3AFAB

The human nucleosome structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaB00
3REKA 4DRAA 3C1CB 3RELA 5E5AC 5JRGD 3WTPA 1H3OA 3V9RA 4Z5TD 1BH8A 5AV8B 3R45A 5AVCD 1P3FD 4CSRA 5G49A 3MGRD 5B40C 3C1CD 3WTPD 3AFAC 1R4VA 4Z66D 1P3LB 3AZJA 4XUJC 3W96D 3X1SC 4KUDA 3AZHB 5B0ZA 1EQZC 5CP6B 2NZDB 5GXQB 2AROC 5AV8C 2RVQD 3AZFB 4UUZB 3AZLD 4G91B 3B0CW 2BYMB 1TZYA 5DNNC 3UTAA 3LELB 1P3BA 2CV5C 3LELD 3REKC 5AV8A 3B6GA 3RELB 4WU8D 4CSRB 4Z5TA 1P3FA 3WTPE 3V9RB 3AV1D 3AN2C 3AZJC 5AY8D 5GSUB 4E45A 3KXBC 3A6NA 5JA4A 3MGPA 5CHLB 3WKJA 3TU4D 3AZJB 3AZKD 5AY8C 5CPKB 3LZ1B 5GXQD 3X1VB 4H9RB 3AZMA 3WAAA 4H9SC 5AV5A 3TU4C 3REJA 3W96B 3B6FD 3MGSC 3AZIC 5E5AB 1P3IB 5B24A 1P3GD 4J8WC 3X1SB 3C1BC 1P3BD 5GT3B 1TZYB 4YM6B 5GT3D 3UTAC 1M19C 5BO0B 2YFVA 3LJAC 5DNMB 4E44A 1P3LC 3B0DC 3KWQC 1M1AC 2F8NK 4WU9B 1P3BC 1H3OB 1KX3C 3R45B 5B1MC 3LJAD 3MGQD 3X1VD 5C3IB 4J8UD 3WTPC 2PYOA 3W97C 1KX3D 5AV9B 2HIOA 4G91C 5B1MB 3LZ1A 4DRBA 5CPJA 1P3GB 1KX5C 1ID3C 4KUDB 4J8UB 5B33B 1P3AA 5AVBD 3AN2B 3W99A 3X1SD 4WU9C 4JJND 4KGCD 2HIOD 1P3ID 2LY8A 4R8PA 3MVDA 2F8NA 2F8NH 1P3MC 1S32A 3AZFA 3X1TB 2YFWA 2AROA 5B32G 3C1BA 1P3OA 5B24C 2FJ7C 1HTAA 5B0YA 4QLCB 1S32D 5AV6A 4KUDC 4Z2MG 3W96C 3NQJB 1P34A 1M18A 5GXQC 4Z66B 3AYWD 2FJ7D 3LZ0A 1WWIA 3B6GC 3UT9A 1P3KC 4KUDD 3X1TC 4H9PB 5BT1D 2L5AA 3AYWC 3B0DB 4H9NA 5F99B 3KWQB 4J8XA 3MNNA 4YS3A 5CPJC 1B67A 4LD9D 3WKJC 3REKB 3W99B 3W97A 4YM6C 1U35A 5AV9D 4WNNA 5JRGA 3REHA 3AZFD 1M1AD 3AZLA 4H9QA 5BS7A 3WTPB 5B0YB 3REID 3AZGC 3WA9A 4YM6D 5B0YD 3REIB 1Q9CA 1P3GC 5DNMD 3X1UA 3AV1A 3W98C 4QLCA 4NE3A 4X23C 3UTBD 3AZHA 3UTBB 3UT9B 3NQJA 5BS7C 3UT9D 2NQBA 5B2JA 3AZKA 3AZNB 1P3IC 3LZ1D 5BNXB 1ZLAD 5DNND 1TZYC 2NZDA 1ULYA 3KWQA 3B0BA 4H9OA 4XZQC 4J8XC 1F66A 3W97D 1U35D 1AOIA 4WU8C 1ZLAA 5B31D 1P3KB 4J8WB 5B2ID 3B6GB 1BH9A 3AZEC 4Z5TB 5AV8D 1P3FB 3C1CC 3REHC 5GSUD 5AY8B 5CPKC 2HIOC 1KX5A 1ID3A 1U35C 3KXBB 4Z66C 5GT0C 3MGPB 4XUJD 1KX4A 1M1AB 3UTBA 5CP6C 3LZ0D 4J8VD 3AYWB 3AV2A 1P3MA 3MGRB 5BNXA 3W96A 1N1JB 3VH5W 3AZKB 3AZNA 3X1VA 1KX4C 3VH5T 3AV2D 3W98B 1P3KD 5B0ZD 5BNVA 5GT0B 1AOIB 3AZGD 4JJNB 1P3IA 4J8WA 1M19D 2CV5D 5B0YC 2F8ND 3AZGB 1BH9B 4H9NB 5F99A 5B33D 3X1SA 5AV5B 1ZLAB 1A7WA 5B31G 4NFTA 5B0ZC 1EQZA 1F66C 5AVCA 3KXBD 4WU8A 1KU5A 5B31B 1M1AA 1TAFA 4J8UC 3C1BD 3WA9B 3MGQA 5FUGB 5B1MA 4CAYA 5B0ZB 2PYOB 4NE5A 3WKJD 3X1UC 4R8PB 5B32C 3MVDB 3X1VC 1B6WA 3AZFC 4JJNA 4ZUXC 3KUYC 2PYOD 3W98A 3AZGA 3WA9C 3UTAB 3REIC 2F8NB 5B24D 1P3GA 3UTAD 5B33A 1P3AB 5F99D 5AV5D 2BYKA 3W98D 3MGRC 1P3OD 3C1BB 3WA9D 4KHAA 1AOID 5B31A 5B2IC 4NE6A 1HQ3D 5AV6C 5B40B 3A6ND 1P3OC 3LZ0B 5CPKA 1KX4B 1ZLAC 1P3LA 5C3IC 5B2JD 1P34B 2RVQC 4XZQA 5AVBB 4J8XB 4JJNC 5CP6D 3LZ0C 4J8XD 3AV2B 5CPIA 5E5AA 1P3MB 3MNNB 4H9PA 3B6FA 1F66D 4KGCB 2CV5B 5B24B 3REKD 3AZMD 5DNNA 3REJC 3REIA 3MNNC 5B1LA 3MGSD 4WU9A 4X23B 2YFVB 3AZIB 4WNNB 5JRGB 4R8PC 3VH6A 3MVDC 4AWLB 4Z2MH 4ZUXB 4WV4B 3AZHD 4M6BA 3AZKC 3LZ1C 3VH5A 3X1UD 1P3PA 1JFIA 4XUJB 5DNMC 3LJAB 3AZEB 1KX3A 5FUGA 1HQ3B 3AZHC 4XZQD 2FJ7A 3WKJB 5CPIB 2F8NG 3B6FC 4XZQB 5AVBA 1P3PD 5JA4B 2NZDD 5AV5C 4J8UA 3TU4A 3AZED 3O62C 3AZND 1AOIC 3B6FB 5KDMA 1M19B 1P3KA 3X1TA 5GT0D 5DNNB 2AROD 4H9OB 5AVBC 5B32A 3KWQD 5B1LD 3A6NC 1P34C 4X23D 3UTBC 4LD9B 3C1CA 3KXBA 4WZSB 3AZIA 4Z66A 2CWEA 5GT3A 5GSUC 5CPKD 3MGRA 5BO0A 3KUYA 1JFIB 3AV2C 1N1JA 1HQ3A 5B40A 3AV1C 5GXQA 3LJAA 3AFAB 3O62A 4KGCC 1P3AC 3AFAD 4G92C 5B31C 3MNND 5F99C 1BFMA 5BNVB 1P3MD 3TU4B 2BYMA 3REHB 3AZLB 3REHD 1U35B 3W99D 2HIOB 4UUZA 5AV9A 2NQBC 4QLCC 4WU8B 4EO5C 4KGCA 3AV1B 5AVCB 3RELD 3W99C 5GSUA 4QLCD 1S32B 4G92B 5B2IB 3B6GD 3LELA 2AROB 3MGPC 1P3BB 3KUYB 4CAYB 1WWSA 5GT3C 3RELC 1TAFB 5CPIC 1M18B 5B40D 3A6NB 3MGPD 4LD9C 1P3PB 3AZEA 3AFAA 4HGAB 3AZMC 1KX3B 5B33C 5B1LC 2IO5C 1F1EA 3NQUA 5E5AD 5JRGC 4YS3D 4AWLC 4KHAB 4H9RA 4HGAC 3AZMB 4R8PD 3MVDD 2NZDC 5B32D 1M18C 5DNMA 1TZYD 4WU9D 3MGSA 2HUEC 3AZID 5B2IA 1M18D 1P34D 4J8VA 3LELC 3X1UB 3VH6T 5AVCC 3O62D 3AZJD 3KUYD 2PYOC 3AN2A 3AZLC 2NQBD 3REJD 2NQBB 5B2JB 3MGQC 5CPJB 3WAAD 3O62B 2CV5A 1EQZB 4ZBJC 5BT1C 1EQZD 1P3AD 1S32C 1KX5D 1ID3D 3WAAC 1HQ3C 4ZUXA 5AV6D 1F66B 2YFWB 4ZBJB 4X23A 5AY8A 3MGSB 4J8VC 5AV9C 1KX5B 1ID3B 5B1LB 2IO5B 5AV6B 5B2JC 3MGQB 1BH8B 1P3OB 5G49B 1P3PC 2FJ7B 4J8VB 4XUJA 1KX4D 3B0CT 2JSSA 4H9SA 1P3LD 3AYWA 3AZNC 5CPJD 3WAAB 2HUEB 3KSYA 4YS3C 3AN2D 3REJB 5CPID 5B1MD 5KDMB 4J8WD 3UT9C 1M19A 5CP6A 2BYKB 3X1TD 4YS3B 5GT0A 4H9QB 3VH6W 4LD9A 3W97B 4YM6A 4Z5TC 5B32B 1P3FC 3NQUB 4EO5B 4ZUXD
