3AFAB

The human nucleosome structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaB00
5FUGB 3REJC 5B24A 3WKJB 2FJ7D 1P3KC 3AN2C 3X1TD 3AV1D 1M18D 3WAAB 1P3FD 3W99B 3MGPD 3AYWB 3LZ0C 2NQBD 5AV9C 5B1MA 5B33C 3AZKD 5B31D 3C1CA 3MGRC 4JJNC 3AV2C 3X1SB 5GT3C 3A6NC 3KWQB 1P3ID 2PYOC 5BNVA 5B32A 4Z5TC 3X1VB 1ID3B 3KUYC 3B6FC 1P3AD 3NQUA 1KX4B 3MVDB 5BT1D 4J8XD 4YS3C 3UTAA 3AZFC 4LD9C 2BYMB 4M6BA 4X23D 5GSUC 3AFAD 4J8WA 2NZDD 3B6GB 1P3PC 5B0YA 4J8UB 1S32D 3AZHA 3R45A 5AV8C 4ZUXD 3MGSD 3V9RB 3W97A 1KX3C 1TZYD 4R8PA 3LZ1C 5GXQB 3AZLC 3VH5A 5CPJD 3B0CT 1A7WA 4QLCD 4H9SC 2FJ7B 1P3MC 1M1AA 3AZMA 3AV1B 3X1TB 1P34D 1P3FB 1M18B 5E5AA 2F8ND 5AVBD 4KGCD 3MGPB 2NQBB 5BNXB 3AZKB 4H9RB 4XUJB 1WWSA 1KX5A 3REKD 5B31B 1P3IA 3WA9C 3REJD 3WKJC 3AN2D 5B2ID 2CV5B 4H9QA 3MNNA 5B0ZC 4NFTA 3LZ0D 3UTBC 1P3AB 3REIB 4WU9C 4DRBA 3W98C 3NQJA 3MGQB 3KXBD 3AV2D 3AFAA 4J8XB 2YFVA 5GT3D 5GT0B 4X23B 2PYOD 2NZDA 4Z5TD 3VH6W 3RELC 5AY8D 3KUYD 2HIOA 3W96C 4ZUXA 1S32B 2F8NK 3MGSA 1TZYA 5AV5B 5BO0B 3MVDC 3AZFD 3AZGA 2AROC 5CPKB 5GSUD 4WZSB 3AZJC 4WU8C 1U35B 5CPJB 1ZLAD 1KX3D 3REHC 4QLCB 4XZQC 5AVBA 5KDMA 4G92C 1P34B 3LZ1D 3O62A 2F8NB 3AZLD 4KGCB 1N1JB 3REJA 3B0DC 4KHAA 3REKB 1P3KA 3AN2A 1F66C 2F8NH 4Z66C 1P3MD 2HUEC 4YM6C 3C1CD 1Q9CA 2CWEA 3LZ0A 5B33A 5AV9A 4EO5B 5B2IB 4HGAC 3LELC 5G49B 3MGRA 4JJNA 3AV2A 4AWLC 1P3LC 5GT3A 3A6NA 2PYOA 3KSYA 3KXBB 4Z5TA 2IO5C 4H9NB 3WTPC 3KUYA 5CPIB 3B6FA 1AOIB 4ZBJB 5AVCC 1JFIB 5AY8B 5AV6B 3UTBD 4LD9A 4YS3A 3AZFA 4WU9D 5GSUA 1HQ3B 5B40C 3AZHD 1P3PA 3AZNB 3RELD 5AV8A 3W96D 4R8PD 1KX3A 5F99B 1ZLAB 5DNNB 4UUZA 1HTAA 3LZ1A 3AZLA 3C1BB 3AZJD 4J8VC 3B0BA 5B24B 4WU8D 1M1AD 5B1LC 3VH6A 5B2JC 3AZMD 4H9SA 5E5AD 1P3MA 5B1MB 4XZQD 1KX5D 1P3OC 3C1CB 3UT9C 3B0CW 4WNNA 5CP6C 3WA9A 1M19B 5BNVB 5B32B 3WKJA 5DNMC 3MNND 1F66D 2LY8A 3NQUB 3TU4C 5B32G 4YM6D 1P3GC 5B0ZA 3UTBA 3UTAB 3AYWA 3LJAC 4WU9A 3W98A 3LELD 1BH9A 4J8WB 1P3LD 1F1EA 3X1UC 2HIOD 3AZIB 5B0YB 5C3IB 3AZHB 3RELA 3R45B 3AZEC 3W96A 3W97B 3AZGD 4R8PB 4H9OA 2RVQC 3MVDA 5JRGC 2AROA 4Z2MH 5B40D 3AZJA 4WU8A 4KUDC 5CHLB 1EQZC 4G91B 1M1AB 3AZMB 3REHA 1P3BC 3O62D 5E5AB 4XZQA 5DNNC 1KX5B 1P3KD 1P3IB 5B31G 5B1LD 3WAAC 5B2JD 5JA4A 1F66A 3W99C 5B33D 5AV9D 4Z66A 3AYWC 4YM6A 3MNNB 3MGRD 4JJND 1P3OD 3A6ND 3UT9D 3LELA 3NQJB 3X1SC 3AFAB 3KWQC 5CP6D 2YFVB 1P3LA 2NZDB 3B6FD 3X1VC 1ID3C 1M19C 3WTPA 2HIOB 4ZUXB 1KX4C 4LD9D 4YS3D 5AVCA 3MGSB 1P3GD 1TZYB 2BYKB 3LJAD 3AZGB 1P3PD 5B40A 3B6GC 1B67A 4J8UC 5AV8D 1TAFA 3AZIC 4NE5A 4E45A 5AVBB 4CSRA 5JRGD 5KDMB 5BO0A 5GXQC 3O62B 4J8VA 3REJB 2F8NG 4KUDD 5B1LA 1P3KB 5B2JA 3AN2B 4WV4B 2FJ7C 1EQZD 3AV1C 3X1TC 1M18C 1P3FC 1P3BD 3LZ0B 5AV9B 1BH8A 3MGPC 2NQBC 1P3OA 3AZKC 3UT9A 4XUJC 3WA9D 3MGRB 4JJNB 3AV2B 5B31C 5CP6A 3WKJD 5GT3B 3A6NB 2PYOB 4H9PA 4Z5TB 3WAAD 5DNMA 5B0ZD 3KUYB 2CV5C 3B6FB 3W99D 3AYWD 3TU4A 1P3GA 3W98D 1P3AC 4E44A 3REIC 3LJAA 3AZFB 3MGQC 5BT1C 4J8XC 3X1SD 5GSUB 5GT0C 4X23C 3X1UA 1P3PB 1S32C 5AV8B 3AZEA 3MVDD 1KX3B 2YFWA 5AV5C 2AROD 1R4VA 4UUZB 5JRGA 5CPKC 4CAYA 3LZ1B 3AZLB 1U35C 5CPJC 4KUDA 3REHD 1EQZA 4DRAA 1H3OA 5BS7C 4QLCC 1P3MB 1P3BA 1P34C 5DNNA 5GXQD 4KGCC 4WNNB 5FUGA 3VH5T 3WA9B 3REKC 4Z66D 3WAAA 3W99A 5B2IC 4EO5C 5B0ZB 3UTBB 4WU9B 3W98B 4XUJD 3X1SA 3KWQA 1BH9B 3KXBC 3WTPD 3X1VA 1ID3A 5AVCD 1M19A 5CPIC 3RELB 1AOIC 4ZBJC 2CV5D 1KX4A 3W96B 5AY8C 5AV6C 3REID 2BYMA 4H9OB 4Z2MG 3MGQD 1HQ3C 2AROB 5GT0D 3B6GA 3AZJB 4J8UA 3AZNC 4WU8B 3AZIA 3V9RA 5F99C 1ZLAC 5AV5D 3REHB 4XZQB 5CPKD 4G92B 4J8VD 5GXQA 3C1BC 5B24C 3B0DB 1U35D 4H9QB 4NE3A 5JA4B 2FJ7A 1F66B 4Z66B 3AV1A 3X1TA 2HUEB 1M18A 1P3FA 4YM6B 5B1MC 4HGAB 3MGPA 3C1CC 2NQBA 5BNXA 3AZKA 4H9RA 4XUJA 3LELB 5B31A 1WWIA 4AWLB 1P3LB 5B32C 5DNMD 2IO5B 3TU4D 3WTPB 2CV5A 5AVCB 1P3AA 3UTAC 3REIA 4NE6A 3MGQA 4J8XA 3X1UD 4J8WC 5GT0A 4X23A 5B40B 5B0YC 5C3IC 3AZED 2L5AA 3AZHC 1TAFB 5CPID 1S32A 1AOID 3W97C 2RVQD 5AV6D 4R8PC 5AV5A 4CSRB 5CPKA 1HQ3D 2BYKA 4KHAB 4J8VB 3AZND 1U35A 5CPJA 5B1LB 5B2JB 4G91C 1M1AC 5F99D 5B33B 3AZMC 5BS7A 4QLCA 5DNND 3WTPE 5E5AC 1BH8B 1P34A 1P3OB 3UT9B 2F8NA 4KGCA 3C1BD 1KX5C 1N1JA 1P3IC 5CP6B 5B24D 1B6WA 4H9PB 3REKA 5DNMB 3VH6T 4LD9B 3MNNC 4YS3B 3TU4B 1P3GB 5B1MD 5B2IA 3KWQD 3LJAB 5G49A 3VH5W 3AFAC 1KU5A 3X1VD 1ID3D 2NZDC 1M19D 5B32D 3KXBA 3X1UB 1KX4D 4H9NA 1BFMA 2HIOC 4ZUXC 5CPIA 1AOIA 3MGSC 3AZEB 2JSSA 1JFIA 1TZYC 5AY8A 2YFWB 5AV6A 3UTAD 1ULYA 3AZGC 3B6GD 5JRGB 4CAYB 4J8UD 1HQ3A 4J8WD 3AZID 5B0YD 3AZNA 4KUDB 5F99A 1EQZB 3W97D 1H3OB 1ZLAA 1P3BB 5AVBC 3O62C 3C1BA
