3AFAB

The human nucleosome structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaB00
3X1TD 4H9PB 5AV8C 1P34B 1AOIA 3AV1D 1P3KD 3C1BB 5B33A 4HGAB 2PYOB 1M18C 3MGQA 3AN2B 3X1VD 3UTAB 1P3GD 5BS7A 3VH6A 3AZKA 2F8ND 1AOIC 3VH6W 3V9RB 1P3PB 3AZLA 3A6NB 5B33C 1U35A 3MGQC 4XZQB 3AZMB 2AROB 1WWSA 1BH8A 2BYKA 5BS7C 5B2JD 1TZYA 5GT0D 3AZKC 1P3MB 1P3LD 4YM6B 3AZLC 4J8VA 1BH9B 1P3OD 1JFIB 1F66B 5F99C 1U35C 5B32G 4NE3A 3KXBD 1TZYC 5B1LB 4CAYB 5AVBA 1KU5A 4WU9D 3AYWA 3AZGD 3KUYB 3W98D 4J8VC 5JA4B 5KDMB 3X1SA 3KSYA 4XUJD 3KWQB 5B0YB 3LELB 3NQJB 5GSUD 3RELD 3AZHA 5AY8A 5B2ID 5AVBC 3AYWC 1M1AA 3AFAA 1R4VA 4KUDA 3C1CA 3MNNB 4J8WD 2HIOA 3X1SC 1N1JB 1TAFA 3AZNB 4YS3B 1KX5D 1HQ3D 5GT3A 3AZHC 4H9QA 5AY8C 4JJNC 3LZ1B 4DRBA 1M1AC 3NQUA 3AFAC 5G49B 1P3BB 4KUDC 5AV8B 2RVQD 2HIOC 3WAAB 1B67A 4KGCD 4WU8A 5GT3C 1M19A 1M18B 3REHB 4ZBJB 4J8UB 1KX4D 4H9PA 2CV5B 1P34A 1HTAA 3X1UB 1H3OB 3UTBB 4WU8C 2PYOA 1M19C 5GXQD 3MGQB 5CP6D 1Q9CA 4J8XB 3AN2A 3UTAA 5BT1C 1P34C 3V9RA 3B0CW 1P3PA 5F99B 4HGAC 2PYOC 1U35B 3WKJB 4H9SA 4KHAB 4EO5B 4XZQA 3O62D 5B0ZD 3LJAD 3AN2C 3AZMA 2AROA 1ID3D 1P3MA 3UT9D 4YM6A 1P3PC 1BH9A 5JRGA 4LD9B 1JFIA 4Z2MG 3B6FA 5B31D 3REIC 4XZQC 4R8PD 4QLCA 3AZMC 2AROC 3TU4A 1P3MC 5B1LA 3AYWB 5AV5D 3W97B 4YM6C 5CPKD 3REKD 5B1MD 5JRGC 5JA4A 1P3AD 5KDMA 1P3FA 3VH5A 3B6FC 3VH5W 4ZUXA 5B0YA 4QLCC 3NQJA 3LELA 4JJNB 5BNVB 3TU4C 5B1LC 1M1AB 3MGPB 4G91B 4KUDB 3WTPB 3MNNA 2HIOB 1P3FC 3AZFD 1N1JA 3MGSA 4ZUXC 4YS3A 3AZIB 3LELC 5CPJA 3R45A 4X23A 4H9QB 4NE6A 1KX3D 3WA9B 3LZ1A 4Z66C 5G49A 1P3BA 4H9NB 3MGRD 3MNNC 3AZEA 3WAAA 3MGSC 4YS3C 4WU8B 5CPJC 5DNMD 4X23C 1M18A 3REHA 3AV2B 4Z5TC 4J8UA 3WTPE 1P3BC 2NZDD 2CV5A 3X1UA 3AZEC 3WAAC 1H3OA 3UTBA 5B24C 1AOID 2YFVA 3REHC 4J8XA 5FUGA 1EQZB 4ZBJC 4J8UC 5AV6B 5B33D 2CV5C 2FJ7A 3X1UC 5E5AB 3UTBC 5F99A 3REIB 3AZKD 3WKJA 4KHAA 4J8XC 3AZLD 2FJ7C 5B32D 5BO0A 1ZLAB 3B0BA 1S32B 5JRGB 4LD9A 3B6FB 3AV1C 3WKJC 1TZYD 4EO5C 4QLCB 5AVCD 5CPIB 4J8VD 3TU4B 3W97A 4H9RB 4E44A 4LD9C 1P3FB 3B6GB 1P3IB 5AVBD 4ZUXB 3W99D 4JJNA 5BNVA 5AV9B 4Z66B 3W97C 2F8NK 3X1SD 3MGPA 5DNNB 5B40D 3WTPA 3W96B 3AZHD 4WU9A 5AY8D 3MGSB 3W98A 3AFAD 3AZIA 5CPJB 3R45B 4X23B 3C1CD 3WA9A 4Z5TB 3MGPC 4G91C 3REJB 5GT3D 3WTPC 4H9NA 3AZEB 4WU9C 3W98C 5B24B 3AZIC 4J8WA 5BNXB 3MVDD 3WA9C 3AV2A 4WV4B 1KX5A 1M19D 4DRAA 3AZJD 2IO5B 1ULYA 2YFVB 4J8WC 1P34D 2F8NH 5FUGB 1EQZA 3AV2C 2NQBB 1KX5C 4KGCA 5AV6A 3C1BD 3LZ0B 2FJ7B 2PYOD 5E5AA 3AN2D 3X1TB 3UTAD 4CSRB 3AV1B 3REIA 1P3KB 1P3PD 1EQZC 3A6ND 4KGCC 5AV6C 5BO0B 5E5AC 4WZSB 3X1VB 1P3GB 1ZLAA 1S32A 4XZQD 2F8NB 3AZMD 2AROD 1P3MD 3B0DC 4YM6D 5CPIA 1F66D 1ZLAC 3LJAA 1S32C 5GT0B 1P3LB 4H9RA 5B2JB 3B6GA 3UT9A 5B1LD 1P3IA 3KUYD 1P3OB 4AWLB 5CPIC 5AV9A 4Z66A 5B31A 3O62C 5B0ZC 3LJAC 3KXBB 3KWQD 5B0YD 5DNNA 3LELD 1ID3C 3W96A 4WU9B 3B6GC 5AV5A 3UT9C 3AZGB 3W98B 1P3IC 5B1MA 5AV9C 5B31C 3MNND 4Z5TA 4XUJB 4R8PC 5GSUB 3RELB 4YS3D 3REJA 3AZND 5DNNC 3W96C 5B2IB 5AV5C 4G92B 3LZ1D 5B1MC 5B24A 1P3BD 5AV8D 4J8WB 5BNXA 2YFWB 1KX5B 3WAAD 1HQ3B 3REJC 5CHLB 1M18D 3REHD 2BYMA 4J8UD 2CV5D 3X1UD 2NQBA 4KGCB 5DNMA 3LZ0A 3UTBD 3MGQD 1KX4B 2NZDA 2IO5C 4J8XD 3X1TA 4CSRA 3AV1A 3B0DB 1P3KA 5C3IB 2NQBC 4NFTA 5DNMC 2JSSA 5GXQB 3LZ0C 5F99D 5CP6B 1U35D 3WKJD 3X1VA 1P3GA 2NZDC 3X1TC 2F8NA 1P3KC 4LD9D 3O62B 5B0ZB 3X1VC 3LJAB 1P3GC 1WWIA 5GT0A 1P3LA 1ID3B 5B2JA 3UT9B 2F8NG 5B32A 3W97D 3AYWD 3VH6T 1P3OA 5B31B 4E45A 4R8PB 5AVCA 3KXBA 1A7WA 5GT0C 1P3LC 5B2JC 5AV5B 4JJND 3AZGA 5CPKB 5B32C 3REKB 5B1MB 1M1AD 3MGPD 4KUDD 1P3OC 1P3AB 4AWLC 3WTPD 2HIOD 4XUJA 5GSUA 5AVCC 3RELA 3KXBC 2CWEA 3W99A 3AZID 5B2IA 3AZGC 3WA9D 5B40A 3AZFB 4XUJC 2YFWA 1HQ3A 5GSUC 3RELC 1KX3B 3W99C 4WU8D 5B2IC 4WNNB 4G92C 2BYMB 3AV2D 4H9OB 5BT1D 5B40C 3MGRB 1HQ3C 2HUEB 5DNMB 3MVDA 3C1CC 1KX4A 2NZDB 1EQZD 2RVQC 5AV6D 3AZJA 5E5AD 2L5AA 4UUZA 5GXQA 1F1EA 1AOIB 3MVDC 5CP6A 3REID 2LY8A 1KX4C 3C1BA 5B33B 3AZJC 4M6BA 5C3IC 1ZLAD 1S32D 5JRGD 3AZKB 5GXQC 3O62A 3B6FD 5CP6C 5B0ZA 3AZLB 3A6NA 1BFMA 1ID3A 4QLCD 3C1BC 5CPID 1B6WA 3TU4D 5B32B 3B0CT 3UTAC 2BYKB 1BH8B 1TZYB 1P3FD 3B6GD 4R8PA 5AVCB 1P3ID 4ZUXD 3A6NC 4J8VB 4NE5A 1F66A 5CPKA 5AV9D 4Z66D 3REKA 4H9SC 1P3AA 5DNND 3W96D 5AVBB 4CAYA 5B31G 3KUYA 3MGSD 3W99B 5CPJD 4X23D 3X1SB 1F66C 5CPKC 3REKC 4Z5TD 3KWQA 5B40B 1P3AC 3AZHB 5AY8B 3REJD 3AZFA 3AZED 3AFAB 3KUYC 3VH5T 1KX3A 5B24D 3C1CB 4WNNA 1TAFB 3KWQC 3AZNA 4H9OA 5GT3B 5B0YC 3MGRA 3AZFC 3NQUB 5AV8A 1KX3C 3MVDB 2NQBD 3AZNC 3MGRC 1M19B 3LZ0D 4Z2MH 2FJ7D 3AZJB 3LZ1C 4UUZB 2HUEC