chains in the Genus database with same CATH superfamily
3REKA 4DRAA 3C1CB 3RELA 5E5AC 5JRGD 3WTPA 1H3OA 3V9RA 4Z5TD 1BH8A 5AV8B 3R45A 5AVCD 1P3FD 4CSRA 5G49A 3MGRD 5B40C 3C1CD 3WTPD 3AFAC 1R4VA 4Z66D 1P3LB 3AZJA 4XUJC 3W96D 3X1SC 4KUDA 3AZHB 5B0ZA 1EQZC 5CP6B 2NZDB 2Y2MA 5GXQB 2AROC 4UPKA 5AV8C 2RVQD 3AZFB 4UUZB 3AZLD 4G91B 3B0CW 3A1KA 2BYMB 1TZYA 5DNNC 3UTAA 3LELB 1P3BA 2F2AC 2CV5C 3LELD 3REKC 5AV8A 3B6GA 3RELB 4WU8D 4CSRB 4Z5TA 1P3FA 3WTPE 3EG5B 3H0RC 3V9RB 3AV1D 3AN2C 3AZJC 5AY8D 5GSUB 4E45A 3KXBC 3A6NA 5JA4A 3MGPA 5CHLB 3WKJA 3TU4D 3AZJB 3AZKD 5AY8C 5CPKB 3LZ1B 5GXQD 3X1VB 4H9RB 3AZMA 3WAAA 4H9SC 5AV5A 3TU4C 2Y2JA 3REJA 3W96B 2Y2QA 3B6FD 3MGSC 3AZIC 5E5AB 1P3IB 5B24A 1P3GD 4J8WC 3P5JB 3X1SB 3C1BC 1P3BD 5GT3B 1TZYB 4YM6B 5GT3D 3UTAC 1M19C 5BO0B 2YFVA 3LJAC 5DNMB 4E44A 1P3LC 3B0DC 3KWQC 1M1AC 2F8NK 4WU9B 1P3BC 1H3OB 1KX3C 3R45B 5B1MC 3LJAD 3MGQD 3X1VD 5C3IB 4J8UD 3WTPC 2PYOA 3W97C 1KX3D 5AV9B 2HIOA 4G91C 5B1MB 4DRBA 3LZ1A 5CPJA 1P3GB 1KX5C 2Y2NA 4KUDB 4J8UB 5B33B 1P3AA 5AVBD 3AN2B 3EPHA 3W99A 3X1SD 4WU9C 4JJND 4KGCD 2HIOD 1P3ID 2LY8A 4R8PA 3MVDA 2F8NA 2F8NH 1P3MC 1S32A 3AZFA 3X1TB 2YFWA 2AROA 2RIQA 5B32G 3FDDA 3C1BA 1P3OA 5B24C 2FJ7C 1HTAA 5B0YA 4QLCB 1S32D 5AV6A 4KUDC 4Z2MG 3W96C 3NQJB 1P34A 2G5IC 1M18A 5GXQC 4Z66B 3AYWD 2FJ7D 3LZ0A 3EPJA 1WWIA 3B6GC 3UT9A 1P3KC 4KUDD 3X1TC 4H9PB 5BT1D 2L5AA 3AYWC 3B0DB 4H9NA 5F99B 3KWQB 4J8XA 3MNNA 4YS3A 5CPJC 1B67A 4LD9D 2W8SA 3REKB 3WKJC 3W99B 3W97A 4YM6C 1U35A 5AV9D 4WNNA 5JRGA 3REHA 3AZFD 1M1AD 3AZLA 4H9QA 5BS7A 3WTPB 5B0YB 3REID 3AZGC 3WA9A 4YM6D 5B0YD 3REIB 1Q9CA 1P3GC 5DNMD 3X1UA 3AV1A 3W98C 4QLCA 3EPLA 4NE3A 4X23C 3UTBD 3AZHA 3UTBB 3UT9B 3NQJA 5BS7C 3UT9D 2NQBA 5B2JA 3AZKA 3AZNB 1P3IC 3LZ1D 5BNXB 1ZLAD 5DNND 1TZYC 2NZDA 1ULYA 3KWQA 3B0BA 4H9OA 4XZQC 4J8XC 1F66A 3W97D 1U35D 1AOIA 4WU8C 1ZLAA 5B31D 3F6TA 1P3KB 4J8WB 5B2ID 3B6GB 1BH9A 3AZEC 2BG1A 4Z5TB 5AV8D 1P3FB 3C1CC 3REHC 5GSUD 5AY8B 5CPKC 2HIOC 1KX5A 1ID3A 1U35C 3KXBB 4Z66C 5GT0C 3MGPB 4XUJD 1KX4A 1M1AB 3UTBA 5CP6C 3LZ0D 2Y2HA 4J8VD 3AYWB 3AV2A 1P3MA 3MGRB 5BNXA 3W96A 1N1JB 3VH5W 3AZKB 3AZNA 3X1VA 1KX4C 3H0MC 3VH5T 3AV2D 3W98B 1P3KD 5B0ZD 5BNVA 5GT0B 1AOIB 3AZGD 4JJNB 1P3IA 4J8WA 1M19D 2CV5D 5B0YC 2F8ND 3AZGB 1BH9B 4H9NB 5F99A 5B33D 3X1SA 5AV5B 1ZLAB 1A7WA 5B31G 4NFTA 5B0ZC 1EQZA 1F66C 5AVCA 3KXBD 4WU8A 1KU5A 5B31B 1M1AA 1TAFA 4J8UC 3A1IA 3C1BD 3WA9B 3MGQA 5FUGB 5B1MA 4CAYA 2Y2PA 5B0ZB 2PYOB 4NE5A 3WKJD 4DQYB 3X1UC 4R8PB 5B32C 3MVDB 3X1VC 1B6WA 3AZFC 4JJNA 4ZUXC 3KUYC 2PYOD 3W98A 3AZGA 3WA9C 3UTAB 3REIC 2F8NB 5B24D 1P3GA 3UTAD 5B33A 1P3AB 5F99D 5AV5D 2BYKA 2ZM5A 3W98D 3MGRC 2FFFB 2ZY2A 1P3OD 3C1BB 3WA9D 4KHAA 1AOID 5B31A 5B2IC 4NE6A 1HQ3D 5AV6C 5B40B 3A6ND 1P3OC 3H0LC 3LZ0B 5CPKA 1KX4B 1ZLAC 1P3LA 5C3IC 5B2JD 2VQRA 2RVQC 1P34B 4XZQA 5AVBB 4J8XB 4JJNC 5CP6D 3LZ0C 4J8XD 2XD5A 2JCHA 3AV2B 5CPIA 5E5AA 1P3MB 3MNNB 4H9PA 3B6FA 1F66D 4KGCB 2CV5B 5B24B 3REKD 3AZMD 5DNNA 3REJC 2Y2GA 3REIA 3MNNC 2ZY5A 1Z2CB 5B1LA 2Y2OA 3MGSD 4WU9A 4X23B 2YFVB 3AZIB 4WNNB 5JRGB 4R8PC 3VH6A 3MVDC 4AWLB 4Z2MH 4ZUXB 4WV4B 3EPKA 3AZHD 4M6BA 3AZKC 3LZ1C 3VH5A 3X1UD 1P3PA 1JFIA 4XUJB 5DNMC 3LJAB 3AZEB 1KX3A 5FUGA 1HQ3B 3AZHC 4XZQD 2FJ7A 3WKJB 5CPIB 2F8NG 3B6FC 4XZQB 5AVBA 1P3PD 5JA4B 2NZDD 5AV5C 4J8UA 3TU4A 3AZED 3O62C 3AZND 2JE5A 1AOIC 3B6FB 5KDMA 1M19B 1P3KA 3X1TA 5GT0D 5DNNB 2AROD 4H9OB 5AVBC 5B32A 3KWQD 5B1LD 3A6NC 1P34C 4X23D 3UTBC 4LD9B 3C1CA 3KXBA 4WZSB 3AZIA 4Z66A 2CWEA 5GT3A 5GSUC 5CPKD 3MGRA 5BO0A 3KUYA 1JFIB 3AV2C 1N1JA 1HQ3A 5B40A 3AV1C 5GXQA 3LJAA 3AFAB 3O62A 4KGCC 1P3AC 3AFAD 4G92C 5B31C 3MNND 5F99C 3IP4C 5BNVB 1P3MD 1BFMA 3TU4B 2BYMA 3REHB 3AZLB 3REHD 1U35B 3W99D 2HIOB 2Y2IA 4UUZA 5AV9A 2NQBC 4QLCC 2Y2KA 4WU8B 4EO5C 4KGCA 3AV1B 2Y2LA 5AVCB 3KFUG 3RELD 3W99C 5GSUA 4QLCD 1S32B 4G92B 5B2IB 3B6GD 3LELA 2AROB 3MGPC 1P3BB 3KUYB 4CAYB 1WWSA 5GT3C 3RELC 1TAFB 5CPIC 1W2EA 1M18B 5B40D 3A6NB 3MGPD 1PZRA 4LD9C 1P3PB 3AZEA 3AFAA 4HGAB 3AZMC 1KX3B 5B33C 5B1LC 2IO5C 1F1EA 3NQUA 5E5AD 5JRGC 4YS3D 4AWLC 4KHAB 4H9RA 4HGAC 3AZMB 1T3UA 4R8PD 3MVDD 2NZDC 5B32D 1M18C 5DNMA 1TZYD 2DQNC 4WU9D 3MGSA 2HUEC 4WJ3C 3AZID 5B2IA 2DF4C 1M18D 1P34D 2XD1A 4J8VA 3LELC 2J8PA 3X1UB 3VH6T 2UWXA 5AVCC 3O62D 3AZJD 3KUYD 2PYOC 3AN2A 3AZLC 2NQBD 3REJD 2NQBB 5B2JB 3MGQC 5CPJB 3WAAD 3O62B 2CV5A 1EQZB 4ZBJC 5BT1C 1EQZD 1P3AD 1S32C 1KX5D 1ID3D 3WAAC 1HQ3C 4ZUXA 5AV6D 1F66B 2YFWB 4ZBJB 4X23A 5AY8A 3MGSB 4J8VC 5AV9C 1KX5B 1ID3B 5B1LB 2IO5B 2ZY4A 5AV6B 5B2JC 3MGQB 1BH8B 1P3OB 5G49B 1P3PC 2FJ7B 4J8VB 4XUJA 1KX4D 3B0CT 2JSSA 4H9SA 1P3LD 3AYWA 2G5HC 3AZNC 5CPJD 3WAAB 2HUEB 2ZY3A 3KSYA 4YS3C 3AN2D 3REJB 5CPID 3AL0C 5B1MD 5KDMB 4J8WD 3UT9C 1M19A 5CP6A 2BYKB 3X1TD 4YS3B 5GT0A 4H9QB 3VH6W 1ID3C 4LD9A 3W97B 4YM6A 4Z5TC 5B32B 1P3FC 3NQUB 4EO5B 4ZUXD