chains in the Genus database with same CATH superfamily
5FUGB 3REJC 5B24A 2Y2PA 3WKJB 2FJ7D 1P3KC 3AN2C 3X1TD 3AV1D 1M18D 3WAAB 1P3FD 3W99B 3MGPD 3AYWB 1T3UA 3LZ0C 2NQBD 5AV9C 5B1MA 5B33C 3AZKD 5B31D 3C1CA 3MGRC 4JJNC 3AV2C 3X1SB 5GT3C 3A6NC 3KWQB 1P3ID 2PYOC 5BNVA 5B32A 4Z5TC 3X1VB 1ID3B 3KUYC 3B6FC 1P3AD 3NQUA 1KX4B 3MVDB 5BT1D 4J8XD 4YS3C 3UTAA 3AZFC 4LD9C 2BYMB 4M6BA 4X23D 5GSUC 3AFAD 4J8WA 2NZDD 3B6GB 1P3PC 5B0YA 4J8UB 1S32D 3AZHA 3R45A 5AV8C 4ZUXD 3MGSD 3V9RB 3W97A 1KX3C 1TZYD 2G5IC 4R8PA 3LZ1C 5GXQB 3AZLC 3VH5A 5CPJD 3B0CT 1A7WA 4QLCD 4H9SC 2FJ7B 1P3MC 1M1AA 3AZMA 3AV1B 3X1TB 1P34D 1P3FB 1M18B 5E5AA 2F8ND 5AVBD 4KGCD 2Y2GA 3MGPB 2NQBB 5BNXB 3AZKB 4H9RB 4XUJB 1WWSA 1KX5A 3REKD 5B31B 1P3IA 3WA9C 3REJD 3WKJC 3AN2D 2Y2HA 5B2ID 2CV5B 2UWXA 4H9QA 3MNNA 5B0ZC 4NFTA 3LZ0D 3UTBC 1P3AB 3REIB 4WU9C 4DRBA 2JCHA 3W98C 2RIQA 3NQJA 3MGQB 3KXBD 3AV2D 3AFAA 1Z2CB 2J8PA 4J8XB 2YFVA 5GT3D 5GT0B 4X23B 2PYOD 2NZDA 4Z5TD 3VH6W 3RELC 5AY8D 3KUYD 2HIOA 3W96C 4ZUXA 1S32B 2F8NK 3MGSA 1TZYA 5AV5B 5BO0B 3MVDC 3AZFD 3AZGA 2AROC 5CPKB 5GSUD 4WZSB 3AZJC 4WU8C 2ZY4A 1U35B 5CPJB 1ZLAD 1KX3D 3REHC 4QLCB 4XZQC 5AVBA 5KDMA 4G92C 1P34B 3LZ1D 3O62A 4WJ3C 2F8NB 3AZLD 4KGCB 1N1JB 3REJA 3B0DC 4KHAA 1W2EA 3REKB 1P3KA 3AN2A 1F66C 2F8NH 4Z66C 1P3MD 2HUEC 4YM6C 3C1CD 1Q9CA 2CWEA 3LZ0A 5B33A 5B2IB 4EO5B 4HGAC 5AV9A 3LELC 5G49B 3MGRA 4JJNA 3AV2A 4AWLC 1P3LC 5GT3A 3A6NA 2PYOA 3KSYA 3KXBB 4Z5TA 2IO5C 4H9NB 3WTPC 3KUYA 5CPIB 3B6FA 1AOIB 4ZBJB 5AVCC 1JFIB 5AY8B 5AV6B 3UTBD 4LD9A 4YS3A 3AZFA 4WU9D 5GSUA 1HQ3B 2Y2KA 5B40C 3AZHD 1P3PA 3AZNB 3RELD 5AV8A 2JE5A 3W96D 4R8PD 1KX3A 2W8SA 5F99B 1ZLAB 5DNNB 4UUZA 1HTAA 3LZ1A 3AZLA 3C1BB 3AZJD 4J8VC 3B0BA 5B24B 4WU8D 1M1AD 5B1LC 3VH6A 5B2JC 3AZMD 4H9SA 5E5AD 1P3MA 5B1MB 4XZQD 1KX5D 1P3OC 3C1CB 3UT9C 3B0CW 4WNNA 5CP6C 3WA9A 1M19B 5BNVB 5B32B 3WKJA 5DNMC 2Y2MA 2F2AC 3MNND 1F66D 2LY8A 3NQUB 3TU4C 5B32G 4YM6D 1P3GC 5B0ZA 3UTBA 3F6TA 3UTAB 3AYWA 3LJAC 4WU9A 3W98A 3LELD 1BH9A 4J8WB 1P3LD 1F1EA 3X1UC 2HIOD 3AZIB 5B0YB 5C3IB 3AZHB 3RELA 3H0LC 3R45B 3AZEC 3W96A 3W97B 3AZGD 4R8PB 4H9OA 2RVQC 3MVDA 5JRGC 2AROA 4Z2MH 5B40D 3AZJA 4WU8A 4KUDC 5CHLB 1EQZC 4G91B 1M1AB 3AZMB 3REHA 1P3BC 3O62D 5E5AB 4XZQA 5DNNC 1KX5B 1P3KD 2Y2QA 1P3IB 3H0RC 3AL0C 5B31G 5B1LD 3WAAC 5B2JD 5JA4A 1F66A 3W99C 5B33D 5AV9D 4Z66A 3AYWC 4YM6A 3MNNB 3MGRD 4JJND 1P3OD 3A6ND 3UT9D 3LELA 3NQJB 3X1SC 3AFAB 3KWQC 5CP6D 2YFVB 1P3LA 2NZDB 3B6FD 3X1VC 1ID3C 1M19C 3WTPA 2HIOB 4ZUXB 1KX4C 4LD9D 5AVCA 4YS3D 3MGSB 2Y2LA 1P3GD 1TZYB 2BYKB 3LJAD 3AZGB 1P3PD 5B40A 3B6GC 1B67A 4J8UC 5AV8D 1TAFA 2Y2IA 3AZIC 4NE5A 4E45A 3IP4C 5AVBB 4CSRA 5JRGD 5KDMB 5BO0A 5GXQC 3O62B 4J8VA 3REJB 2F8NG 3FDDA 4KUDD 5B1LA 1P3KB 5B2JA 3AN2B 4WV4B 2FJ7C 1EQZD 3AV1C 3X1TC 1M18C 1P3FC 1P3BD 3LZ0B 5AV9B 1BH8A 3P5JB 3MGPC 2NQBC 1P3OA 3AZKC 3UT9A 4XUJC 3WA9D 3MGRB 4JJNB 3AV2B 5B31C 3A1IA 5CP6A 5GT3B 3A6NB 2PYOB 3WKJD 4H9PA 3EPHA 4Z5TB 3WAAD 5DNMA 3EPJA 5B0ZD 3KUYB 2CV5C 3B6FB 3W99D 3AYWD 3TU4A 1P3GA 3W98D 1P3AC 4E44A 3REIC 2DF4C 3EG5B 3LJAA 3AZFB 3MGQC 4DQYB 5BT1C 4J8XC 3X1SD 5GSUB 5GT0C 4X23C 3X1UA 1P3PB 1S32C 5AV8B 3AZEA 3MVDD 1KX3B 2YFWA 5AV5C 2AROD 1R4VA 4UUZB 5JRGA 5CPKC 4CAYA 3LZ1B 3AZLB 3H0MC 5CPJC 1U35C 4KUDA 3REHD 1EQZA 4DRAA 1H3OA 5BS7C 4QLCC 1P3MB 1P3BA 1P34C 5DNNA 2ZY5A 5GXQD 4KGCC 4WNNB 5FUGA 3VH5T 3WA9B 2Y2OA 3REKC 4Z66D 3WAAA 3W99A 5B2IC 4EO5C 5B0ZB 3UTBB 3EPLA 4WU9B 3W98B 4XUJD 3X1SA 3KWQA 1BH9B 3KXBC 3WTPD 2G5HC 3X1VA 1ID3A 5AVCD 1M19A 5CPIC 3RELB 1AOIC 4ZBJC 2CV5D 1KX4A 3W96B 5AY8C 5AV6C 3REID 2BYMA 4H9OB 4Z2MG 3MGQD 1HQ3C 2AROB 2VQRA 5GT0D 3B6GA 3AZJB 4J8UA 3AZNC 4WU8B 3AZIA 1PZRA 3V9RA 5F99C 1ZLAC 2Y2JA 5AV5D 3REHB 4XZQB 5CPKD 4G92B 4J8VD 5GXQA 3C1BC 2Y2NA 5B24C 3B0DB 1U35D 2XD1A 4H9QB 4NE3A 5JA4B 2FJ7A 1F66B 4Z66B 3AV1A 3X1TA 2HUEB 1M18A 1P3FA 4YM6B 5B1MC 4HGAB 3MGPA 3C1CC 2NQBA 5BNXA 3AZKA 4H9RA 4XUJA 3LELB 5B31A 1WWIA 4AWLB 1P3LB 5B32C 5DNMD 2IO5B 3TU4D 3A1KA 3WTPB 2CV5A 5AVCB 1P3AA 3UTAC 3REIA 4NE6A 3MGQA 3EPKA 4J8XA 3X1UD 4J8WC 5GT0A 4X23A 5B40B 5B0YC 5C3IC 3AZED 2L5AA 3AZHC 1TAFB 5CPID 1S32A 1AOID 3W97C 2RVQD 5AV6D 4R8PC 5AV5A 4CSRB 5CPKA 1HQ3D 2BYKA 4KHAB 3KFUG 4J8VB 3AZND 1U35A 5CPJA 5B1LB 5B2JB 4G91C 1M1AC 5F99D 5B33B 3AZMC 5BS7A 4QLCA 5DNND 3WTPE 5E5AC 1BH8B 1P34A 1P3OB 2XD5A 3UT9B 2F8NA 4KGCA 3C1BD 1KX5C 1N1JA 1P3IC 5CP6B 5B24D 1B6WA 4H9PB 3REKA 5DNMB 3VH6T 4LD9B 3MNNC 4YS3B 3TU4B 1P3GB 5B1MD 5B2IA 3KWQD 3LJAB 5G49A 3VH5W 3AFAC 1KU5A 3X1VD 1ID3D 2NZDC 2ZM5A 5B32D 3KXBA 1M19D 3X1UB 1KX4D 4H9NA 1BFMA 2HIOC 4ZUXC 5CPIA 1AOIA 3MGSC 3AZEB 2JSSA 1JFIA 1TZYC 2FFFB 2YFWB 5AY8A 5AV6A 3UTAD 1ULYA 3AZGC 3B6GD 5JRGB 4CAYB 2DQNC 4J8UD 1HQ3A 4J8WD 2ZY3A 4UPKA 3AZID 5B0YD 3AZNA 4KUDB 5F99A 1EQZB 3W97D 1H3OB 1ZLAA 2BG1A 1P3BB 5AVBC 3O62C 3C1BA 2ZY2A
