1TZYB

Crystal structure of the core-histone octamer to 1.90 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H2A-IV
publication title High-resolution structure of the native histone octamer.
pubmed doi rcsb
total genus 35
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tzyB00
2FJ7B 3X1TC 5GT0C 1KX4A 4H9OA 3X1VB 5GT3D 5JRGA 4Z2MH 1M1AD 1BH8B 5B0YA 3AZID 5DNMD 4J8WA 3LZ1B 1P34D 4UUZB 3LJAD 1TAFA 5AVCC 5G49A 5B40C 3AZKC 3AV1A 3W97B 1P3AC 3NQJA 3KWQA 3REKA 5DNNC 5CPKA 1P3LC 3LZ0C 5B33A 5B24B 1P3FC 4WZSB 3UTAD 3VH6A 5B31D 1P3KC 3WTPB 3RELD 3AZGB 4JJNB 3REID 1N1JB 4Z5TB 3UT9A 1U35B 3X1VC 1P3IA 1KX5A 4J8UD 3W98D 3AZMB 3X1SA 3AN2A 3V9RB 3X1UA 2AROD 1S32C 1F66A 3MVDB 5AY8A 2NZDA 4J8XD 5FUGA 5AV8A 2HIOC 3AZHC 3W96D 4NE6A 3MGSD 5AV9B 5B0ZC 3LELD 5JA4B 1EQZB 3W99D 3O62C 4WU9D 3AZLB 3MGPC 1JFIA 4X23A 1AOIB 3MGRB 5GXQB 1H3OA 5GSUC 5CPIB 1ID3D 4H9NB 1HQ3C 3WA9B 5C3IB 3AZFD 3AZJB 3C1BD 2YFWB 5B24D 5B1LD 5GT3A 5AV5C 3AYWB 4ZUXB 1M1AA 3AZIA 5AV6C 5DNMA 5CPJC 3UTBB 1P34A 4KUDD 3WKJB 5E5AD 4XZQB 3LJAA 2BYMB 4R8PC 4G92B 3VH5A 1M18D 1P3MD 3A6NB 4Z66B 2NQBD 3UTAA 5B31A 4WU8B 3RELA 2PYOC 3TU4B 4QLCB 4J8VC 3KXBC 3REIA 5BO0B 3NQUA 5F99D 4J8UA 5KDMA 3B6GC 1EQZD 3KUYD 3B6FD 3W98A 1P3OD 4WV4B 1KX3D 2HUEC 4AWLB 5JRGC 4H9QB 4YS3B 5B0YC 1AOID 2AROA 3MGRD 4J8WC 3AFAD 2F8NG 4E45A 3C1CD 3AZJD 3AZEC 1P3BB 5BT1C 4J8XA 3AV1C 3W96A 5AVBB 3KWQC 3MGSA 1ZLAB 4LD9B 3LELA 5B1MD 3UT9D 5CPKC 2RVQD 4UUZA 5B33C 3W99A 3REJB 1P3GD 4WU9A 1P3PB 3WAAD 4DRAA 5GT0B 3X1TB 1ID3A 3AZFA 1P3IC 1KX5C 3C1BA 5B24A 3X1SC 3B6GA 5B1LA 1M19D 3R45B 5AVCB 5B40B 2F8NB 3AZKB 1P3AB 4KUDA 5DNNB 5AY8C 5E5AA 1P3LB 3LZ0B 3REHD 3AZNC 5AV8C 3AV2D 1P3FB 1P3KB 1M18A 1P3MA 4YM6D 2NQBA 2CV5D 4KGCD 4X23C 4H9PB 3MGQD 1S32B 5F99A 1EQZA 3KUYA 3B6FA 1P3OA 1KX3A 4H9SA 1M1AC 1TZYD 1AOIA 5BNVB 3MGRA 5B32D 5DNMC 4CAYB 2HIOB 3AFAA 3AZHB 1BH9B 3C1CA 1P34C 3AZJA 4G91C 5B0ZB 3O62B 5B40D 5B2ID 3MGPB 3AZKD 4NFTA 5BNXA 5B1MA 5GSUB 2BYKB 1HQ3B 5B2JD 1P3GA 3UTAC 3WAAA 3RELC 1P3FD 5AV5B 4H9RA 3REIC 5AV6B 1A7WA 5CPJB 4NE5A 2FJ7D 3W98C 3X1VD 1M19A 4R8PB 2AROC 3LZ1D 5CP6C 1S32D 4CSRB 4J8XC 3REHA 4HGAC 3AV2A 3W97D 3W96C 3MGSC 2PYOB 4J8VB 3KXBB 3LELC 4YM6A 2CWEA 3W99C 2CV5A 3B6GB 4WU9C 4KGCA 3WTPD 3AZGD 4H9OB 4NE3A 2HUEB 1ID3C 5JRGB 4JJND 3B0DC 5B0YB 4Z5TD 3MGQA 3AZFC 4J8WB 1U35D 3C1BC 3AZMD 5B1LC 3AZEB 1TZYA 3AV1B 5G49B 5AV5D 5B32A 3NQJB 3KWQB 4KUDC 3MVDD 5CPJD 5E5AC 5CPKB 1B67A 5B33B 4XUJC 5B40A 5B2IA 3AZKA 5AV9D 3MNNC 1M18C 4WNNA 1P3MC 1KX4C 5B2JA 1P3IB 1KX5B 2NQBC 3AZLD 4KHAA 3X1SB 1P3FA 5GXQD 2YFVA 5CPID 5BS7A 2PYOD 1ULYA 3WA9D 4E44A 3X1UB 5F99C 2FJ7A 3KSYA 3KUYC 3B6FC 1P3OC 3X1VA 1KX3C 5AY8B 3AYWD 4H9SC 4ZUXD 1BH8A 1WWIA 3AZNB 5FUGB 3LZ1A 5AV8B 3REKC 3AFAC 4EO5C 3UTBD 3C1CC 1S32A 3WKJD 4XZQD 1HTAA 3AZED 1KU5A 3W97A 5BT1D 2IO5C 4X23B 5B1MC 1H3OB 3UT9C 2RVQC 3A6ND 4Z66D 3VH6W 1P3GC 3WAAC 3WTPA 3AN2C 3AZGA 4WU8D 1F1EA 4QLCD 3TU4D 5GT3B 1Q9CA 3X1UC 4JJNA 1M1AB 1F66C 3AZIB 1N1JA 4Z5TA 5DNMB 1U35A 3AZMA 2NZDC 1P34B 4G91B 4DRBA 1M19C 4YS3D 3V9RA 5CHLB 5AV5A 3MVDA 5CPJA 1P3BD 3B0CW 3REHC 2JSSA 3AV2C 3UTAB 5AVBD 5AV9A 3RELB 3AZND 1ZLAD 4LD9D 5JA4A 4YM6C 