chains in the Genus database with same CATH topology
3REKA 4DRAA 3C1CB 3RELA 5E5AC 5JRGD 3WTPA 1H3OA 3V9RA 4Z5TD 1BH8A 5AV8B 3R45A 5AVCD 1P3FD 4CSRA 5G49A 3MGRD 5B40C 3C1CD 3WTPD 3AFAC 1R4VA 4Z66D 1P3LB 3AZJA 4XUJC 3W96D 3X1SC 4KUDA 3AZHB 5B0ZA 1EQZC 5CP6B 2NZDB 2Y2MA 5GXQB 2AROC 4UPKA 5AV8C 2RVQD 3AZFB 4UUZB 3AZLD 4G91B 3B0CW 3A1KA 2BYMB 1TZYA 5DNNC 3UTAA 3LELB 1P3BA 2F2AC 2CV5C 3LELD 3REKC 5AV8A 3B6GA 3RELB 4WU8D 4CSRB 4Z5TA 1P3FA 3WTPE 3EG5B 3H0RC 3V9RB 3AV1D 3AN2C 3AZJC 5AY8D 5GSUB 4E45A 3KXBC 3A6NA 5JA4A 3MGPA 5CHLB 3WKJA 3TU4D 3AZJB 3AZKD 5AY8C 5CPKB 3LZ1B 5GXQD 3X1VB 4H9RB 3AZMA 3WAAA 4H9SC 5AV5A 3TU4C 2Y2JA 3REJA 3W96B 2Y2QA 3B6FD 3MGSC 3AZIC 5E5AB 1P3IB 5B24A 1P3GD 4J8WC 3P5JB 3X1SB 3C1BC 1P3BD 5GT3B 1TZYB 4YM6B 5GT3D 3UTAC 1M19C 5BO0B 2YFVA 3LJAC 5DNMB 4E44A 1P3LC 3B0DC 3KWQC 1M1AC 2F8NK 4WU9B 1P3BC 1H3OB 1KX3C 3R45B 5B1MC 3LJAD 3MGQD 3X1VD 5C3IB 4J8UD 3WTPC 2PYOA 3W97C 1KX3D 5AV9B 2HIOA 4G91C 5B1MB 4DRBA 3LZ1A 5CPJA 1P3GB 1KX5C 2Y2NA 4KUDB 4J8UB 5B33B 1P3AA 5AVBD 3AN2B 3EPHA 3W99A 3X1SD 4WU9C 4JJND 4KGCD 2HIOD 1P3ID 2LY8A 4R8PA 3MVDA 2F8NA 2F8NH 1P3MC 1S32A 3AZFA 3X1TB 2YFWA 2AROA 2RIQA 5B32G 3FDDA 3C1BA 1P3OA 5B24C 2FJ7C 1HTAA 5B0YA 4QLCB 1S32D 5AV6A 4KUDC 4Z2MG 3W96C 3NQJB 1P34A 2G5IC 1M18A 5GXQC 4Z66B 3AYWD 2FJ7D 3LZ0A 3EPJA 1WWIA 3B6GC 3UT9A 1P3KC 4KUDD 3X1TC 4H9PB 5BT1D 2L5AA 3AYWC 3B0DB 4H9NA 5F99B 3KWQB 4J8XA 3MNNA 4YS3A 5CPJC 1B67A 4LD9D 2W8SA 3REKB 3WKJC 3W99B 3W97A 4YM6C 1U35A 5AV9D 4WNNA 5JRGA 3REHA 3AZFD 1M1AD 3AZLA 4H9QA 5BS7A 3WTPB 5B0YB 3REID 3AZGC 3WA9A 4YM6D 5B0YD 3REIB 1Q9CA 1P3GC 5DNMD 3X1UA 3AV1A 3W98C 4QLCA 3EPLA 4NE3A 4X23C 3UTBD 3AZHA 3UTBB 3UT9B 3NQJA 5BS7C 3UT9D 2NQBA 5B2JA 3AZKA 3AZNB 1P3IC 3LZ1D 5BNXB 1ZLAD 5DNND 1TZYC 2NZDA 1ULYA 3KWQA 3B0BA 4H9OA 4XZQC 4J8XC 1F66A 3W97D 1U35D 1AOIA 4WU8C 1ZLAA 5B31D 3F6TA 1P3KB 4J8WB 5B2ID 3B6GB 1BH9A 3AZEC 2BG1A 4Z5TB 5AV8D 1P3FB 3C1CC 3REHC 5GSUD 5AY8B 5CPKC 2HIOC 1KX5A 1ID3A 1U35C 3KXBB 4Z66C 5GT0C 3MGPB 4XUJD 1KX4A 1M1AB 3UTBA 5CP6C 3LZ0D 2Y2HA 4J8VD 3AYWB 3AV2A 1P3MA 3MGRB 5BNXA 3W96A 1N1JB 3VH5W 3AZKB 3AZNA 3X1VA 1KX4C 3H0MC 3VH5T 3AV2D 3W98B 1P3KD 5B0ZD 5BNVA 5GT0B 1AOIB 3AZGD 4JJNB 1P3IA 4J8WA 1M19D 2CV5D 5B0YC 2F8ND 3AZGB 1BH9B 4H9NB 5F99A 5B33D 3X1SA 5AV5B 1ZLAB 1A7WA 5B31G 4NFTA 5B0ZC 1EQZA 1F66C 5AVCA 3KXBD 4WU8A 1KU5A 5B31B 1M1AA 1TAFA 4J8UC 3A1IA 3C1BD 3WA9B 3MGQA 5FUGB 5B1MA 4CAYA 2Y2PA 5B0ZB 2PYOB 4NE5A 3WKJD 4DQYB 3X1UC 4R8PB 5B32C 3MVDB 3X1VC 1B6WA 3AZFC 4JJNA 4ZUXC 3KUYC 2PYOD 3W98A 3AZGA 3WA9C 3UTAB 3REIC 2F8NB 5B24D 1P3GA 3UTAD 5B33A 1P3AB 5F99D 5AV5D 2BYKA 2ZM5A 3W98D 3MGRC 2FFFB 2ZY2A 1P3OD 3C1BB 3WA9D 4KHAA 1AOID 5B31A 5B2IC 4NE6A 1HQ3D 5AV6C 5B40B 3A6ND 1P3OC 3H0LC 3LZ0B 5CPKA 1KX4B 1ZLAC 1P3LA 5C3IC 5B2JD 2VQRA 2RVQC 1P34B 4XZQA 5AVBB 4J8XB 4JJNC 5CP6D 3LZ0C 4J8XD 2XD5A 2JCHA 3AV2B 5CPIA 5E5AA 1P3MB 3MNNB 4H9PA 3B6FA 1F66D 4KGCB 2CV5B 5B24B 3REKD 3AZMD 5DNNA 3REJC 2Y2GA 3REIA 3MNNC 2ZY5A 1Z2CB 5B1LA 2Y2OA 3MGSD 4WU9A 4X23B 2YFVB 3AZIB 4WNNB 5JRGB 4R8PC 3VH6A 3MVDC 4AWLB 4Z2MH 4ZUXB 4WV4B 3EPKA 3AZHD 4M6BA 3AZKC 3LZ1C 3VH5A 3X1UD 1P3PA 1JFIA 4XUJB 5DNMC 3LJAB 3AZEB 1KX3A 5FUGA 1HQ3B 3AZHC 4XZQD 2FJ7A 3WKJB 5CPIB 2F8NG 3B6FC 4XZQB 5AVBA 1P3PD 5JA4B 2NZDD 5AV5C 4J8UA 3TU4A 3AZED 3O62C 3AZND 2JE5A 1AOIC 3B6FB 5KDMA 1M19B 1P3KA 3X1TA 5GT0D 5DNNB 2AROD 4H9OB 5AVBC 5B32A 3KWQD 5B1LD 3A6NC 1P34C 4X23D 3UTBC 4LD9B 3C1CA 3KXBA 4WZSB 3AZIA 4Z66A 2CWEA 5GT3A 5GSUC 5CPKD 3MGRA 5BO0A 3KUYA 1JFIB 3AV2C 1N1JA 1HQ3A 5B40A 3AV1C 5GXQA 3LJAA 3AFAB 3O62A 4KGCC 1P3AC 3AFAD 4G92C 5B31C 3MNND 5F99C 3IP4C 5BNVB 1P3MD 1BFMA 3TU4B 2BYMA 3REHB 3AZLB 3REHD 1U35B 3W99D 2HIOB 2Y2IA 4UUZA 5AV9A 2NQBC 4QLCC 2Y2KA 4WU8B 4EO5C 4KGCA 3AV1B 2Y2LA 5AVCB 3KFUG 3RELD 3W99C 5GSUA 4QLCD 1S32B 4G92B 5B2IB 3B6GD 3LELA 2AROB 3MGPC 1P3BB 3KUYB 4CAYB 1WWSA 5GT3C 