chains in the Genus database with same CATH superfamily
3X1TD 4H9PB 5AV8C 1P34B 1AOIA 3AV1D 1P3KD 3C1BB 5B33A 4HGAB 2PYOB 1M18C 3MGQA 3AN2B 3X1VD 3UTAB 1P3GD 5BS7A 3VH6A 3AZKA 2F8ND 1AOIC 3VH6W 3V9RB 1P3PB 3AZLA 3A6NB 3AL0C 5B33C 3EG5B 1U35A 3MGQC 4XZQB 3AZMB 2AROB 1WWSA 1BH8A 2BYKA 5BS7C 5B2JD 1TZYA 5GT0D 3AZKC 1P3MB 1P3LD 4YM6B 3AZLC 4J8VA 1BH9B 1P3OD 1JFIB 1F66B 5F99C 1U35C 5B32G 4NE3A 3H0MC 3KXBD 1TZYC 5B1LB 4CAYB 5AVBA 1KU5A 4WU9D 3AYWA 3AZGD 3KUYB 3W98D 4J8VC 5JA4B 5KDMB 3X1SA 3KSYA 4XUJD 3KWQB 5B0YB 3A1KA 3LELB 3NQJB 5GSUD 3RELD 2XD5A 2Y2LA 5AY8A 3AZHA 5B2ID 5AVBC 3AYWC 1M1AA 3AFAA 1R4VA 4KUDA 3C1CA 3MNNB 4J8WD 2HIOA 2VQRA 1N1JB 3X1SC 1TAFA 3AZNB 4YS3B 1KX5D 1HQ3D 5GT3A 3AZHC 4H9QA 5AY8C 4JJNC 3IP4C 4DRBA 3LZ1B 1M1AC 3NQUA 3AFAC 5G49B 1P3BB 4KUDC 5AV8B 2RVQD 2Y2PA 2HIOC 2ZY5A 3WAAB 1B67A 4KGCD 4WU8A 5GT3C 1M19A 1M18B 3REHB 4ZBJB 4J8UB 1KX4D 4H9PA 2CV5B 1P34A 1HTAA 3X1UB 1H3OB 3UTBB 4WU8C 2PYOA 1M19C 5GXQD 3MGQB 5CP6D 1Q9CA 4J8XB 2Y2OA 2F2AC 3UTAA 3AN2A 5BT1C 1P34C 3V9RA 3B0CW 3EPJA 1P3PA 5F99B 2XD1A 4HGAC 1U35B 2PYOC 3WKJB 1Z2CB 4H9SA 4KHAB 4EO5B 4XZQA 3O62D 5B0ZD 3LJAD 3AN2C 3AZMA 2AROA 1ID3D 1P3MA 3UT9D 4YM6A 2JCHA 1P3PC 1BH9A 5JRGA 4LD9B 1JFIA 4Z2MG 3B6FA 5B31D 3REIC 4XZQC 4R8PD 4QLCA 3AZMC 2AROC 3TU4A 1P3MC 5B1LA 3AYWB 5AV5D 3W97B 4YM6C 5CPKD 3REKD 5B1MD 5JRGC 5JA4A 1P3AD 5KDMA 1P3FA 3VH5A 3B6FC 3VH5W 4ZUXA 5B0YA 4QLCC 3NQJA 3LELA 4JJNB 2DQNC 5BNVB 3TU4C 5B1LC 1M1AB 3MGPB 4G91B 4KUDB 3WTPB 3MNNA 2HIOB 1P3FC 3AZFD 1N1JA 3MGSA 4ZUXC 4YS3A 3AZIB 3LELC 5CPJA 3R45A 4X23A 4H9QB 4NE6A 1KX3D 3WA9B 3LZ1A 4Z66C 5G49A 1P3BA 2Y2KA 4H9NB 3MNNC 3MGRD 3AZEA 4DQYB 3WAAA 3MGSC 4YS3C 4WU8B 5CPJC 5DNMD 4X23C 1M18A 3REHA 3AV2B 4Z5TC 4J8UA 3WTPE 1P3BC 2NZDD 2CV5A 3X1UA 3AZEC 3WAAC 1H3OA 3UTBA 5B24C 1AOID 2YFVA 3REHC 4J8XA 5FUGA 1EQZB 4ZBJC 4J8UC 5AV6B 5B33D 2CV5C 2FJ7A 3X1UC 5E5AB 3UTBC 5F99A 3REIB 3AZKD 3WKJA 4KHAA 4J8XC 3AZLD 2ZY2A 2FJ7C 5B32D 5BO0A 1ZLAB 2G5HC 3B0BA 1S32B 5JRGB 4LD9A 3B6FB 2BG1A 3AV1C 3WKJC 1TZYD 4EO5C 4QLCB 5AVCD 5CPIB 4J8VD 3TU4B 3W97A 4H9RB 4E44A 4LD9C 1P3FB 3B6GB 1P3IB 5AVBD 4ZUXB 2Y2GA 3W99D 1T3UA 4JJNA 5BNVA 5AV9B 4Z66B 3W97C 2F8NK 3X1SD 3MGPA 2DF4C 5DNNB 5B40D 3WTPA 3W96B 3AZHD 4WU9A 5AY8D 2RIQA 3MGSB 3W98A 3AFAD 3AZIA 5CPJB 3R45B 4UPKA 4X23B 3C1CD 3WA9A 3EPHA 4Z5TB 3MGPC 4G91C 3REJB 5GT3D 3WTPC 4H9NA 3AZEB 4WU9C 2JE5A 3W98C 5B24B 3AZIC 4J8WA 5BNXB 3MVDD 3WA9C 3AV2A 4WV4B 1KX5A 2Y2NA 1M19D 4DRAA 3AZJD 2IO5B 1ULYA 2YFVB 4J8WC 1P34D 2F8NH 5FUGB 1EQZA 3AV2C 2NQBB 1KX5C 4KGCA 5AV6A 3C1BD 3LZ0B 2FJ7B 2PYOD 5E5AA 3FDDA 3AN2D 3UTAD 2FFFB 4CSRB 3X1TB 3AV1B 3REIA 1P3KB 1P3PD 1EQZC 3A6ND 4KGCC 5AV6C 2J8PA 5BO0B 5E5AC 4WZSB 3X1VB 1P3GB 1ZLAA 1S32A 4XZQD 2F8NB 3AZMD 2AROD 1P3MD 2Y2IA 3B0DC 4YM6D 2ZY4A 5CPIA 2ZM5A 1F66D 1ZLAC 3LJAA 1S32C 5GT0B 1P3LB 4H9RA 5B2JB 3B6GA 3UT9A 5B1LD 1P3IA 3KUYD 1P3OB 4AWLB 5CPIC 5AV9A 4Z66A 5B31A 3O62C 5B0ZC 3LJAC 3A1IA 3KXBB 3KWQD 5B0YD 5DNNA 3LELD 1ID3C 3W96A 2UWXA 4WU9B 5AV5A 3UT9C 3B6GC 3AZGB 3W98B 1P3IC 5B1MA 5AV9C 5B31C 3MNND 4Z5TA 4XUJB 4R8PC 5GSUB 3RELB 4YS3D 3REJA 3AZND 5DNNC 3W96C 5B2IB 5AV5C 4G92B 3LZ1D 5B1MC 5B24A 1P3BD 5AV8D 4J8WB 5BNXA 2YFWB 1KX5B 3WAAD 1HQ3B 3REJC 5CHLB 1M18D 3REHD 2BYMA 4J8UD 2CV5D 3X1UD 2NQBA 4KGCB 5DNMA 3LZ0A 3UTBD 3MGQD 1KX4B 2NZDA 2IO5C 4J8XD 3X1TA 4CSRA 2Y2MA 3AV1A 3B0DB 1P3KA 5C3IB 2NQBC 4NFTA 5DNMC 2JSSA 5GXQB 3LZ0C 5F99D 2G5IC 5CP6B 1U35D 3WKJD 3X1VA 1P3GA 2NZDC 3X1TC 2F8NA 1P3KC 2Y2QA 4LD9D 3O62B 5B0ZB 3X1VC 2W8SA 3LJAB 1WWIA 1P3GC 5GT0A 1P3LA 1ID3B 5B2JA 3UT9B 2F8NG 5B32A 3W97D 3AYWD 3VH6T 1P3OA 5B31B 4E45A 4R8PB 5AVCA 3KXBA 1A7WA 5GT0C 1P3LC 5B2JC 5AV5B 4JJND 3AZGA 5CPKB 5B32C 3REKB 5B1MB 1M1AD 3EPLA 3MGPD 4KUDD 1P3OC 1P3AB 4AWLC 3EPKA 3WTPD 1W2EA 2HIOD 4XUJA 5GSUA 5AVCC 3RELA 3KXBC 2CWEA 3W99A 2ZY3A 3AZID 5B2IA 3AZGC 3WA9D 5B40A 3AZFB 4XUJC 2YFWA 1HQ3A 5GSUC 3RELC 1KX3B 3W99C 4WU8D 5B2IC 4WNNB 4G92C 2BYMB 3AV2D 2Y2JA 4H9OB 5BT1D 3MGRB 5B40C 1HQ3C 2HUEB 5DNMB 3MVDA 3C1CC 3F6TA 1KX4A 2NZDB 1EQZD 2RVQC 5AV6D 3AZJA 5E5AD 2L5AA 4UUZA 5GXQA 1F1EA 1AOIB 3MVDC 5CP6A 3REID 2LY8A 1KX4C 3C1BA 5B33B 3AZJC 4M6BA 5C3IC 1ZLAD 1S32D 3H0LC 5JRGD 3P5JB 3AZKB 5GXQC 3O62A 3B6FD 5CP6C 5B0ZA 3AZLB 3A6NA 1BFMA 1ID3A 4QLCD 3C1BC 5CPID 1B6WA 3TU4D 5B32B 3B0CT 3UTAC 2BYKB 1BH8B 1TZYB 1P3FD 3B6GD 4R8PA 5AVCB 1P3ID 4ZUXD 3A6NC 4J8VB 4NE5A 1F66A 5CPKA 5AV9D 4Z66D 3REKA 4H9SC 1P3AA 5DNND 3W96D 5AVBB 4CAYA 5B31G 3KUYA 3MGSD 3W99B 5CPJD 4X23D 3X1SB 1F66C 5CPKC 3REKC 4Z5TD 3H0RC 3KWQA 5B40B 1P3AC 3AZHB 5AY8B 3REJD 3AZFA 3AZED 3AFAB 3KFUG 3KUYC 1PZRA 3VH5T 1KX3A 5B24D 3C1CB 4WNNA 1TAFB 3KWQC 3AZNA 4H9OA 5GT3B 5B0YC 3MGRA 3AZFC 2Y2HA 3NQUB 5AV8A 1KX3C 3MVDB 2NQBD 3AZNC 4WJ3C 3MGRC 1M19B 3LZ0D 4Z2MH 2FJ7D 3AZJB 3LZ1C 4UUZB 2HUEC