chains in the Genus database with same CATH topology
5FUGB 3REJC 5B24A 2Y2PA 3WKJB 2FJ7D 1P3KC 3AN2C 3X1TD 3AV1D 1M18D 3WAAB 1P3FD 3W99B 3MGPD 3AYWB 1T3UA 3LZ0C 2NQBD 5AV9C 5B1MA 5B33C 3AZKD 5B31D 3C1CA 3MGRC 4JJNC 3AV2C 3X1SB 5GT3C 3A6NC 3KWQB 1P3ID 2PYOC 5BNVA 5B32A 4Z5TC 3X1VB 1ID3B 3KUYC 3B6FC 1P3AD 3NQUA 1KX4B 3MVDB 5BT1D 4J8XD 4YS3C 3UTAA 3AZFC 4LD9C 2BYMB 4M6BA 4X23D 5GSUC 3AFAD 4J8WA 2NZDD 3B6GB 1P3PC 5B0YA 4J8UB 1S32D 3AZHA 3R45A 5AV8C 4ZUXD 3MGSD 3V9RB 3W97A 1KX3C 1TZYD 2G5IC 4R8PA 3LZ1C 5GXQB 3AZLC 3VH5A 5CPJD 3B0CT 1A7WA 4QLCD 4H9SC 2FJ7B 1P3MC 1M1AA 3AZMA 3AV1B 3X1TB 1P34D 1P3FB 1M18B 5E5AA 2F8ND 5AVBD 4KGCD 2Y2GA 3MGPB 2NQBB 5BNXB 3AZKB 4H9RB 4XUJB 1WWSA 1KX5A 3REKD 5B31B 1P3IA 3WA9C 3REJD 3WKJC 3AN2D 2Y2HA 5B2ID 2CV5B 2UWXA 4H9QA 3MNNA 5B0ZC 4NFTA 3LZ0D 3UTBC 1P3AB 3REIB 4WU9C 4DRBA 2JCHA 3W98C 2RIQA 3NQJA 3MGQB 3KXBD 3AV2D 3AFAA 1Z2CB 2J8PA 4J8XB 2YFVA 5GT3D 5GT0B 4X23B 2PYOD 2NZDA 4Z5TD 3VH6W 3RELC 5AY8D 3KUYD 2HIOA 3W96C 4ZUXA 1S32B 2F8NK 3MGSA 1TZYA 5AV5B 5BO0B 3MVDC 3AZFD 3AZGA 2AROC 5CPKB 5GSUD 4WZSB 3AZJC 4WU8C 2ZY4A 1U35B 5CPJB 1ZLAD 1KX3D 3REHC 4QLCB 4XZQC 5AVBA 5KDMA 4G92C 1P34B 3LZ1D 3O62A 4WJ3C 2F8NB 3AZLD 4KGCB 1N1JB 3REJA 3B0DC 4KHAA 1W2EA 3REKB 1P3KA 3AN2A 1F66C 2F8NH 4Z66C 1P3MD 2HUEC 4YM6C 3C1CD 1Q9CA 2CWEA 3LZ0A 5B33A 5B2IB 4EO5B 4HGAC 5AV9A 3LELC 5G49B 3MGRA 4JJNA 3AV2A 4AWLC 1P3LC 5GT3A 3A6NA 2PYOA 3KSYA 3KXBB 4Z5TA 2IO5C 4H9NB 3WTPC 3KUYA 5CPIB 3B6FA 1AOIB 4ZBJB 5AVCC 1JFIB 5AY8B 5AV6B 3UTBD 4LD9A 4YS3A 3AZFA 4WU9D 5GSUA 1HQ3B 2Y2KA 5B40C 3AZHD 1P3PA 3AZNB 3RELD 5AV8A 2JE5A 3W96D 4R8PD 1KX3A 2W8SA 5F99B 1ZLAB 5DNNB 4UUZA 1HTAA 3LZ1A 3AZLA 3C1BB 3AZJD 4J8VC 3B0BA 5B24B 4WU8D 1M1AD 5B1LC 3VH6A 5B2JC 3AZMD 4H9SA 5E5AD 1P3MA 5B1MB 4XZQD 1KX5D 1P3OC 3C1CB 3UT9C 3B0CW 4WNNA 5CP6C 3WA9A 1M19B 5BNVB 5B32B 3WKJA 5DNMC 2Y2MA 2F2AC 3MNND 1F66D 2LY8A 3NQUB 3TU4C 5B32G 4YM6D 1P3GC 5B0ZA 3UTBA 3F6TA 3UTAB 3AYWA 3LJAC 4WU9A 3W98A 3LELD 1BH9A 4J8WB 1P3LD 1F1EA 3X1UC 2HIOD 3AZIB 5B0YB 5C3IB 3AZHB 3RELA 3H0LC 3R45B 3AZEC 3W96A 3W97B 3AZGD 4R8PB 4H9OA 2RVQC 3MVDA 5JRGC 2AROA 4Z2MH 5B40D 3AZJA 4WU8A 4KUDC 5CHLB 1EQZC 4G91B 1M1AB 3AZMB 3REHA 1P3BC 3O62D 5E5AB 4XZQA 5DNNC 1KX5B 1P3KD 2Y2QA 1P3IB 3H0RC 3AL0C 5B31G 5B1LD 3WAAC 5B2JD 5JA4A 1F66A 3W99C 5B33D 5AV9D 4Z66A 3AYWC 4YM6A 3MNNB 3MGRD 4JJND 1P3OD 3A6ND 3UT9D 3LELA 3NQJB 3X1SC 3AFAB 3KWQC 5CP6D 2YFVB 1P3LA 2NZDB 3B6FD 3X1VC 1ID3C 1M19C 3WTPA 2HIOB 4ZUXB 1KX4C 4LD9D 5AVCA 4YS3D 3MGSB 2Y2LA 1P3GD 1TZYB 2BYKB 3LJAD 3AZGB 1P3PD 5B40A 3B6GC 1B67A 4J8UC 5AV8D 1TAFA 2Y2IA 3AZIC 4NE5A 4E45A 3IP4C 5AVBB 4CSRA 5JRGD 5KDMB 5BO0A 5GXQC 3O62B 4J8VA 3REJB 2F8NG 3FDDA 4KUDD 5B1LA 1P3KB 5B2JA 3AN2B 4WV4B 2FJ7C 1EQZD 3AV1C 3X1TC 1M18C 1P3FC 1P3BD 3LZ0B 5AV9B 1BH8A 3P5JB 3MGPC 2NQBC 1P3OA 3AZKC 3UT9A 4XUJC 3WA9D 3MGRB 4JJNB 3AV2B 5B31C 3A1IA 5CP6A 5GT3B 3A6NB 2PYOB 3WKJD 4H9PA 3EPHA 4Z5TB 3WAAD 5DNMA 3EPJA 5B0ZD 3KUYB 2CV5C 3B6FB 3W99D 3AYWD 3TU4A 1P3GA 3W98D 1P3AC 4E44A 3REIC 2DF4C 3EG5B 3LJAA 3AZFB 3MGQC 4DQYB 5BT1C 4J8XC 3X1SD 5GSUB 5GT0C 4X23C 3X1UA 1P3PB 1S32C 5AV8B 3AZEA 3MVDD 1KX3B 2YFWA 5AV5C 2AROD 1R4VA 4UUZB 5JRGA 5CPKC 4CAYA 3LZ1B 3AZLB 3H0MC 5CPJC 1U35C 4KUDA 3REHD 1EQZA 4DRAA 1H3OA 5BS7C 4QLCC 1P3MB 1P3BA 1P34C 5DNNA 2ZY5A 5GXQD 4KGCC 4WNNB 5FUGA 3VH5T 3WA9B 2Y2OA 3REKC 4Z66D 3WAAA 3W99A 5B2IC 4EO5C 5B0ZB 3UTBB 3EPLA 4WU9B 3W98B 4XUJD 3X1SA 3KWQA 1BH9B 3KXBC 3WTPD 2G5HC 3X1VA 1ID3A 5AVCD 1M19A 5CPIC 3RELB 1AOIC 4ZBJC 2CV5D 1KX4A 3W96B 5AY8C 5AV6C 3REID 2BYMA 4H9OB 4Z2MG 3MGQD 1HQ3C 2AROB 2VQRA 5GT0D 3B6GA 3AZJB 4J8UA 3AZNC 4WU8B 3AZIA 1PZRA 3V9RA 5F99C 1ZLAC 2Y2JA 5AV5D 3REHB 4XZQB 5CPKD 4G92B 4J8VD 5GXQA 3C1BC 2Y2NA 5B24C 3B0DB 1U35D 2XD1A 4H9QB 4NE3A 5JA4B 2FJ7A 1F66B 4Z66B 3AV1A 3X1TA 2HUEB 1M18A 1P3FA 4YM6B 5B1MC 4HGAB 3MGPA 3C1CC 2NQBA 5BNXA 3AZKA 