3RELC 1TAFB 5CPIC 1W2EA 1M18B 5B40D 3A6NB 3MGPD 1PZRA 4LD9C 1P3PB 3AZEA 3AFAA 4HGAB 3AZMC 1KX3B 5B33C 5B1LC 2IO5C 1F1EA 3NQUA 5E5AD 5JRGC 4YS3D 4AWLC 4KHAB 4H9RA 4HGAC 3AZMB 1T3UA 4R8PD 3MVDD 2NZDC 5B32D 1M18C 5DNMA 1TZYD 2DQNC 4WU9D 3MGSA 2HUEC 4WJ3C 3AZID 5B2IA 2DF4C 1M18D 1P34D 2XD1A 4J8VA 3LELC 2J8PA 3X1UB 3VH6T 2UWXA 5AVCC 3O62D 3AZJD 3KUYD 2PYOC 3AN2A 3AZLC 2NQBD 3REJD 2NQBB 5B2JB 3MGQC 5CPJB 3WAAD 3O62B 2CV5A 1EQZB 4ZBJC 5BT1C 1EQZD 1P3AD 1S32C 1KX5D 1ID3D 3WAAC 1HQ3C 4ZUXA 5AV6D 1F66B 2YFWB 4ZBJB 4X23A 5AY8A 3MGSB 4J8VC 5AV9C 1KX5B 1ID3B 5B1LB 2IO5B 2ZY4A 5AV6B 5B2JC 3MGQB 1BH8B 1P3OB 5G49B 1P3PC 2FJ7B 4J8VB 4XUJA 1KX4D 3B0CT 2JSSA 4H9SA 1P3LD 3AYWA 2G5HC 3AZNC 5CPJD 3WAAB 2HUEB 2ZY3A 3KSYA 4YS3C 3AN2D 3REJB 5CPID 3AL0C 5B1MD 5KDMB 4J8WD 3UT9C 1M19A 5CP6A 2BYKB 3X1TD 4YS3B 5GT0A 4H9QB 3VH6W 1ID3C 4LD9A 3W97B 4YM6A 4Z5TC 5B32B 1P3FC 3NQUB 4EO5B 4ZUXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK A;  4DRA A;  3C1C B;  3REL A;  5E5A C;  5JRG D;  3WTP A;  1H3O A;  3V9R A;  4Z5T D;  1BH8 A;  5AV8 B;  3R45 A;  5AVC D;  1P3F D;  4CSR A;  5G49 A;  3MGR D;  5B40 C;  3C1C D;  3WTP D;  3AFA C;  1R4V A;  4Z66 D;  1P3L B;  3AZJ A;  4XUJ C;  3W96 D;  3X1S C;  4KUD A;  3AZH B;  5B0Z A;  1EQZ C;  5CP6 B;  2NZD B;  5GXQ B;  2ARO C;  5AV8 C;  2RVQ D;  3AZF B;  4UUZ B;  3AZL D;  4G91 B;  3B0C W;  2BYM B;  1TZY A;  5DNN C;  3UTA A;  3LEL B;  1P3B A;  2CV5 C;  3LEL D;  3REK C;  5AV8 A;  3B6G A;  3REL B;  4WU8 D;  4CSR B;  4Z5T A;  1P3F A;  3WTP E;  3V9R B;  3AV1 D;  3AN2 C;  3AZJ C;  5AY8 D;  5GSU B;  4E45 A;  3KXB C;  3A6N A;  5JA4 A;  3MGP A;  5CHL B;  3WKJ A;  3TU4 D;  3AZJ B;  3AZK D;  5AY8 C;  5CPK B;  3LZ1 B;  5GXQ D;  3X1V B;  4H9R B;  3AZM A;  3WAA A;  4H9S C;  5AV5 A;  3TU4 C;  3REJ A;  3W96 B;  3B6F D;  3MGS C;  3AZI C;  5E5A B;  1P3I B;  5B24 A;  1P3G D;  4J8W C;  3X1S B;  3C1B C;  1P3B D;  5GT3 B;  1TZY B;  4YM6 B;  5GT3 D;  3UTA C;  1M19 C;  5BO0 B;  2YFV A;  3LJA C;  5DNM B;  4E44 A;  1P3L C;  3B0D C;  3KWQ C;  1M1A C;  2F8N K;  4WU9 B;  1P3B C;  1H3O B;  1KX3 C;  3R45 B;  5B1M C;  3LJA D;  3MGQ D;  3X1V D;  5C3I B;  4J8U D;  3WTP C;  2PYO A;  3W97 C;  1KX3 D;  5AV9 B;  2HIO A;  4G91 C;  5B1M B;  3LZ1 A;  4DRB A;  5CPJ A;  1P3G B;  1KX5 C;  1ID3 C;  4KUD B;  4J8U B;  5B33 B;  1P3A A;  5AVB D;  3AN2 B;  3W99 A;  3X1S D;  4WU9 C;  4JJN D;  4KGC D;  2HIO D;  1P3I D;  2LY8 A;  4R8P A;  3MVD A;  2F8N A;  2F8N H;  1P3M C;  1S32 A;  3AZF A;  3X1T B;  2YFW A;  2ARO A;  5B32 G;  3C1B A;  1P3O A;  5B24 C;  2FJ7 C;  1HTA A;  5B0Y A;  4QLC B;  1S32 D;  5AV6 A;  4KUD C;  4Z2M G;  3W96 C;  3NQJ B;  1P34 A;  1M18 A;  5GXQ C;  4Z66 B;  3AYW D;  2FJ7 D;  3LZ0 A;  1WWI A;  3B6G C;  3UT9 A;  1P3K C;  4KUD D;  3X1T C;  4H9P B;  5BT1 D;  2L5A A;  3AYW C;  3B0D B;  4H9N A;  5F99 B;  3KWQ B;  4J8X A;  3MNN A;  4YS3 A;  5CPJ C;  1B67 A;  4LD9 D;  3WKJ C;  3REK B;  3W99 B;  3W97 A;  4YM6 C;  1U35 A;  5AV9 D;  4WNN A;  5JRG A;  3REH A;  3AZF D;  1M1A D;  3AZL A;  4H9Q A;  5BS7 A;  3WTP B;  5B0Y B;  3REI D;  3AZG C;  3WA9 A;  4YM6 D;  5B0Y D;  3REI B;  1Q9C A;  1P3G C;  5DNM D;  3X1U A;  3AV1 A;  3W98 C;  4QLC A;  4NE3 A;  4X23 C;  3UTB D;  3AZH A;  3UTB B;  3UT9 B;  3NQJ A;  5BS7 C;  3UT9 D;  2NQB A;  5B2J A;  3AZK A;  3AZN B;  1P3I C;  3LZ1 D;  5BNX B;  1ZLA D;  5DNN D;  1TZY C;  2NZD A;  1ULY A;  3KWQ A;  3B0B A;  4H9O A;  4XZQ C;  4J8X C;  1F66 A;  3W97 D;  1U35 D;  1AOI A;  4WU8 C;  1ZLA A;  5B31 D;  1P3K B;  4J8W B;  5B2I D;  3B6G B;  1BH9 A;  3AZE C;  4Z5T B;  5AV8 D;  1P3F B;  3C1C C;  3REH C;  5GSU D;  5AY8 B;  5CPK C;  2HIO C;  1KX5 A;  1ID3 A;  1U35 C;  3KXB B;  4Z66 C;  5GT0 C;  3MGP B;  4XUJ D;  1KX4 A;  1M1A B;  3UTB A;  5CP6 C;  3LZ0 D;  4J8V D;  3AYW B;  3AV2 A;  1P3M A;  3MGR B;  5BNX A;  3W96 A;  1N1J B;  3VH5 W;  3AZK B;  3AZN A;  3X1V A;  1KX4 C;  3VH5 T;  3AV2 D;  3W98 B;  1P3K D;  5B0Z D;  5BNV A;  5GT0 B;  1AOI B;  3AZG D;  4JJN B;  1P3I A;  4J8W A;  1M19 D;  2CV5 D;  5B0Y C;  2F8N D;  3AZG B;  1BH9 B;  4H9N B;  5F99 A;  5B33 D;  3X1S A;  5AV5 B;  1ZLA B;  1A7W A;  5B31 G;  4NFT A;  5B0Z C;  1EQZ A;  1F66 C;  5AVC A;  3KXB D;  4WU8 A;  1KU5 A;  5B31 B;  1M1A A;  1TAF A;  4J8U C;  3C1B D;  3WA9 B;  3MGQ A;  5FUG B;  5B1M A;  4CAY A;  5B0Z B;  2PYO B;  4NE5 A;  3WKJ D;  3X1U C;  4R8P B;  