3REIB 3REJD 2CV5C 3NQUB 5GT3C 3AZLA 5KDMB 4Z2MG 1P3PD 3X1TD 5GT0D 3W98B 4KGCC 3AZIC 5GXQA 5CPIA 4H9NA 2PYOA 3WA9A 3MGQC 2AROB 2YFWA 5CP6B 3LJAC 3AYWA 4ZUXA 4J8XB 1TZYC 5AVCD 2F8ND 5B32C 4HGAB 1P3AD 3UTBA 3W96B 3MGSB 3WKJA 5DNND 4XZQA 3LELB 2BYMA 1P3LD 3LZ0D 5B31C 3AZEA 3W99B 4WU9B 5B2IC 1P3KD 3VH5W 1ID3B 3B0DB 4J8UC 3A6NA 4Z66A 3AZFB 5B2JC 3C1BB 4WU8A 3TU4A 4QLCA 5B1LB 5BS7C 5BO0A 4ZBJC 2FJ7C 4KUDB 2L5AA 1R4VA 5E5AB 4H9QA 4YS3A 4XUJB 3LZ1C 2HIOD 3AZHD 3MNNB 5CP6D 2F8NK 5B0ZD 1P3BA 1M18B 1P3MB 3O62D 1KX4B 3W97C 2NQBB 1WWSA 3MGPD 5AVBA 3AZNA 1ZLAA 4LD9A 5GSUD 1HQ3D 5B24C 3REJA 5F99B 1P3PA 3KUYB 5GT0A 3WTPC 3AZGC 1TAFB 3X1TA 1P3OB 1KX3B 3B6FB 4JJNC 4Z5TC 5AV6D 1U35C 3REKB 3AFAB 4EO5B 3AZMC 3C1CB 3R45A 5AVCA 2F8NA 4R8PD 1P3AA 5DNNA 3MVDC 2IO5B 5BNXB 5B1MB 3UT9B 1P3LA 1B6WA 3LZ0A 3VH6T 3WTPE 1P3GB 1P3KA 3AN2B 3WAAB 5AV9C 4XUJD 4J8VD 3KXBD 3MNND 4H9RB 1F66B 1EQZC 2LY8A 3B6GD 3AZLC 2NZDB 1KX4D 1M19B 1AOIC 3MGRC 5GXQC 5CPIC 4H9PA 5JRGD 3WA9C 5B0YD 5C3IC 4J8WD 3AZJC 5B32G 2F8NH 3AYWC 4ZUXC 3B0CT 3AV1D 3REHB 5BNVA 1JFIB 4CAYA 3AV2B 2HIOA 3AZHA 1BH9A 5B31G 3UTBC 3KWQD 3WKJC 3REKD 5CP6A 5B0ZA 4XZQC 5CPKD 4YM6B 5B33D 3O62A 2CV5B 3B0BA 4G92C 3MGPA 4KGCB 4M6BA 5GSUA 2BYKA 1HQ3A 3A6NC 3MGQB 4Z66C 1P3ID 1KX5D 3LJAB 4WU8C 3X1SD 3TU4C 4QLCC 3AN2D 1TZYB 5AV6A 3X1UD 5B32B 1F66D 5AY8D 2NZDD 4AWLC 4YS3C 5B31B 4R8PA 1BFMA 5AV8D 3VH5T 5B2IB 4CSRA 1P3BC 4WNNB 4J8UB 5B2JB 4KHAB 5AVBC 4XUJA 1ZLAC 4LD9C 4X23D 4J8VA 3KXBA 2YFVB 3MNNA 3REJC 4ZBJB 1P3PC
chains in the Genus database with same CATH superfamily
2FJ7B 3X1TC 5GT0C 1KX4A 4H9OA 3X1VB 5GT3D 1PZRA 5JRGA 4Z2MH 1M1AD 1BH8B 5B0YA 3AZID 5DNMD 4J8WA 3LZ1B 1P34D 4UUZB 3LJAD 1TAFA 5AVCC 5G49A 2W8SA 2RIQA 5B40C 3AZKC 3AV1A 3W97B 1P3AC 3NQJA 3KWQA 3REKA 5DNNC 5CPKA 1P3LC 3LZ0C 5B33A 5B24B 1P3FC 4WZSB 3UTAD 3VH6A 5B31D 1P3KC 3WTPB 3RELD 3AZGB 4JJNB 4DQYB 3REID 1N1JB 4Z5TB 3EPJA 3UT9A 1U35B 3X1VC 1P3IA 1KX5A 4J8UD 3W98D 3AZMB 3X1SA 3AN2A 3H0RC 3V9RB 3X1UA 2AROD 1S32C 1F66A 3MVDB 5AY8A 2NZDA 4J8XD 5FUGA 2Y2IA 5AV8A 2HIOC 3AZHC 3W96D 4NE6A 3MGSD 5AV9B 5B0ZC 3LELD 5JA4B 1EQZB 3W99D 3O62C 4WU9D 3AZLB 3MGPC 1JFIA 4X23A 1AOIB 3MGRB 5GXQB 1H3OA 5GSUC 5CPIB 2F2AC 1ID3D 4H9NB 1HQ3C 3WA9B 5C3IB 3AZFD 3AZJB 3C1BD 2YFWB 5B24D 5B1LD 5GT3A 5AV5C 3AYWB 3P5JB 4ZUXB 1M1AA 3AZIA 5AV6C 5DNMA 5CPJC 3UTBB 1P34A 4KUDD 3WKJB 5E5AD 4XZQB 3LJAA 2BYMB 4R8PC 4G92B 3VH5A 1M18D 1P3MD 3A6NB 4Z66B 2NQBD 4WJ3C 3UTAA 2Y2MA 5B31A 4WU8B 3RELA 2PYOC 3TU4B 4QLCB 4J8VC 3KXBC 3REIA 5BO0B 3NQUA 5F99D 4J8UA 5KDMA 3B6GC 1EQZD 3KUYD 3B6FD 3W98A 1P3OD 3AL0C 4WV4B 1KX3D 2HUEC 3KFUG 4AWLB 5JRGC 4H9QB 4YS3B 5B0YC 1AOID 2AROA 3MGRD 4J8WC 3AFAD 2F8NG 4E45A 3C1CD 3AZJD 3AZEC 1P3BB 5BT1C 3IP4C 4J8XA 3AV1C 3W96A 5AVBB 3KWQC 3MGSA 1ZLAB 4LD9B 2Y2GA 3LELA 5B1MD 3UT9D 5CPKC 2RVQD 4UUZA 5B33C 3W99A 3REJB 1P3GD 4WU9A 1P3PB 3WAAD 4DRAA 5GT0B 3X1TB 1ID3A 3AZFA 1P3IC 1KX5C 3C1BA 5B24A 3X1SC 3B6GA 5B1LA 1M19D 3R45B 5AVCB 5B40B 2F8NB 3AZKB 2UWXA 1P3AB 4KUDA 5DNNB 5AY8C 3FDDA 5E5AA 1P3LB 3LZ0B 3REHD 3AZNC 5AV8C 3AV2D 1P3FB 1P3KB 1M18A 1P3MA 4YM6D 2Y2JA 2NQBA 2CV5D 4KGCD 2G5IC 4X23C 4H9PB 3MGQD 1S32B 5F99A 