chains in the Genus database with same CATH topology
3X1TD 4H9PB 5AV8C 1P34B 1AOIA 3AV1D 1P3KD 3C1BB 5B33A 4HGAB 2PYOB 1M18C 3MGQA 3AN2B 3X1VD 3UTAB 1P3GD 5BS7A 3VH6A 3AZKA 2F8ND 1AOIC 3VH6W 3V9RB 1P3PB 3AZLA 3A6NB 3AL0C 5B33C 3EG5B 1U35A 3MGQC 4XZQB 3AZMB 2AROB 1WWSA 1BH8A 2BYKA 5BS7C 5B2JD 1TZYA 5GT0D 3AZKC 1P3MB 1P3LD 4YM6B 3AZLC 4J8VA 1BH9B 1P3OD 1JFIB 1F66B 5F99C 1U35C 5B32G 4NE3A 3H0MC 3KXBD 1TZYC 5B1LB 4CAYB 5AVBA 1KU5A 4WU9D 3AYWA 3AZGD 3KUYB 3W98D 4J8VC 5JA4B 5KDMB 3X1SA 3KSYA 4XUJD 3KWQB 5B0YB 3A1KA 3LELB 3NQJB 5GSUD 3RELD 2XD5A 2Y2LA 5AY8A 3AZHA 5B2ID 5AVBC 3AYWC 1M1AA 3AFAA 1R4VA 4KUDA 3C1CA 3MNNB 4J8WD 2HIOA 2VQRA 1N1JB 3X1SC 1TAFA 3AZNB 4YS3B 1KX5D 1HQ3D 5GT3A 3AZHC 4H9QA 5AY8C 4JJNC 3IP4C 4DRBA 3LZ1B 1M1AC 3NQUA 3AFAC 5G49B 1P3BB 4KUDC 5AV8B 2RVQD 2Y2PA 2HIOC 2ZY5A 3WAAB 1B67A 4KGCD 4WU8A 5GT3C 1M19A 1M18B 3REHB 4ZBJB 4J8UB 1KX4D 4H9PA 2CV5B 1P34A 1HTAA 3X1UB 1H3OB 3UTBB 4WU8C 2PYOA 1M19C 5GXQD 3MGQB 5CP6D 1Q9CA 4J8XB 2Y2OA 2F2AC 3UTAA 3AN2A 5BT1C 1P34C 3V9RA 3B0CW 3EPJA 1P3PA 5F99B 2XD1A 4HGAC 1U35B 2PYOC 3WKJB 1Z2CB 4H9SA 4KHAB 4EO5B 4XZQA 3O62D 5B0ZD 3LJAD 3AN2C 3AZMA 2AROA 1ID3D 1P3MA 3UT9D 4YM6A 2JCHA 1P3PC 1BH9A 5JRGA 4LD9B 1JFIA 4Z2MG 3B6FA 5B31D 3REIC 4XZQC 4R8PD 4QLCA 3AZMC 2AROC 3TU4A 1P3MC 5B1LA 3AYWB 5AV5D 3W97B 4YM6C 5CPKD 3REKD 5B1MD 5JRGC 5JA4A 1P3AD 5KDMA 1P3FA 3VH5A 3B6FC 3VH5W 4ZUXA 5B0YA 4QLCC 3NQJA 3LELA 4JJNB 2DQNC 5BNVB 3TU4C 5B1LC 1M1AB 3MGPB 4G91B 4KUDB 3WTPB 3MNNA 2HIOB 1P3FC 3AZFD 1N1JA 3MGSA 4ZUXC 4YS3A 3AZIB 3LELC 5CPJA 3R45A 4X23A 4H9QB 4NE6A 1KX3D 3WA9B 3LZ1A 4Z66C 5G49A 1P3BA 2Y2KA 4H9NB 3MNNC 3MGRD 3AZEA 4DQYB 3WAAA 3MGSC 4YS3C 4WU8B 5CPJC 5DNMD 4X23C 1M18A 3REHA 3AV2B 4Z5TC 4J8UA 3WTPE 1P3BC 2NZDD 2CV5A 3X1UA 3AZEC 3WAAC 1H3OA 3UTBA 5B24C 1AOID 2YFVA 3REHC 4J8XA 5FUGA 1EQZB 4ZBJC 4J8UC 5AV6B 5B33D 2CV5C 2FJ7A 3X1UC 5E5AB 3UTBC 5F99A 3REIB 3AZKD 3WKJA 4KHAA 4J8XC 3AZLD 2ZY2A 2FJ7C 5B32D 5BO0A 1ZLAB 2G5HC 3B0BA 1S32B 5JRGB 4LD9A 3B6FB 2BG1A 3AV1C 3WKJC 1TZYD 4EO5C 4QLCB 5AVCD 5CPIB 4J8VD 3TU4B 3W97A 4H9RB 4E44A 4LD9C 1P3FB 3B6GB 1P3IB 5AVBD 4ZUXB 2Y2GA 3W99D 1T3UA 4JJNA 5BNVA 5AV9B 4Z66B 3W97C 2F8NK 3X1SD 3MGPA 2DF4C 5DNNB 5B40D 3WTPA 3W96B 3AZHD 4WU9A 5AY8D 2RIQA 3MGSB 3W98A 3AFAD 3AZIA 5CPJB 3R45B 4UPKA 4X23B 3C1CD 3WA9A 3EPHA 4Z5TB 3MGPC 4G91C 3REJB 5GT3D 3WTPC 4H9NA 3AZEB 4WU9C 2JE5A 3W98C 5B24B 3AZIC 4J8WA 5BNXB 3MVDD 3WA9C 3AV2A 4WV4B 1KX5A 2Y2NA 1M19D 4DRAA 3AZJD 2IO5B 1ULYA 2YFVB 4J8WC 1P34D 2F8NH 5FUGB 1EQZA 3AV2C 2NQBB 1KX5C 4KGCA 5AV6A 3C1BD 3LZ0B 2FJ7B 2PYOD 5E5AA 3FDDA 3AN2D 3UTAD 2FFFB 4CSRB 3X1TB 3AV1B 3REIA 1P3KB 1P3PD 1EQZC 3A6ND 4KGCC 5AV6C 2J8PA 5BO0B 5E5AC 4WZSB 3X1VB 1P3GB 1ZLAA 1S32A 4XZQD 2F8NB 3AZMD 2AROD 1P3MD 2Y2IA 3B0DC 4YM6D 2ZY4A 5CPIA 2ZM5A 1F66D 1ZLAC 3LJAA 1S32C 5GT0B 1P3LB 4H9RA 5B2JB 3B6GA 3UT9A 5B1LD 1P3IA 3KUYD 1P3OB 4AWLB 5CPIC 5AV9A 4Z66A 5B31A 3O62C 5B0ZC 3LJAC 3A1IA 3KXBB 3KWQD 5B0YD 5DNNA 3LELD 1ID3C 3W96A 2UWXA 4WU9B 5AV5A 3UT9C 3B6GC 3AZGB 3W98B 1P3IC 5B1MA 5AV9C 5B31C 3MNND 4Z5TA 4XUJB 4R8PC 5GSUB 3RELB 4YS3D 3REJA 3AZND 5DNNC 3W96C 5B2IB 5AV5C 4G92B 3LZ1D 5B1MC 5B24A 1P3BD 5AV8D 4J8WB 5BNXA 2YFWB 1KX5B 3WAAD 1HQ3B 3REJC 5CHLB 1M18D 3REHD 2BYMA 4J8UD 2CV5D 3X1UD 2NQBA 4KGCB 5DNMA 3LZ0A 3UTBD 3MGQD 1KX4B 2NZDA 2IO5C 4J8XD 3X1TA 4CSRA 2Y2MA 3AV1A 3B0DB 1P3KA 5C3IB 2NQBC 4NFTA 5DNMC 2JSSA 5GXQB 3LZ0C 5F99D 2G5IC 5CP6B 1U35D 3WKJD 3X1VA 1P3GA 2NZDC 3X1TC 2F8NA 1P3KC 2Y2QA 4LD9D 3O62B 5B0ZB 3X1VC 2W8SA 3LJAB 1WWIA 1P3GC 5GT0A 1P3LA 1ID3B 5B2JA 3UT9B 2F8NG 5B32A 3W97D 3AYWD 3VH6T 1P3OA 5B31B 4E45A 4R8PB 5AVCA 3KXBA 1A7WA 5GT0C 1P3LC 5B2JC 5AV5B 4JJND 3AZGA 5CPKB 5B32C 3REKB 5B1MB 1M1AD 3EPLA 3MGPD 4KUDD 1P3OC 1P3AB 4AWLC 3EPKA 3WTPD 1W2EA 2HIOD 4XUJA 5GSUA 5AVCC 3RELA 3KXBC 2CWEA 3W99A 2ZY3A 3AZID 5B2IA 3AZGC 3WA9D 5B40A 3AZFB 4XUJC 