4H9RA 4XUJA 3LELB 5B31A 1WWIA 4AWLB 1P3LB 5B32C 5DNMD 2IO5B 3TU4D 3A1KA 3WTPB 2CV5A 5AVCB 1P3AA 3UTAC 3REIA 4NE6A 3MGQA 3EPKA 4J8XA 3X1UD 4J8WC 5GT0A 4X23A 5B40B 5B0YC 5C3IC 3AZED 2L5AA 3AZHC 1TAFB 5CPID 1S32A 1AOID 3W97C 2RVQD 5AV6D 4R8PC 5AV5A 4CSRB 5CPKA 1HQ3D 2BYKA 4KHAB 3KFUG 4J8VB 3AZND 1U35A 5CPJA 5B1LB 5B2JB 4G91C 1M1AC 5F99D 5B33B 3AZMC 5BS7A 4QLCA 5DNND 3WTPE 5E5AC 1BH8B 1P34A 1P3OB 2XD5A 3UT9B 2F8NA 4KGCA 3C1BD 1KX5C 1N1JA 1P3IC 5CP6B 5B24D 1B6WA 4H9PB 3REKA 5DNMB 3VH6T 4LD9B 3MNNC 4YS3B 3TU4B 1P3GB 5B1MD 5B2IA 3KWQD 3LJAB 5G49A 3VH5W 3AFAC 1KU5A 3X1VD 1ID3D 2NZDC 2ZM5A 5B32D 3KXBA 1M19D 3X1UB 1KX4D 4H9NA 1BFMA 2HIOC 4ZUXC 5CPIA 1AOIA 3MGSC 3AZEB 2JSSA 1JFIA 1TZYC 2FFFB 2YFWB 5AY8A 5AV6A 3UTAD 1ULYA 3AZGC 3B6GD 5JRGB 4CAYB 2DQNC 4J8UD 1HQ3A 4J8WD 2ZY3A 4UPKA 3AZID 5B0YD 3AZNA 4KUDB 5F99A 1EQZB 3W97D 1H3OB 1ZLAA 2BG1A 1P3BB 5AVBC 3O62C 3C1BA 2ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG B;  3REJ C;  5B24 A;  3WKJ B;  2FJ7 D;  1P3K C;  3AN2 C;  3X1T D;  3AV1 D;  1M18 D;  3WAA B;  1P3F D;  3W99 B;  3MGP D;  3AYW B;  3LZ0 C;  2NQB D;  5AV9 C;  5B1M A;  5B33 C;  3AZK D;  5B31 D;  3C1C A;  3MGR C;  4JJN C;  3AV2 C;  3X1S B;  5GT3 C;  3A6N C;  3KWQ B;  1P3I D;  2PYO C;  5BNV A;  5B32 A;  4Z5T C;  3X1V B;  1ID3 B;  3KUY C;  3B6F C;  1P3A D;  3NQU A;  1KX4 B;  3MVD B;  5BT1 D;  4J8X D;  4YS3 C;  3UTA A;  3AZF C;  4LD9 C;  2BYM B;  4M6B A;  4X23 D;  5GSU C;  3AFA D;  4J8W A;  2NZD D;  3B6G B;  1P3P C;  5B0Y A;  4J8U B;  1S32 D;  3AZH A;  3R45 A;  5AV8 C;  4ZUX D;  3MGS D;  3V9R B;  3W97 A;  1KX3 C;  1TZY D;  4R8P A;  3LZ1 C;  5GXQ B;  3AZL C;  3VH5 A;  5CPJ D;  3B0C T;  1A7W A;  4QLC D;  4H9S C;  2FJ7 B;  1P3M C;  1M1A A;  3AZM A;  3AV1 B;  3X1T B;  1P34 D;  1P3F B;  1M18 B;  5E5A A;  2F8N D;  5AVB D;  4KGC D;  3MGP B;  2NQB B;  5BNX B;  3AZK B;  4H9R B;  4XUJ B;  1WWS A;  1KX5 A;  3REK D;  5B31 B;  1P3I A;  3WA9 C;  3REJ D;  3WKJ C;  3AN2 D;  5B2I D;  2CV5 B;  4H9Q A;  3MNN A;  5B0Z C;  4NFT A;  3LZ0 D;  3UTB C;  1P3A B;  3REI B;  4WU9 C;  4DRB A;  3W98 C;  3NQJ A;  3MGQ B;  3KXB D;  3AV2 D;  3AFA A;  4J8X B;  2YFV A;  5GT3 D;  5GT0 B;  4X23 B;  2PYO D;  2NZD A;  4Z5T D;  3VH6 W;  3REL C;  5AY8 D;  3KUY D;  2HIO A;  3W96 C;  4ZUX A;  1S32 B;  2F8N K;  3MGS A;  1TZY A;  5AV5 B;  5BO0 B;  3MVD C;  3AZF D;  3AZG A;  2ARO C;  5CPK B;  5GSU D;  4WZS B;  3AZJ C;  4WU8 C;  1U35 B;  5CPJ B;  1ZLA D;  1KX3 D;  3REH C;  4QLC B;  4XZQ C;  5AVB A;  5KDM A;  4G92 C;  1P34 B;  3LZ1 D;  3O62 A;  2F8N B;  3AZL D;  4KGC B;  1N1J B;  3REJ A;  3B0D C;  4KHA A;  3REK B;  1P3K A;  3AN2 A;  1F66 C;  2F8N H;  4Z66 C;  1P3M D;  2HUE C;  4YM6 C;  3C1C D;  1Q9C A;  2CWE A;  3LZ0 A;  5B33 A;  5AV9 A;  4EO5 B;  5B2I B;  4HGA C;  3LEL C;  5G49 B;  3MGR A;  4JJN A;  3AV2 A;  4AWL C;  1P3L C;  5GT3 A;  3A6N A;  2PYO A;  3KSY A;  3KXB B;  4Z5T A;  2IO5 C;  4H9N B;  3WTP C;  3KUY A;  5CPI B;  3B6F A;  1AOI B;  4ZBJ B;  5AVC C;  1JFI B;  5AY8 B;  5AV6 B;  3UTB D;  4LD9 A;  4YS3 A;  3AZF A;  4WU9 D;  5GSU A;  1HQ3 B;  5B40 C;  3AZH D;  1P3P A;  3AZN B;  3REL D;  5AV8 A;  3W96 D;  4R8P D;  1KX3 A;  5F99 B;  1ZLA B;  5DNN B;  4UUZ A;  1HTA A;  3LZ1 A;  3AZL A;  3C1B B;  3AZJ D;  4J8V C;  3B0B A;  5B24 B;  4WU8 D;  1M1A D;  5B1L C;  3VH6 A;  5B2J C;  3AZM D;  4H9S A;  5E5A D;  1P3M A;  5B1M B;  4XZQ D;  1KX5 D;  1P3O C;  3C1C B;  3UT9 C;  3B0C W;  4WNN A;  5CP6 C;  3WA9 A;  1M19 B;  5BNV B;  5B32 B;  3WKJ A;  5DNM C;  3MNN D;  1F66 D;  2LY8 A;  3NQU B;  3TU4 C;  5B32 G;  4YM6 D;  1P3G C;  5B0Z A;  3UTB A;  3UTA B;  3AYW A;  3LJA C;  4WU9 A;  3W98 A;  3LEL D;  1BH9 A;  4J8W B;  1P3L D;  1F1E A;  3X1U C;  2HIO D;  3AZI B;  5B0Y B;  5C3I B;  3AZH B;  3REL A;  3R45 B;  3AZE C;  3W96 A;  3W97 B;  3AZG D;  4R8P B;  4H9O A;  2RVQ C;  3MVD A;  5JRG C;  2ARO A;  4Z2M H;  5B40 D;  3AZJ A;  4WU8 A;  4KUD C;  5CHL B;  1EQZ C;  4G91 B;  1M1A B;  3AZM B;  3REH A;  1P3B C;  3O62 D;  5E5A B;  4XZQ A;  5DNN C;  1KX5 B;  1P3K D;  1P3I B;  5B31 G;  5B1L D;  3WAA C;  5B2J D;  5JA4 A;  1F66 A;  3W99 C;  5B33 D;  5AV9 D;  4Z66 A;  3AYW C;  4YM6 A;  3MNN B;  3MGR D;  4JJN D;  1P3O D;  3A6N D;  3UT9 D;  3LEL A;  3NQJ B;  3X1S C;  3AFA B;  3KWQ C;  5CP6 D;  2YFV B;  1P3L A;  2NZD B;  3B6F D;  3X1V C;  1ID3 C;  1M19 C;  3WTP A;  2HIO B;  