;  3W96 C;  3AL0 C;  3MNN D;  3O62 C;  3AZE B;  2FJ7 A;  3MGQ D;  3LZ1 D;  2NZD B;  3VH6 A;  3AZG D;  5AVC B;  5B2J C;  5B1L D;  1KU5 A;  5B32 B;  5B2I A;  5BNV B;  5B33 C;  3C1B C;  1M1A D;  4YM6 C;  3REL B;  4R8P D;  2PYO C;  2ZM5 A;  1H3O B;  3AV1 D;  4LD9 D;  5AY8 D;  3MNN A;  1P3M B;  3B6F B;  5CHL B;  3AYW A;  3H0L C;  3WA9 D;  3H0M C;  1KX5 C;  4DRA A;  3REH C;  3AZI B;  3AN2 B;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 1P3K D;  1ID3 D;  5AVB C;  4WU9 A;  4R8P A;  1M19 B;  3WAA D;  4QLC C;  5GT3 C;  5E5A B;  4EO5 B;  1Z2C B;  2G5H C;  3KXB D;  2YFV A;  5B0Y D;  3WA9 A;  1F66 D;  3R45 A;  5AV6 D;  3LZ0 D;  2G5I C;  2ARO C;  3X1V C;  3UT9 C;  1P3O C;  2NQB B;  1W2E A;  1ID3 A;  5AV8 D;  3LEL C;  5B32 G;  2ZY3 A;  3NQU B;  2Y2M A;  3AZH D;  4HGA C;  3X1T A;  3LEL B;  4ZUX C;  3B0C W;  1F1E A;  1P34 D;  3MVD A;  1F66 A;  2DF4 C;  3WKJ C;  5AV6 A;  3LZ0 A;  4X23 C;  4KUD A;  2IO5 B;  5AV9 C;  4Z66 A;  4JJN A;  2FJ7 C;  3AZH A;  5GT0 D;  1P3B D;  4WV4 B;  2YFW A;  5B24 A;  3W99 C;  1TZY D;  2BYK B;  5B2I C;  1EQZ A;  1HQ3 B;  3AZF D;  2JE5 A;  3MNN C;  2HUE B;  5B40 B;  4WZS B;  3AFA B;  1P3G D;  1P3L B;  3LZ1 C;  1P3B A;  3AZG C;  3AYW B;  5B1L C;  3AV2 A;  5B31 D;  3EPK A;  1M1A C;  5F99 D;  2BG1 A;  4R8P C;  4J8X B;  1S32 A;  2BYM A;  2HIO D;  5G49 A;  3AZJ D;  4LD9 C;  4WU9 B;  3W96 A;  5AY8 C;  3V9R A;  3O62 A;  3F6T A;  3KWQ D;  3WA9 C;  3FDD A;  1KX3 D;  3B0C T;  5C3I C;  1P3P B;  5B2J A;  1P3K C;  1ID3 C;  5DNN D;  4J8U D;  3R45 B;  1TAF A;  3WAA C;  3W97 B;  2HIO A;  2PYO A;  4NE6 A;  3KXB C;  5GSU D;  5B0Y C;  3KWQ A;  3X1T B;  1N1J B;  4Z2M G;  2ZY2 A;  1KX3 A;  3AZK D;  1F66 C;  5AV6 C;  3LZ0 C;  3REH A;  5B1M D;  3MVD B;  4KGC D;  5AV8 C;  4J8U A;  3REK D;  3AZH C;  4J8V D;  4KUD B;  3MGR D;  4Z66 B;  4AWL C;  4JJN B;  3REI D;  5JRG D;  1P3F D;  4UUZ A;  1P34 C;  5GSU A;  2YFW B;  5B24 B;  3KUY D;  1BH8 A;  5E5A D;  3AZK A;  3AZL D;  1EQZ B;  5JA4 B;  2XD1 A;  5B1M A;  5CPJ D;  3X1V A;  1P3O A;  4H9N A;  2F8N D;  5GT0 C;  1P3B C;  1P3A D;  3REI A;  1WWI A;  4E45 A;  5B0Z D;  3A1I A;  1TZY C;  5BNX A;  3KUY A;  3X1U D;  3AV2 B;  4ZBJ B;  3AZL A;  1M18 B;  3AZF C;  3WKJ A;  4NE5 A;  5CPI B;  3X1S D;  4X23 A;  1S32 B;  1P3G C;  5G49 B;  5AV9 A;  4XZQ B;  3W96 B;  1BH9 B;  3V9R B;  4WU8 D;  3O62 B;  1P3A A;  3W99 A;  5B31 C;  5BO0 A;  5F99 C;  5B2J B;  1U35 D;  2HIO C;  3UTA D;  3AZJ C;  5B33 B;  3C1B B;  5BT1 D;  1TAF B;  3X1S A;  5GXQ D;  4YM6 B;  