2YFWA 1HQ3A 5GSUC 3RELC 1KX3B 3W99C 4WU8D 5B2IC 4WNNB 4G92C 2BYMB 3AV2D 2Y2JA 4H9OB 5BT1D 3MGRB 5B40C 1HQ3C 2HUEB 5DNMB 3MVDA 3C1CC 3F6TA 1KX4A 2NZDB 1EQZD 2RVQC 5AV6D 3AZJA 5E5AD 2L5AA 4UUZA 5GXQA 1F1EA 1AOIB 3MVDC 5CP6A 3REID 2LY8A 1KX4C 3C1BA 5B33B 3AZJC 4M6BA 5C3IC 1ZLAD 1S32D 3H0LC 5JRGD 3P5JB 3AZKB 5GXQC 3O62A 3B6FD 5CP6C 5B0ZA 3AZLB 3A6NA 1BFMA 1ID3A 4QLCD 3C1BC 5CPID 1B6WA 3TU4D 5B32B 3B0CT 3UTAC 2BYKB 1BH8B 1TZYB 1P3FD 3B6GD 4R8PA 5AVCB 1P3ID 4ZUXD 3A6NC 4J8VB 4NE5A 1F66A 5CPKA 5AV9D 4Z66D 3REKA 4H9SC 1P3AA 5DNND 3W96D 5AVBB 4CAYA 5B31G 3KUYA 3MGSD 3W99B 5CPJD 4X23D 3X1SB 1F66C 5CPKC 3REKC 4Z5TD 3H0RC 3KWQA 5B40B 1P3AC 3AZHB 5AY8B 3REJD 3AZFA 3AZED 3AFAB 3KFUG 3KUYC 1PZRA 3VH5T 1KX3A 5B24D 3C1CB 4WNNA 1TAFB 3KWQC 3AZNA 4H9OA 5GT3B 5B0YC 3MGRA 3AZFC 2Y2HA 3NQUB 5AV8A 1KX3C 3MVDB 2NQBD 3AZNC 4WJ3C 3MGRC 1M19B 3LZ0D 4Z2MH 2FJ7D 3AZJB 3LZ1C 4UUZB 2HUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T D;  4H9P B;  5AV8 C;  1P34 B;  1AOI A;  3AV1 D;  1P3K D;  3C1B B;  5B33 A;  4HGA B;  2PYO B;  1M18 C;  3MGQ A;  3AN2 B;  3X1V D;  3UTA B;  1P3G D;  5BS7 A;  3VH6 A;  3AZK A;  2F8N D;  1AOI C;  3VH6 W;  3V9R B;  1P3P B;  3AZL A;  3A6N B;  5B33 C;  1U35 A;  3MGQ C;  4XZQ B;  3AZM B;  2ARO B;  1WWS A;  1BH8 A;  2BYK A;  5BS7 C;  5B2J D;  1TZY A;  5GT0 D;  3AZK C;  1P3M B;  1P3L D;  4YM6 B;  3AZL C;  4J8V A;  1BH9 B;  1P3O D;  1JFI B;  1F66 B;  5F99 C;  1U35 C;  5B32 G;  4NE3 A;  3KXB D;  1TZY C;  5B1L B;  4CAY B;  5AVB A;  1KU5 A;  4WU9 D;  3AYW A;  3AZG D;  3KUY B;  3W98 D;  4J8V C;  5JA4 B;  5KDM B;  3X1S A;  3KSY A;  4XUJ D;  3KWQ B;  5B0Y B;  3LEL B;  3NQJ B;  5GSU D;  3REL D;  3AZH A;  5AY8 A;  5B2I D;  5AVB C;  3AYW C;  1M1A A;  3AFA A;  1R4V A;  4KUD A;  3C1C A;  3MNN B;  4J8W D;  2HIO A;  3X1S C;  1N1J B;  1TAF A;  3AZN B;  4YS3 B;  1KX5 D;  1HQ3 D;  5GT3 A;  3AZH C;  4H9Q A;  5AY8 C;  4JJN C;  3LZ1 B;  4DRB A;  1M1A C;  3NQU A;  3AFA C;  5G49 B;  1P3B B;  4KUD C;  5AV8 B;  2RVQ D;  2HIO C;  3WAA B;  1B67 A;  4KGC D;  4WU8 A;  5GT3 C;  1M19 A;  1M18 B;  3REH B;  4ZBJ B;  4J8U B;  1KX4 D;  4H9P A;  2CV5 B;  1P34 A;  1HTA A;  3X1U B;  1H3O B;  3UTB B;  4WU8 C;  2PYO A;  1M19 C;  5GXQ D;  3MGQ B;  5CP6 D;  1Q9C A;  4J8X B;  3AN2 A;  3UTA A;  5BT1 C;  1P34 C;  3V9R A;  3B0C W;  1P3P A;  5F99 B;  4HGA C;  2PYO C;  1U35 B;  3WKJ B;  4H9S A;  4KHA B;  4EO5 B;  4XZQ A;  3O62 D;  5B0Z D;  3LJA D;  3AN2 C;  3AZM A;  2ARO A;  1ID3 D;  1P3M A;  3UT9 D;  4YM6 A;  1P3P C;  1BH9 A;  5JRG A;  4LD9 B;  1JFI A;  4Z2M G;  3B6F A;  5B31 D;  3REI C;  4XZQ C;  4R8P D;  4QLC A;  3AZM C;  2ARO C;  3TU4 A;  1P3M C;  5B1L A;  3AYW B;  5AV5 D;  3W97 B;  4YM6 C;  5CPK D;  3REK D;  5B1M D;  5JRG C;  5JA4 A;  1P3A D;  5KDM A;  1P3F A;  3VH5 A;  3B6F C;  3VH5 W;  4ZUX A;  5B0Y A;  4QLC C;  3NQJ A;  3LEL A;  4JJN B;  5BNV B;  3TU4 C;  5B1L C;  1M1A B;  3MGP B;  4G91 B;  4KUD B;  3WTP B;  3MNN A;  2HIO B;  1P3F C;  3AZF D;  1N1J A;  3MGS A;  4ZUX C;  4YS3 A;  3AZI B;  3LEL C;  5CPJ A;  3R45 A;  4X23 A;  4H9Q B;  4NE6 A;  1KX3 D;  3WA9 B;  3LZ1 A;  4Z66 C;  5G49 A;  1P3B A;  4H9N B;  3MGR D;  3MNN C;  3AZE A;  3WAA A;  3MGS C;  4YS3 C;  4WU8 B;  5CPJ C;  5DNM D;  4X23 C;  1M18 A;  3REH A;  3AV2 B;  4Z5T C;  4J8U A;  3WTP E;  1P3B C;  2NZD D;  2CV5 A;  3X1U A;  3AZE C;  3WAA C;  1H3O A;  3UTB A;  5B24 C;  1AOI D;  2YFV A;  3REH C;  4J8X A;  5FUG A;  1EQZ B;  4ZBJ C;  4J8U C;  5AV6 B;  5B33 D;  2CV5 C;  2FJ7 A;  3X1U C;  5E5A B;  3UTB C;  5F99 A;  3REI B;  3AZK D;  3WKJ A;  4KHA A;  4J8X C;  3AZL D;  2FJ7 C;  5B32 D;  5BO0 A;  1ZLA B;  3B0B A;  1S32 B;  5JRG B;  4LD9 A;  3B6F B;  3AV1 C;  3WKJ C;  1TZY D;  4EO5 C;  4QLC B;  5AVC D;  5CPI B;  4J8V D;  3TU4 B;  3W97 A;  4H9R B;  4E44 A;  4LD9 C;  1P3F B;  3B6G B;  1P3I B;  5AVB D;  4ZUX B;  3W99 D;  4JJN A;  5BNV A;  5AV9 B;  4Z66 B;  3W97 C;  2F8N K;  3X1S D;  3MGP A;  5DNN B;  5B40 D;  3WTP A;  3W96 B;  3AZH D;  4WU9 A;  5AY8 D;  3MGS B;  3W98 A;  3AFA D;  3AZI A;  5CPJ B;  3R45 B;  4X23 B;  3C1C D;  3WA9 A;  4Z5T B;  3MGP C;  4G91 C;  3REJ B;  5GT3 D;  3WTP C;  4H9N A;  3AZE B;  4WU9 C;  3W98 C;  5B24 B;  3AZI C;  4J8W A;  5BNX B;  3MVD D;  3WA9 C;  3AV2 A;  4WV4 B;  1KX5 A;  1M19 D;  4DRA A;  3AZJ D;  2IO5 B;  1ULY A;  2YFV B;  4J8W C;  1P34 D;  2F8N H;  5FUG B;  