4ZUX B;  1KX4 C;  4LD9 D;  4YS3 D;  5AVC A;  3MGS B;  1P3G D;  1TZY B;  2BYK B;  3LJA D;  3AZG B;  1P3P D;  5B40 A;  3B6G C;  1B67 A;  4J8U C;  5AV8 D;  1TAF A;  3AZI C;  4NE5 A;  4E45 A;  5AVB B;  4CSR A;  5JRG D;  5KDM B;  5BO0 A;  5GXQ C;  3O62 B;  4J8V A;  3REJ B;  2F8N G;  4KUD D;  5B1L A;  1P3K B;  5B2J A;  3AN2 B;  4WV4 B;  2FJ7 C;  1EQZ D;  3AV1 C;  3X1T C;  1M18 C;  1P3F C;  1P3B D;  3LZ0 B;  5AV9 B;  1BH8 A;  3MGP C;  2NQB C;  1P3O A;  3AZK C;  3UT9 A;  4XUJ C;  3WA9 D;  3MGR B;  4JJN B;  3AV2 B;  5B31 C;  5CP6 A;  3WKJ D;  5GT3 B;  3A6N B;  2PYO B;  4H9P A;  4Z5T B;  3WAA D;  5DNM A;  5B0Z D;  3KUY B;  2CV5 C;  3B6F B;  3W99 D;  3AYW D;  3TU4 A;  1P3G A;  3W98 D;  1P3A C;  4E44 A;  3REI C;  3LJA A;  3AZF B;  3MGQ C;  5BT1 C;  4J8X C;  3X1S D;  5GSU B;  5GT0 C;  4X23 C;  3X1U A;  1P3P B;  1S32 C;  5AV8 B;  3AZE A;  3MVD D;  1KX3 B;  2YFW A;  5AV5 C;  2ARO D;  1R4V A;  4UUZ B;  5JRG A;  5CPK C;  4CAY A;  3LZ1 B;  3AZL B;  1U35 C;  5CPJ C;  4KUD A;  3REH D;  1EQZ A;  4DRA A;  1H3O A;  5BS7 C;  4QLC C;  1P3M B;  1P3B A;  1P34 C;  5DNN A;  5GXQ D;  4KGC C;  4WNN B;  5FUG A;  3VH5 T;  3WA9 B;  3REK C;  4Z66 D;  3WAA A;  3W99 A;  5B2I C;  4EO5 C;  5B0Z B;  3UTB B;  4WU9 B;  3W98 B;  4XUJ D;  3X1S A;  3KWQ A;  1BH9 B;  3KXB C;  3WTP D;  3X1V A;  1ID3 A;  5AVC D;  1M19 A;  5CPI C;  3REL B;  1AOI C;  4ZBJ C;  2CV5 D;  1KX4 A;  3W96 B;  5AY8 C;  5AV6 C;  3REI D;  2BYM A;  4H9O B;  4Z2M G;  3MGQ D;  1HQ3 C;  2ARO B;  5GT0 D;  3B6G A;  3AZJ B;  4J8U A;  3AZN C;  4WU8 B;  3AZI A;  3V9R A;  5F99 C;  1ZLA C;  5AV5 D;  3REH B;  4XZQ B;  5CPK D;  4G92 B;  4J8V D;  5GXQ A;  3C1B C;  5B24 C;  3B0D B;  1U35 D;  4H9Q B;  4NE3 A;  5JA4 B;  2FJ7 A;  1F66 B;  4Z66 B;  3AV1 A;  3X1T A;  2HUE B;  1M18 A;  1P3F A;  4YM6 B;  5B1M C;  4HGA B;  3MGP A;  3C1C C;  2NQB A;  5BNX A;  3AZK A;  4H9R A;  4XUJ A;  3LEL B;  5B31 A;  1WWI A;  4AWL B;  1P3L B;  5B32 C;  5DNM D;  2IO5 B;  3TU4 D;  3WTP B;  2CV5 A;  5AVC B;  1P3A A;  3UTA C;  3REI A;  4NE6 A;  3MGQ A;  4J8X A;  3X1U D;  4J8W C;  5GT0 A;  4X23 A;  5B40 B;  5B0Y C;  5C3I C;  3AZE D;  2L5A A;  3AZH C;  1TAF B;  5CPI D;  1S32 A;  1AOI D;  3W97 C;  2RVQ D;  5AV6 D;  4R8P C;  5AV5 A;  4CSR B;  5CPK A;  1HQ3 D;  2BYK A;  4KHA B;  4J8V B;  3AZN D;  1U35 A;  5CPJ A;  5B1L B;  5B2J B;  4G91 C;  1M1A C;  5F99 D;  5B33 B;  3AZM C;  5BS7 A;  4QLC A;  5DNN D;  3WTP E;  5E5A C;  1BH8 B;  1P34 A;  1P3O B;  3UT9 B;  2F8N A;  4KGC A;  3C1B D;  1KX5 C;  1N1J A;  1P3I C;  5CP6 B;  5B24 D;  1B6W A;  4H9P B;  3REK A;  5DNM B;  3VH6 T;  4LD9 B;  3MNN C;  4YS3 B;  3TU4 B;  1P3G B;  5B1M D;  5B2I A;  3KWQ D;  3LJA B;  5G49 A;  3VH5 W;  3AFA C;  1KU5 A;  3X1V D;  1ID3 D;  2NZD C;  1M19 D;  5B32 D;  3KXB A;  3X1U B;  1KX4 D;  4H9N A;  1BFM A;  2HIO C;  4ZUX C;  5CPI A;  1AOI A;  3MGS C;  3AZE B;  2JSS A;  1JFI A;  1TZY C;  5AY8 A;  2YFW B;  5AV6 A;  3UTA D;  1ULY A;  3AZG C;  3B6G D;  5JRG B;  4CAY B;  4J8U D;  1HQ3 A;  4J8W D;  3AZI D;  5B0Y D;  3AZN A;  4KUD B;  5F99 A;  1EQZ B;  3W97 D;  1H3O B;  1ZLA A;  1P3B B;  5AVB C;  3O62 C;  3C1B A; 
#chains in the Genus database with same CATH topology
 5FUG B;  3REJ C;  5B24 A;  2Y2P A;  3WKJ B;  2FJ7 D;  1P3K C;  3AN2 C;  3X1T D;  3AV1 D;  1M18 D;  3WAA B;  1P3F D;  3W99 B;  3MGP D;  3AYW B;  1T3U A;  3LZ0 C;  2NQB D;  5AV9 C;  5B1M A;  5B33 C;  3AZK D;  5B31 D;  3C1C A;  3MGR C;  4JJN C;  3AV2 C;  3X1S B;  5GT3 C;  3A6N C;  3KWQ B;  1P3I D;  2PYO C;  5BNV A;  5B32 A;  4Z5T C;  3X1V B;  1ID3 B;  3KUY C;  3B6F C;  1P3A D;  3NQU A;  1KX4 B;  3MVD B;  5BT1 D;  4J8X D;  4YS3 C;  3UTA A;  3AZF C;  4LD9 C;  2BYM B;  4M6B A;  4X23 D;  5GSU C;  3AFA D;  4J8W A;  2NZD D;  3B6G B;  1P3P C;  5B0Y A;  4J8U B;  1S32 D;  3AZH A;  3R45 A;  5AV8 C;  4ZUX D;  3MGS D;  3V9R B;  3W97 A;  1KX3 C;  1TZY D;  2G5I C;  4R8P A;  3LZ1 C;  5GXQ B;  3AZL C;  3VH5 A;  5CPJ D;  3B0C T;  1A7W A;  4QLC D;  4H9S C;  2FJ7 B;  1P3M C;  1M1A A;  3AZM A;  3AV1 B;  3X1T B;  1P34 D;  1P3F B;  1M18 B;  5E5A A;  2F8N D;  5AVB D;  4KGC D;  2Y2G A;  3MGP B;  2NQB B;  5BNX B;  3AZK B;  4H9R B;  4XUJ B;  1WWS A;  1KX5 A;  3REK D;  5B31 B;  1P3I A;  3WA9 C;  3REJ D;  3WKJ C;  3AN2 D;  2Y2H A;  5B2I D;  2CV5 B;  2UWX A;  4H9Q A;  3MNN A;  5B0Z C;  4NFT A;  3LZ0 D;  3UTB C;  1P3A