5B32 C;  3MVD B;  3X1V C;  1B6W A;  3AZF C;  4JJN A;  4ZUX C;  3KUY C;  2PYO D;  3W98 A;  3AZG A;  3WA9 C;  3UTA B;  3REI C;  2F8N B;  5B24 D;  1P3G A;  3UTA D;  5B33 A;  1P3A B;  5F99 D;  5AV5 D;  2BYK A;  3W98 D;  3MGR C;  1P3O D;  3C1B B;  3WA9 D;  4KHA A;  1AOI D;  5B31 A;  5B2I C;  4NE6 A;  1HQ3 D;  5AV6 C;  5B40 B;  3A6N D;  1P3O C;  3LZ0 B;  5CPK A;  1KX4 B;  1ZLA C;  1P3L A;  5C3I C;  5B2J D;  1P34 B;  2RVQ C;  4XZQ A;  5AVB B;  4J8X B;  4JJN C;  5CP6 D;  3LZ0 C;  4J8X D;  3AV2 B;  5CPI A;  5E5A A;  1P3M B;  3MNN B;  4H9P A;  3B6F A;  1F66 D;  4KGC B;  2CV5 B;  5B24 B;  3REK D;  3AZM D;  5DNN A;  3REJ C;  3REI A;  3MNN C;  5B1L A;  3MGS D;  4WU9 A;  4X23 B;  2YFV B;  3AZI B;  4WNN B;  5JRG B;  4R8P C;  3VH6 A;  3MVD C;  4AWL B;  4Z2M H;  4ZUX B;  4WV4 B;  3AZH D;  4M6B A;  3AZK C;  3LZ1 C;  3VH5 A;  3X1U D;  1P3P A;  1JFI A;  4XUJ B;  5DNM C;  3LJA B;  3AZE B;  1KX3 A;  5FUG A;  1HQ3 B;  3AZH C;  4XZQ D;  2FJ7 A;  3WKJ B;  5CPI B;  2F8N G;  3B6F C;  4XZQ B;  5AVB A;  1P3P D;  5JA4 B;  2NZD D;  5AV5 C;  4J8U A;  3TU4 A;  3AZE D;  3O62 C;  3AZN D;  1AOI C;  3B6F B;  5KDM A;  1M19 B;  1P3K A;  3X1T A;  5GT0 D;  5DNN B;  2ARO D;  4H9O B;  5AVB C;  5B32 A;  3KWQ D;  5B1L D;  3A6N C;  1P34 C;  4X23 D;  3UTB C;  4LD9 B;  3C1C A;  3KXB A;  4WZS B;  3AZI A;  4Z66 A;  2CWE A;  5GT3 A;  5GSU C;  5CPK D;  3MGR A;  5BO0 A;  3KUY A;  1JFI B;  3AV2 C;  1N1J A;  1HQ3 A;  5B40 A;  3AV1 C;  5GXQ A;  3LJA A;  3AFA B;  3O62 A;  4KGC C;  1P3A C;  3AFA D;  4G92 C;  5B31 C;  3MNN D;  5F99 C;  1BFM A;  5BNV B;  1P3M D;  3TU4 B;  2BYM A;  3REH B;  3AZL B;  3REH D;  1U35 B;  3W99 D;  2HIO B;  4UUZ A;  5AV9 A;  2NQB C;  4QLC C;  4WU8 B;  4EO5 C;  4KGC A;  3AV1 B;  5AVC B;  3REL D;  3W99 C;  5GSU A;  4QLC D;  1S32 B;  4G92 B;  5B2I B;  3B6G D;  3LEL A;  2ARO B;  3MGP C;  1P3B B;  3KUY B;  4CAY B;  1WWS A;  5GT3 C;  3REL C;  1TAF B;  5CPI C;  1M18 B;  5B40 D;  3A6N B;  3MGP D;  4LD9 C;  1P3P B;  3AZE A;  3AFA A;  4HGA B;  3AZM C;  1KX3 B;  5B33 C;  5B1L C;  2IO5 C;  1F1E A;  3NQU A;  5E5A D;  5JRG C;  4YS3 D;  4AWL C;  4KHA B;  4H9R A;  4HGA C;  3AZM B;  4R8P D;  3MVD D;  2NZD C;  5B32 D;  1M18 C;  5DNM A;  1TZY D;  4WU9 D;  3MGS A;  2HUE C;  3AZI D;  5B2I A;  1M18 D;  1P34 D;  4J8V A;  3LEL C;  3X1U B;  3VH6 T;  5AVC C;  3O62 D;  3AZJ D;  3KUY D;  2PYO C;  3AN2 A;  3AZL C;  2NQB D;  3REJ D;  2NQB B;  5B2J B;  3MGQ C;  5CPJ B;  3WAA D;  3O62 B;  2CV5 A;  1EQZ B;  4ZBJ C;  5BT1 C;  1EQZ D;  1P3A D;  1S32 C;  1KX5 D;  1ID3 D;  3WAA C;  1HQ3 C;  4ZUX A;  5AV6 D;  1F66 B;  2YFW B;  4ZBJ B;  4X23 A;  5AY8 A;  3MGS B;  4J8V C;  5AV9 C;  1KX5 B;  1ID3 B;  5B1L B;  2IO5 B;  5AV6 B;  5B2J C;  3MGQ B;  1BH8 B;  1P3O B;  5G49 B;  1P3P C;  2FJ7 B;  4J8V B;  4XUJ A;  1KX4 D;  3B0C T;  2JSS A;  4H9S A;  1P3L D;  3AYW A;  3AZN C;  5CPJ D;  3WAA B;  2HUE B;  3KSY A;  4YS3 C;  3AN2 D;  3REJ B;  5CPI D;  5B1M D;  5KDM B;  4J8W D;  3UT9 C;  1M19 A;  5CP6 A;  2BYK B;  3X1T D;  4YS3 B;  5GT0 A;  4H9Q B;  3VH6 W;  4LD9 A;  3W97 B;  4YM6 A;  4Z5T C;  5B32 B;  1P3F C;  3NQU B;  4EO5 B;  4ZUX D; 
#chains in the Genus database with same CATH topology
 3REK A;  4DRA A;  3C1C B;  3REL A;  5E5A C;  5JRG D;  3WTP A;  1H3O A;  3V9R A;  4Z5T D;  1BH8 A;  5AV8 B;  3R45 A;  5AVC D;  1P3F D;  4CSR A;  5G49 A;  3MGR D;  5B40 C;  3C1C D;  3WTP D;  3AFA C;  1R4V A;  4Z66 D;  1P3L B;  3AZJ A;  4XUJ C;  3W96 D;  3X1S C;  4KUD A;  3AZH B;  5B0Z A;  1EQZ C;  5CP6 B;  2NZD B;  2Y2M A;  5GXQ B;  2ARO C;  4UPK A;  5AV8 C;  2RVQ D;  3AZF B;  4UUZ B;  3AZL D;  4G91 B;  3B0C W;  3A1K A;  2BYM B;  1TZY A;  5DNN C;  3UTA A;  3LEL B;  1P3B A;  2F2A C;  2CV5 C;  3LEL D;  3REK C;  5AV8 A;  3B6G A;  3REL B;  4WU8 D;  4CSR B;  4Z5T A;  1P3F A;  3WTP E;  3EG5 B;  3H0R C;  3V9R B;  3AV1 D;  3AN2 C;  3AZJ C;  5AY8 D;  5GSU B;  4E45 A;  3KXB C;  3A6N A;  5JA4 A;  3MGP A;  5CHL B;  3WKJ A;  3TU4 D;  3AZJ B;  3AZK D;  5AY8 C;  5CPK B;  3LZ1 B;  5GXQ D;  3X1V B;  4H9R B;  3AZM A;  3WAA A;  4H9S C;  5AV5 A;  3TU4 C;  2Y2J A;  3REJ A;  3W96 B;  2Y2Q A;  3B6F D;  3MGS C;  3AZI C;  5E5A B;  1P3I B;  5B24 A;  1P3G D;  4J8W C;  3P5J B;  3X1S B;  3C1B C;  1P3B D;  5GT3 B;  1TZY B;  4YM6 B;  5GT3 D;  3UTA C;  1M19 C;  5BO0 B;  2YFV A;  3LJA C;  5DNM B;  4E44 A;  1P3L C;  3B0D C;  