1TZYB

Crystal structure of the core-histone octamer to 1.90 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
b'RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title High-resolution structure of the native histone octamer.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 35
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tzyB00
2NQBB 3MVDB 2AROC 5B0ZA 3AZMB 1M19A 5BNVA 4H9QB 3W96B 5GT0A 3B6FC 5B2ID 5AV9D 3UTAB 3KUYA 1P3BD 5JA4A 3X1UA 1HQ3B 5B31D 3WA9C 1P3KB 4J8XD 3C1BD 5CPIA 5BO0A 5JRGB 3MGPD 3AZJC 5B40D 5F99A 3REKA 3WTPC 4QLCA 3B6GB 5AV6B 2YFWB 3LZ0B 4J8VC 1P3IB 5CP6D 1ZLAB 3AZIA 2NZDA 5BT1D 1BH9A 4R8PC 3X1TB 4YS3B 3AV2B 1KX4A 1AOIC 4XUJC 4KHAA 4EO5C 4J8UA 3C1CB 1P3LB 1P34A 5E5AD 4KGCC 3RELD 3MGQA 3AZND 1P3AD 3W97B 1S32C 3AZLB 5B1MA 5G49A 3X1SC 3UTBB 3AZKA 1U35D 1P3MD 4NE3A 1JFIB 4NE6A 3AZJB 2PYOB 5B33A 5DNMB 5AVCA 2HIOD 3AN2A 4J8WC 5B2JA 3TU4C 3AZEA 4YM6D 1M1AB 3WAAB 3LZ1A 3MGSC 3KWQA 3REIC 5CHLB 5B2IA 1P3OB 3LJAC 4UUZB 1P3BA 2IO5B 4E44A 5B31A 4WU8C 1KX5C 5AV8B 3WKJC 3AFAD 1P3PC 3KXBD 4J8XA 3C1BA 1EQZD 2CV5C 5B32B 2AROA 5B24C 5GXQB 4XZQC 3MGPA 3W99C 3LELD 4CSRA 1KX3C 1ID3B 4H9SC 5AY8D 1ULYA 4Z5TB 4X23C 5AVBC 5CPKB 3UT9C 4LD9C 5B1LC 1P3GB 5GSUC 1TZYB 3AZHC 3X1VB 5E5AA 1Q9CA 3RELA 3AYWB 3AZNA 1P3AA 3A6ND 2CV5B 3AZFB 1M18D 1U35A 4XUJA 3O62D 1P3MA 1AOIA 2FJ7D 3W99B 2NQBC 2NZDD 3MVDC 4ZUXB 3AZMC 1B6WA 2HIOA 5DNND 3W96C 3MNNB 4YM6A 4ZBJB 3W98B 1HQ3C 1P3KC 3MGRD 5B0ZB 4Z66C 1M19B 4Z2MH 3NQUA 5B0YD 4JJNC 5GT0B 3REHD 3NQJA 4J8WA 3AZKD 3KUYB 5JA4B 3X1UB 3AFAA 3UTAD 3KXBA 3B6GC 1EQZA 5AV6C 3LZ0C 1N1JA 5CPIB 4G91B 1ZLAC 2F8ND 5B2JD 3AZGD 3LELA 3VH6A 5AV5D 3X1TC 5JRGD 5F99B 3REKB 4YS3C 3KWQD 4WU9D 3AV2C 5AY8A 3REJD 3C1CC 1F66B 1P3LC 3B6GD 5AV6D 3AZIB 3VH6W 1P3ID 1BH9B 3KSYA 3W97C 3AV1B 3AZLC 4Z66B 5BS7C 1KX3A 1KX4B 2AROD 4KHAB 4J8UB 3UTBC 4JJNB 1P34B 3C1CD 2PYOC 3A6NA 3B6FD 5DNMC 1A7WA 3MGQB 4CAYB 1M1AC 3WAAC 3WA9D 1M18A 3O62A 2FJ7A 2YFVA 5DNNA 5AVCB 1BH8A 3B0CT 3AZJD 1P3OC 3WTPD 3AZEB 2IO5C 4J8VD 3LZ1B 4KUDC 5AV8C 3MGRA 5B32C 4R8PD 5B0YA 5GXQC 4H9OA 3REHA 5B2IB 5AV9B 4H9QA 1P3BB 1AOID 4XUJD 3UTAA 5B31B 5B32G 3VH5T 1ID3C 4AWLB 4J8XB 3C1BB 2F8NA 4KGCD 4Z5TC 3AZGA 1S32D 3MGPB 5CPKC 5AV5A 4H9PA 5B40B 5JRGA 2RVQC 1P3GC 4CSRB 3X1SD 4WU9A 1KU5A 1TZYC 3REJA 3B0DB 3B6GA 5AV6A 5CP6B 3X1VC 4J8WD 1P3IA 3AYWC 4KUDB 3TU4D 4WZSB 3MGSD 3AZFC 1TZYD 3REID 3C1CA 5E5AB 3B6FA 4ZUXC 3LJAD 3RELB 1P3AB 1WWIA 4WU8D 3MNNC 1KX5D 3WA9A 3WKJD 4NFTA 4ZBJC 1P3PD 3W98C 4DRAA 2CV5D 1U35B 1P3MB 5B24D 4XZQD 5BNXA 5CPJB 3W99D 5B0ZC 1M19C 3AZJA 2HIOB 3WTPA 1WWSA 1KX3D 5GT0C 4YM6B 4J8VA 3KUYC 4M6BA 3X1UC 4H9RA 4X23D 4R8PA 5CPIC 5AVBD 4G92B 1H3OA 4G91C 4H9NA 3UT9D 4LD9D 3NQUB 5B1LD 5GSUD 1P3OA 3AZHD 1HTAA 5F99C 3REKC 5GT3B 3AFAB 3KXBB 3V9RA 5AV8A 1EQZB 4KGCA 1F66C 1P3FB 1S32A 5FUGA 3AZIC 2BYKB 3LELB 3X1SA 3WTPE 3AV1C 2NQBD 1KX4C 5BNVB 3MVDD 5AY8B 4J8UC 3AZMD 3R45A 1P34C 3W96D 3TU4A 3MGQC 3MGSA 1HQ3D 1P3KD 3AV1D 1TZYA 3REIA 4Z66D 5BO0B 3LJAA 2BYMA 4JJND 3A6NB 2CWEA 5AVCC 4WU8A 1KX5A 4QLCB 3AN2C 3WKJA 1P3PA 4HGAB 3AZEC 2CV5A 3LZ0D 1M18B 3LZ1C 3O62B 2NZDB 5B24A 2FJ7B 4XZQA 1ZLAD 3W99A 4DRBA 5KDMA 5DNNB 3X1TD 1BH8B 2HUEB 5B2IC 5AV9C 4YS3D 4H9SA 3AV2D 1P3BC 5B31C 1P3LD 4WNNA 4AWLC 3MGRB 4X23A 3C1BC 5AVBA 4J8XC 3UT9A 4LD9A 1TAFA 5B1LA 5B0YB 5B1MB 5GSUA 3W97D 4H9OB 3MGPC 3REHB 5B31G 5G49B 3AZLD 3AZHA 3AZKB 3B0BA 5B40C 3UTBD 5B33B 3B0DC 2PYOD 3AN2B 5CP6C 5DNMD 5B2JB 2F8NB 2L5AA 3AZGB 5BT1C 5AV5B 1M1AD 4H9PB 3WAAD 3KWQB 4WU9B 2NQBA 3MVDA 3REJB 3AZMA 3W96A 1F66A 5E5AC 1P3OD 3RELC 3AZNC 1P3AC 5C3IC 1HQ3A 4KUDD 5AV8D 1P3KA 3AV1A 2AROB 4Z66A 5B32D 1U35C 1P3MC 5GXQD 4JJNA 5CPJC 3B6FB 2HIOC 1ID3D 4YM6C 4CAYA 3WA9B 3LZ0A 2YFWA 1ZLAA 4Z5TD 5BNXB 4G92C 5CPKD 3X1TA 2JSSA 5CPJD 2RVQD 3B0CW 3WTPB 4YS3A 1P3GD 3AV2A 4J8VB 1P3LA 5GT3C 3AFAC 3KXBC 3AZNB 3VH5A 3X1VD 1EQZC 5C3IB 4H9RB 3AYWD 1P3FC 4R8PB 3W97A 1H3OB 4H9NB 3AZLA 5BS7A 3LELC 1AOIB 4XUJB 5AV9A 4EO5B 3UTBA 3AZFD 3VH5W 1JFIA 2PYOA 3V9RB 5GT3D 5AY8C 4ZUXD 5DNMA 4KGCB 1S32B 5FUGB 1P3FD 1M1AA 3MNND 3WAAA 3W98D 3X1SB 4E45A 5B40A 5B0ZD 1M19D 3NQJB 3R45B 4UUZA 5CP6A 4J8WB 5GT0D 3A6NC 3TU4B 1F1EA 3KUYD 4KUDA 4QLCC 3MGSB 3X1UD 1N1JB 4HGAC 1M18C 5B32A 3O62C 2NZDC 3REIB 2FJ7C 5CPID 5GXQA 3LJAB 2F8NK 2BYMB 4NE5A 5DNNC 1B67A 2HUEC 5F99D 4WU8B 3REKD 1KX5B 1ID3A 3WKJB 1P3PB 4QLCD 1R4VA 1F66D 1BFMA 4Z5TA 5B24B 4XZQB 3MGRC 3VH6T 3AZID 5CPKA 5KDMB 5CPJA 5B0YC 1P3GA 5B1MC 1KX3B 3REHC 3AZKC 1KX4D 3UTAC 4J8UD 3X1VA 4WNNB 4Z2MG 5B33C 1P34D 3AYWA 4X23B 5AVBB 3UT9B 4LD9B 1TAFB 5B2JC 3MGQD 5B1LB 3AZGC 5GSUB 5AV5C 3AZHB 5B1MD 5JRGC 3AZFA 2LY8A 2YFVB 4WV4B 3KWQC 4WU9C 2F8NG 5GT3A 4ZUXA 3REJC 5B33D 5AVCD 1P3FA 2F8NH 3MNNA 3AN2D 1P3IC 3W98A 3AZED 2BYKA 3LZ1D