1EQZA 3KUYA 3B6FA 1P3OA 1KX3A 4H9SA 1M1AC 1TZYD 1AOIA 5BNVB 3MGRA 5B32D 5DNMC 4CAYB 3EPHA 2HIOB 3AFAA 3AZHB 1BH9B 3C1CA 1P34C 2BG1A 3AZJA 4G91C 5B0ZB 2J8PA 3O62B 2XD5A 5B2ID 5B40D 3MGPB 3AZKD 4NFTA 5BNXA 5B1MA 5GSUB 2BYKB 1HQ3B 2VQRA 5B2JD 1P3GA 3UTAC 3WAAA 3RELC 1P3FD 5AV5B 4H9RA 3REIC 5AV6B 3EPKA 1A7WA 5CPJB 4NE5A 2FJ7D 3W98C 3X1VD 1M19A 2Y2OA 4R8PB 2AROC 3LZ1D 5CP6C 1S32D 4CSRB 4J8XC 3REHA 4HGAC 3AV2A 3W97D 3W96C 3MGSC 2PYOB 4J8VB 3KXBB 3LELC 4YM6A 2CWEA 2ZY2A 3EG5B 3W99C 2CV5A 3B6GB 4WU9C 4KGCA 3WTPD 3AZGD 4H9OB 4NE3A 2Y2KA 2HUEB 1ID3C 5JRGB 4JJND 3B0DC 5B0YB 4Z5TD 3MGQA 3AZFC 4J8WB 1U35D 3C1BC 3AZMD 5B1LC 3AZEB 1TZYA 3AV1B 5G49B 5AV5D 5B32A 3NQJB 3KWQB 4KUDC 3MVDD 5CPJD 5E5AC 5CPKB 1B67A 5B33B 4XUJC 2G5HC 5B40A 5B2IA 3AZKA 5AV9D 3MNNC 1M18C 4WNNA 1P3MC 2ZM5A 1KX4C 5B2JA 2ZY4A 1P3IB 1KX5B 2NQBC 3AZLD 4KHAA 3X1SB 1P3FA 5GXQD 2YFVA 5CPID 5BS7A 2PYOD 1ULYA 2JE5A 3WA9D 4E44A 3X1UB 5F99C 2FJ7A 3KSYA 3KUYC 3B6FC 1P3OC 3X1VA 1KX3C 5AY8B 3AYWD 4H9SC 4ZUXD 1BH8A 1WWIA 3AZNB 5FUGB 3LZ1A 5AV8B 3REKC 3AFAC 4EO5C 3UTBD 3C1CC 1S32A 3WKJD 4XZQD 1HTAA 3AZED 1KU5A 3W97A 5BT1D 2IO5C 4X23B 5B1MC 1H3OB 3UT9C 2RVQC 3A6ND 4Z66D 3VH6W 1P3GC 3WAAC 3WTPA 3AN2C 3AZGA 4WU8D 1F1EA 4QLCD 3TU4D 5GT3B 1Q9CA 3X1UC 4JJNA 1M1AB 1F66C 3AZIB 1N1JA 4Z5TA 5DNMB 1U35A 3AZMA 2NZDC 1P34B 4G91B 4DRBA 1M19C 4YS3D 3V9RA 5CHLB 5AV5A 2FFFB 3F6TA 3MVDA 5CPJA 1P3BD 3B0CW 3REHC 2JSSA 3AV2C 3UTAB 5AVBD 5AV9A 3RELB 3AZND 1ZLAD 4LD9D 5JA4A 4YM6C 3REIB 3REJD 2CV5C 3NQUB 5GT3C 3AZLA 5KDMB 4Z2MG 1P3PD 3X1TD 5GT0D 3W98B 4KGCC 3AZIC 5GXQA 5CPIA 4H9NA 2PYOA 3WA9A 3MGQC 2AROB 2YFWA 5CP6B 3LJAC 3AYWA 4ZUXA 4J8XB 1TZYC 5AVCD 2F8ND 4UPKA 5B32C 4HGAB 1P3AD 3UTBA 3W96B 3MGSB 3WKJA 5DNND 4XZQA 3LELB 2BYMA 1P3LD 3LZ0D 5B31C 3AZEA 3W99B 4WU9B 5B2IC 1P3KD 3VH5W 2Y2HA 1ID3B 3B0DB 4J8UC 3A6NA 4Z66A 3AZFB 5B2JC 3C1BB 2JCHA 4WU8A 3TU4A 4QLCA 5B1LB 5BS7C 5BO0A 4ZBJC 2Y2LA 2FJ7C 4KUDB 2L5AA 1R4VA 5E5AB 4H9QA 4YS3A 4XUJB 3LZ1C 2HIOD 1Z2CB 3AZHD 3MNNB 5CP6D 2F8NK 5B0ZD 1P3BA 1M18B 1P3MB 3A1IA 3O62D 1KX4B 3W97C 2NQBB 1WWSA 3MGPD 5AVBA 3AZNA 1ZLAA 4LD9A 5GSUD 1W2EA 1HQ3D 3H0LC 5B24C 3REJA 5F99B 1P3PA 3KUYB 5GT0A 3WTPC 3AZGC 1TAFB 3X1TA 1P3OB 1KX3B 3B6FB 4JJNC 4Z5TC 5AV6D 1U35C 3REKB 3AFAB 4EO5B 3AZMC 3C1CB 3R45A 5AVCA 2F8NA 4R8PD 1P3AA 2ZY5A 5DNNA 3MVDC 2IO5B 5BNXB 5B1MB 3UT9B 1P3LA 1B6WA 3LZ0A 3VH6T 3WTPE 1P3GB 1P3KA 3AN2B 3WAAB 5AV9C 4XUJD 4J8VD 3KXBD 3MNND 2XD1A 4H9RB 1F66B 1EQZC 2LY8A 3A1KA 3B6GD 3AZLC 2NZDB 1KX4D 1M19B 1AOIC 3MGRC 5GXQC 5CPIC 4H9PA 5JRGD 3WA9C 5B0YD 5C3IC 4J8WD 2Y2NA 3AZJC 5B32G 2F8NH 3AYWC 4ZUXC 3B0CT 3AV1D 3REHB 5BNVA 1JFIB 4CAYA 3AV2B 2HIOA 3AZHA 1BH9A 5B31G 3UTBC 3KWQD 3WKJC 3REKD 5CP6A 5B0ZA 4XZQC 5CPKD 4YM6B 5B33D 3O62A 2CV5B 3B0BA 4G92C 2Y2PA 3MGPA 4KGCB 4M6BA 2DQNC 5GSUA 2BYKA 1HQ3A 3A6NC 3MGQB 4Z66C 1P3ID 1KX5D 3EPLA 3LJAB 4WU8C 3X1SD 3TU4C 4QLCC 3AN2D 1TZYB 5AV6A 3X1UD 5B32B 1F66D 5AY8D 2NZDD 4AWLC 4YS3C 5B31B 4R8PA 1BFMA 5AV8D 2Y2QA 3VH5T 5B2IB 3H0MC 2DF4C 4CSRA 1T3UA 1P3BC 4WNNB 4J8UB 5B2JB 4KHAB 5AVBC 4XUJA 1ZLAC 4LD9C 4X23D 4J8VA 3KXBA 2YFVB 3MNNA 2ZY3A 3REJC 4ZBJB 1P3PC