B;  3REI B;  4WU9 C;  4DRB A;  2JCH A;  3W98 C;  2RIQ A;  3NQJ A;  3MGQ B;  3KXB D;  3AV2 D;  3AFA A;  1Z2C B;  2J8P A;  4J8X B;  2YFV A;  5GT3 D;  5GT0 B;  4X23 B;  2PYO D;  2NZD A;  4Z5T D;  3VH6 W;  3REL C;  5AY8 D;  3KUY D;  2HIO A;  3W96 C;  4ZUX A;  1S32 B;  2F8N K;  3MGS A;  1TZY A;  5AV5 B;  5BO0 B;  3MVD C;  3AZF D;  3AZG A;  2ARO C;  5CPK B;  5GSU D;  4WZS B;  3AZJ C;  4WU8 C;  2ZY4 A;  1U35 B;  5CPJ B;  1ZLA D;  1KX3 D;  3REH C;  4QLC B;  4XZQ C;  5AVB A;  5KDM A;  4G92 C;  1P34 B;  3LZ1 D;  3O62 A;  4WJ3 C;  2F8N B;  3AZL D;  4KGC B;  1N1J B;  3REJ A;  3B0D C;  4KHA A;  1W2E A;  3REK B;  1P3K A;  3AN2 A;  1F66 C;  2F8N H;  4Z66 C;  1P3M D;  2HUE C;  4YM6 C;  3C1C D;  1Q9C A;  2CWE A;  3LZ0 A;  5B33 A;  5B2I B;  4EO5 B;  4HGA C;  5AV9 A;  3LEL C;  5G49 B;  3MGR A;  4JJN A;  3AV2 A;  4AWL C;  1P3L C;  5GT3 A;  3A6N A;  2PYO A;  3KSY A;  3KXB B;  4Z5T A;  2IO5 C;  4H9N B;  3WTP C;  3KUY A;  5CPI B;  3B6F A;  1AOI B;  4ZBJ B;  5AVC C;  1JFI B;  5AY8 B;  5AV6 B;  3UTB D;  4LD9 A;  4YS3 A;  3AZF A;  4WU9 D;  5GSU A;  1HQ3 B;  2Y2K A;  5B40 C;  3AZH D;  1P3P A;  3AZN B;  3REL D;  5AV8 A;  2JE5 A;  3W96 D;  4R8P D;  1KX3 A;  2W8S A;  5F99 B;  1ZLA B;  5DNN B;  4UUZ A;  1HTA A;  3LZ1 A;  3AZL A;  3C1B B;  3AZJ D;  4J8V C;  3B0B A;  5B24 B;  4WU8 D;  1M1A D;  5B1L C;  3VH6 A;  5B2J C;  3AZM D;  4H9S A;  5E5A D;  1P3M A;  5B1M B;  4XZQ D;  1KX5 D;  1P3O C;  3C1C B;  3UT9 C;  3B0C W;  4WNN A;  5CP6 C;  3WA9 A;  1M19 B;  5BNV B;  5B32 B;  3WKJ A;  5DNM C;  2Y2M A;  2F2A C;  3MNN D;  1F66 D;  2LY8 A;  3NQU B;  3TU4 C;  5B32 G;  4YM6 D;  1P3G C;  5B0Z A;  3UTB A;  3F6T A;  3UTA B;  3AYW A;  3LJA C;  4WU9 A;  3W98 A;  3LEL D;  1BH9 A;  4J8W B;  1P3L D;  1F1E A;  3X1U C;  2HIO D;  3AZI B;  5B0Y B;  5C3I B;  3AZH B;  3REL A;  3H0L C;  3R45 B;  3AZE C;  3W96 A;  3W97 B;  3AZG D;  4R8P B;  4H9O A;  2RVQ C;  3MVD A;  5JRG C;  2ARO A;  4Z2M H;  5B40 D;  3AZJ A;  4WU8 A;  4KUD C;  5CHL B;  1EQZ C;  4G91 B;  1M1A B;  3AZM B;  3REH A;  1P3B C;  3O62 D;  5E5A B;  4XZQ A;  5DNN C;  1KX5 B;  1P3K D;  2Y2Q A;  1P3I B;  3H0R C;  3AL0 C;  5B31 G;  5B1L D;  3WAA C;  5B2J D;  5JA4 A;  1F66 A;  3W99 C;  5B33 D;  5AV9 D;  4Z66 A;  3AYW C;  4YM6 A;  3MNN B;  3MGR D;  4JJN D;  1P3O D;  3A6N D;  3UT9 D;  3LEL A;  3NQJ B;  3X1S C;  3AFA B;  3KWQ C;  5CP6 D;  2YFV B;  1P3L A;  2NZD B;  3B6F D;  3X1V C;  1ID3 C;  1M19 C;  3WTP A;  2HIO B;  4ZUX B;  1KX4 C;  4LD9 D;  5AVC A;  4YS3 D;  3MGS B;  2Y2L A;  1P3G D;  1TZY B;  2BYK B;  3LJA D;  3AZG B;  1P3P D;  5B40 A;  3B6G C;  1B67 A;  4J8U C;  5AV8 D;  1TAF A;  2Y2I A;  3AZI C;  4NE5 A;  4E45 A;  3IP4 C;  5AVB B;  4CSR A;  5JRG D;  5KDM B;  5BO0 A;  5GXQ C;  3O62 B;  4J8V A;  3REJ B;  2F8N G;  3FDD A;  4KUD D;  5B1L A;  1P3K B;  5B2J A;  3AN2 B;  4WV4 B;  2FJ7 C;  1EQZ D;  3AV1 C;  3X1T C;  1M18 C;  1P3F C;  1P3B D;  3LZ0 B;  5AV9 B;  1BH8 A;  3P5J B;  3MGP C;  2NQB C;  1P3O A;  3AZK C;  3UT9 A;  4XUJ C;  3WA9 D;  3MGR B;  4JJN B;  3AV2 B;  5B31 C;  3A1I A;  5CP6 A;  5GT3 B;  3A6N B;  2PYO B;  3WKJ D;  4H9P A;  3EPH A;  4Z5T B;  3WAA D;  5DNM A;  3EPJ A;  5B0Z D;  3KUY B;  2CV5 C;  3B6F B;  3W99 D;  3AYW D;  3TU4 A;  1P3G A;  3W98 D;  1P3A C;  4E44 A;  3REI C;  2DF4 C;  3EG5 B;  3LJA A;  3AZF B;  3MGQ C;  4DQY B;  5BT1 C;  4J8X C;  3X1S D;  5GSU B;  5GT0 C;  4X23 C;  3X1U A;  1P3P B;  1S32 C;  5AV8 B;  3AZE A;  3MVD D;  1KX3 B;  2YFW A;  5AV5 C;  2ARO D;  1R4V A;  4UUZ B;  5JRG A;  5CPK C;  4CAY A;  3LZ1 B;  3AZL B;  3H0M C;  5CPJ C;  1U35 C;  4KUD A;  3REH D;  1EQZ A;  4DRA A;  1H3O A;  5BS7 C;  4QLC C;  1P3M B;  1P3B A;  1P34 C;  5DNN A;  2ZY5 A;  5GXQ D;  4KGC C;  4WNN B;  5FUG A;  3VH5 T;  3WA9 B;  2Y2O A;  3REK C;  4Z66 D;  3WAA A;  3W99 A;  5B2I C;  4EO5 C;  5B0Z B;  3UTB B;  3EPL A;  4WU9 B;  3W98 B;  4XUJ D;  3X1S A;  3KWQ A;  1BH9 B;  3KXB C;  3WTP D;  2G5H C;  3X1V A;  1ID3 A;  5AVC D;  1M19 A;  5CPI C;  3REL B;  1AOI C;  4ZBJ C;  2CV5 D;  1KX4 A;  3W96 B;  5AY8 C;  5AV6 C;  3REI D;  2BYM A;  4H9O B;  4Z2M G;  3MGQ D;  1HQ3 C;  2ARO B;  2VQR A;  5GT0 D;  3B6G A;  3AZJ B;  4J8U A;  3AZN C;  4WU8 B;  3AZI A;  1PZR A;  3V9R A;  5F99 C;  1ZLA C;  2Y2J A;  5AV5 D;  3REH B;  4XZQ B;  5CPK D;  4G92 B;  4J8V D;  5GXQ A;  3C1B C;  2Y2N A;  5B24 C;  3B0D B;  1U35 D;  2XD1 