chains in the Genus database with same CATH superfamily
2NQBB 3MVDB 2AROC 5B0ZA 3AZMB 1M19A 5BNVA 4H9QB 3W96B 5GT0A 3B6FC 5B2ID 5AV9D 3UTAB 3H0MC 3KUYA 1P3BD 5JA4A 3X1UA 1HQ3B 5B31D 3WA9C 1P3KB 4J8XD 3C1BD 5CPIA 5BO0A 5JRGB 3MGPD 3AZJC 2Y2HA 5F99A 5B40D 3REKA 3WTPC 4QLCA 3B6GB 2Y2NA 5AV6B 2YFWB 3H0LC 3LZ0B 4J8VC 1P3IB 5CP6D 1ZLAB 3AZIA 2NZDA 5BT1D 1BH9A 4R8PC 3X1TB 4YS3B 3AV2B 1KX4A 1AOIC 4XUJC 4KHAA 4EO5C 4J8UA 2BG1A 3C1CB 1P3LB 1P34A 5E5AD 4KGCC 3RELD 3MGQA 3AZND 1P3AD 3W97B 1S32C 3AZLB 5B1MA 5G49A 3X1SC 3UTBB 3AZKA 1U35D 1P3MD 4NE3A 1JFIB 4NE6A 3AZJB 2PYOB 5B33A 5DNMB 5AVCA 2W8SA 2HIOD 3AN2A 4J8WC 5B2JA 3TU4C 3AZEA 4YM6D 1M1AB 3WAAB 3LZ1A 3MGSC 3KWQA 3REIC 5CHLB 5B2IA 1P3OB 3LJAC 4UUZB 1Z2CB 1P3BA 2XD5A 2IO5B 4E44A 5B31A 4WU8C 1KX5C 5AV8B 3WKJC 3AFAD 1P3PC 3KXBD 4J8XA 3C1BA 1EQZD 2CV5C 5B32B 2AROA 5B24C 5GXQB 4XZQC 3MGPA 3KFUG 3W99C 3LELD 4CSRA 1KX3C 2Y2JA 1ID3B 4H9SC 3EG5B 5AY8D 1ULYA 4Z5TB 4X23C 2Y2PA 5AVBC 5CPKB 3UT9C 4LD9C 5B1LC 1P3GB 5GSUC 1TZYB 3AZHC 2DF4C 3X1VB 5E5AA 1Q9CA 3RELA 3AYWB 3AZNA 1P3AA 3A6ND 2ZY5A 2CV5B 3AZFB 1M18D 1U35A 4XUJA 3O62D 1P3MA 1AOIA 2FJ7D 3W99B 2NQBC 2NZDD 3MVDC 4ZUXB 3AZMC 1B6WA 2HIOA 5DNND 3W96C 3EPHA 3MNNB 4YM6A 4ZBJB 3W98B 1HQ3C 1P3KC 3MGRD 5B0ZB 4Z66C 1M19B 4Z2MH 3NQUA 5B0YD 4JJNC 5GT0B 3REHD 3NQJA 4J8WA 1W2EA 3AZKD 3KUYB 5JA4B 3X1UB 3AFAA 3EPJA 3KXBA 3UTAD 3B6GC 1EQZA 5AV6C 3LZ0C 1N1JA 2Y2MA 2ZM5A 5CPIB 4G91B 1ZLAC 2F8ND 5B2JD 3AZGD 3LELA 3VH6A 5AV5D 3X1TC 5JRGD 5F99B 3REKB 2ZY3A 4YS3C 2JCHA 4WU9D 3KWQD 3AV2C 5AY8A 3REJD 3C1CC 1F66B 1P3LC 3B6GD 5AV6D 3AZIB 3VH6W 1P3ID 1BH9B 3KSYA 3W97C 3AV1B 3AZLC 4Z66B 5BS7C 1KX3A 1KX4B 2AROD 4KHAB 4J8UB 3UTBC 4JJNB 1P34B 3C1CD 2PYOC 3A6NA 3B6FD 5DNMC 1A7WA 3MGQB 4CAYB 1M1AC 3WAAC 3WA9D 1M18A 3O62A 2FJ7A 2YFVA 2Y2GA 2ZY2A 2JE5A 5DNNA 5AVCB 1BH8A 3B0CT 3AZJD 1P3OC 3WTPD 3AZEB 2IO5C 4J8VD 3LZ1B 4KUDC 5AV8C 3MGRA 5B32C 4R8PD 5B0YA 5GXQC 2UWXA 4H9OA 3REHA 5B2IB 5AV9B 1PZRA 4H9QA 1P3BB 1AOID 4XUJD 3UTAA 5B31B 5B32G 3VH5T 1ID3C 2G5HC 4AWLB 4J8XB 3C1BB 2F8NA 4KGCD 4Z5TC 3AZGA 1S32D 3MGPB 5CPKC 5AV5A 4H9PA 5B40B 5JRGA 2RVQC 1P3GC 4CSRB 3X1SD 4WU9A 1KU5A 1TZYC 3REJA 3B0DB 3B6GA 5AV6A 5CP6B 3X1VC 2VQRA 4J8WD 1P3IA 3AYWC 4KUDB 3TU4D 4WZSB 3MGSD 3AZFC 1TZYD 3REID 3C1CA 5E5AB 3B6FA 4ZUXC 3LJAD 3RELB 1P3AB 3EPLA 1WWIA 3A1IA 3MNNC 4WU8D 1KX5D 3WA9A 3WKJD 4NFTA 4ZBJC 1P3PD 3W98C 4DRAA 2CV5D 1U35B 1P3MB 5B24D 2XD1A 4XZQD 5BNXA 5CPJB 3W99D 5B0ZC 1M19C 3AZJA 2HIOB 3WTPA 1WWSA 1KX3D 5GT0C 4YM6B 4J8VA 3KUYC 4M6BA 3X1UC 2G5IC 4H9RA 4X23D 4R8PA 5AVBD 5CPIC 4G92B 1H3OA 4G91C 4H9NA 3UT9D 4LD9D 3NQUB 5B1LD 5GSUD 2Y2KA 1P3OA 3AZHD 1HTAA 5F99C 3REKC 5GT3B 3A1KA 3AFAB 3KXBB 3V9RA 5AV8A 1EQZB 4KGCA 1F66C 1P3FB 1S32A 5FUGA 3AZIC 2BYKB 3LELB 3X1SA 3WTPE 4UPKA 3AV1C 2NQBD 1KX4C 5BNVB 3MVDD 5AY8B 3FDDA 4J8UC 3AZMD 3R45A 1P34C 2F2AC 3W96D 3IP4C 3TU4A 3MGQC 3MGSA 1HQ3D 1P3KD 3AV1D 1TZYA 3REIA 4Z66D 5BO0B 3LJAA 2BYMA 4JJND 3A6NB 2CWEA 5AVCC 3EPKA 4WU8A 1KX5A 4QLCB 3AN2C 3WKJA 1P3PA 4HGAB 3AZEC 4DQYB 2CV5A 3LZ0D 1M18B 3LZ1C 3O62B 2NZDB 5B24A 2FJ7B 4XZQA 1ZLAD 3F6TA 3W99A 4DRBA 5KDMA 5DNNB 3X1TD 1BH8B 2HUEB 5B2IC 5AV9C 4YS3D 4H9SA 3AV2D 1P3BC 5B31C 1P3LD 4WNNA 4AWLC 3MGRB 4X23A 3C1BC 5AVBA 4J8XC 3UT9A 4LD9A 1TAFA 5B1LA 5B0YB 5B1MB 5GSUA 3W97D 4H9OB 3MGPC 3REHB 5B31G 5G49B 3AZLD 3AZHA 3AZKB 3B0BA 5B40C 3UTBD 5B33B 2Y2QA 3B0DC 2PYOD 3AN2B 5CP6C 5DNMD 5B2JB 2F8NB 2L5AA 3AZGB 5BT1C 2Y2OA 5AV5B 1M1AD 4H9PB 3WAAD 3H0RC 3KWQB 4WU9B 2NQBA 2Y2LA 3MVDA 3REJB 3AZMA 3W96A 1F66A 5E5AC 1P3OD 3RELC 3AZNC 1P3AC 5C3IC 1HQ3A 4KUDD 5AV8D 1P3KA 3AV1A 2AROB 4Z66A 5B32D 1U35C 1P3MC 5GXQD 4JJNA 5CPJC 3B6FB 2HIOC 1ID3D 4YM6C 4CAYA 3WA9B 3LZ0A 2YFWA 1ZLAA 4Z5TD 2ZY4A 5BNXB 4G92C 5CPKD 3X1TA 2JSSA 5CPJD 2RVQD 3B0CW 3WTPB 4YS3A 1P3GD 3AV2A 4J8VB 1P3LA 5GT3C 3AFAC 2FFFB 3KXBC 3AZNB 3VH5A 3X1VD 1EQZC 5C3IB 4H9RB 3AYWD 1P3FC 4R8PB 3W97A 1H3OB 4H9NB 2Y2IA 3AZLA 5BS7A 3LELC 1AOIB 4XUJB 5AV9A 4EO5B 3UTBA 3AZFD 3VH5W 1JFIA 2PYOA 3V9RB 1T3UA 5GT3D 5AY8C 4ZUXD 5DNMA 4KGCB 1S32B 5FUGB 3P5JB 1P3FD 1M1AA 3MNND 