1EQZ A;  3AV2 C;  2NQB B;  1KX5 C;  4KGC A;  5AV6 A;  3C1B D;  3LZ0 B;  2FJ7 B;  2PYO D;  5E5A A;  3AN2 D;  3X1T B;  3UTA D;  4CSR B;  3AV1 B;  3REI A;  1P3K B;  1P3P D;  1EQZ C;  3A6N D;  4KGC C;  5AV6 C;  5BO0 B;  5E5A C;  4WZS B;  3X1V B;  1P3G B;  1ZLA A;  1S32 A;  4XZQ D;  2F8N B;  3AZM D;  2ARO D;  1P3M D;  3B0D C;  4YM6 D;  5CPI A;  1F66 D;  1ZLA C;  3LJA A;  1S32 C;  5GT0 B;  1P3L B;  4H9R A;  5B2J B;  3B6G A;  3UT9 A;  5B1L D;  1P3I A;  3KUY D;  1P3O B;  4AWL B;  5CPI C;  5AV9 A;  4Z66 A;  5B31 A;  3O62 C;  5B0Z C;  3LJA C;  3KXB B;  3KWQ D;  5B0Y D;  5DNN A;  3LEL D;  1ID3 C;  3W96 A;  4WU9 B;  3B6G C;  5AV5 A;  3UT9 C;  3AZG B;  3W98 B;  1P3I C;  5B1M A;  5AV9 C;  5B31 C;  3MNN D;  4Z5T A;  4XUJ B;  4R8P C;  5GSU B;  3REL B;  4YS3 D;  3REJ A;  3AZN D;  5DNN C;  3W96 C;  5B2I B;  5AV5 C;  4G92 B;  3LZ1 D;  5B1M C;  5B24 A;  1P3B D;  5AV8 D;  4J8W B;  5BNX A;  2YFW B;  1KX5 B;  3WAA D;  1HQ3 B;  3REJ C;  5CHL B;  1M18 D;  3REH D;  2BYM A;  4J8U D;  2CV5 D;  3X1U D;  2NQB A;  4KGC B;  5DNM A;  3LZ0 A;  3UTB D;  3MGQ D;  1KX4 B;  2NZD A;  2IO5 C;  4J8X D;  3X1T A;  4CSR A;  3AV1 A;  3B0D B;  1P3K A;  5C3I B;  2NQB C;  4NFT A;  5DNM C;  2JSS A;  5GXQ B;  3LZ0 C;  5F99 D;  5CP6 B;  1U35 D;  3WKJ D;  3X1V A;  1P3G A;  2NZD C;  3X1T C;  2F8N A;  1P3K C;  4LD9 D;  3O62 B;  5B0Z B;  3X1V C;  3LJA B;  1P3G C;  1WWI A;  5GT0 A;  1P3L A;  1ID3 B;  5B2J A;  3UT9 B;  2F8N G;  5B32 A;  3W97 D;  3AYW D;  3VH6 T;  1P3O A;  5B31 B;  4E45 A;  4R8P B;  5AVC A;  3KXB A;  1A7W A;  5GT0 C;  1P3L C;  5B2J C;  5AV5 B;  4JJN D;  3AZG A;  5CPK B;  5B32 C;  3REK B;  5B1M B;  1M1A D;  3MGP D;  4KUD D;  1P3O C;  1P3A B;  4AWL C;  3WTP D;  2HIO D;  4XUJ A;  5GSU A;  5AVC C;  3REL A;  3KXB C;  2CWE A;  3W99 A;  3AZI D;  5B2I A;  3AZG C;  3WA9 D;  5B40 A;  3AZF B;  4XUJ C;  2YFW A;  1HQ3 A;  5GSU C;  3REL C;  1KX3 B;  3W99 C;  4WU8 D;  5B2I C;  4WNN B;  4G92 C;  2BYM B;  3AV2 D;  4H9O B;  5BT1 D;  5B40 C;  3MGR B;  1HQ3 C;  2HUE B;  5DNM B;  3MVD A;  3C1C C;  1KX4 A;  2NZD B;  1EQZ D;  2RVQ C;  5AV6 D;  3AZJ A;  5E5A D;  2L5A A;  4UUZ A;  5GXQ A;  1F1E A;  1AOI B;  3MVD C;  5CP6 A;  3REI D;  2LY8 A;  1KX4 C;  3C1B A;  5B33 B;  3AZJ C;  4M6B A;  5C3I C;  1ZLA D;  1S32 D;  5JRG D;  3AZK B;  5GXQ C;  3O62 A;  3B6F D;  5CP6 C;  5B0Z A;  3AZL B;  3A6N A;  1BFM A;  1ID3 A;  4QLC D;  3C1B C;  5CPI D;  1B6W A;  3TU4 D;  5B32 B;  3B0C T;  3UTA C;  2BYK B;  1BH8 B;  1TZY B;  1P3F D;  3B6G D;  4R8P A;  5AVC B;  1P3I D;  4ZUX D;  3A6N C;  4J8V B;  4NE5 A;  1F66 A;  5CPK A;  5AV9 D;  4Z66 D;  3REK A;  4H9S C;  1P3A A;  5DNN D;  3W96 D;  5AVB B;  4CAY A;  5B31 G;  3KUY A;  3MGS D;  3W99 B;  5CPJ D;  4X23 D;  3X1S B;  1F66 C;  5CPK C;  3REK C;  4Z5T D;  3KWQ A;  5B40 B;  1P3A C;  3AZH B;  5AY8 B;  3REJ D;  3AZF A;  3AZE D;  3AFA B;  3KUY C;  3VH5 T;  1KX3 A;  5B24 D;  3C1C B;  4WNN A;  1TAF B;  3KWQ C;  3AZN A;  4H9O A;  5GT3 B;  5B0Y C;  3MGR A;  3AZF C;  3NQU B;  5AV8 A;  1KX3 C;  3MVD B;  2NQB D;  3AZN C;  3MGR C;  1M19 B;  3LZ0 D;  4Z2M H;  2FJ7 D;  3AZJ B;  3LZ1 C;  4UUZ B;  2HUE C; 
#chains in the Genus database with same CATH topology
 3X1T D;  4H9P B;  5AV8 C;  1P34 B;  1AOI A;  3AV1 D;  1P3K D;  3C1B B;  5B33 A;  4HGA B;  2PYO B;  1M18 C;  3MGQ A;  3AN2 B;  3X1V D;  3UTA B;  1P3G D;  5BS7 A;  3VH6 A;  3AZK A;  2F8N D;  1AOI C;  3VH6 W;  3V9R B;  1P3P B;  3AZL A;  3A6N B;  3AL0 C;  5B33 C;  3EG5 B;  1U35 A;  3MGQ C;  4XZQ B;  3AZM B;  2ARO B;  1WWS A;  1BH8 A;  2BYK A;  5BS7 C;  5B2J D;  1TZY A;  5GT0 D;  3AZK C;  1P3M B;  1P3L D;  4YM6 B;  3AZL C;  4J8V A;  1BH9 B;  1P3O D;  1JFI B;  1F66 B;  5F99 C;  1U35 C;  5B32 G;  4NE3 A;  3H0M C;  3KXB D;  1TZY C;  5B1L B;  4CAY B;  5AVB A;  1KU5 A;  4WU9 D;  3AYW A;  3AZG D;  3KUY B;  3W98 D;  4J8V C;  5JA4 B;  5KDM B;  3X1S A;  3KSY A;  4XUJ D;  3KWQ B;  5B0Y B;  3A1K A;  3LEL B;  3NQJ B;  5GSU D;  3REL D;  2XD5 A;  2Y2L A;  5AY8 A;  3AZH A;  5B2I D;  5AVB C;  3AYW C;  1M1A A;  3AFA A;  1R4V A;  4KUD A;  3C1C A;  3MNN B;  4J8W D;  2HIO A;  2VQR A;  1N1J B;  3X1S C;  1TAF A;  3AZN B;  4YS3 B;  1KX5 D;  1HQ3 D;  5GT3 A;  3AZH C;  4H9Q A;  5AY8 C;  4JJN C;  3IP4 C;  4DRB A;  3LZ1 B;  1M1A C;  3NQU A;  3AFA C;  5G49 B;  1P3B B;  4KUD C;  5AV8 B;  2RVQ D;  2Y2P A;  2HIO C;  2ZY5 A;  