3KWQ C;  1M1A C;  2F8N K;  4WU9 B;  1P3B C;  1H3O B;  1KX3 C;  3R45 B;  5B1M C;  3LJA D;  3MGQ D;  3X1V D;  5C3I B;  4J8U D;  3WTP C;  2PYO A;  3W97 C;  1KX3 D;  5AV9 B;  2HIO A;  4G91 C;  5B1M B;  4DRB A;  3LZ1 A;  5CPJ A;  1P3G B;  1KX5 C;  2Y2N A;  4KUD B;  4J8U B;  5B33 B;  1P3A A;  5AVB D;  3AN2 B;  3EPH A;  3W99 A;  3X1S D;  4WU9 C;  4JJN D;  4KGC D;  2HIO D;  1P3I D;  2LY8 A;  4R8P A;  3MVD A;  2F8N A;  2F8N H;  1P3M C;  1S32 A;  3AZF A;  3X1T B;  2YFW A;  2ARO A;  2RIQ A;  5B32 G;  3FDD A;  3C1B A;  1P3O A;  5B24 C;  2FJ7 C;  1HTA A;  5B0Y A;  4QLC B;  1S32 D;  5AV6 A;  4KUD C;  4Z2M G;  3W96 C;  3NQJ B;  1P34 A;  2G5I C;  1M18 A;  5GXQ C;  4Z66 B;  3AYW D;  2FJ7 D;  3LZ0 A;  3EPJ A;  1WWI A;  3B6G C;  3UT9 A;  1P3K C;  4KUD D;  3X1T C;  4H9P B;  5BT1 D;  2L5A A;  3AYW C;  3B0D B;  4H9N A;  5F99 B;  3KWQ B;  4J8X A;  3MNN A;  4YS3 A;  5CPJ C;  1B67 A;  4LD9 D;  2W8S A;  3REK B;  3WKJ C;  3W99 B;  3W97 A;  4YM6 C;  1U35 A;  5AV9 D;  4WNN A;  5JRG A;  3REH A;  3AZF D;  1M1A D;  3AZL A;  4H9Q A;  5BS7 A;  3WTP B;  5B0Y B;  3REI D;  3AZG C;  3WA9 A;  4YM6 D;  5B0Y D;  3REI B;  1Q9C A;  1P3G C;  5DNM D;  3X1U A;  3AV1 A;  3W98 C;  4QLC A;  3EPL A;  4NE3 A;  4X23 C;  3UTB D;  3AZH A;  3UTB B;  3UT9 B;  3NQJ A;  5BS7 C;  3UT9 D;  2NQB A;  5B2J A;  3AZK A;  3AZN B;  1P3I C;  3LZ1 D;  5BNX B;  1ZLA D;  5DNN D;  1TZY C;  2NZD A;  1ULY A;  3KWQ A;  3B0B A;  4H9O A;  4XZQ C;  4J8X C;  1F66 A;  3W97 D;  1U35 D;  1AOI A;  4WU8 C;  1ZLA A;  5B31 D;  3F6T A;  1P3K B;  4J8W B;  5B2I D;  3B6G B;  1BH9 A;  3AZE C;  2BG1 A;  4Z5T B;  5AV8 D;  1P3F B;  3C1C C;  3REH C;  5GSU D;  5AY8 B;  5CPK C;  2HIO C;  1KX5 A;  1ID3 A;  1U35 C;  3KXB B;  4Z66 C;  5GT0 C;  3MGP B;  4XUJ D;  1KX4 A;  1M1A B;  3UTB A;  5CP6 C;  3LZ0 D;  2Y2H A;  4J8V D;  3AYW B;  3AV2 A;  1P3M A;  3MGR B;  5BNX A;  3W96 A;  1N1J B;  3VH5 W;  3AZK B;  3AZN A;  3X1V A;  1KX4 C;  3H0M C;  3VH5 T;  3AV2 D;  3W98 B;  1P3K D;  5B0Z D;  5BNV A;  5GT0 B;  1AOI B;  3AZG D;  4JJN B;  1P3I A;  4J8W A;  1M19 D;  2CV5 D;  5B0Y C;  2F8N D;  3AZG B;  1BH9 B;  4H9N B;  5F99 A;  5B33 D;  3X1S A;  5AV5 B;  1ZLA B;  1A7W A;  5B31 G;  4NFT A;  5B0Z C;  1EQZ A;  1F66 C;  5AVC A;  3KXB D;  4WU8 A;  1KU5 A;  5B31 B;  1M1A A;  1TAF A;  4J8U C;  3A1I A;  3C1B D;  3WA9 B;  3MGQ A;  5FUG B;  5B1M A;  4CAY A;  2Y2P A;  5B0Z B;  2PYO B;  4NE5 A;  3WKJ D;  4DQY B;  3X1U C;  4R8P B;  5B32 C;  3MVD B;  3X1V C;  1B6W A;  3AZF C;  4JJN A;  4ZUX C;  3KUY C;  2PYO D;  3W98 A;  3AZG A;  3WA9 C;  3UTA B;  3REI C;  2F8N B;  5B24 D;  1P3G A;  3UTA D;  5B33 A;  1P3A B;  5F99 D;  5AV5 D;  2BYK A;  2ZM5 A;  3W98 D;  3MGR C;  2FFF B;  2ZY2 A;  1P3O D;  3C1B B;  3WA9 D;  4KHA A;  1AOI D;  5B31 A;  5B2I C;  4NE6 A;  1HQ3 D;  5AV6 C;  5B40 B;  3A6N D;  1P3O C;  3H0L C;  3LZ0 B;  5CPK A;  1KX4 B;  1ZLA C;  1P3L A;  5C3I C;  5B2J D;  2VQR A;  2RVQ C;  1P34 B;  4XZQ A;  5AVB B;  4J8X B;  4JJN C;  5CP6 D;  3LZ0 C;  4J8X D;  2XD5 A;  2JCH A;  3AV2 B;  5CPI A;  5E5A A;  1P3M B;  3MNN B;  4H9P A;  3B6F A;  1F66 D;  4KGC B;  2CV5 B;  5B24 B;  3REK D;  3AZM D;  5DNN A;  3REJ C;  2Y2G A;  3REI A;  3MNN C;  2ZY5 A;  1Z2C B;  5B1L A;  2Y2O A;  3MGS D;  4WU9 A;  4X23 B;  2YFV B;  3AZI B;  4WNN B;  5JRG B;  4R8P C;  3VH6 A;  3MVD C;  4AWL B;  4Z2M H;  4ZUX B;  4WV4 B;  3EPK A;  3AZH D;  4M6B A;  3AZK C;  3LZ1 C;  3VH5 A;  3X1U D;  1P3P A;  1JFI A;  4XUJ B;  5DNM C;  3LJA B;  3AZE B;  1KX3 A;  5FUG A;  1HQ3 B;  3AZH C;  4XZQ D;  2FJ7 A;  3WKJ B;  5CPI B;  2F8N G;  3B6F C;  4XZQ B;  5AVB A;  1P3P D;  5JA4 B;  2NZD D;  5AV5 C;  4J8U A;  3TU4 A;  3AZE D;  3O62 C;  3AZN D;  2JE5 A;  1AOI C;  3B6F B;  5KDM A;  1M19 B;  1P3K A;  3X1T A;  5GT0 D;  5DNN B;  2ARO D;  4H9O B;  5AVB C;  5B32 A;  3KWQ D;  5B1L D;  3A6N C;  1P34 C;  4X23 D;  3UTB C;  4LD9 B;  3C1C A;  3KXB A;  4WZS B;  3AZI A;  4Z66 A;  2CWE A;  5GT3 A;  5GSU C;  5CPK D;  3MGR A;  5BO0 A;  3KUY A;  1JFI B;  3AV2 C;  1N1J A;  1HQ3 A;  5B40 A;  3AV1 C;  5GXQ A;  3LJA A;  3AFA B;  3O62 A;  4KGC C;  1P3A C;  3AFA D;  4G92 C;  5B31 C;  3MNN D;  5F99 C;  3IP4 C;  5BNV B;  1P3M D;  1BFM A;  3TU4 B;  2BYM A;  3REH B;  3AZL B;  3REH D;  1U35 B;  3W99 D;  2HIO B;  2Y2I A;  4UUZ A;  5AV9 A;  2NQB C;  4QLC C;  2Y2K A;  4WU8 B;  4EO5 C;  4KGC A;  3AV1 B;  