3WAAA 3W98D 3X1SB 4E45A 5B40A 5B0ZD 1M19D 3NQJB 3R45B 4UUZA 5CP6A 4J8WB 5GT0D 3A6NC 3TU4B 1F1EA 3KUYD 4KUDA 4QLCC 3MGSB 3X1UD 1N1JB 4HGAC 1M18C 5B32A 3O62C 2NZDC 3REIB 2FJ7C 5CPID 5GXQA 3LJAB 2F8NK 2BYMB 4NE5A 5DNNC 4WJ3C 1B67A 2HUEC 5F99D 4WU8B 3REKD 1KX5B 1ID3A 3WKJB 1P3PB 3AL0C 4QLCD 1R4VA 1F66D 1BFMA 4Z5TA 5B24B 4XZQB 3MGRC 3VH6T 3AZID 5CPKA 2RIQA 5KDMB 5CPJA 5B0YC 1P3GA 5B1MC 1KX3B 3REHC 3AZKC 1KX4D 3UTAC 4J8UD 3X1VA 4WNNB 4Z2MG 5B33C 1P34D 3AYWA 4X23B 5AVBB 3UT9B 4LD9B 1TAFB 5B2JC 3MGQD 5B1LB 3AZGC 5GSUB 5AV5C 3AZHB 5B1MD 5JRGC 3AZFA 2LY8A 2YFVB 4WV4B 3KWQC 4WU9C 2DQNC 2F8NG 5GT3A 4ZUXA 3REJC 5B33D 5AVCD 1P3FA 2J8PA 3MNNA 2F8NH 3AN2D 1P3IC 3W98A 3AZED 2BYKA 3LZ1D
chains in the Genus database with same CATH topology
2NQBB 3MVDB 2AROC 5B0ZA 3AZMB 1M19A 5BNVA 4H9QB 3W96B 5GT0A 3B6FC 5B2ID 5AV9D 3UTAB 3H0MC 3KUYA 1P3BD 5JA4A 3X1UA 1HQ3B 5B31D 3WA9C 1P3KB 4J8XD 3C1BD 5CPIA 5BO0A 5JRGB 3MGPD 3AZJC 2Y2HA 5F99A 5B40D 3REKA 3WTPC 4QLCA 3B6GB 2Y2NA 5AV6B 2YFWB 3H0LC 3LZ0B 4J8VC 1P3IB 5CP6D 1ZLAB 3AZIA 2NZDA 5BT1D 1BH9A 4R8PC 3X1TB 4YS3B 3AV2B 1KX4A 1AOIC 4XUJC 4KHAA 4EO5C 4J8UA 2BG1A 3C1CB 1P3LB 1P34A 5E5AD 4KGCC 3RELD 3MGQA 3AZND 1P3AD 3W97B 1S32C 3AZLB 5B1MA 5G49A 3X1SC 3UTBB 3AZKA 1U35D 1P3MD 4NE3A 1JFIB 4NE6A 3AZJB 2PYOB 5B33A 5DNMB 5AVCA 2W8SA 2HIOD 3AN2A 4J8WC 5B2JA 3TU4C 3AZEA 4YM6D 1M1AB 3WAAB 3LZ1A 3MGSC 3KWQA 3REIC 5CHLB 5B2IA 1P3OB 3LJAC 4UUZB 1Z2CB 1P3BA 2XD5A 2IO5B 4E44A 5B31A 4WU8C 1KX5C 5AV8B 3WKJC 3AFAD 1P3PC 3KXBD 4J8XA 3C1BA 1EQZD 2CV5C 5B32B 2AROA 5B24C 5GXQB 4XZQC 3MGPA 3KFUG 3W99C 3LELD 4CSRA 1KX3C 2Y2JA 1ID3B 4H9SC 3EG5B 5AY8D 1ULYA 4Z5TB 4X23C 2Y2PA 5AVBC 5CPKB 3UT9C 4LD9C 5B1LC 1P3GB 5GSUC 1TZYB 3AZHC 2DF4C 3X1VB 5E5AA 1Q9CA 3RELA 3AYWB 3AZNA 1P3AA 3A6ND 2ZY5A 2CV5B 3AZFB 1M18D 1U35A 4XUJA 3O62D 1P3MA 1AOIA 2FJ7D 3W99B 2NQBC 2NZDD 3MVDC 4ZUXB 3AZMC 1B6WA 2HIOA 5DNND 3W96C 3EPHA 3MNNB 4YM6A 4ZBJB 3W98B 1HQ3C 1P3KC 3MGRD 5B0ZB 4Z66C 1M19B 4Z2MH 3NQUA 5B0YD 4JJNC 5GT0B 3REHD 3NQJA 4J8WA 1W2EA 3AZKD 3KUYB 5JA4B 3X1UB 3AFAA 3EPJA 3KXBA 3UTAD 3B6GC 1EQZA 5AV6C 3LZ0C 1N1JA 2Y2MA 2ZM5A 5CPIB 4G91B 1ZLAC 2F8ND 5B2JD 3AZGD 3LELA 3VH6A 5AV5D 3X1TC 5JRGD 5F99B 3REKB 2ZY3A 4YS3C 2JCHA 4WU9D 3KWQD 3AV2C 5AY8A 3REJD 3C1CC 1F66B 1P3LC 3B6GD 5AV6D 3AZIB 3VH6W 1P3ID 1BH9B 3KSYA 3W97C 3AV1B 3AZLC 4Z66B 5BS7C 1KX3A 1KX4B 2AROD 4KHAB 4J8UB 3UTBC 4JJNB 1P34B 3C1CD 2PYOC 3A6NA 3B6FD 5DNMC 1A7WA 3MGQB 4CAYB 1M1AC 3WAAC 3WA9D 1M18A 3O62A 2FJ7A 2YFVA 2Y2GA 2ZY2A 2JE5A 5DNNA 5AVCB 1BH8A 3B0CT 3AZJD 1P3OC 3WTPD 3AZEB 2IO5C 4J8VD 3LZ1B 4KUDC 5AV8C 3MGRA 5B32C 4R8PD 5B0YA 5GXQC 2UWXA 4H9OA 3REHA 5B2IB 5AV9B 1PZRA 4H9QA 1P3BB 1AOID 4XUJD 3UTAA 5B31B 5B32G 3VH5T 1ID3C 2G5HC 4AWLB 4J8XB 3C1BB 2F8NA 4KGCD 4Z5TC 3AZGA 1S32D 3MGPB 5CPKC 5AV5A 4H9PA 5B40B 5JRGA 2RVQC 1P3GC 4CSRB 3X1SD 4WU9A 1KU5A 1TZYC 3REJA 3B0DB 3B6GA 5AV6A 5CP6B 3X1VC 2VQRA 4J8WD 1P3IA 3AYWC 4KUDB 3TU4D 4WZSB 3MGSD 3AZFC 1TZYD 3REID 3C1CA 5E5AB 3B6FA 4ZUXC 3LJAD 3RELB 1P3AB 3EPLA 1WWIA 3A1IA 3MNNC 4WU8D 1KX5D 3WA9A 3WKJD 4NFTA 4ZBJC 1P3PD 3W98C 4DRAA 2CV5D 1U35B 1P3MB 5B24D 2XD1A 4XZQD 5BNXA 5CPJB 3W99D 5B0ZC 1M19C 3AZJA 2HIOB 3WTPA 1WWSA 1KX3D 5GT0C 4YM6B 4J8VA 3KUYC 4M6BA 3X1UC 2G5IC 4H9RA 4X23D 4R8PA 5AVBD 5CPIC 4G92B 1H3OA 4G91C 4H9NA 3UT9D 4LD9D 3NQUB 5B1LD 5GSUD 2Y2KA 1P3OA 3AZHD 1HTAA 5F99C 3REKC 5GT3B 3A1KA 3AFAB 3KXBB 3V9RA 5AV8A 1EQZB 4KGCA 1F66C 1P3FB 1S32A 5FUGA 3AZIC 2BYKB 3LELB 3X1SA 3WTPE 4UPKA 3AV1C 2NQBD 1KX4C 5BNVB 3MVDD 5AY8B 3FDDA 4J8UC 3AZMD 3R45A 1P34C 2F2AC 3W96D 3IP4C 3TU4A 3MGQC 3MGSA 1HQ3D 1P3KD 3AV1D 1TZYA 3REIA 4Z66D 5BO0B 3LJAA 2BYMA 4JJND 3A6NB 2CWEA 5AVCC 3EPKA 4WU8A 1KX5A 4QLCB 3AN2C 3WKJA 1P3PA 4HGAB 3AZEC 4DQYB 2CV5A 3LZ0D 1M18B 3LZ1C 3O62B 2NZDB 5B24A 2FJ7B 4XZQA 1ZLAD 3F6TA 3W99A 4DRBA 5KDMA 5DNNB 3X1TD 1BH8B 2HUEB 5B2IC 5AV9C 4YS3D 4H9SA 3AV2D 1P3BC 5B31C 1P3LD 4WNNA 4AWLC 3MGRB 4X23A 3C1BC 5AVBA 4J8XC 3UT9A 4LD9A 1TAFA 5B1LA 5B0YB 5B1MB 5GSUA 3W97D 4H9OB 3MGPC 3REHB 5B31G 5G49B 3AZLD 3AZHA 3AZKB 3B0BA 5B40C 3UTBD 5B33B 2Y2QA 3B0DC 2PYOD 3AN2B 5CP6C 5DNMD 5B2JB 2F8NB 2L5AA 3AZGB 5BT1C 2Y2OA 5AV5B 1M1AD 4H9PB 3WAAD 3H0RC 3KWQB 4WU9B 2NQBA 2Y2LA 3MVDA 3REJB 3AZMA 3W96A 1F66A 5E5AC 1P3OD 3RELC 3AZNC 1P3AC 5C3IC 1HQ3A 4KUDD 5AV8D 1P3KA 3AV1A 2AROB 4Z66A 5B32D 1U35C 1P3MC 5GXQD 4JJNA 5CPJC 3B6FB 2HIOC 1ID3D 4YM6C 4CAYA 3WA9B 3LZ0A 2YFWA 