chains in the Genus database with same CATH topology
2FJ7B 3X1TC 5GT0C 1KX4A 4H9OA 3X1VB 5GT3D 1PZRA 5JRGA 4Z2MH 1M1AD 1BH8B 5B0YA 3AZID 5DNMD 4J8WA 3LZ1B 1P34D 4UUZB 3LJAD 1TAFA 5AVCC 5G49A 2W8SA 2RIQA 5B40C 3AZKC 3AV1A 3W97B 1P3AC 3NQJA 3KWQA 3REKA 5DNNC 5CPKA 1P3LC 3LZ0C 5B33A 5B24B 1P3FC 4WZSB 3UTAD 3VH6A 5B31D 1P3KC 3WTPB 3RELD 3AZGB 4JJNB 4DQYB 3REID 1N1JB 4Z5TB 3EPJA 3UT9A 1U35B 3X1VC 1P3IA 1KX5A 4J8UD 3W98D 3AZMB 3X1SA 3AN2A 3H0RC 3V9RB 3X1UA 2AROD 1S32C 1F66A 3MVDB 5AY8A 2NZDA 4J8XD 5FUGA 2Y2IA 5AV8A 2HIOC 3AZHC 3W96D 4NE6A 3MGSD 5AV9B 5B0ZC 3LELD 5JA4B 1EQZB 3W99D 3O62C 4WU9D 3AZLB 3MGPC 1JFIA 4X23A 1AOIB 3MGRB 5GXQB 1H3OA 5GSUC 5CPIB 2F2AC 1ID3D 4H9NB 1HQ3C 3WA9B 5C3IB 3AZFD 3AZJB 3C1BD 2YFWB 5B24D 5B1LD 5GT3A 5AV5C 3AYWB 3P5JB 4ZUXB 1M1AA 3AZIA 5AV6C 5DNMA 5CPJC 3UTBB 1P34A 4KUDD 3WKJB 5E5AD 4XZQB 3LJAA 2BYMB 4R8PC 4G92B 3VH5A 1M18D 1P3MD 3A6NB 4Z66B 2NQBD 4WJ3C 3UTAA 2Y2MA 5B31A 4WU8B 3RELA 2PYOC 3TU4B 4QLCB 4J8VC 3KXBC 3REIA 5BO0B 3NQUA 5F99D 4J8UA 5KDMA 3B6GC 1EQZD 3KUYD 3B6FD 3W98A 1P3OD 3AL0C 4WV4B 1KX3D 2HUEC 3KFUG 4AWLB 5JRGC 4H9QB 4YS3B 5B0YC 1AOID 2AROA 3MGRD 4J8WC 3AFAD 2F8NG 4E45A 3C1CD 3AZJD 3AZEC 1P3BB 5BT1C 3IP4C 4J8XA 3AV1C 3W96A 5AVBB 3KWQC 3MGSA 1ZLAB 4LD9B 2Y2GA 3LELA 5B1MD 3UT9D 5CPKC 2RVQD 4UUZA 5B33C 3W99A 3REJB 1P3GD 4WU9A 1P3PB 3WAAD 4DRAA 5GT0B 3X1TB 1ID3A 3AZFA 1P3IC 1KX5C 3C1BA 5B24A 3X1SC 3B6GA 5B1LA 1M19D 3R45B 5AVCB 5B40B 2F8NB 3AZKB 2UWXA 1P3AB 4KUDA 5DNNB 5AY8C 3FDDA 5E5AA 1P3LB 3LZ0B 3REHD 3AZNC 5AV8C 3AV2D 1P3FB 1P3KB 1M18A 1P3MA 4YM6D 2Y2JA 2NQBA 2CV5D 4KGCD 2G5IC 4X23C 4H9PB 3MGQD 1S32B 5F99A 1EQZA 3KUYA 3B6FA 1P3OA 1KX3A 4H9SA 1M1AC 1TZYD 1AOIA 5BNVB 3MGRA 5B32D 5DNMC 4CAYB 3EPHA 2HIOB 3AFAA 3AZHB 1BH9B 3C1CA 1P34C 2BG1A 3AZJA 4G91C 5B0ZB 2J8PA 3O62B 2XD5A 5B2ID 5B40D 3MGPB 3AZKD 4NFTA 5BNXA 5B1MA 5GSUB 2BYKB 1HQ3B 2VQRA 5B2JD 1P3GA 3UTAC 3WAAA 3RELC 1P3FD 5AV5B 4H9RA 3REIC 5AV6B 3EPKA 1A7WA 5CPJB 4NE5A 2FJ7D 3W98C 3X1VD 1M19A 2Y2OA 4R8PB 2AROC 3LZ1D 5CP6C 1S32D 4CSRB 4J8XC 3REHA 4HGAC 3AV2A 3W97D 3W96C 3MGSC 2PYOB 4J8VB 3KXBB 3LELC 4YM6A 2CWEA 2ZY2A 3EG5B 3W99C 2CV5A 3B6GB 4WU9C 4KGCA 3WTPD 3AZGD 4H9OB 4NE3A 2Y2KA 2HUEB 1ID3C 5JRGB 4JJND 3B0DC 5B0YB 4Z5TD 3MGQA 3AZFC 4J8WB 1U35D 3C1BC 3AZMD 5B1LC 3AZEB 1TZYA 3AV1B 5G49B 5AV5D 5B32A 3NQJB 3KWQB 4KUDC 3MVDD 5CPJD 5E5AC 5CPKB 1B67A 5B33B 4XUJC 2G5HC 5B40A 5B2IA 3AZKA 5AV9D 3MNNC 1M18C 4WNNA 1P3MC 2ZM5A 1KX4C 5B2JA 2ZY4A 1P3IB 1KX5B 2NQBC 3AZLD 4KHAA 3X1SB 1P3FA 5GXQD 2YFVA 5CPID 5BS7A 2PYOD 1ULYA 2JE5A 3WA9D 4E44A 3X1UB 5F99C 2FJ7A 3KSYA 3KUYC 3B6FC 1P3OC 3X1VA 1KX3C 5AY8B 3AYWD 4H9SC 4ZUXD 1BH8A 1WWIA 3AZNB 5FUGB 3LZ1A 5AV8B 3REKC 3AFAC 4EO5C 3UTBD 3C1CC 1S32A 3WKJD 4XZQD 1HTAA 3AZED 1KU5A 3W97A 5BT1D 2IO5C 4X23B 5B1MC 1H3OB 3UT9C 2RVQC 3A6ND 4Z66D 3VH6W 1P3GC 3WAAC 3WTPA 3AN2C 3AZGA 4WU8D 1F1EA 4QLCD 3TU4D 5GT3B 1Q9CA 3X1UC 4JJNA 1M1AB 1F66C 3AZIB 1N1JA 4Z5TA 5DNMB 1U35A 3AZMA 2NZDC 1P34B 4G91B 4DRBA 1M19C 4YS3D 3V9RA 5CHLB 5AV5A 2FFFB 3F6TA 3MVDA 5CPJA 1P3BD 3B0CW 3REHC 2JSSA 3AV2C 3UTAB 5AVBD 5AV9A 3RELB 3AZND 1ZLAD 4LD9D 5JA4A 4YM6C 3REIB 3REJD 2CV5C 3NQUB 5GT3C 3AZLA 5KDMB 4Z2MG 