3WAA B;  1B67 A;  4KGC D;  4WU8 A;  5GT3 C;  1M19 A;  1M18 B;  3REH B;  4ZBJ B;  4J8U B;  1KX4 D;  4H9P A;  2CV5 B;  1P34 A;  1HTA A;  3X1U B;  1H3O B;  3UTB B;  4WU8 C;  2PYO A;  1M19 C;  5GXQ D;  3MGQ B;  5CP6 D;  1Q9C A;  4J8X B;  2Y2O A;  2F2A C;  3UTA A;  3AN2 A;  5BT1 C;  1P34 C;  3V9R A;  3B0C W;  3EPJ A;  1P3P A;  5F99 B;  2XD1 A;  4HGA C;  1U35 B;  2PYO C;  3WKJ B;  1Z2C B;  4H9S A;  4KHA B;  4EO5 B;  4XZQ A;  3O62 D;  5B0Z D;  3LJA D;  3AN2 C;  3AZM A;  2ARO A;  1ID3 D;  1P3M A;  3UT9 D;  4YM6 A;  2JCH A;  1P3P C;  1BH9 A;  5JRG A;  4LD9 B;  1JFI A;  4Z2M G;  3B6F A;  5B31 D;  3REI C;  4XZQ C;  4R8P D;  4QLC A;  3AZM C;  2ARO C;  3TU4 A;  1P3M C;  5B1L A;  3AYW B;  5AV5 D;  3W97 B;  4YM6 C;  5CPK D;  3REK D;  5B1M D;  5JRG C;  5JA4 A;  1P3A D;  5KDM A;  1P3F A;  3VH5 A;  3B6F C;  3VH5 W;  4ZUX A;  5B0Y A;  4QLC C;  3NQJ A;  3LEL A;  4JJN B;  2DQN C;  5BNV B;  3TU4 C;  5B1L C;  1M1A B;  3MGP B;  4G91 B;  4KUD B;  3WTP B;  3MNN A;  2HIO B;  1P3F C;  3AZF D;  1N1J A;  3MGS A;  4ZUX C;  4YS3 A;  3AZI B;  3LEL C;  5CPJ A;  3R45 A;  4X23 A;  4H9Q B;  4NE6 A;  1KX3 D;  3WA9 B;  3LZ1 A;  4Z66 C;  5G49 A;  1P3B A;  2Y2K A;  4H9N B;  3MNN C;  3MGR D;  3AZE A;  4DQY B;  3WAA A;  3MGS C;  4YS3 C;  4WU8 B;  5CPJ C;  5DNM D;  4X23 C;  1M18 A;  3REH A;  3AV2 B;  4Z5T C;  4J8U A;  3WTP E;  1P3B C;  2NZD D;  2CV5 A;  3X1U A;  3AZE C;  3WAA C;  1H3O A;  3UTB A;  5B24 C;  1AOI D;  2YFV A;  3REH C;  4J8X A;  5FUG A;  1EQZ B;  4ZBJ C;  4J8U C;  5AV6 B;  5B33 D;  2CV5 C;  2FJ7 A;  3X1U C;  5E5A B;  3UTB C;  5F99 A;  3REI B;  3AZK D;  3WKJ A;  4KHA A;  4J8X C;  3AZL D;  2ZY2 A;  2FJ7 C;  5B32 D;  5BO0 A;  1ZLA B;  2G5H C;  3B0B A;  1S32 B;  5JRG B;  4LD9 A;  3B6F B;  2BG1 A;  3AV1 C;  3WKJ C;  1TZY D;  4EO5 C;  4QLC B;  5AVC D;  5CPI B;  4J8V D;  3TU4 B;  3W97 A;  4H9R B;  4E44 A;  4LD9 C;  1P3F B;  3B6G B;  1P3I B;  5AVB D;  4ZUX B;  2Y2G A;  3W99 D;  1T3U A;  4JJN A;  5BNV A;  5AV9 B;  4Z66 B;  3W97 C;  2F8N K;  3X1S D;  3MGP A;  2DF4 C;  5DNN B;  5B40 D;  3WTP A;  3W96 B;  3AZH D;  4WU9 A;  5AY8 D;  2RIQ A;  3MGS B;  3W98 A;  3AFA D;  3AZI A;  5CPJ B;  3R45 B;  4UPK A;  4X23 B;  3C1C D;  3WA9 A;  3EPH A;  4Z5T B;  3MGP C;  4G91 C;  3REJ B;  5GT3 D;  3WTP C;  4H9N A;  3AZE B;  4WU9 C;  2JE5 A;  3W98 C;  5B24 B;  3AZI C;  4J8W A;  5BNX B;  3MVD D;  3WA9 C;  3AV2 A;  4WV4 B;  1KX5 A;  2Y2N A;  1M19 D;  4DRA A;  3AZJ D;  2IO5 B;  1ULY A;  2YFV B;  4J8W C;  1P34 D;  2F8N H;  5FUG B;  1EQZ A;  3AV2 C;  2NQB B;  1KX5 C;  4KGC A;  5AV6 A;  3C1B D;  3LZ0 B;  2FJ7 B;  2PYO D;  5E5A A;  3FDD A;  3AN2 D;  3UTA D;  2FFF B;  4CSR B;  3X1T B;  3AV1 B;  3REI A;  1P3K B;  1P3P D;  1EQZ C;  3A6N D;  4KGC C;  5AV6 C;  2J8P A;  5BO0 B;  5E5A C;  4WZS B;  3X1V B;  1P3G B;  1ZLA A;  1S32 A;  4XZQ D;  2F8N B;  3AZM D;  2ARO D;  1P3M D;  2Y2I A;  3B0D C;  4YM6 D;  2ZY4 A;  5CPI A;  2ZM5 A;  1F66 D;  1ZLA C;  3LJA A;  1S32 C;  5GT0 B;  1P3L B;  4H9R A;  5B2J B;  3B6G A;  3UT9 A;  5B1L D;  1P3I A;  3KUY D;  1P3O B;  4AWL B;  5CPI C;  5AV9 A;  4Z66 A;  5B31 A;  3O62 C;  5B0Z C;  3LJA C;  3A1I A;  3KXB B;  3KWQ D;  5B0Y D;  5DNN A;  3LEL D;  1ID3 C;  3W96 A;  2UWX A;  4WU9 B;  5AV5 A;  3UT9 C;  3B6G C;  3AZG B;  3W98 B;  1P3I C;  5B1M A;  5AV9 C;  5B31 C;  3MNN D;  4Z5T A;  4XUJ B;  4R8P C;  5GSU B;  3REL B;  4YS3 D;  3REJ A;  3AZN D;  5DNN C;  3W96 C;  5B2I B;  5AV5 C;  4G92 B;  3LZ1 D;  5B1M C;  5B24 A;  1P3B D;  5AV8 D;  4J8W B;  5BNX A;  2YFW B;  1KX5 B;  3WAA D;  1HQ3 B;  3REJ C;  5CHL B;  1M18 D;  3REH D;  2BYM A;  4J8U D;  2CV5 D;  3X1U D;  2NQB A;  4KGC B;  5DNM A;  3LZ0 A;  3UTB D;  3MGQ D;  1KX4 B;  2NZD A;  2IO5 C;  4J8X D;  3X1T A;  4CSR A;  2Y2M A;  3AV1 A;  3B0D B;  1P3K A;  5C3I B;  2NQB C;  4NFT A;  5DNM C;  2JSS A;  5GXQ B;  3LZ0 C;  5F99 D;  2G5I C;  5CP6 B;  1U35 D;  3WKJ D;  3X1V A;  1P3G A;  2NZD C;  3X1T C;  2F8N A;  1P3K C;  2Y2Q A;  4LD9 D;  3O62 B;  5B0Z B;  3X1V C;  2W8S A;  3LJA B;  1WWI A;  1P3G C;  5GT0 A;  1P3L A;  1ID3 B;  5B2J A;  3UT9 B;  2F8N G;  5B32 A;  3W97 D;  3AYW D;  3VH6 T;  1P3O A;  5B31 B;  4E45 A;  4R8P B;  5AVC A;  3KXB A;  1A7W A;  5GT0 C;  1P3L C;  5B2J C;  5AV5 B;  4JJN D;  3AZG A;  5CPK B;  5B32 C;  3REK B;  5B1M B;  1M1A D;  3EPL A;  3MGP D;  4KUD D;  1P3O C;  1P3A B;  4AWL