1ZLAA 4Z5TD 2ZY4A 5BNXB 4G92C 5CPKD 3X1TA 2JSSA 5CPJD 2RVQD 3B0CW 3WTPB 4YS3A 1P3GD 3AV2A 4J8VB 1P3LA 5GT3C 3AFAC 2FFFB 3KXBC 3AZNB 3VH5A 3X1VD 1EQZC 5C3IB 4H9RB 3AYWD 1P3FC 4R8PB 3W97A 1H3OB 4H9NB 2Y2IA 3AZLA 5BS7A 3LELC 1AOIB 4XUJB 5AV9A 4EO5B 3UTBA 3AZFD 3VH5W 1JFIA 2PYOA 3V9RB 1T3UA 5GT3D 5AY8C 4ZUXD 5DNMA 4KGCB 1S32B 5FUGB 3P5JB 1P3FD 1M1AA 3MNND 3WAAA 3W98D 3X1SB 4E45A 5B40A 5B0ZD 1M19D 3NQJB 3R45B 4UUZA 5CP6A 4J8WB 5GT0D 3A6NC 3TU4B 1F1EA 3KUYD 4KUDA 4QLCC 3MGSB 3X1UD 1N1JB 4HGAC 1M18C 5B32A 3O62C 2NZDC 3REIB 2FJ7C 5CPID 5GXQA 3LJAB 2F8NK 2BYMB 4NE5A 5DNNC 4WJ3C 1B67A 2HUEC 5F99D 4WU8B 3REKD 1KX5B 1ID3A 3WKJB 1P3PB 3AL0C 4QLCD 1R4VA 1F66D 1BFMA 4Z5TA 5B24B 4XZQB 3MGRC 3VH6T 3AZID 5CPKA 2RIQA 5KDMB 5CPJA 5B0YC 1P3GA 5B1MC 1KX3B 3REHC 3AZKC 1KX4D 3UTAC 4J8UD 3X1VA 4WNNB 4Z2MG 5B33C 1P34D 3AYWA 4X23B 5AVBB 3UT9B 4LD9B 1TAFB 5B2JC 3MGQD 5B1LB 3AZGC 5GSUB 5AV5C 3AZHB 5B1MD 5JRGC 3AZFA 2LY8A 2YFVB 4WV4B 3KWQC 4WU9C 2DQNC 2F8NG 5GT3A 4ZUXA 3REJC 5B33D 5AVCD 1P3FA 2J8PA 3MNNA 2F8NH 3AN2D 1P3IC 3W98A 3AZED 2BYKA 3LZ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB B;  3MVD B;  2ARO C;  5B0Z A;  3AZM B;  1M19 A;  5BNV A;  4H9Q B;  3W96 B;  5GT0 A;  3B6F C;  5B2I D;  5AV9 D;  3UTA B;  3KUY A;  1P3B D;  5JA4 A;  3X1U A;  1HQ3 B;  5B31 D;  3WA9 C;  1P3K B;  4J8X D;  3C1B D;  5CPI A;  5BO0 A;  5JRG B;  3MGP D;  3AZJ C;  5B40 D;  5F99 A;  3REK A;  3WTP C;  4QLC A;  3B6G B;  5AV6 B;  2YFW B;  3LZ0 B;  4J8V C;  1P3I B;  5CP6 D;  1ZLA B;  3AZI A;  2NZD A;  5BT1 D;  1BH9 A;  4R8P C;  3X1T B;  4YS3 B;  3AV2 B;  1KX4 A;  1AOI C;  4XUJ C;  4KHA A;  4EO5 C;  4J8U A;  3C1C B;  1P3L B;  1P34 A;  5E5A D;  4KGC C;  3REL D;  3MGQ A;  3AZN D;  1P3A D;  3W97 B;  1S32 C;  3AZL B;  5B1M A;  5G49 A;  3X1S C;  3UTB B;  3AZK A;  1U35 D;  1P3M D;  4NE3 A;  1JFI B;  4NE6 A;  3AZJ B;  2PYO B;  5B33 A;  5DNM B;  5AVC A;  2HIO D;  3AN2 A;  4J8W C;  5B2J A;  3TU4 C;  3AZE A;  4YM6 D;  1M1A B;  3WAA B;  3LZ1 A;  3MGS C;  3KWQ A;  3REI C;  5CHL B;  5B2I A;  1P3O B;  3LJA C;  4UUZ B;  1P3B A;  2IO5 B;  4E44 A;  5B31 A;  4WU8 C;  1KX5 C;  5AV8 B;  3WKJ C;  3AFA D;  1P3P C;  3KXB D;  4J8X A;  3C1B A;  1EQZ D;  2CV5 C;  5B32 B;  2ARO A;  5B24 C;  5GXQ B;  4XZQ C;  3MGP A;  3W99 C;  3LEL D;  4CSR A;  1KX3 C;  1ID3 B;  4H9S C;  5AY8 D;  1ULY A;  4Z5T B;  4X23 C;  5AVB C;  5CPK B;  3UT9 C;  4LD9 C;  5B1L C;  1P3G B;  5GSU C;  1TZY B;  3AZH C;  3X1V B;  5E5A A;  1Q9C A;  3REL A;  3AYW B;  3AZN A;  1P3A A;  3A6N D;  2CV5 B;  3AZF B;  1M18 D;  1U35 A;  4XUJ A;  3O62 D;  1P3M A;  1AOI A;  2FJ7 D;  3W99 B;  2NQB C;  2NZD D;  3MVD C;  4ZUX B;  3AZM C;  1B6W A;  2HIO A;  5DNN D;  3W96 C;  3MNN B;  4YM6 A;  4ZBJ B;  3W98 B;  1HQ3 C;  1P3K C;  3MGR D;  5B0Z B;  4Z66 C;  1M19 B;  4Z2M H;  3NQU A;  5B0Y D;  4JJN C;  5GT0 B;  3REH D;  3NQJ A;  4J8W A;  3AZK D;  3KUY B;  5JA4 B;  3X1U B;  3AFA A;  3UTA D;  3KXB A;  3B6G C;  1EQZ A;  5AV6 C;  3LZ0 C;  1N1J A;  5CPI B;  4G91 B;  1ZLA C;  2F8N D;  5B2J D;  3AZG D;  3LEL A;  3VH6 A;  5AV5 D;  3X1T C;  5JRG D;  5F99 B;  3REK B;  4YS3 C;  3KWQ D;  4WU9 D;  3AV2 C;  5AY8 A;  3REJ D;  3C1C C;  1F66 B;  1P3L C;  3B6G D;  5AV6 D;  3AZI B;  3VH6 W;  1P3I D;  1BH9 B;  3KSY A;  3W97 C;  3AV1 B;  3AZL C;  4Z66 B;  5BS7 C;  1KX3 A;  1KX4 B;  2ARO D;  4KHA B;  4J8U B;  3UTB C;  4JJN B;  1P34 B;  3C1C D;  2PYO C;  3A6N A;  3B6F D;  5DNM C;  1A7W A;  3MGQ B;  4CAY B;  1M1A C;  3WAA C;  3WA9 D;  1M18 A;  3O62 A;  2FJ7 A;  2YFV A;  5DNN A;  5AVC B;  1BH8 A;  3B0C T;  3AZJ D;  1P3O C;  3WTP D;  3AZE B;  2IO5 C;  4J8V D;  3LZ1 B;  4KUD C;  5AV8 C;  3MGR A;  5B32 C;  4R8P D;  5B0Y A;  5GXQ C;  4H9O A;  3REH A;  5B2I B;  5AV9 B;  4H9Q A;  1P3B B;  1AOI D;  4XUJ D;  3UTA A;  5B31 B;  5B32 G;  3VH5 T;  1ID3 C;  4AWL B;  4J8X B;  3C1B B;  2F8N A;  4KGC D;  4Z5T C;  3AZG A;  1S32 D;  3MGP B;  5CPK C;  5AV5 A;  4H9P A;  5B40 B;  5JRG A;  2RVQ C;  1P3G C;  4CSR B;  3X1S D;  4WU9 A;  1KU5 A;  1TZY C;  3REJ A;  3B0D B;  3B6G A;  5AV6 A;  5CP6 B;  3X1V C;  4J8W D;  1P3I A;  3AYW C;  4KUD B;  3TU4 D;  4WZS B;  3MGS D;  3AZF C;  1TZY D;  3REI D;  3C1C A;  5E5A B;  3B6F A;  4ZUX C;  3LJA D;  3REL B;  1P3A B;  1WWI A;  4WU8 D;  3MNN C;  1KX5 D;  3WA9 A;  3WKJ D;  4NFT A;  4ZBJ C;  1P3P D;  3W98 C;  4DRA A;  2CV5 D;  1U35 B;  1P3M B;  5B24 D;  4XZQ D;  5BNX