1P3PD 3X1TD 5GT0D 3W98B 4KGCC 3AZIC 5GXQA 5CPIA 4H9NA 2PYOA 3WA9A 3MGQC 2AROB 2YFWA 5CP6B 3LJAC 3AYWA 4ZUXA 4J8XB 1TZYC 5AVCD 2F8ND 4UPKA 5B32C 4HGAB 1P3AD 3UTBA 3W96B 3MGSB 3WKJA 5DNND 4XZQA 3LELB 2BYMA 1P3LD 3LZ0D 5B31C 3AZEA 3W99B 4WU9B 5B2IC 1P3KD 3VH5W 2Y2HA 1ID3B 3B0DB 4J8UC 3A6NA 4Z66A 3AZFB 5B2JC 3C1BB 2JCHA 4WU8A 3TU4A 4QLCA 5B1LB 5BS7C 5BO0A 4ZBJC 2Y2LA 2FJ7C 4KUDB 2L5AA 1R4VA 5E5AB 4H9QA 4YS3A 4XUJB 3LZ1C 2HIOD 1Z2CB 3AZHD 3MNNB 5CP6D 2F8NK 5B0ZD 1P3BA 1M18B 1P3MB 3A1IA 3O62D 1KX4B 3W97C 2NQBB 1WWSA 3MGPD 5AVBA 3AZNA 1ZLAA 4LD9A 5GSUD 1W2EA 1HQ3D 3H0LC 5B24C 3REJA 5F99B 1P3PA 3KUYB 5GT0A 3WTPC 3AZGC 1TAFB 3X1TA 1P3OB 1KX3B 3B6FB 4JJNC 4Z5TC 5AV6D 1U35C 3REKB 3AFAB 4EO5B 3AZMC 3C1CB 3R45A 5AVCA 2F8NA 4R8PD 1P3AA 2ZY5A 5DNNA 3MVDC 2IO5B 5BNXB 5B1MB 3UT9B 1P3LA 1B6WA 3LZ0A 3VH6T 3WTPE 1P3GB 1P3KA 3AN2B 3WAAB 5AV9C 4XUJD 4J8VD 3KXBD 3MNND 2XD1A 4H9RB 1F66B 1EQZC 2LY8A 3A1KA 3B6GD 3AZLC 2NZDB 1KX4D 1M19B 1AOIC 3MGRC 5GXQC 5CPIC 4H9PA 5JRGD 3WA9C 5B0YD 5C3IC 4J8WD 2Y2NA 3AZJC 5B32G 2F8NH 3AYWC 4ZUXC 3B0CT 3AV1D 3REHB 5BNVA 1JFIB 4CAYA 3AV2B 2HIOA 3AZHA 1BH9A 5B31G 3UTBC 3KWQD 3WKJC 3REKD 5CP6A 5B0ZA 4XZQC 5CPKD 4YM6B 5B33D 3O62A 2CV5B 3B0BA 4G92C 2Y2PA 3MGPA 4KGCB 4M6BA 2DQNC 5GSUA 2BYKA 1HQ3A 3A6NC 3MGQB 4Z66C 1P3ID 1KX5D 3EPLA 3LJAB 4WU8C 3X1SD 3TU4C 4QLCC 3AN2D 1TZYB 5AV6A 3X1UD 5B32B 1F66D 5AY8D 2NZDD 4AWLC 4YS3C 5B31B 4R8PA 1BFMA 5AV8D 2Y2QA 3VH5T 5B2IB 3H0MC 2DF4C 4CSRA 1T3UA 1P3BC 4WNNB 4J8UB 5B2JB 4KHAB 5AVBC 4XUJA 1ZLAC 4LD9C 4X23D 4J8VA 3KXBA 2YFVB 3MNNA 2ZY3A 3REJC 4ZBJB 1P3PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 B;  3X1T C;  5GT0 C;  1KX4 A;  4H9O A;  3X1V B;  5GT3 D;  5JRG A;  4Z2M H;  1M1A D;  1BH8 B;  5B0Y A;  3AZI D;  5DNM D;  4J8W A;  3LZ1 B;  1P34 D;  4UUZ B;  3LJA D;  1TAF A;  5AVC C;  5G49 A;  5B40 C;  3AZK C;  3AV1 A;  3W97 B;  1P3A C;  3NQJ A;  3KWQ A;  3REK A;  5DNN C;  5CPK A;  1P3L C;  3LZ0 C;  5B33 A;  5B24 B;  1P3F C;  4WZS B;  3UTA D;  3VH6 A;  5B31 D;  1P3K C;  3WTP B;  3REL D;  3AZG B;  4JJN B;  3REI D;  1N1J B;  4Z5T B;  3UT9 A;  1U35 B;  3X1V C;  1P3I A;  1KX5 A;  4J8U D;  3W98 D;  3AZM B;  3X1S A;  3AN2 A;  3V9R B;  3X1U A;  2ARO D;  1S32 C;  1F66 A;  3MVD B;  5AY8 A;  2NZD A;  4J8X D;  5FUG A;  5AV8 A;  2HIO C;  3AZH C;  3W96 D;  4NE6 A;  3MGS D;  5AV9 B;  5B0Z C;  3LEL D;  5JA4 B;  1EQZ B;  3W99 D;  3O62 C;  4WU9 D;  3AZL B;  3MGP C;  1JFI A;  4X23 A;  1AOI B;  3MGR B;  5GXQ B;  1H3O A;  5GSU C;  5CPI B;  1ID3 D;  4H9N B;  1HQ3 C;  3WA9 B;  5C3I B;  3AZF D;  3AZJ B;  3C1B D;  2YFW B;  5B24 D;  5B1L D;  5GT3 A;  5AV5 C;  3AYW B;  4ZUX B;  1M1A A;  3AZI A;  5AV6 C;  5DNM A;  5CPJ C;  3UTB B;  1P34 A;  4KUD D;  3WKJ B;  5E5A D;  4XZQ B;  3LJA A;  2BYM B;  4R8P C;  4G92 B;  3VH5 A;  1M18 D;  1P3M D;  3A6N B;  4Z66 B;  2NQB D;  3UTA A;  5B31 A;  4WU8 B;  3REL A;  2PYO C;  3TU4 B;  4QLC B;  4J8V C;  3KXB C;  3REI A;  5BO0 B;  3NQU A;  5F99 D;  4J8U A;  5KDM A;  3B6G C;  1EQZ D;  3KUY D;  3B6F D;  3W98 A;  1P3O D;  4WV4 B;  1KX3 D;  2HUE C;  4AWL B;  5JRG C;  4H9Q B;  4YS3 B;  5B0Y C;  1AOI D;  2ARO A;  3MGR D;  