C;  3EPK A;  3WTP D;  1W2E A;  2HIO D;  4XUJ A;  5GSU A;  5AVC C;  3REL A;  3KXB C;  2CWE A;  3W99 A;  2ZY3 A;  3AZI D;  5B2I A;  3AZG C;  3WA9 D;  5B40 A;  3AZF B;  4XUJ C;  2YFW A;  1HQ3 A;  5GSU C;  3REL C;  1KX3 B;  3W99 C;  4WU8 D;  5B2I C;  4WNN B;  4G92 C;  2BYM B;  3AV2 D;  2Y2J A;  4H9O B;  5BT1 D;  3MGR B;  5B40 C;  1HQ3 C;  2HUE B;  5DNM B;  3MVD A;  3C1C C;  3F6T A;  1KX4 A;  2NZD B;  1EQZ D;  2RVQ C;  5AV6 D;  3AZJ A;  5E5A D;  2L5A A;  4UUZ A;  5GXQ A;  1F1E A;  1AOI B;  3MVD C;  5CP6 A;  3REI D;  2LY8 A;  1KX4 C;  3C1B A;  5B33 B;  3AZJ C;  4M6B A;  5C3I C;  1ZLA D;  1S32 D;  3H0L C;  5JRG D;  3P5J B;  3AZK B;  5GXQ C;  3O62 A;  3B6F D;  5CP6 C;  5B0Z A;  3AZL B;  3A6N A;  1BFM A;  1ID3 A;  4QLC D;  3C1B C;  5CPI D;  1B6W A;  3TU4 D;  5B32 B;  3B0C T;  3UTA C;  2BYK B;  1BH8 B;  1TZY B;  1P3F D;  3B6G D;  4R8P A;  5AVC B;  1P3I D;  4ZUX D;  3A6N C;  4J8V B;  4NE5 A;  1F66 A;  5CPK A;  5AV9 D;  4Z66 D;  3REK A;  4H9S C;  1P3A A;  5DNN D;  3W96 D;  5AVB B;  4CAY A;  5B31 G;  3KUY A;  3MGS D;  3W99 B;  5CPJ D;  4X23 D;  3X1S B;  1F66 C;  5CPK C;  3REK C;  4Z5T D;  3H0R C;  3KWQ A;  5B40 B;  1P3A C;  3AZH B;  5AY8 B;  3REJ D;  3AZF A;  3AZE D;  3AFA B;  3KFU G;  3KUY C;  1PZR A;  3VH5 T;  1KX3 A;  5B24 D;  3C1C B;  4WNN A;  1TAF B;  3KWQ C;  3AZN A;  4H9O A;  5GT3 B;  5B0Y C;  3MGR A;  3AZF C;  2Y2H A;  3NQU B;  5AV8 A;  1KX3 C;  3MVD B;  2NQB D;  3AZN C;  4WJ3 C;  3MGR C;  1M19 B;  3LZ0 D;  4Z2M H;  2FJ7 D;  3AZJ B;  3LZ1 C;  4UUZ B;  2HUE C; 
#chains in the Genus database with same CATH homology
 3X1T D;  4H9P B;  5AV8 C;  1P34 B;  1AOI A;  3AV1 D;  1P3K D;  3C1B B;  5B33 A;  4HGA B;  2PYO B;  1M18 C;  3MGQ A;  3AN2 B;  3X1V D;  3UTA B;  1P3G D;  5BS7 A;  3VH6 A;  3AZK A;  2F8N D;  1AOI C;  3VH6 W;  3V9R B;  1P3P B;  3AZL A;  3A6N B;  3AL0 C;  5B33 C;  3EG5 B;  1U35 A;  3MGQ C;  4XZQ B;  3AZM B;  2ARO B;  1WWS A;  1BH8 A;  2BYK A;  5BS7 C;  5B2J D;  1TZY A;  5GT0 D;  3AZK C;  1P3M B;  1P3L D;  4YM6 B;  3AZL C;  4J8V A;  1BH9 B;  1P3O D;  1JFI B;  1F66 B;  5F99 C;  1U35 C;  5B32 G;  4NE3 A;  3H0M C;  3KXB D;  1TZY C;  5B1L B;  4CAY B;  5AVB A;  1KU5 A;  4WU9 D;  3AYW A;  3AZG D;  3KUY B;  3W98 D;  4J8V C;  5JA4 B;  5KDM B;  3X1S A;  3KSY A;  4XUJ D;  3KWQ B;  5B0Y B;  3A1K A;  3LEL B;  3NQJ B;  5GSU D;  3REL D;  2XD5 A;  2Y2L A;  5AY8 A;  3AZH A;  5B2I D;  5AVB C;  3AYW C;  1M1A A;  3AFA A;  1R4V A;  4KUD A;  3C1C A;  3MNN B;  4J8W D;  2HIO A;  2VQR A;  1N1J B;  3X1S C;  1TAF A;  3AZN B;  4YS3 B;  1KX5 D;  1HQ3 D;  5GT3 A;  3AZH C;  4H9Q A;  5AY8 C;  4JJN C;  3IP4 C;  4DRB A;  3LZ1 B;  1M1A C;  3NQU A;  3AFA C;  5G49 B;  1P3B B;  4KUD C;  5AV8 B;  2RVQ D;  2Y2P A;  2HIO C;  2ZY5 A;  3WAA B;  1B67 A;  4KGC D;  4WU8 A;  5GT3 C;  1M19 A;  1M18 B;  3REH B;  4ZBJ B;  4J8U B;  1KX4 D;  4H9P A;  2CV5 B;  1P34 A;  1HTA A;  3X1U B;  1H3O B;  3UTB B;  4WU8 C;  2PYO A;  1M19 C;  5GXQ D;  3MGQ B;  5CP6 D;  1Q9C A;  4J8X B;  2Y2O A;  2F2A C;  3UTA A;  3AN2 A;  5BT1 C;  1P34 C;  3V9R A;  3B0C W;  3EPJ A;  1P3P A;  5F99 B;  2XD1 A;  4HGA C;  1U35 B;  2PYO C;  3WKJ B;  1Z2C B;  4H9S A;  4KHA B;  4EO5 B;  4XZQ A;  3O62 D;  5B0Z D;  3LJA D;  3AN2 C;  3AZM A;  2ARO A;  1ID3 D;  1P3M A;  3UT9 D;  4YM6 A;  2JCH A;  1P3P C;  1BH9 A;  5JRG A;  4LD9 B;  1JFI A;  4Z2M G;  3B6F A;  5B31 D;  3REI C;  4XZQ C;  4R8P D;  4QLC A;  3AZM C;  2ARO C;  3TU4 A;  1P3M C;  5B1L A;  3AYW B;  5AV5 D;  3W97 B;  4YM6 C;  5CPK D;  3REK D;  5B1M D;  5JRG C;  5JA4 A;  1P3A D;  5KDM A;  1P3F A;  3VH5 A;  3B6F C;  3VH5 W;  4ZUX A;  5B0Y A;  4QLC C;  3NQJ A;  3LEL A;  4JJN B;  2DQN C;  5BNV B;  3TU4 C;  5B1L C;  1M1A B;  3MGP B;  4G91 B;  4KUD B;  3WTP B;  3MNN A;  2HIO B;  1P3F C;  3AZF D;  1N1J A;  3MGS A;  4ZUX C;  4YS3 A;  3AZI B;  3LEL C;  5CPJ A;  3R45 A;  4X23 A;  4H9Q B;  4NE6 A;  1KX3 D;  3WA9 B;  3LZ1 A;  4Z66 C;  5G49 A;  1P3B A;  2Y2K A;  4H9N B;  3MNN C;  3MGR D;  3AZE A;  4DQY B;  3WAA A;  3MGS C;  4YS3 C;  4WU8 B;  5CPJ C;  5DNM D;  4X23 C;  1M18 A;  3REH A;  3AV2 B;  4Z5T C;  4J8U A;  3WTP E;  1P3B C;  2NZD D;  2CV5 A;  3X1U A;  3AZE C;  3WAA C;  1H3O A;  3UTB A;  5B24 C;  1AOI D;  2YFV A;  3REH C;  4J8X A;  5FUG A;  1EQZ B;  4ZBJ C;  4J8U C;  5AV6 B;  5B33 D;  2CV5 C;  2FJ7 A;  3X1U C;  5E5A B;  3UTB C;  5F99 