2Y2L A;  5AVC B;  3KFU G;  3REL D;  3W99 C;  5GSU A;  4QLC D;  1S32 B;  4G92 B;  5B2I B;  3B6G D;  3LEL A;  2ARO B;  3MGP C;  1P3B B;  3KUY B;  4CAY B;  1WWS A;  5GT3 C;  3REL C;  1TAF B;  5CPI C;  1W2E A;  1M18 B;  5B40 D;  3A6N B;  3MGP D;  1PZR A;  4LD9 C;  1P3P B;  3AZE A;  3AFA A;  4HGA B;  3AZM C;  1KX3 B;  5B33 C;  5B1L C;  2IO5 C;  1F1E A;  3NQU A;  5E5A D;  5JRG C;  4YS3 D;  4AWL C;  4KHA B;  4H9R A;  4HGA C;  3AZM B;  1T3U A;  4R8P D;  3MVD D;  2NZD C;  5B32 D;  1M18 C;  5DNM A;  1TZY D;  2DQN C;  4WU9 D;  3MGS A;  2HUE C;  4WJ3 C;  3AZI D;  5B2I A;  2DF4 C;  1M18 D;  1P34 D;  2XD1 A;  4J8V A;  3LEL C;  2J8P A;  3X1U B;  3VH6 T;  2UWX A;  5AVC C;  3O62 D;  3AZJ D;  3KUY D;  2PYO C;  3AN2 A;  3AZL C;  2NQB D;  3REJ D;  2NQB B;  5B2J B;  3MGQ C;  5CPJ B;  3WAA D;  3O62 B;  2CV5 A;  1EQZ B;  4ZBJ C;  5BT1 C;  1EQZ D;  1P3A D;  1S32 C;  1KX5 D;  1ID3 D;  3WAA C;  1HQ3 C;  4ZUX A;  5AV6 D;  1F66 B;  2YFW B;  4ZBJ B;  4X23 A;  5AY8 A;  3MGS B;  4J8V C;  5AV9 C;  1KX5 B;  1ID3 B;  5B1L B;  2IO5 B;  2ZY4 A;  5AV6 B;  5B2J C;  3MGQ B;  1BH8 B;  1P3O B;  5G49 B;  1P3P C;  2FJ7 B;  4J8V B;  4XUJ A;  1KX4 D;  3B0C T;  2JSS A;  4H9S A;  1P3L D;  3AYW A;  2G5H C;  3AZN C;  5CPJ D;  3WAA B;  2HUE B;  2ZY3 A;  3KSY A;  4YS3 C;  3AN2 D;  3REJ B;  5CPI D;  3AL0 C;  5B1M D;  5KDM B;  4J8W D;  3UT9 C;  1M19 A;  5CP6 A;  2BYK B;  3X1T D;  4YS3 B;  5GT0 A;  4H9Q B;  3VH6 W;  1ID3 C;  4LD9 A;  3W97 B;  4YM6 A;  4Z5T C;  5B32 B;  1P3F C;  3NQU B;  4EO5 B;  4ZUX D; 
#chains in the Genus database with same CATH homology
 3REK A;  4DRA A;  3C1C B;  3REL A;  5E5A C;  5JRG D;  3WTP A;  1H3O A;  3V9R A;  4Z5T D;  1BH8 A;  5AV8 B;  3R45 A;  5AVC D;  1P3F D;  4CSR A;  5G49 A;  3MGR D;  5B40 C;  3C1C D;  3WTP D;  3AFA C;  1R4V A;  4Z66 D;  1P3L B;  3AZJ A;  4XUJ C;  3W96 D;  3X1S C;  4KUD A;  3AZH B;  5B0Z A;  1EQZ C;  5CP6 B;  2NZD B;  2Y2M A;  5GXQ B;  2ARO C;  4UPK A;  5AV8 C;  2RVQ D;  3AZF B;  4UUZ B;  3AZL D;  4G91 B;  3B0C W;  3A1K A;  2BYM B;  1TZY A;  5DNN C;  3UTA A;  3LEL B;  1P3B A;  2F2A C;  2CV5 C;  3LEL D;  3REK C;  5AV8 A;  3B6G A;  3REL B;  4WU8 D;  4CSR B;  4Z5T A;  1P3F A;  3WTP E;  3EG5 B;  3H0R C;  3V9R B;  3AV1 D;  3AN2 C;  3AZJ C;  5AY8 D;  5GSU B;  4E45 A;  3KXB C;  3A6N A;  5JA4 A;  3MGP A;  5CHL B;  3WKJ A;  3TU4 D;  3AZJ B;  3AZK D;  5AY8 C;  5CPK B;  3LZ1 B;  5GXQ D;  3X1V B;  4H9R B;  3AZM A;  3WAA A;  4H9S C;  5AV5 A;  3TU4 C;  2Y2J A;  3REJ A;  3W96 B;  2Y2Q A;  3B6F D;  3MGS C;  3AZI C;  5E5A B;  1P3I B;  5B24 A;  1P3G D;  4J8W C;  3P5J B;  3X1S B;  3C1B C;  1P3B D;  5GT3 B;  1TZY B;  4YM6 B;  5GT3 D;  3UTA C;  1M19 C;  5BO0 B;  2YFV A;  3LJA C;  5DNM B;  4E44 A;  1P3L C;  3B0D C;  3KWQ C;  1M1A C;  2F8N K;  4WU9 B;  1P3B C;  1H3O B;  1KX3 C;  3R45 B;  5B1M C;  3LJA D;  3MGQ D;  3X1V D;  5C3I B;  4J8U D;  3WTP C;  2PYO A;  3W97 C;  1KX3 D;  5AV9 B;  2HIO A;  4G91 C;  5B1M B;  4DRB A;  3LZ1 A;  5CPJ A;  1P3G B;  1KX5 C;  2Y2N A;  4KUD B;  4J8U B;  5B33 B;  1P3A A;  5AVB D;  3AN2 B;  3EPH A;  3W99 A;  3X1S D;  4WU9 C;  4JJN D;  4KGC D;  2HIO D;  1P3I D;  2LY8 A;  4R8P A;  3MVD A;  2F8N A;  2F8N H;  1P3M C;  1S32 A;  3AZF A;  3X1T B;  2YFW A;  2ARO A;  2RIQ A;  5B32 G;  3FDD A;  3C1B A;  1P3O A;  5B24 C;  2FJ7 C;  1HTA A;  5B0Y A;  4QLC B;  1S32 D;  5AV6 A;  4KUD C;  4Z2M G;  3W96 C;  3NQJ B;  1P34 A;  2G5I C;  1M18 A;  5GXQ C;  4Z66 B;  3AYW D;  2FJ7 D;  3LZ0 A;  3EPJ A;  1WWI A;  3B6G C;  3UT9 A;  1P3K C;  4KUD D;  3X1T C;  4H9P B;  5BT1 D;  2L5A A;  3AYW C;  3B0D B;  4H9N A;  5F99 B;  3KWQ B;  4J8X A;  3MNN A;  4YS3 A;  5CPJ C;  1B67 A;  4LD9 D;  2W8S A;  3REK B;  3WKJ C;  3W99 B;  3W97 A;  4YM6 C;  1U35 A;  5AV9 D;  4WNN A;  5JRG A;  3REH A;  3AZF D;  1M1A D;  3AZL A;  4H9Q A;  5BS7 A;  3WTP B;  5B0Y B;  3REI D;  3AZG C;  3WA9 A;  4YM6 D;  5B0Y D;  3REI B;  1Q9C A;  1P3G C;  5DNM D;  3X1U A;  3AV1 A;  3W98 C;  4QLC A;  3EPL A;  4NE3 A;  4X23 C;  3UTB D;  3AZH A;  3UTB B;  3UT9 B;  3NQJ A;  5BS7 C;  3UT9 D;  2NQB A;  5B2J A;  3AZK A;  3AZN B;  1P3I C;  3LZ1 D;  5BNX B;  1ZLA D;  5DNN D;  1TZY C;  2NZD A;  1ULY A;  3KWQ A;  3B0B A;  4H9O A;  4XZQ C;  4J8X C;  1F66 A;  3W97 D;  1U35 D;  1AOI A;  4WU8 C;  1ZLA A;  5B31 D;  3F6T A;  1P3K B;  4J8W B;  5B2I D;  3B6G B;  1BH9 A;  3AZE