4J8W C;  3AFA D;  2F8N G;  4E45 A;  3C1C D;  3AZJ D;  3AZE C;  1P3B B;  5BT1 C;  4J8X A;  3AV1 C;  3W96 A;  5AVB B;  3KWQ C;  3MGS A;  1ZLA B;  4LD9 B;  3LEL A;  5B1M D;  3UT9 D;  5CPK C;  2RVQ D;  4UUZ A;  5B33 C;  3W99 A;  3REJ B;  1P3G D;  4WU9 A;  1P3P B;  3WAA D;  4DRA A;  5GT0 B;  3X1T B;  1ID3 A;  3AZF A;  1P3I C;  1KX5 C;  3C1B A;  5B24 A;  3X1S C;  3B6G A;  5B1L A;  1M19 D;  3R45 B;  5AVC B;  5B40 B;  2F8N B;  3AZK B;  1P3A B;  4KUD A;  5DNN B;  5AY8 C;  5E5A A;  1P3L B;  3LZ0 B;  3REH D;  3AZN C;  5AV8 C;  3AV2 D;  1P3F B;  1P3K B;  1M18 A;  1P3M A;  4YM6 D;  2NQB A;  2CV5 D;  4KGC D;  4X23 C;  4H9P B;  3MGQ D;  1S32 B;  5F99 A;  1EQZ A;  3KUY A;  3B6F A;  1P3O A;  1KX3 A;  4H9S A;  1M1A C;  1TZY D;  1AOI A;  5BNV B;  3MGR A;  5B32 D;  5DNM C;  4CAY B;  2HIO B;  3AFA A;  3AZH B;  1BH9 B;  3C1C A;  1P34 C;  3AZJ A;  4G91 C;  5B0Z B;  3O62 B;  5B40 D;  5B2I D;  3MGP B;  3AZK D;  4NFT A;  5BNX A;  5B1M A;  5GSU B;  2BYK B;  1HQ3 B;  5B2J D;  1P3G A;  3UTA C;  3WAA A;  3REL C;  1P3F D;  5AV5 B;  4H9R A;  3REI C;  5AV6 B;  1A7W A;  5CPJ B;  4NE5 A;  2FJ7 D;  3W98 C;  3X1V D;  1M19 A;  4R8P B;  2ARO C;  3LZ1 D;  5CP6 C;  1S32 D;  4CSR B;  4J8X C;  3REH A;  4HGA C;  3AV2 A;  3W97 D;  3W96 C;  3MGS C;  2PYO B;  4J8V B;  3KXB B;  3LEL C;  4YM6 A;  2CWE A;  3W99 C;  2CV5 A;  3B6G B;  4WU9 C;  4KGC A;  3WTP D;  3AZG D;  4H9O B;  4NE3 A;  2HUE B;  1ID3 C;  5JRG B;  4JJN D;  3B0D C;  5B0Y B;  4Z5T D;  3MGQ A;  3AZF C;  4J8W B;  1U35 D;  3C1B C;  3AZM D;  5B1L C;  3AZE B;  1TZY A;  3AV1 B;  5G49 B;  5AV5 D;  5B32 A;  3NQJ B;  3KWQ B;  4KUD C;  3MVD D;  5CPJ D;  5E5A C;  5CPK B;  1B67 A;  5B33 B;  4XUJ C;  5B40 A;  5B2I A;  3AZK A;  5AV9 D;  3MNN C;  1M18 C;  4WNN A;  1P3M C;  1KX4 C;  5B2J A;  1P3I B;  1KX5 B;  2NQB C;  3AZL D;  4KHA A;  3X1S B;  1P3F A;  5GXQ D;  2YFV A;  5CPI D;  5BS7 A;  2PYO D;  1ULY A;  3WA9 D;  4E44 A;  3X1U B;  5F99 C;  2FJ7 A;  3KSY A;  3KUY C;  3B6F C;  1P3O C;  3X1V A;  1KX3 C;  5AY8 B;  3AYW D;  4H9S C;  4ZUX D;  1BH8 A;  1WWI A;  3AZN B;  5FUG B;  3LZ1 A;  5AV8 B;  3REK C;  3AFA C;  4EO5 C;  3UTB D;  3C1C C;  1S32 A;  3WKJ D;  4XZQ D;  1HTA A;  3AZE D;  1KU5 A;  3W97 A;  5BT1 D;  2IO5 C;  4X23 B;  5B1M C;  1H3O B;  3UT9 C;  2RVQ C;  3A6N D;  4Z66 D;  3VH6 W;  1P3G C;  3WAA C;  3WTP A;  3AN2 C;  3AZG A;  4WU8 D;  1F1E A;  4QLC D;  3TU4 D;  5GT3 B;  1Q9C A;  3X1U C;  4JJN A;  1M1A B;  1F66 C;  3AZI B;  1N1J A;  4Z5T A;  5DNM B;  1U35 A;  3AZM A;  2NZD C;  1P34 B;  4G91 B;  4DRB A;  1M19 C;  4YS3 D;  3V9R A;  5CHL B;  5AV5 A;  3MVD A;  5CPJ A;  1P3B D;  3B0C W;  3REH C;  2JSS A;  3AV2 C;  3UTA B;  5AVB D;  5AV9 A;  3REL B;  3AZN D;  1ZLA D;  4LD9 D;  5JA4 A;  4YM6 C;  3REI B;  3REJ D;  2CV5 C;  3NQU B;  5GT3 C;  3AZL A;  5KDM B;  4Z2M G;  1P3P D;  3X1T D;  5GT0 D;  3W98 B;  4KGC C;  3AZI C;  5GXQ A;  5CPI A;  4H9N A;  2PYO A;  3WA9 A;  3MGQ C;  2ARO B;  2YFW A;  5CP6 B;  3LJA C;  3AYW A;  4ZUX A;  4J8X B;  1TZY C;  5AVC D;  2F8N D;  5B32 C;  4HGA B;  1P3A D;  3UTB A;  3W96 B;  3MGS B;  3WKJ A;  5DNN D;  4XZQ A;  3LEL B;  2BYM A;  1P3L