A;  4H9Q B;  4NE3 A;  5JA4 B;  2FJ7 A;  1F66 B;  4Z66 B;  3AV1 A;  3X1T A;  2HUE B;  1M18 A;  1P3F A;  4YM6 B;  5B1M C;  4HGA B;  3MGP A;  3C1C C;  2NQB A;  5BNX A;  3AZK A;  4H9R A;  4XUJ A;  3LEL B;  5B31 A;  1WWI A;  4AWL B;  1P3L B;  5B32 C;  5DNM D;  2IO5 B;  3TU4 D;  3A1K A;  3WTP B;  2CV5 A;  5AVC B;  1P3A A;  3UTA C;  3REI A;  4NE6 A;  3MGQ A;  3EPK A;  4J8X A;  3X1U D;  4J8W C;  5GT0 A;  4X23 A;  5B40 B;  5B0Y C;  5C3I C;  3AZE D;  2L5A A;  3AZH C;  1TAF B;  5CPI D;  1S32 A;  1AOI D;  3W97 C;  2RVQ D;  5AV6 D;  4R8P C;  5AV5 A;  4CSR B;  5CPK A;  1HQ3 D;  2BYK A;  4KHA B;  3KFU G;  4J8V B;  3AZN D;  1U35 A;  5CPJ A;  5B1L B;  5B2J B;  4G91 C;  1M1A C;  5F99 D;  5B33 B;  3AZM C;  5BS7 A;  4QLC A;  5DNN D;  3WTP E;  5E5A C;  1BH8 B;  1P34 A;  1P3O B;  2XD5 A;  3UT9 B;  2F8N A;  4KGC A;  3C1B D;  1KX5 C;  1N1J A;  1P3I C;  5CP6 B;  5B24 D;  1B6W A;  4H9P B;  3REK A;  5DNM B;  3VH6 T;  4LD9 B;  3MNN C;  4YS3 B;  3TU4 B;  1P3G B;  5B1M D;  5B2I A;  3KWQ D;  3LJA B;  5G49 A;  3VH5 W;  3AFA C;  1KU5 A;  3X1V D;  1ID3 D;  2NZD C;  2ZM5 A;  5B32 D;  3KXB A;  1M19 D;  3X1U B;  1KX4 D;  4H9N A;  1BFM A;  2HIO C;  4ZUX C;  5CPI A;  1AOI A;  3MGS C;  3AZE B;  2JSS A;  1JFI A;  1TZY C;  2FFF B;  2YFW B;  5AY8 A;  5AV6 A;  3UTA D;  1ULY A;  3AZG C;  3B6G D;  5JRG B;  4CAY B;  2DQN C;  4J8U D;  1HQ3 A;  4J8W D;  2ZY3 A;  4UPK A;  3AZI D;  5B0Y D;  3AZN A;  4KUD B;  5F99 A;  1EQZ B;  3W97 D;  1H3O B;  1ZLA A;  2BG1 A;  1P3B B;  5AVB C;  3O62 C;  3C1B A;  2ZY2 A; 
#chains in the Genus database with same CATH homology
 5FUG B;  3REJ C;  5B24 A;  2Y2P A;  3WKJ B;  2FJ7 D;  1P3K C;  3AN2 C;  3X1T D;  3AV1 D;  1M18 D;  3WAA B;  1P3F D;  3W99 B;  3MGP D;  3AYW B;  1T3U A;  3LZ0 C;  2NQB D;  5AV9 C;  5B1M A;  5B33 C;  3AZK D;  5B31 D;  3C1C A;  3MGR C;  4JJN C;  3AV2 C;  3X1S B;  5GT3 C;  3A6N C;  3KWQ B;  1P3I D;  2PYO C;  5BNV A;  5B32 A;  4Z5T C;  3X1V B;  1ID3 B;  3KUY C;  3B6F C;  1P3A D;  3NQU A;  1KX4 B;  3MVD B;  5BT1 D;  4J8X D;  4YS3 C;  3UTA A;  3AZF C;  4LD9 C;  2BYM B;  4M6B A;  4X23 D;  5GSU C;  3AFA D;  4J8W A;  2NZD D;  3B6G B;  1P3P C;  5B0Y A;  4J8U B;  1S32 D;  3AZH A;  3R45 A;  5AV8 C;  4ZUX D;  3MGS D;  3V9R B;  3W97 A;  1KX3 C;  1TZY D;  2G5I C;  4R8P A;  3LZ1 C;  5GXQ B;  3AZL C;  3VH5 A;  5CPJ D;  3B0C T;  1A7W A;  4QLC D;  4H9S C;  2FJ7 B;  1P3M C;  1M1A A;  3AZM A;  3AV1 B;  3X1T B;  1P34 D;  1P3F B;  1M18 B;  5E5A A;  2F8N D;  5AVB D;  4KGC D;  2Y2G A;  3MGP B;  2NQB B;  5BNX B;  3AZK B;  4H9R B;  4XUJ B;  1WWS A;  1KX5 A;  3REK D;  5B31 B;  1P3I A;  3WA9 C;  3REJ D;  3WKJ C;  3AN2 D;  2Y2H A;  5B2I D;  2CV5 B;  2UWX A;  4H9Q A;  3MNN A;  5B0Z C;  4NFT A;  3LZ0 D;  3UTB C;  1P3A B;  3REI B;  4WU9 C;  4DRB A;  2JCH A;  3W98 C;  2RIQ A;  3NQJ A;  3MGQ B;  3KXB D;  3AV2 D;  3AFA A;  1Z2C B;  2J8P A;  4J8X B;  2YFV A;  5GT3 D;  5GT0 B;  4X23 B;  2PYO D;  2NZD A;  4Z5T D;  3VH6 W;  3REL C;  5AY8 D;  3KUY D;  2HIO A;  3W96 C;  4ZUX A;  1S32 B;  2F8N K;  3MGS A;  1TZY A;  5AV5 B;  5BO0 B;  3MVD C;  3AZF D;  3AZG A;  2ARO C;  5CPK B;  5GSU D;  4WZS B;  3AZJ C;  4WU8 C;  2ZY4 A;  1U35 B;  5CPJ B;  1ZLA D;  1KX3 D;  3REH C;  4QLC B;  4XZQ C;  5AVB A;  5KDM A;  4G92 C;  1P34 B;  3LZ1 D;  3O62 A;  4WJ3 C;  2F8N B;  3AZL D;  4KGC B;  1N1J B;  3REJ A;  3B0D C;  4KHA A;  1W2E A;  3REK B;  1P3K A;  3AN2 A;  1F66 C;  2F8N H;  4Z66 C;  1P3M D;  2HUE C;  4YM6 C;  3C1C D;  1Q9C A;  2CWE A;  3LZ0 A;  5B33 A;  5B2I B;  4EO5 B;  4HGA C;  5AV9 A;  3LEL C;  5G49 B;  3MGR A;  4JJN A;  3AV2 A;  4AWL C;  1P3L C;  5GT3 A;  3A6N A;  2PYO A;  3KSY A;  3KXB B;  4Z5T A;  2IO5 C;  4H9N B;  3WTP C;  3KUY A;  5CPI B;  3B6F A;  1AOI B;  4ZBJ B;  5AVC C;  1JFI B;  5AY8 B;  5AV6 B;  3UTB D;  4LD9 A;  4YS3 A;  3AZF A;  4WU9 D;  5GSU A;  1HQ3 B;  2Y2K A;  5B40 C;  3AZH D;  1P3P A;  3AZN B;  3REL D;  5AV8 A;  2JE5 A;  3W96 D;  4R8P D;  1KX3 A;  2W8S A;  5F99 B;  1ZLA B;  5DNN B;  4UUZ A;  1HTA A;  3LZ1 A;  3AZL A;  3C1B B;  3AZJ D;  4J8V C;  3B0B A;  5B24 B;  4WU8 D;  1M1A D;  5B1L C;  3VH6 A;  5B2J C;  3AZM D;  4H9S A;  5E5A D;  1P3M A;  5B1M B;  4XZQ D;  1KX5 D;  1P3O C;  3C1C B;  3UT9 C;  3B0C W;  4WNN A;  5CP6 C;  3WA9 A;  1M19 B;  5BNV B;  5B32 B;  3WKJ A;  5DNM C;  2Y2M A;  2F2A C;  3MNN D;  1F66 D;  2LY8 A;  3NQU