A;  5CPJ B;  3W99 D;  5B0Z C;  1M19 C;  3AZJ A;  2HIO B;  3WTP A;  1WWS A;  1KX3 D;  5GT0 C;  4YM6 B;  4J8V A;  3KUY C;  4M6B A;  3X1U C;  4H9R A;  4X23 D;  4R8P A;  5CPI C;  5AVB D;  4G92 B;  1H3O A;  4G91 C;  4H9N A;  3UT9 D;  4LD9 D;  3NQU B;  5B1L D;  5GSU D;  1P3O A;  3AZH D;  1HTA A;  5F99 C;  3REK C;  5GT3 B;  3AFA B;  3KXB B;  3V9R A;  5AV8 A;  1EQZ B;  4KGC A;  1F66 C;  1P3F B;  1S32 A;  5FUG A;  3AZI C;  2BYK B;  3LEL B;  3X1S A;  3WTP E;  3AV1 C;  2NQB D;  1KX4 C;  5BNV B;  3MVD D;  5AY8 B;  4J8U C;  3AZM D;  3R45 A;  1P34 C;  3W96 D;  3TU4 A;  3MGQ C;  3MGS A;  1HQ3 D;  1P3K D;  3AV1 D;  1TZY A;  3REI A;  4Z66 D;  5BO0 B;  3LJA A;  2BYM A;  4JJN D;  3A6N B;  2CWE A;  5AVC C;  4WU8 A;  1KX5 A;  4QLC B;  3AN2 C;  3WKJ A;  1P3P A;  4HGA B;  3AZE C;  2CV5 A;  3LZ0 D;  1M18 B;  3LZ1 C;  3O62 B;  2NZD B;  5B24 A;  2FJ7 B;  4XZQ A;  1ZLA D;  3W99 A;  4DRB A;  5KDM A;  5DNN B;  3X1T D;  1BH8 B;  2HUE B;  5B2I C;  5AV9 C;  4YS3 D;  4H9S A;  3AV2 D;  1P3B C;  5B31 C;  1P3L D;  4WNN A;  4AWL C;  3MGR B;  4X23 A;  3C1B C;  5AVB A;  4J8X C;  3UT9 A;  4LD9 A;  1TAF A;  5B1L A;  5B0Y B;  5B1M B;  5GSU A;  3W97 D;  4H9O B;  3MGP C;  3REH B;  5B31 G;  5G49 B;  3AZL D;  3AZH A;  3AZK B;  3B0B A;  5B40 C;  3UTB D;  5B33 B;  3B0D C;  2PYO D;  3AN2 B;  5CP6 C;  5DNM D;  5B2J B;  2F8N B;  2L5A A;  3AZG B;  5BT1 C;  5AV5 B;  1M1A D;  4H9P B;  3WAA D;  3KWQ B;  4WU9 B;  2NQB A;  3MVD A;  3REJ B;  3AZM A;  3W96 A;  1F66 A;  5E5A C;  1P3O D;  3REL C;  3AZN C;  1P3A C;  5C3I C;  1HQ3 A;  4KUD D;  5AV8 D;  1P3K A;  3AV1 A;  2ARO B;  4Z66 A;  5B32 D;  1U35 C;  1P3M C;  5GXQ D;  4JJN A;  5CPJ C;  3B6F B;  2HIO C;  1ID3 D;  4YM6 C;  4CAY A;  3WA9 B;  3LZ0 A;  2YFW A;  1ZLA A;  4Z5T D;  5BNX B;  4G92 C;  5CPK D;  3X1T A;  2JSS A;  5CPJ D;  2RVQ D;  3B0C W;  3WTP B;  4YS3 A;  1P3G D;  3AV2 A;  4J8V B;  1P3L A;  5GT3 C;  3AFA C;  3KXB C;  3AZN B;  3VH5 A;  3X1V D;  1EQZ C;  5C3I B;  4H9R B;  3AYW D;  1P3F C;  4R8P B;  3W97 A;  1H3O B;  4H9N B;  3AZL A;  5BS7 A;  3LEL C;  1AOI B;  4XUJ B;  5AV9 A;  4EO5 B;  3UTB A;  3AZF D;  3VH5 W;  1JFI A;  2PYO A;  3V9R B;  5GT3 D;  5AY8 C;  4ZUX D;  5DNM A;  4KGC B;  1S32 B;  5FUG B;  1P3F D;  1M1A A;  3MNN D;  3WAA A;  3W98 D;  3X1S B;  4E45 A;  5B40 A;  5B0Z D;  1M19 D;  3NQJ B;  3R45 B;  4UUZ A;  5CP6 A;  4J8W B;  5GT0 D;  3A6N C;  3TU4 B;  1F1E A;  3KUY D;  4KUD A;  4QLC C;  3MGS B;  3X1U D;  1N1J B;  4HGA C;  1M18 C;  5B32 A;  3O62 C;  2NZD C;  3REI B;  2FJ7 C;  5CPI D;  5GXQ A;  3LJA B;  2F8N K;  2BYM B;  4NE5 A;  5DNN C;  1B67 A;  2HUE C;  5F99 D;  4WU8 B;  3REK D;  1KX5 B;  1ID3 A;  3WKJ B;  1P3P B;  4QLC D;  1R4V A;  1F66 D;  1BFM A;  4Z5T A;  5B24 B;  4XZQ B;  3MGR C;  3VH6 T;  3AZI D;  5CPK A;  5KDM B;  5CPJ A;  5B0Y C;  1P3G A;  5B1M C;  1KX3 B;  3REH C;  3AZK C;  1KX4 D;  3UTA C;  4J8U D;  3X1V A;  4WNN B;  4Z2M G;  5B33 C;  1P34 D;  3AYW A;  4X23 B;  5AVB B;  3UT9 B;  4LD9 B;  1TAF B;  5B2J C;  3MGQ D;  5B1L B;  3AZG C;  5GSU B;  5AV5 C;  3AZH B;  5B1M D;  5JRG C;  3AZF A;  2LY8 A;  2YFV B;  4WV4 B;  3KWQ C;  4WU9 C;  2F8N G;  5GT3 A;  4ZUX A;  3REJ C;  5B33 D;  5AVC D;  1P3F A;  2F8N H;  3MNN A;  3AN2 D;  1P3I C;  3W98 A;  3AZE D;  2BYK A;  3LZ1 D; 
#chains in the Genus database with same CATH topology
 2NQB B;  3MVD B;  2ARO C;  5B0Z A;  3AZM B;  1M19 A;  5BNV A;  4H9Q B;  3W96 B;  5GT0 A;  3B6F C;  5B2I D;  5AV9 D;  3UTA B;  3H0M C;  3KUY A;  1P3B D;  5JA4 A;  3X1U A;  1HQ3 B;  5B31 D;  3WA9 C;  1P3K B;  4J8X D;  3C1B D;  5CPI A;  5BO0 A;  5JRG B;  3MGP D;  3AZJ C;  2Y2H A;  5F99 A;  5B40 D;  3REK A;  3WTP C;  4QLC A;  3B6G B;  2Y2N A;  5AV6 B;  2YFW B;  3H0L C;  3LZ0 B;  4J8V C;  1P3I B;  5CP6 D;  1ZLA B;  3AZI A;  2NZD A;  5BT1 D;  1BH9 A;  4R8P C;  3X1T B;  4YS3 B;  3AV2 B;  1KX4 A;  1AOI C;  4XUJ C;  4KHA A;  4EO5 C;  4J8U A;  2BG1 A;  3C1C B;  1P3L B;  1P34 A;  5E5A D;  4KGC C;  3REL D;  3MGQ A;  3AZN D;  1P3A D;  3W97 B;  1S32 C;  3AZL B;  5B1M A;  5G49 A;  3X1S C;  3UTB B;  3AZK A;  1U35 D;  1P3M D;  4NE3 A;  1JFI B;  4NE6 A;  3AZJ B;  2PYO B;  5B33 A;  5DNM B;  5AVC A;  2W8S A;  2HIO D;  3AN2 A;  4J8W C;  5B2J A;  3TU4 C;  3AZE A;  4YM6 D;  1M1A B;  3WAA B;  3LZ1 A;  3MGS C;  3KWQ A;  3REI C;  5CHL B;  5B2I A;  1P3O B;  3LJA C;  4UUZ B;  1Z2C B;  1P3B A;  2XD5 A;  2IO5 B;  4E44 A;  