D;  3LZ0 D;  5B31 C;  3AZE A;  3W99 B;  4WU9 B;  5B2I C;  1P3K D;  3VH5 W;  1ID3 B;  3B0D B;  4J8U C;  3A6N A;  4Z66 A;  3AZF B;  5B2J C;  3C1B B;  4WU8 A;  3TU4 A;  4QLC A;  5B1L B;  5BS7 C;  5BO0 A;  4ZBJ C;  2FJ7 C;  4KUD B;  2L5A A;  1R4V A;  5E5A B;  4H9Q A;  4YS3 A;  4XUJ B;  3LZ1 C;  2HIO D;  3AZH D;  3MNN B;  5CP6 D;  2F8N K;  5B0Z D;  1P3B A;  1M18 B;  1P3M B;  3O62 D;  1KX4 B;  3W97 C;  2NQB B;  1WWS A;  3MGP D;  5AVB A;  3AZN A;  1ZLA A;  4LD9 A;  5GSU D;  1HQ3 D;  5B24 C;  3REJ A;  5F99 B;  1P3P A;  3KUY B;  5GT0 A;  3WTP C;  3AZG C;  1TAF B;  3X1T A;  1P3O B;  1KX3 B;  3B6F B;  4JJN C;  4Z5T C;  5AV6 D;  1U35 C;  3REK B;  3AFA B;  4EO5 B;  3AZM C;  3C1C B;  3R45 A;  5AVC A;  2F8N A;  4R8P D;  1P3A A;  5DNN A;  3MVD C;  2IO5 B;  5BNX B;  5B1M B;  3UT9 B;  1P3L A;  1B6W A;  3LZ0 A;  3VH6 T;  3WTP E;  1P3G B;  1P3K A;  3AN2 B;  3WAA B;  5AV9 C;  4XUJ D;  4J8V D;  3KXB D;  3MNN D;  4H9R B;  1F66 B;  1EQZ C;  2LY8 A;  3B6G D;  3AZL C;  2NZD B;  1KX4 D;  1M19 B;  1AOI C;  3MGR C;  5GXQ C;  5CPI C;  4H9P A;  5JRG D;  3WA9 C;  5B0Y D;  5C3I C;  4J8W D;  3AZJ C;  5B32 G;  2F8N H;  3AYW C;  4ZUX C;  3B0C T;  3AV1 D;  3REH B;  5BNV A;  1JFI B;  4CAY A;  3AV2 B;  2HIO A;  3AZH A;  1BH9 A;  5B31 G;  3UTB C;  3KWQ D;  3WKJ C;  3REK D;  5CP6 A;  5B0Z A;  4XZQ C;  5CPK D;  4YM6 B;  5B33 D;  3O62 A;  2CV5 B;  3B0B A;  4G92 C;  3MGP A;  4KGC B;  4M6B A;  5GSU A;  2BYK A;  1HQ3 A;  3A6N C;  3MGQ B;  4Z66 C;  1P3I D;  1KX5 D;  3LJA B;  4WU8 C;  3X1S D;  3TU4 C;  4QLC C;  3AN2 D;  1TZY B;  5AV6 A;  3X1U D;  5B32 B;  1F66 D;  5AY8 D;  2NZD D;  4AWL C;  4YS3 C;  5B31 B;  4R8P A;  1BFM A;  5AV8 D;  3VH5 T;  5B2I B;  4CSR A;  1P3B C;  4WNN B;  4J8U B;  5B2J B;  4KHA B;  5AVB C;  4XUJ A;  1ZLA C;  4LD9 C;  4X23 D;  4J8V A;  3KXB A;  2YFV B;  3MNN A;  3REJ C;  4ZBJ B;  1P3P C; 
#chains in the Genus database with same CATH topology
 2FJ7 B;  3X1T C;  5GT0 C;  1KX4 A;  4H9O A;  3X1V B;  5GT3 D;  1PZR A;  5JRG A;  4Z2M H;  1M1A D;  1BH8 B;  5B0Y A;  3AZI D;  5DNM D;  4J8W A;  3LZ1 B;  1P34 D;  4UUZ B;  3LJA D;  1TAF A;  5AVC C;  5G49 A;  2W8S A;  2RIQ A;  5B40 C;  3AZK C;  3AV1 A;  3W97 B;  1P3A C;  3NQJ A;  3KWQ A;  3REK A;  5DNN C;  5CPK A;  1P3L C;  3LZ0 C;  5B33 A;  5B24 B;  1P3F C;  4WZS B;  3UTA D;  3VH6 A;  5B31 D;  1P3K C;  3WTP B;  3REL D;  3AZG B;  4JJN B;  4DQY B;  3REI D;  1N1J B;  4Z5T B;  3EPJ A;  3UT9 A;  1U35 B;  3X1V C;  1P3I A;  1KX5 A;  4J8U D;  3W98 D;  3AZM B;  3X1S A;  3AN2 A;  3H0R C;  3V9R B;  3X1U A;  2ARO D;  1S32 C;  1F66 A;  3MVD B;  5AY8 A;  2NZD A;  4J8X D;  5FUG A;  2Y2I A;  5AV8 A;  2HIO C;  3AZH C;  3W96 D;  4NE6 A;  3MGS D;  5AV9 B;  5B0Z C;  3LEL D;  5JA4 B;  1EQZ B;  3W99 D;  3O62 C;  4WU9 D;  3AZL B;  3MGP C;  1JFI A;  4X23 A;  1AOI B;  3MGR B;  5GXQ B;  1H3O A;  5GSU C;  5CPI B;  2F2A C;  1ID3 D;  4H9N B;  1HQ3 C;  3WA9 B;  5C3I B;  3AZF D;  3AZJ B;  3C1B D;  2YFW B;  5B24 D;  5B1L D;  5GT3 A;  5AV5 C;  3AYW B;  3P5J B;  4ZUX B;  1M1A A;  3AZI A;  5AV6 C;  5DNM A;  5CPJ C;  3UTB B;  1P34 A;  4KUD D;  3WKJ B;  5E5A D;  4XZQ B;  3LJA A;  2BYM