B;  3TU4 C;  5B32 G;  4YM6 D;  1P3G C;  5B0Z A;  3UTB A;  3F6T A;  3UTA B;  3AYW A;  3LJA C;  4WU9 A;  3W98 A;  3LEL D;  1BH9 A;  4J8W B;  1P3L D;  1F1E A;  3X1U C;  2HIO D;  3AZI B;  5B0Y B;  5C3I B;  3AZH B;  3REL A;  3H0L C;  3R45 B;  3AZE C;  3W96 A;  3W97 B;  3AZG D;  4R8P B;  4H9O A;  2RVQ C;  3MVD A;  5JRG C;  2ARO A;  4Z2M H;  5B40 D;  3AZJ A;  4WU8 A;  4KUD C;  5CHL B;  1EQZ C;  4G91 B;  1M1A B;  3AZM B;  3REH A;  1P3B C;  3O62 D;  5E5A B;  4XZQ A;  5DNN C;  1KX5 B;  1P3K D;  2Y2Q A;  1P3I B;  3H0R C;  3AL0 C;  5B31 G;  5B1L D;  3WAA C;  5B2J D;  5JA4 A;  1F66 A;  3W99 C;  5B33 D;  5AV9 D;  4Z66 A;  3AYW C;  4YM6 A;  3MNN B;  3MGR D;  4JJN D;  1P3O D;  3A6N D;  3UT9 D;  3LEL A;  3NQJ B;  3X1S C;  3AFA B;  3KWQ C;  5CP6 D;  2YFV B;  1P3L A;  2NZD B;  3B6F D;  3X1V C;  1ID3 C;  1M19 C;  3WTP A;  2HIO B;  4ZUX B;  1KX4 C;  4LD9 D;  5AVC A;  4YS3 D;  3MGS B;  2Y2L A;  1P3G D;  1TZY B;  2BYK B;  3LJA D;  3AZG B;  1P3P D;  5B40 A;  3B6G C;  1B67 A;  4J8U C;  5AV8 D;  1TAF A;  2Y2I A;  3AZI C;  4NE5 A;  4E45 A;  3IP4 C;  5AVB B;  4CSR A;  5JRG D;  5KDM B;  5BO0 A;  5GXQ C;  3O62 B;  4J8V A;  3REJ B;  2F8N G;  3FDD A;  4KUD D;  5B1L A;  1P3K B;  5B2J A;  3AN2 B;  4WV4 B;  2FJ7 C;  1EQZ D;  3AV1 C;  3X1T C;  1M18 C;  1P3F C;  1P3B D;  3LZ0 B;  5AV9 B;  1BH8 A;  3P5J B;  3MGP C;  2NQB C;  1P3O A;  3AZK C;  3UT9 A;  4XUJ C;  3WA9 D;  3MGR B;  4JJN B;  3AV2 B;  5B31 C;  3A1I A;  5CP6 A;  5GT3 B;  3A6N B;  2PYO B;  3WKJ D;  4H9P A;  3EPH A;  4Z5T B;  3WAA D;  5DNM A;  3EPJ A;  5B0Z D;  3KUY B;  2CV5 C;  3B6F B;  3W99 D;  3AYW D;  3TU4 A;  1P3G A;  3W98 D;  1P3A C;  4E44 A;  3REI C;  2DF4 C;  3EG5 B;  3LJA A;  3AZF B;  3MGQ C;  4DQY B;  5BT1 C;  4J8X C;  3X1S D;  5GSU B;  5GT0 C;  4X23 C;  3X1U A;  1P3P B;  1S32 C;  5AV8 B;  3AZE A;  3MVD D;  1KX3 B;  2YFW A;  5AV5 C;  2ARO D;  1R4V A;  4UUZ B;  5JRG A;  5CPK C;  4CAY A;  3LZ1 B;  3AZL B;  3H0M C;  5CPJ C;  1U35 C;  4KUD A;  3REH D;  1EQZ A;  4DRA A;  1H3O A;  5BS7 C;  4QLC C;  1P3M B;  1P3B A;  1P34 C;  5DNN A;  2ZY5 A;  5GXQ D;  4KGC C;  4WNN B;  5FUG A;  3VH5 T;  3WA9 B;  2Y2O A;  3REK C;  4Z66 D;  3WAA A;  3W99 A;  5B2I C;  4EO5 C;  5B0Z B;  3UTB B;  3EPL A;  4WU9 B;  3W98 B;  4XUJ D;  3X1S A;  3KWQ A;  1BH9 B;  3KXB C;  3WTP D;  2G5H C;  3X1V A;  1ID3 A;  5AVC D;  1M19 A;  5CPI C;  3REL B;  1AOI C;  4ZBJ C;  2CV5 D;  1KX4 A;  3W96 B;  5AY8 C;  5AV6 C;  3REI D;  2BYM A;  4H9O B;  4Z2M G;  3MGQ D;  1HQ3 C;  2ARO B;  2VQR A;  5GT0 D;  3B6G A;  3AZJ B;  4J8U A;  3AZN C;  4WU8 B;  3AZI A;  1PZR A;  3V9R A;  5F99 C;  1ZLA C;  2Y2J A;  5AV5 D;  3REH B;  4XZQ B;  5CPK D;  4G92 B;  4J8V D;  5GXQ A;  3C1B C;  2Y2N A;  5B24 C;  3B0D B;  1U35 D;  2XD1 A;  4H9Q B;  4NE3 A;  5JA4 B;  2FJ7 A;  1F66 B;  4Z66 B;  3AV1 A;  3X1T A;  2HUE B;  1M18 A;  1P3F A;  4YM6 B;  5B1M C;  4HGA B;  3MGP A;  3C1C C;  2NQB A;  5BNX A;  3AZK A;  4H9R A;  4XUJ A;  3LEL B;  5B31 A;  1WWI A;  4AWL B;  1P3L B;  5B32 C;  5DNM D;  2IO5 B;  3TU4 D;  3A1K A;  3WTP B;  2CV5 A;  5AVC B;  1P3A A;  3UTA C;  3REI A;  4NE6 A;  3MGQ A;  3EPK A;  4J8X A;  3X1U D;  4J8W C;  5GT0 A;  4X23 A;  5B40 B;  5B0Y C;  5C3I C;  3AZE D;  2L5A A;  3AZH C;  1TAF B;  5CPI D;  1S32 A;  1AOI D;  3W97 C;  2RVQ D;  5AV6 D;  4R8P C;  5AV5 A;  4CSR B;  5CPK A;  1HQ3 D;  2BYK A;  4KHA B;  3KFU G;  4J8V B;  3AZN D;  1U35 A;  5CPJ A;  5B1L B;  5B2J B;  4G91 C;  1M1A C;  5F99 D;  5B33 B;  3AZM C;  5BS7 A;  4QLC A;  5DNN D;  3WTP E;  5E5A C;  1BH8 B;  1P34 A;  1P3O B;  2XD5 A;  3UT9 B;  2F8N A;  4KGC A;  3C1B D;  1KX5 C;  1N1J A;  1P3I C;  5CP6 B;  5B24 D;  1B6W A;  4H9P B;  3REK A;  5DNM B;  3VH6 T;  4LD9 B;  3MNN C;  4YS3 B;  3TU4 B;  1P3G B;  5B1M D;  5B2I A;  3KWQ D;  3LJA B;  5G49 A;  3VH5 W;  3AFA C;  1KU5 A;  3X1V D;  1ID3 D;  2NZD C;  2ZM5 A;  5B32 D;  3KXB A;  1M19 D;  3X1U B;  1KX4 D;  4H9N A;  1BFM A;  2HIO C;  4ZUX C;  5CPI A;  1AOI A;  3MGS C;  3AZE B;  2JSS A;  1JFI A;  1TZY C;  2FFF B;  2YFW B;  5AY8 A;  5AV6 A;  3UTA D;  1ULY A;  3AZG C;  3B6G D;  5JRG B;  4CAY B;  2DQN C;  4J8U D;  1HQ3 A;  4J8W D;  2ZY3 A;  4UPK A;  3AZI D;  5B0Y D;  3AZN A;  4KUD B;  5F99 A;  1EQZ B;  3W97 D;  1H3O B;  1ZLA A;  2BG1 A;  1P3B B;  5AVB C;  3O62 C;  3C1B A;  2ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...