5B31 A;  4WU8 C;  1KX5 C;  5AV8 B;  3WKJ C;  3AFA D;  1P3P C;  3KXB D;  4J8X A;  3C1B A;  1EQZ D;  2CV5 C;  5B32 B;  2ARO A;  5B24 C;  5GXQ B;  4XZQ C;  3MGP A;  3KFU G;  3W99 C;  3LEL D;  4CSR A;  1KX3 C;  2Y2J A;  1ID3 B;  4H9S C;  3EG5 B;  5AY8 D;  1ULY A;  4Z5T B;  4X23 C;  2Y2P A;  5AVB C;  5CPK B;  3UT9 C;  4LD9 C;  5B1L C;  1P3G B;  5GSU C;  1TZY B;  3AZH C;  2DF4 C;  3X1V B;  5E5A A;  1Q9C A;  3REL A;  3AYW B;  3AZN A;  1P3A A;  3A6N D;  2ZY5 A;  2CV5 B;  3AZF B;  1M18 D;  1U35 A;  4XUJ A;  3O62 D;  1P3M A;  1AOI A;  2FJ7 D;  3W99 B;  2NQB C;  2NZD D;  3MVD C;  4ZUX B;  3AZM C;  1B6W A;  2HIO A;  5DNN D;  3W96 C;  3EPH A;  3MNN B;  4YM6 A;  4ZBJ B;  3W98 B;  1HQ3 C;  1P3K C;  3MGR D;  5B0Z B;  4Z66 C;  1M19 B;  4Z2M H;  3NQU A;  5B0Y D;  4JJN C;  5GT0 B;  3REH D;  3NQJ A;  4J8W A;  1W2E A;  3AZK D;  3KUY B;  5JA4 B;  3X1U B;  3AFA A;  3EPJ A;  3KXB A;  3UTA D;  3B6G C;  1EQZ A;  5AV6 C;  3LZ0 C;  1N1J A;  2Y2M A;  2ZM5 A;  5CPI B;  4G91 B;  1ZLA C;  2F8N D;  5B2J D;  3AZG D;  3LEL A;  3VH6 A;  5AV5 D;  3X1T C;  5JRG D;  5F99 B;  3REK B;  2ZY3 A;  4YS3 C;  2JCH A;  4WU9 D;  3KWQ D;  3AV2 C;  5AY8 A;  3REJ D;  3C1C C;  1F66 B;  1P3L C;  3B6G D;  5AV6 D;  3AZI B;  3VH6 W;  1P3I D;  1BH9 B;  3KSY A;  3W97 C;  3AV1 B;  3AZL C;  4Z66 B;  5BS7 C;  1KX3 A;  1KX4 B;  2ARO D;  4KHA B;  4J8U B;  3UTB C;  4JJN B;  1P34 B;  3C1C D;  2PYO C;  3A6N A;  3B6F D;  5DNM C;  1A7W A;  3MGQ B;  4CAY B;  1M1A C;  3WAA C;  3WA9 D;  1M18 A;  3O62 A;  2FJ7 A;  2YFV A;  2Y2G A;  2ZY2 A;  2JE5 A;  5DNN A;  5AVC B;  1BH8 A;  3B0C T;  3AZJ D;  1P3O C;  3WTP D;  3AZE B;  2IO5 C;  4J8V D;  3LZ1 B;  4KUD C;  5AV8 C;  3MGR A;  5B32 C;  4R8P D;  5B0Y A;  5GXQ C;  2UWX A;  4H9O A;  3REH A;  5B2I B;  5AV9 B;  1PZR A;  4H9Q A;  1P3B B;  1AOI D;  4XUJ D;  3UTA A;  5B31 B;  5B32 G;  3VH5 T;  1ID3 C;  2G5H C;  4AWL B;  4J8X B;  3C1B B;  2F8N A;  4KGC D;  4Z5T C;  3AZG A;  1S32 D;  3MGP B;  5CPK C;  5AV5 A;  4H9P A;  5B40 B;  5JRG A;  2RVQ C;  1P3G C;  4CSR B;  3X1S D;  4WU9 A;  1KU5 A;  1TZY C;  3REJ A;  3B0D B;  3B6G A;  5AV6 A;  5CP6 B;  3X1V C;  2VQR A;  4J8W D;  1P3I A;  3AYW C;  4KUD B;  3TU4 D;  4WZS B;  3MGS D;  3AZF C;  1TZY D;  3REI D;  3C1C A;  5E5A B;  3B6F A;  4ZUX C;  3LJA D;  3REL B;  1P3A B;  3EPL A;  1WWI A;  3A1I A;  3MNN C;  4WU8 D;  1KX5 D;  3WA9 A;  3WKJ D;  4NFT A;  4ZBJ C;  1P3P D;  3W98 C;  4DRA A;  2CV5 D;  1U35 B;  1P3M B;  5B24 D;  2XD1 A;  4XZQ D;  5BNX A;  5CPJ B;  3W99 D;  5B0Z C;  1M19 C;  3AZJ A;  2HIO B;  3WTP A;  1WWS A;  1KX3 D;  5GT0 C;  4YM6 B;  4J8V A;  3KUY C;  4M6B A;  3X1U C;  2G5I C;  4H9R A;  4X23 D;  4R8P A;  5AVB D;  5CPI C;  4G92 B;  1H3O A;  4G91 C;  4H9N A;  3UT9 D;  4LD9 D;  3NQU B;  5B1L D;  5GSU D;  2Y2K A;  1P3O A;  3AZH D;  1HTA A;  5F99 C;  3REK C;  5GT3 B;  3A1K A;  3AFA B;  3KXB B;  3V9R A;  5AV8 A;  1EQZ B;  4KGC A;  1F66 C;  1P3F B;  1S32 A;  5FUG A;  3AZI C;  2BYK B;  3LEL B;  3X1S A;  3WTP E;  4UPK A;  3AV1 C;  2NQB D;  1KX4 C;  5BNV B;  3MVD D;  5AY8 B;  3FDD A;  4J8U C;  3AZM D;  3R45 A;  1P34 C;  2F2A C;  3W96 D;  3IP4 C;  3TU4 A;  3MGQ C;  3MGS A;  1HQ3 D;  1P3K D;  3AV1 D;  1TZY A;  3REI A;  4Z66 D;  5BO0 B;  3LJA A;  2BYM A;  4JJN D;  3A6N B;  2CWE A;  5AVC C;  3EPK A;  4WU8 A;  1KX5 A;  4QLC B;  3AN2 C;  3WKJ A;  1P3P A;  4HGA B;  3AZE C;  4DQY B;  2CV5 A;  3LZ0 D;  1M18 B;  3LZ1 C;  3O62 B;  2NZD B;  5B24 A;  2FJ7 B;  4XZQ A;  1ZLA D;  3F6T A;  3W99 A;  4DRB A;  5KDM A;  5DNN B;  3X1T D;  1BH8 B;  2HUE B;  5B2I C;  5AV9 C;  4YS3 D;  4H9S A;  3AV2 D;  1P3B C;  5B31 C;  1P3L D;  4WNN A;  4AWL C;  3MGR B;  4X23 A;  3C1B C;  5AVB A;  4J8X C;  3UT9 A;  4LD9 A;  1TAF A;  5B1L A;  5B0Y B;  5B1M B;  5GSU A;  3W97 D;  4H9O B;  3MGP C;  3REH B;  5B31 G;  5G49 B;  3AZL D;  3AZH A;  3AZK B;  3B0B A;  5B40 C;  3UTB D;  5B33 B;  2Y2Q A;  3B0D C;  2PYO D;  3AN2 B;  5CP6 C;  5DNM D;  5B2J B;  2F8N B;  2L5A A;  3AZG B;  5BT1 C;  2Y2O A;  5AV5 B;  1M1A D;  4H9P B;  3WAA D;  3H0R C;  3KWQ B;  4WU9 B;  2NQB A;  2Y2L A;  3MVD A;  3REJ B;  3AZM A;  3W96 A;  1F66 A;  5E5A C;  1P3O D;  3REL C;  3AZN C;  1P3A C;  5C3I C;  1HQ3 A;  4KUD D;  5AV8 D;  1P3K A;  3AV1 A;  2ARO B;  4Z66 A;  5B32 D;  1U35 C;  1P3M C;  5GXQ D;  4JJN A;  5CPJ C;  3B6F B;  2HIO C;  1ID3 D;  4YM6 C;  4CAY A;  3WA9 B;  3LZ0 A;  2YFW A;  1ZLA