C;  2BG1 A;  4Z5T B;  5AV8 D;  1P3F B;  3C1C C;  3REH C;  5GSU D;  5AY8 B;  5CPK C;  2HIO C;  1KX5 A;  1ID3 A;  1U35 C;  3KXB B;  4Z66 C;  5GT0 C;  3MGP B;  4XUJ D;  1KX4 A;  1M1A B;  3UTB A;  5CP6 C;  3LZ0 D;  2Y2H A;  4J8V D;  3AYW B;  3AV2 A;  1P3M A;  3MGR B;  5BNX A;  3W96 A;  1N1J B;  3VH5 W;  3AZK B;  3AZN A;  3X1V A;  1KX4 C;  3H0M C;  3VH5 T;  3AV2 D;  3W98 B;  1P3K D;  5B0Z D;  5BNV A;  5GT0 B;  1AOI B;  3AZG D;  4JJN B;  1P3I A;  4J8W A;  1M19 D;  2CV5 D;  5B0Y C;  2F8N D;  3AZG B;  1BH9 B;  4H9N B;  5F99 A;  5B33 D;  3X1S A;  5AV5 B;  1ZLA B;  1A7W A;  5B31 G;  4NFT A;  5B0Z C;  1EQZ A;  1F66 C;  5AVC A;  3KXB D;  4WU8 A;  1KU5 A;  5B31 B;  1M1A A;  1TAF A;  4J8U C;  3A1I A;  3C1B D;  3WA9 B;  3MGQ A;  5FUG B;  5B1M A;  4CAY A;  2Y2P A;  5B0Z B;  2PYO B;  4NE5 A;  3WKJ D;  4DQY B;  3X1U C;  4R8P B;  5B32 C;  3MVD B;  3X1V C;  1B6W A;  3AZF C;  4JJN A;  4ZUX C;  3KUY C;  2PYO D;  3W98 A;  3AZG A;  3WA9 C;  3UTA B;  3REI C;  2F8N B;  5B24 D;  1P3G A;  3UTA D;  5B33 A;  1P3A B;  5F99 D;  5AV5 D;  2BYK A;  2ZM5 A;  3W98 D;  3MGR C;  2FFF B;  2ZY2 A;  1P3O D;  3C1B B;  3WA9 D;  4KHA A;  1AOI D;  5B31 A;  5B2I C;  4NE6 A;  1HQ3 D;  5AV6 C;  5B40 B;  3A6N D;  1P3O C;  3H0L C;  3LZ0 B;  5CPK A;  1KX4 B;  1ZLA C;  1P3L A;  5C3I C;  5B2J D;  2VQR A;  2RVQ C;  1P34 B;  4XZQ A;  5AVB B;  4J8X B;  4JJN C;  5CP6 D;  3LZ0 C;  4J8X D;  2XD5 A;  2JCH A;  3AV2 B;  5CPI A;  5E5A A;  1P3M B;  3MNN B;  4H9P A;  3B6F A;  1F66 D;  4KGC B;  2CV5 B;  5B24 B;  3REK D;  3AZM D;  5DNN A;  3REJ C;  2Y2G A;  3REI A;  3MNN C;  2ZY5 A;  1Z2C B;  5B1L A;  2Y2O A;  3MGS D;  4WU9 A;  4X23 B;  2YFV B;  3AZI B;  4WNN B;  5JRG B;  4R8P C;  3VH6 A;  3MVD C;  4AWL B;  4Z2M H;  4ZUX B;  4WV4 B;  3EPK A;  3AZH D;  4M6B A;  3AZK C;  3LZ1 C;  3VH5 A;  3X1U D;  1P3P A;  1JFI A;  4XUJ B;  5DNM C;  3LJA B;  3AZE B;  1KX3 A;  5FUG A;  1HQ3 B;  3AZH C;  4XZQ D;  2FJ7 A;  3WKJ B;  5CPI B;  2F8N G;  3B6F C;  4XZQ B;  5AVB A;  1P3P D;  5JA4 B;  2NZD D;  5AV5 C;  4J8U A;  3TU4 A;  3AZE D;  3O62 C;  3AZN D;  2JE5 A;  1AOI C;  3B6F B;  5KDM A;  1M19 B;  1P3K A;  3X1T A;  5GT0 D;  5DNN B;  2ARO D;  4H9O B;  5AVB C;  5B32 A;  3KWQ D;  5B1L D;  3A6N C;  1P34 C;  4X23 D;  3UTB C;  4LD9 B;  3C1C A;  3KXB A;  4WZS B;  3AZI A;  4Z66 A;  2CWE A;  5GT3 A;  5GSU C;  5CPK D;  3MGR A;  5BO0 A;  3KUY A;  1JFI B;  3AV2 C;  1N1J A;  1HQ3 A;  5B40 A;  3AV1 C;  5GXQ A;  3LJA A;  3AFA B;  3O62 A;  4KGC C;  1P3A C;  3AFA D;  4G92 C;  5B31 C;  3MNN D;  5F99 C;  3IP4 C;  5BNV B;  1P3M D;  1BFM A;  3TU4 B;  2BYM A;  3REH B;  3AZL B;  3REH D;  1U35 B;  3W99 D;  2HIO B;  2Y2I A;  4UUZ A;  5AV9 A;  2NQB C;  4QLC C;  2Y2K A;  4WU8 B;  4EO5 C;  4KGC A;  3AV1 B;  2Y2L A;  5AVC B;  3KFU G;  3REL D;  3W99 C;  5GSU A;  4QLC D;  1S32 B;  4G92 B;  5B2I B;  3B6G D;  3LEL A;  2ARO B;  3MGP C;  1P3B B;  3KUY B;  4CAY B;  1WWS A;  5GT3 C;  3REL C;  1TAF B;  5CPI C;  1W2E A;  1M18 B;  5B40 D;  3A6N B;  3MGP D;  1PZR A;  4LD9 C;  1P3P B;  3AZE A;  3AFA A;  4HGA B;  3AZM C;  1KX3 B;  5B33 C;  5B1L C;  2IO5 C;  1F1E A;  3NQU A;  5E5A D;  5JRG C;  4YS3 D;  4AWL C;  4KHA B;  4H9R A;  4HGA C;  3AZM B;  1T3U A;  4R8P D;  3MVD D;  2NZD C;  5B32 D;  1M18 C;  5DNM A;  1TZY D;  2DQN C;  4WU9 D;  3MGS A;  2HUE C;  4WJ3 C;  3AZI D;  5B2I A;  2DF4 C;  1M18 D;  1P34 D;  2XD1 A;  4J8V A;  3LEL C;  2J8P A;  3X1U B;  3VH6 T;  2UWX A;  5AVC C;  3O62 D;  3AZJ D;  3KUY D;  2PYO C;  3AN2 A;  3AZL C;  2NQB D;  3REJ D;  2NQB B;  5B2J B;  3MGQ C;  5CPJ B;  3WAA D;  3O62 B;  2CV5 A;  1EQZ B;  4ZBJ C;  5BT1 C;  1EQZ D;  1P3A D;  1S32 C;  1KX5 D;  1ID3 D;  3WAA C;  1HQ3 C;  4ZUX A;  5AV6 D;  1F66 B;  2YFW B;  4ZBJ B;  4X23 A;  5AY8 A;  3MGS B;  4J8V C;  5AV9 C;  1KX5 B;  1ID3 B;  5B1L B;  2IO5 B;  2ZY4 A;  5AV6 B;  5B2J C;  3MGQ B;  1BH8 B;  1P3O B;  5G49 B;  1P3P C;  2FJ7 B;  4J8V B;  4XUJ A;  1KX4 D;  3B0C T;  2JSS A;  4H9S A;  1P3L D;  3AYW A;  2G5H C;  3AZN C;  5CPJ D;  3WAA B;  2HUE B;  2ZY3 A;  3KSY A;  4YS3 C;  3AN2 D;  3REJ B;  5CPI D;  3AL0 C;  5B1M D;  5KDM B;  4J8W D;  3UT9 C;  1M19 A;  5CP6 A;  2BYK B;  3X1T D;  4YS3 B;  5GT0 A;  4H9Q B;  3VH6 W;  1ID3 C;  4LD9 A;  3W97 B;  4YM6 A;  4Z5T C;  5B32 B;  1P3F C;  3NQU B;  4EO5 B;  4ZUX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...