A;  3REI B;  3AZK D;  3WKJ A;  4KHA A;  4J8X C;  3AZL D;  2ZY2 A;  2FJ7 C;  5B32 D;  5BO0 A;  1ZLA B;  2G5H C;  3B0B A;  1S32 B;  5JRG B;  4LD9 A;  3B6F B;  2BG1 A;  3AV1 C;  3WKJ C;  1TZY D;  4EO5 C;  4QLC B;  5AVC D;  5CPI B;  4J8V D;  3TU4 B;  3W97 A;  4H9R B;  4E44 A;  4LD9 C;  1P3F B;  3B6G B;  1P3I B;  5AVB D;  4ZUX B;  2Y2G A;  3W99 D;  1T3U A;  4JJN A;  5BNV A;  5AV9 B;  4Z66 B;  3W97 C;  2F8N K;  3X1S D;  3MGP A;  2DF4 C;  5DNN B;  5B40 D;  3WTP A;  3W96 B;  3AZH D;  4WU9 A;  5AY8 D;  2RIQ A;  3MGS B;  3W98 A;  3AFA D;  3AZI A;  5CPJ B;  3R45 B;  4UPK A;  4X23 B;  3C1C D;  3WA9 A;  3EPH A;  4Z5T B;  3MGP C;  4G91 C;  3REJ B;  5GT3 D;  3WTP C;  4H9N A;  3AZE B;  4WU9 C;  2JE5 A;  3W98 C;  5B24 B;  3AZI C;  4J8W A;  5BNX B;  3MVD D;  3WA9 C;  3AV2 A;  4WV4 B;  1KX5 A;  2Y2N A;  1M19 D;  4DRA A;  3AZJ D;  2IO5 B;  1ULY A;  2YFV B;  4J8W C;  1P34 D;  2F8N H;  5FUG B;  1EQZ A;  3AV2 C;  2NQB B;  1KX5 C;  4KGC A;  5AV6 A;  3C1B D;  3LZ0 B;  2FJ7 B;  2PYO D;  5E5A A;  3FDD A;  3AN2 D;  3UTA D;  2FFF B;  4CSR B;  3X1T B;  3AV1 B;  3REI A;  1P3K B;  1P3P D;  1EQZ C;  3A6N D;  4KGC C;  5AV6 C;  2J8P A;  5BO0 B;  5E5A C;  4WZS B;  3X1V B;  1P3G B;  1ZLA A;  1S32 A;  4XZQ D;  2F8N B;  3AZM D;  2ARO D;  1P3M D;  2Y2I A;  3B0D C;  4YM6 D;  2ZY4 A;  5CPI A;  2ZM5 A;  1F66 D;  1ZLA C;  3LJA A;  1S32 C;  5GT0 B;  1P3L B;  4H9R A;  5B2J B;  3B6G A;  3UT9 A;  5B1L D;  1P3I A;  3KUY D;  1P3O B;  4AWL B;  5CPI C;  5AV9 A;  4Z66 A;  5B31 A;  3O62 C;  5B0Z C;  3LJA C;  3A1I A;  3KXB B;  3KWQ D;  5B0Y D;  5DNN A;  3LEL D;  1ID3 C;  3W96 A;  2UWX A;  4WU9 B;  5AV5 A;  3UT9 C;  3B6G C;  3AZG B;  3W98 B;  1P3I C;  5B1M A;  5AV9 C;  5B31 C;  3MNN D;  4Z5T A;  4XUJ B;  4R8P C;  5GSU B;  3REL B;  4YS3 D;  3REJ A;  3AZN D;  5DNN C;  3W96 C;  5B2I B;  5AV5 C;  4G92 B;  3LZ1 D;  5B1M C;  5B24 A;  1P3B D;  5AV8 D;  4J8W B;  5BNX A;  2YFW B;  1KX5 B;  3WAA D;  1HQ3 B;  3REJ C;  5CHL B;  1M18 D;  3REH D;  2BYM A;  4J8U D;  2CV5 D;  3X1U D;  2NQB A;  4KGC B;  5DNM A;  3LZ0 A;  3UTB D;  3MGQ D;  1KX4 B;  2NZD A;  2IO5 C;  4J8X D;  3X1T A;  4CSR A;  2Y2M A;  3AV1 A;  3B0D B;  1P3K A;  5C3I B;  2NQB C;  4NFT A;  5DNM C;  2JSS A;  5GXQ B;  3LZ0 C;  5F99 D;  2G5I C;  5CP6 B;  1U35 D;  3WKJ D;  3X1V A;  1P3G A;  2NZD C;  3X1T C;  2F8N A;  1P3K C;  2Y2Q A;  4LD9 D;  3O62 B;  5B0Z B;  3X1V C;  2W8S A;  3LJA B;  1WWI A;  1P3G C;  5GT0 A;  1P3L A;  1ID3 B;  5B2J A;  3UT9 B;  2F8N G;  5B32 A;  3W97 D;  3AYW D;  3VH6 T;  1P3O A;  5B31 B;  4E45 A;  4R8P B;  5AVC A;  3KXB A;  1A7W A;  5GT0 C;  1P3L C;  5B2J C;  5AV5 B;  4JJN D;  3AZG A;  5CPK B;  5B32 C;  3REK B;  5B1M B;  1M1A D;  3EPL A;  3MGP D;  4KUD D;  1P3O C;  1P3A B;  4AWL C;  3EPK A;  3WTP D;  1W2E A;  2HIO D;  4XUJ A;  5GSU A;  5AVC C;  3REL A;  3KXB C;  2CWE A;  3W99 A;  2ZY3 A;  3AZI D;  5B2I A;  3AZG C;  3WA9 D;  5B40 A;  3AZF B;  4XUJ C;  2YFW A;  1HQ3 A;  5GSU C;  3REL C;  1KX3 B;  3W99 C;  4WU8 D;  5B2I C;  4WNN B;  4G92 C;  2BYM B;  3AV2 D;  2Y2J A;  4H9O B;  5BT1 D;  3MGR B;  5B40 C;  1HQ3 C;  2HUE B;  5DNM B;  3MVD A;  3C1C C;  3F6T A;  1KX4 A;  2NZD B;  1EQZ D;  2RVQ C;  5AV6 D;  3AZJ A;  5E5A D;  2L5A A;  4UUZ A;  5GXQ A;  1F1E A;  1AOI B;  3MVD C;  5CP6 A;  3REI D;  2LY8 A;  1KX4 C;  3C1B A;  5B33 B;  3AZJ C;  4M6B A;  5C3I C;  1ZLA D;  1S32 D;  3H0L C;  5JRG D;  3P5J B;  3AZK B;  5GXQ C;  3O62 A;  3B6F D;  5CP6 C;  5B0Z A;  3AZL B;  3A6N A;  1BFM A;  1ID3 A;  4QLC D;  3C1B C;  5CPI D;  1B6W A;  3TU4 D;  5B32 B;  3B0C T;  3UTA C;  2BYK B;  1BH8 B;  1TZY B;  1P3F D;  3B6G D;  4R8P A;  5AVC B;  1P3I D;  4ZUX D;  3A6N C;  4J8V B;  4NE5 A;  1F66 A;  5CPK A;  5AV9 D;  4Z66 D;  3REK A;  4H9S C;  1P3A A;  5DNN D;  3W96 D;  5AVB B;  4CAY A;  5B31 G;  3KUY A;  3MGS D;  3W99 B;  5CPJ D;  4X23 D;  3X1S B;  1F66 C;  5CPK C;  3REK C;  4Z5T D;  3H0R C;  3KWQ A;  5B40 B;  1P3A C;  3AZH B;  5AY8 B;  3REJ D;  3AZF A;  3AZE D;  3AFA B;  3KFU G;  3KUY C;  1PZR A;  3VH5 T;  1KX3 A;  5B24 D;  3C1C B;  4WNN A;  1TAF B;  3KWQ C;  3AZN A;  4H9O A;  5GT3 B;  5B0Y C;  3MGR A;  3AZF C;  2Y2H A;  3NQU B;  5AV8 A;  1KX3 C;  3MVD B;  2NQB D;  3AZN C;  4WJ3 C;  3MGR C;  1M19 B;  3LZ0 D;  4Z2M H;  2FJ7 D;  3AZJ B;  3LZ1 C;  4UUZ B;  2HUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...