A;  4Z5T D;  2ZY4 A;  5BNX B;  4G92 C;  5CPK D;  3X1T A;  2JSS A;  5CPJ D;  2RVQ D;  3B0C W;  3WTP B;  4YS3 A;  1P3G D;  3AV2 A;  4J8V B;  1P3L A;  5GT3 C;  3AFA C;  2FFF B;  3KXB C;  3AZN B;  3VH5 A;  3X1V D;  1EQZ C;  5C3I B;  4H9R B;  3AYW D;  1P3F C;  4R8P B;  3W97 A;  1H3O B;  4H9N B;  2Y2I A;  3AZL A;  5BS7 A;  3LEL C;  1AOI B;  4XUJ B;  5AV9 A;  4EO5 B;  3UTB A;  3AZF D;  3VH5 W;  1JFI A;  2PYO A;  3V9R B;  1T3U A;  5GT3 D;  5AY8 C;  4ZUX D;  5DNM A;  4KGC B;  1S32 B;  5FUG B;  3P5J B;  1P3F D;  1M1A A;  3MNN D;  3WAA A;  3W98 D;  3X1S B;  4E45 A;  5B40 A;  5B0Z D;  1M19 D;  3NQJ B;  3R45 B;  4UUZ A;  5CP6 A;  4J8W B;  5GT0 D;  3A6N C;  3TU4 B;  1F1E A;  3KUY D;  4KUD A;  4QLC C;  3MGS B;  3X1U D;  1N1J B;  4HGA C;  1M18 C;  5B32 A;  3O62 C;  2NZD C;  3REI B;  2FJ7 C;  5CPI D;  5GXQ A;  3LJA B;  2F8N K;  2BYM B;  4NE5 A;  5DNN C;  4WJ3 C;  1B67 A;  2HUE C;  5F99 D;  4WU8 B;  3REK D;  1KX5 B;  1ID3 A;  3WKJ B;  1P3P B;  3AL0 C;  4QLC D;  1R4V A;  1F66 D;  1BFM A;  4Z5T A;  5B24 B;  4XZQ B;  3MGR C;  3VH6 T;  3AZI D;  5CPK A;  2RIQ A;  5KDM B;  5CPJ A;  5B0Y C;  1P3G A;  5B1M C;  1KX3 B;  3REH C;  3AZK C;  1KX4 D;  3UTA C;  4J8U D;  3X1V A;  4WNN B;  4Z2M G;  5B33 C;  1P34 D;  3AYW A;  4X23 B;  5AVB B;  3UT9 B;  4LD9 B;  1TAF B;  5B2J C;  3MGQ D;  5B1L B;  3AZG C;  5GSU B;  5AV5 C;  3AZH B;  5B1M D;  5JRG C;  3AZF A;  2LY8 A;  2YFV B;  4WV4 B;  3KWQ C;  4WU9 C;  2DQN C;  2F8N G;  5GT3 A;  4ZUX A;  3REJ C;  5B33 D;  5AVC D;  1P3F A;  2J8P A;  3MNN A;  2F8N H;  3AN2 D;  1P3I C;  3W98 A;  3AZE D;  2BYK A;  3LZ1 D; 
#chains in the Genus database with same CATH homology
 2NQB B;  3MVD B;  2ARO C;  5B0Z A;  3AZM B;  1M19 A;  5BNV A;  4H9Q B;  3W96 B;  5GT0 A;  3B6F C;  5B2I D;  5AV9 D;  3UTA B;  3H0M C;  3KUY A;  1P3B D;  5JA4 A;  3X1U A;  1HQ3 B;  5B31 D;  3WA9 C;  1P3K B;  4J8X D;  3C1B D;  5CPI A;  5BO0 A;  5JRG B;  3MGP D;  3AZJ C;  2Y2H A;  5F99 A;  5B40 D;  3REK A;  3WTP C;  4QLC A;  3B6G B;  2Y2N A;  5AV6 B;  2YFW B;  3H0L C;  3LZ0 B;  4J8V C;  1P3I B;  5CP6 D;  1ZLA B;  3AZI A;  2NZD A;  5BT1 D;  1BH9 A;  4R8P C;  3X1T B;  4YS3 B;  3AV2 B;  1KX4 A;  1AOI C;  4XUJ C;  4KHA A;  4EO5 C;  4J8U A;  2BG1 A;  3C1C B;  1P3L B;  1P34 A;  5E5A D;  4KGC C;  3REL D;  3MGQ A;  3AZN D;  1P3A D;  3W97 B;  1S32 C;  3AZL B;  5B1M A;  5G49 A;  3X1S C;  3UTB B;  3AZK A;  1U35 D;  1P3M D;  4NE3 A;  1JFI B;  4NE6 A;  3AZJ B;  2PYO B;  5B33 A;  5DNM B;  5AVC A;  2W8S A;  2HIO D;  3AN2 A;  4J8W C;  5B2J A;  3TU4 C;  3AZE A;  4YM6 D;  1M1A B;  3WAA B;  3LZ1 A;  3MGS C;  3KWQ A;  3REI C;  5CHL B;  5B2I A;  1P3O B;  3LJA C;  4UUZ B;  1Z2C B;  1P3B A;  2XD5 A;  2IO5 B;  4E44 A;  5B31 A;  4WU8 C;  1KX5 C;  5AV8 B;  3WKJ C;  3AFA D;  1P3P C;  3KXB D;  4J8X A;  3C1B A;  1EQZ D;  2CV5 C;  5B32 B;  2ARO A;  5B24 C;  5GXQ B;  4XZQ C;  3MGP A;  3KFU G;  3W99 C;  3LEL D;  4CSR A;  1KX3 C;  2Y2J A;  1ID3 B;  4H9S C;  3EG5 B;  5AY8 D;  1ULY A;  4Z5T B;  4X23 C;  2Y2P A;  5AVB C;  5CPK B;  3UT9 C;  4LD9 C;  5B1L C;  1P3G B;  5GSU C;  1TZY B;  3AZH C;  2DF4 C;  3X1V B;  5E5A A;  1Q9C A;  3REL A;  3AYW B;  3AZN A;  1P3A A;  3A6N D;  2ZY5 A;  2CV5 B;  3AZF B;  1M18 D;  1U35 A;  4XUJ A;  3O62 D;  1P3M A;  1AOI A;  2FJ7 D;  3W99 B;  2NQB C;  2NZD D;  3MVD C;  4ZUX B;  3AZM C;  1B6W A;  2HIO A;  5DNN D;  3W96 C;  3EPH A;  3MNN B;  4YM6 A;  4ZBJ B;  3W98 B;  1HQ3 C;  1P3K C;  3MGR D;  5B0Z B;  4Z66 C;  1M19 B;  4Z2M H;  3NQU A;  5B0Y D;  4JJN C;  5GT0 B;  3REH D;  3NQJ A;  4J8W A;  1W2E A;  3AZK D;  3KUY B;  5JA4 B;  3X1U B;  3AFA A;  3EPJ A;  3KXB A;  3UTA D;  3B6G C;  1EQZ A;  5AV6 C;  3LZ0 C;  1N1J A;  2Y2M A;  2ZM5 A;  5CPI B;  4G91 B;  1ZLA C;  2F8N D;  5B2J D;  3AZG D;  3LEL A;  3VH6 A;  5AV5 D;  3X1T C;  5JRG D;  5F99 B;  3REK B;  2ZY3 A;  4YS3 C;  2JCH A;  4WU9 D;  3KWQ D;  3AV2 C;  5AY8 A;  3REJ D;  3C1C C;  1F66 B;  1P3L C;  3B6G D;  5AV6 D;  3AZI B;  3VH6 W;  1P3I D;  1BH9 B;  3KSY A;  3W97 C;  3AV1 B;  3AZL C;  4Z66 B;  5BS7 C;  1KX3 A;  1KX4 B;  2ARO D;  4KHA B;  4J8U B;  3UTB C;  4JJN B;  1P34 B;  3C1C D;  2PYO C;  3A6N A;  3B6F D;  5DNM C;  1A7W A;  3MGQ B;  4CAY B;  1M1A C;  3WAA C;  3WA9 D;  1M18 A;  3O62 A;  2FJ7 A;  2YFV A;  2Y2G A;  2ZY2 A;  2JE5 A;  5DNN A;  5AVC B;  1BH8 A;  3B0C T;  3AZJ D;  1P3O C;  3WTP D;  3AZE B;  2IO5 C;  4J8V D;  