3MGP D;  3KWQ C;  2PYO B;  3B6G D;  1KX3 C;  3MGQ A;  3C1C D;  3LZ1 A;  3EPL A;  1JFI A;  3AZG A;  3REJ D;  5B1L A;  1KX5 B;  5DNN C;  4J8U C;  1M1A A;  3REH B;  5AVB B;  3MGS D;  3VH5 T;  3AV1 A;  5CP6 D;  4LD9 A;  5AY8 A;  5GSU C;  1PZR A;  4YS3 D;  5CPK D;  4QLC B;  5GT3 B;  3AZK C;  1BH8 B;  1AOI D;  1T3U A;  5B1M C;  4KGC C;  4H9P A;  3REK C;  1P3K A;  3WTP D;  4Z5T D;  4J8V C;  4CSR A;  3MGR C;  3P5J B;  2ARO B;  5FUG B;  3UT9 B;  3X1V B;  1P3O B;  4H9N B;  5KDM A;  3MGS A;  3REI C;  3WAA A;  5JRG C;  1P3F C;  5DNM D;  3KXB A;  3KUY C;  5B0Y A;  4HGA B;  3AZL C;  3W98 D;  4ZUX B;  5BNX B;  4J8W D;  1BFM A;  3B0D C;  1KX4 D;  1AOI A;  5CPJ C;  2CV5 D;  5AV8 A;  4Z5T A;  3WKJ B;  1P3I D;  4X23 B;  4XUJ D;  1P3A C;  5AV9 B;  2VQR A;  5B0Z C;  3A6N D;  2FJ7 B;  3LJA D;  5AV5 D;  1P34 A;  3X1U C;  3W99 B;  3W98 A;  4H9Q A;  4G92 C;  5BO0 B;  5B2I B;  4J8W A;  1KX4 A;  3X1S C;  2CV5 A;  3MGQ C;  4UPK A;  1ZLA D;  4WU8 C;  4XUJ A;  5GT0 A;  4H9R A;  3MNN B;  1Q9C A;  3A6N A;  2XD5 A;  3UTB D;  4H9S A;  3LJA A;  1TZY A;  5AV5 A;  3LZ1 B;  3TU4 D;  1JFI B;  3AZG B;  5B1L B;  1U35 C;  3UTA C;  3AZM D;  2F2A C;  3AZF A;  3AV1 C;  1M1A B;  5BT1 C;  5GXQ C;  3MGP C;  4R8P B;  3B6G C;  3AZN D;  1P3G A;  3AV1 B;  3C1C C;  1ZLA A;  4LD9 B;  5AY8 B;  2YFV B;  2ZY5 A;  4DRB A;  3AZE D;  3REJ C;  3WA9 B;  3UTB A;  5C3I B;  5B31 A;  2NZD D;  1B67 A;  5AVC D;  5F99 A;  4H9P B;  3AZM A;  5B32 D;  1P3K B;  1ID3 B;  3MGS C;  3AZJ A;  5CP6 C;  4CSR B;  2Y2K A;  4YS3 C;  3REL D;  3WAA B;  5CPK C;  5KDM B;  2RIQ A;  3KXB B;  1P3M D;  5B0Y B;  3AZE A;  1AOI C;  3B6F D;  2Y2O A;  4NE3 A;  3WTP C;  2LY8 A;  3VH6 W;  5DNN A;  1F66 B;  4Z5T C;  5AV6 B;  5AVC A;  3LZ0 B;  3AZI D;  3AN2 D;  5AV8 B;  5BNV A;  5DNM C;  3AZH B;  3REL A;  2W8S A;  1M19 D;  1B6W A;  4AWL B;  1H3O A;  1R4V A;  3W98 C;  3WTP E;  1P34 B;  4J8W C;  3B0B A;  1P3M A;  1KX4 C;  4KHA A;  2Y2G A;  1HTA A;  2CV5 C;  4KGC A;  2J8P A;  3REK A;  1P3I C;  3EPH A;  3AN2 A;  4H9O A;  4Z2M H;  4XUJ C;  3MGR A;  4J8V A;  2NQB D;  3A6N C;  4H9S C;  5JRG A;  5AV5 C;  3LJA C;  1P3F A;  5GT0 B;  4H9R B;  2Y2I A;  1P3B B;  3LEL D;  5E5A A;  1TZY B;  5CPJ A;  2BYM B;  3AZF B;  1ZLA C;  2F8N A;  1P3G B;  5B0Z A;  3UTB C;  3TU4 C;  3KSY A;  1WWS A;  3X1U A;  3AZM C;  3VH6 T;  5B31 B;  5F99 B;  4G91 C;  2Y2N A;  4WJ3 C;  3AZN C;  2HIO B;  1HQ3 D;  3AZJ B;  4WU8 A;  3AZE C;  5B40 D;  2CWE A;  3KWQ B;  3AFA D;  1P3L D;  1KX3 B;  4E44 A;  2NZD C;  5BS7 