3LZ1 B;  4KUD C;  5AV8 C;  3MGR A;  5B32 C;  4R8P D;  5B0Y A;  5GXQ C;  2UWX A;  4H9O A;  3REH A;  5B2I B;  5AV9 B;  1PZR A;  4H9Q A;  1P3B B;  1AOI D;  4XUJ D;  3UTA A;  5B31 B;  5B32 G;  3VH5 T;  1ID3 C;  2G5H C;  4AWL B;  4J8X B;  3C1B B;  2F8N A;  4KGC D;  4Z5T C;  3AZG A;  1S32 D;  3MGP B;  5CPK C;  5AV5 A;  4H9P A;  5B40 B;  5JRG A;  2RVQ C;  1P3G C;  4CSR B;  3X1S D;  4WU9 A;  1KU5 A;  1TZY C;  3REJ A;  3B0D B;  3B6G A;  5AV6 A;  5CP6 B;  3X1V C;  2VQR A;  4J8W D;  1P3I A;  3AYW C;  4KUD B;  3TU4 D;  4WZS B;  3MGS D;  3AZF C;  1TZY D;  3REI D;  3C1C A;  5E5A B;  3B6F A;  4ZUX C;  3LJA D;  3REL B;  1P3A B;  3EPL A;  1WWI A;  3A1I A;  3MNN C;  4WU8 D;  1KX5 D;  3WA9 A;  3WKJ D;  4NFT A;  4ZBJ C;  1P3P D;  3W98 C;  4DRA A;  2CV5 D;  1U35 B;  1P3M B;  5B24 D;  2XD1 A;  4XZQ D;  5BNX A;  5CPJ B;  3W99 D;  5B0Z C;  1M19 C;  3AZJ A;  2HIO B;  3WTP A;  1WWS A;  1KX3 D;  5GT0 C;  4YM6 B;  4J8V A;  3KUY C;  4M6B A;  3X1U C;  2G5I C;  4H9R A;  4X23 D;  4R8P A;  5AVB D;  5CPI C;  4G92 B;  1H3O A;  4G91 C;  4H9N A;  3UT9 D;  4LD9 D;  3NQU B;  5B1L D;  5GSU D;  2Y2K A;  1P3O A;  3AZH D;  1HTA A;  5F99 C;  3REK C;  5GT3 B;  3A1K A;  3AFA B;  3KXB B;  3V9R A;  5AV8 A;  1EQZ B;  4KGC A;  1F66 C;  1P3F B;  1S32 A;  5FUG A;  3AZI C;  2BYK B;  3LEL B;  3X1S A;  3WTP E;  4UPK A;  3AV1 C;  2NQB D;  1KX4 C;  5BNV B;  3MVD D;  5AY8 B;  3FDD A;  4J8U C;  3AZM D;  3R45 A;  1P34 C;  2F2A C;  3W96 D;  3IP4 C;  3TU4 A;  3MGQ C;  3MGS A;  1HQ3 D;  1P3K D;  3AV1 D;  1TZY A;  3REI A;  4Z66 D;  5BO0 B;  3LJA A;  2BYM A;  4JJN D;  3A6N B;  2CWE A;  5AVC C;  3EPK A;  4WU8 A;  1KX5 A;  4QLC B;  3AN2 C;  3WKJ A;  1P3P A;  4HGA B;  3AZE C;  4DQY B;  2CV5 A;  3LZ0 D;  1M18 B;  3LZ1 C;  3O62 B;  2NZD B;  5B24 A;  2FJ7 B;  4XZQ A;  1ZLA D;  3F6T A;  3W99 A;  4DRB A;  5KDM A;  5DNN B;  3X1T D;  1BH8 B;  2HUE B;  5B2I C;  5AV9 C;  4YS3 D;  4H9S A;  3AV2 D;  1P3B C;  5B31 C;  1P3L D;  4WNN A;  4AWL C;  3MGR B;  4X23 A;  3C1B C;  5AVB A;  4J8X C;  3UT9 A;  4LD9 A;  1TAF A;  5B1L A;  5B0Y B;  5B1M B;  5GSU A;  3W97 D;  4H9O B;  3MGP C;  3REH B;  5B31 G;  5G49 B;  3AZL D;  3AZH A;  3AZK B;  3B0B A;  5B40 C;  3UTB D;  5B33 B;  2Y2Q A;  3B0D C;  2PYO D;  3AN2 B;  5CP6 C;  5DNM D;  5B2J B;  2F8N B;  2L5A A;  3AZG B;  5BT1 C;  2Y2O A;  5AV5 B;  1M1A D;  4H9P B;  3WAA D;  3H0R C;  3KWQ B;  4WU9 B;  2NQB A;  2Y2L A;  3MVD A;  3REJ B;  3AZM A;  3W96 A;  1F66 A;  5E5A C;  1P3O D;  3REL C;  3AZN C;  1P3A C;  5C3I C;  1HQ3 A;  4KUD D;  5AV8 D;  1P3K A;  3AV1 A;  2ARO B;  4Z66 A;  5B32 D;  1U35 C;  1P3M C;  5GXQ D;  4JJN A;  5CPJ C;  3B6F B;  2HIO C;  1ID3 D;  4YM6 C;  4CAY A;  3WA9 B;  3LZ0 A;  2YFW A;  1ZLA A;  4Z5T D;  2ZY4 A;  5BNX B;  4G92 C;  5CPK D;  3X1T A;  2JSS A;  5CPJ D;  2RVQ D;  3B0C W;  3WTP B;  4YS3 A;  1P3G D;  3AV2 A;  4J8V B;  1P3L A;  5GT3 C;  3AFA C;  2FFF B;  3KXB C;  3AZN B;  3VH5 A;  3X1V D;  1EQZ C;  5C3I B;  4H9R B;  3AYW D;  1P3F C;  4R8P B;  3W97 A;  1H3O B;  4H9N B;  2Y2I A;  3AZL A;  5BS7 A;  3LEL C;  1AOI B;  4XUJ B;  5AV9 A;  4EO5 B;  3UTB A;  3AZF D;  3VH5 W;  1JFI A;  2PYO A;  3V9R B;  1T3U A;  5GT3 D;  5AY8 C;  4ZUX D;  5DNM A;  4KGC B;  1S32 B;  5FUG B;  3P5J B;  1P3F D;  1M1A A;  3MNN D;  3WAA A;  3W98 D;  3X1S B;  4E45 A;  5B40 A;  5B0Z D;  1M19 D;  3NQJ B;  3R45 B;  4UUZ A;  5CP6 A;  4J8W B;  5GT0 D;  3A6N C;  3TU4 B;  1F1E A;  3KUY D;  4KUD A;  4QLC C;  3MGS B;  3X1U D;  1N1J B;  4HGA C;  1M18 C;  5B32 A;  3O62 C;  2NZD C;  3REI B;  2FJ7 C;  5CPI D;  5GXQ A;  3LJA B;  2F8N K;  2BYM B;  4NE5 A;  5DNN C;  4WJ3 C;  1B67 A;  2HUE C;  5F99 D;  4WU8 B;  3REK D;  1KX5 B;  1ID3 A;  3WKJ B;  1P3P B;  3AL0 C;  4QLC D;  1R4V A;  1F66 D;  1BFM A;  4Z5T A;  5B24 B;  4XZQ B;  3MGR C;  3VH6 T;  3AZI D;  5CPK A;  2RIQ A;  5KDM B;  5CPJ A;  5B0Y C;  1P3G A;  5B1M C;  1KX3 B;  3REH C;  3AZK C;  1KX4 D;  3UTA C;  4J8U D;  3X1V A;  4WNN B;  4Z2M G;  5B33 C;  1P34 D;  3AYW A;  4X23 B;  5AVB B;  3UT9 B;  4LD9 B;  1TAF B;  5B2J C;  3MGQ D;  5B1L B;  3AZG C;  5GSU B;  5AV5 C;  3AZH B;  5B1M D;  5JRG C;  3AZF A;  2LY8 A;  2YFV B;  4WV4 B;  3KWQ C;  4WU9 C;  2DQN C;  2F8N G;  5GT3 A;  4ZUX A;  3REJ C;  5B33 D;  5AVC D;  1P3F A;  2J8P A;  3MNN A;  2F8N H;  3AN2 D;  1P3I C;  3W98 A;  3AZE D;  2BYK A;  3LZ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...