C;  3AYW D;  5AVC C;  5B32 C;  1U35 A;  2BYK A;  5DNN B;  4J8U B;  3UTA A;  2L5A A;  5GXQ A;  3MGP A;  3REL C;  4J8X D;  1HQ3 A;  3B6G A;  4WU9 D;  3C1C A;  4UUZ B;  5GSU B;  1P3M C;  3B6F C;  5B40 A;  1P3L A;  3AFA A;  3REJ A;  3AZK B;  3AZI C;  4KHA B;  3AN2 C;  2F8N K;  1P3P D;  5B1M B;  4KGC B;  3REK B;  3NQJ A;  5CP6 A;  4H9O B;  5B31 G;  4J8V B;  3VH5 A;  3MGR B;  4CAY A;  1M19 C;  4YS3 A;  3W97 D;  5CPK A;  3REI B;  5E5A C;  4EO5 C;  4WNN A;  5JRG B;  1P3F B;  2RVQ D;  3X1T D;  3KUY B;  2Y2H A;  3AZL B;  3WTP A;  3B0D B;  2NQB C;  1P3P A;  5CPJ B;  3MVD D;  5DNM A;  2F8N B;  4KUD D;  3W97 A;  4Z66 D;  1P3A B;  3KFU G;  5B0Z B;  4JJN D;  1A7W A;  1N1J A;  5B24 D;  3IP4 C;  3X1U B;  1EQZ D;  4G92 B;  1P3I A;  3A1K A;  3X1S B;  2UWX A;  2IO5 C;  3MGQ B;  4M6B A;  4WU8 B;  2Y2L A;  4NFT A;  3AV2 D;  1U35 B;  1M18 D;  1HQ3 C;  3UTA B;  5JA4 A;  5CPI D;  5GXQ B;  3MGP B;  1S32 D;  2HUE C;  5B40 C;  1P3L C;  3AFA C;  3B6G B;  4XZQ D;  3C1C B;  3W96 D;  3TU4 A;  3AYW C;  2F8N G;  3O62 D;  3REJ B;  4J8X C;  5B2J D;  2FFF B;  1M18 A;  3NQJ B;  3AZN A;  2Y2J A;  3MGS B;  4WU9 C;  5CP6 B;  5B33 D;  3C1B D;  5CPI A;  4YM6 D;  4CAY B;  4YS3 B;  5CPK B;  2PYO D;  4XZQ A;  2ZY4 A;  4WNN B;  2JCH A;  1BH9 A;  2NZD A;  5BS7 A;  1P3P C;  1AOI B;  3H0R C;  1KX5 D;  5B32 A;  3WTP B;  4Z5T B;  3REH D;  2DQN C;  3W97 C;  5AVB D;  5B33 A;  3C1B A;  5DNM B;  4YM6 A;  2F8N H;  2RVQ C;  3X1T C;  3B6F A;  4QLC D;  5GT3 D;  3W98 B;  4H9Q B;  4DQY B;  4J8W B;  1KX4 B;  3AZI A;  3MVD C;  1KX5 A;  1ULY A;  2CV5 B;  4J8X A;  1P3I B;  4KUD C;  4XUJ B;  2ARO D;  4Z66 C;  3UT9 D;  3X1V D;  1P3O D;  4JJN C;  5AVB A;  1M19 A;  3A6N B;  3LJA B;  5AV5 B;  5B24 C;  4QLC A;  5GT3 A;  2JSS A;  1EQZ C;  4ZUX D;  3EG5 B;  2Y2P A;  2NQB A;  3WKJ D;  3NQU A;  1ZLA B;  4X23 D;  2ARO A;  5FUG A;  3UT9 A;  5AV9 D;  3VH5 W;  3LEL A;  2FJ7 D;  3UTB B;  3TU4 B;  3AV2 C;  4ZBJ C;  3W99 D;  1M18 C;  4ZUX A;  3AZM B;  5B2I D;  3EPJ A;  5CPI C;  1S32 C;  4G91 B;  3AZN B;  4XZQ C;  3W96 C;  3AL0 C;  3MNN D;  3O62 C;  3AZE B;  2FJ7 A;  3MGQ D;  3LZ1 D;  2NZD B;  3VH6 A;  3AZG D;  5AVC B;  5B2J C;  5B1L D;  1KU5 A;  5B32 B;  5B2I A;  5BNV B;  5B33 C;  3C1B C;  1M1A D;  4YM6 C;  3REL B;  4R8P D;  2PYO C;  2ZM5 A;  1H3O B;  3AV1 D;  4LD9 D;  5AY8 D;  3MNN A;  1P3M B;  3B6F B;  5CHL B;  3AYW A;  3H0L C;  3WA9 D;  3H0M C;  1KX5 C;  4DRA A;  3REH C;  3AZI B;  3AN2 B;  2Y2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...