B;  4R8P C;  4G92 B;  3VH5 A;  1M18 D;  1P3M D;  3A6N B;  4Z66 B;  2NQB D;  4WJ3 C;  3UTA A;  2Y2M A;  5B31 A;  4WU8 B;  3REL A;  2PYO C;  3TU4 B;  4QLC B;  4J8V C;  3KXB C;  3REI A;  5BO0 B;  3NQU A;  5F99 D;  4J8U A;  5KDM A;  3B6G C;  1EQZ D;  3KUY D;  3B6F D;  3W98 A;  1P3O D;  3AL0 C;  4WV4 B;  1KX3 D;  2HUE C;  3KFU G;  4AWL B;  5JRG C;  4H9Q B;  4YS3 B;  5B0Y C;  1AOI D;  2ARO A;  3MGR D;  4J8W C;  3AFA D;  2F8N G;  4E45 A;  3C1C D;  3AZJ D;  3AZE C;  1P3B B;  5BT1 C;  3IP4 C;  4J8X A;  3AV1 C;  3W96 A;  5AVB B;  3KWQ C;  3MGS A;  1ZLA B;  4LD9 B;  2Y2G A;  3LEL A;  5B1M D;  3UT9 D;  5CPK C;  2RVQ D;  4UUZ A;  5B33 C;  3W99 A;  3REJ B;  1P3G D;  4WU9 A;  1P3P B;  3WAA D;  4DRA A;  5GT0 B;  3X1T B;  1ID3 A;  3AZF A;  1P3I C;  1KX5 C;  3C1B A;  5B24 A;  3X1S C;  3B6G A;  5B1L A;  1M19 D;  3R45 B;  5AVC B;  5B40 B;  2F8N B;  3AZK B;  2UWX A;  1P3A B;  4KUD A;  5DNN B;  5AY8 C;  3FDD A;  5E5A A;  1P3L B;  3LZ0 B;  3REH D;  3AZN C;  5AV8 C;  3AV2 D;  1P3F B;  1P3K B;  1M18 A;  1P3M A;  4YM6 D;  2Y2J A;  2NQB A;  2CV5 D;  4KGC D;  2G5I C;  4X23 C;  4H9P B;  3MGQ D;  1S32 B;  5F99 A;  1EQZ A;  3KUY A;  3B6F A;  1P3O A;  1KX3 A;  4H9S A;  1M1A C;  1TZY D;  1AOI A;  5BNV B;  3MGR A;  5B32 D;  5DNM C;  4CAY B;  3EPH A;  2HIO B;  3AFA A;  3AZH B;  1BH9 B;  3C1C A;  1P34 C;  2BG1 A;  3AZJ A;  4G91 C;  5B0Z B;  2J8P A;  3O62 B;  2XD5 A;  5B2I D;  5B40 D;  3MGP B;  3AZK D;  4NFT A;  5BNX A;  5B1M A;  5GSU B;  2BYK B;  1HQ3 B;  2VQR A;  5B2J D;  1P3G A;  3UTA C;  3WAA A;  3REL C;  1P3F D;  5AV5 B;  4H9R A;  3REI C;  5AV6 B;  3EPK A;  1A7W A;  5CPJ B;  4NE5 A;  2FJ7 D;  3W98 C;  3X1V D;  1M19 A;  2Y2O A;  4R8P B;  2ARO C;  3LZ1 D;  5CP6 C;  1S32 D;  4CSR B;  4J8X C;  3REH A;  4HGA C;  3AV2 A;  3W97 D;  3W96 C;  3MGS C;  2PYO B;  4J8V B;  3KXB B;  3LEL C;  4YM6 A;  2CWE A;  2ZY2 A;  3EG5 B;  3W99 C;  2CV5 A;  3B6G B;  4WU9 C;  4KGC A;  3WTP D;  3AZG D;  4H9O B;  4NE3 A;  2Y2K A;  2HUE B;  1ID3 C;  5JRG B;  4JJN D;  3B0D C;  5B0Y B;  4Z5T D;  3MGQ A;  3AZF C;  4J8W B;  1U35 D;  3C1B C;  3AZM D;  5B1L C;  3AZE B;  1TZY A;  3AV1 B;  5G49 B;  5AV5 D;  5B32 A;  3NQJ B;  3KWQ B;  4KUD C;  3MVD D;  5CPJ D;  5E5A C;  5CPK B;  1B67 A;  5B33 B;  4XUJ C;  2G5H C;  5B40 A;  5B2I A;  3AZK A;  5AV9 D;  3MNN C;  1M18 C;  4WNN A;  1P3M C;  2ZM5 A;  1KX4 C;  5B2J A;  2ZY4 A;  1P3I B;  1KX5 B;  2NQB C;  3AZL D;  4KHA A;  3X1S B;  1P3F A;  5GXQ D;  2YFV A;  5CPI D;  5BS7 A;  2PYO D;  1ULY A;  2JE5 A;  3WA9 D;  4E44 A;  3X1U B;  5F99 C;  2FJ7 A;  3KSY A;  3KUY C;  3B6F C;  1P3O C;  3X1V A;  1KX3 C;  5AY8 B;  3AYW D;  4H9S C;  4ZUX D;  1BH8 A;  1WWI A;  3AZN B;  5FUG B;  3LZ1 A;  5AV8 B;  3REK C;  3AFA C;  4EO5 C;  3UTB D;  3C1C C;  1S32 A;  3WKJ D;  4XZQ D;  1HTA A;  3AZE D;  1KU5 A;  3W97 A;  5BT1 D;  2IO5 C;  4X23 B;  5B1M C;  1H3O B;  3UT9 C;  2RVQ C;  3A6N D;  4Z66 D;  3VH6 W;  1P3G C;  3WAA C;  3WTP A;  3AN2 C;  3AZG A;  4WU8 D;  1F1E A;  4QLC D;  3TU4 D;  5GT3 B;  1Q9C A;  3X1U C;  4JJN A;  1M1A B;  1F66 C;  3AZI B;  1N1J A;  4Z5T A;  5DNM B;  1U35 A;  3AZM A;  2NZD C;  1P34 B;  4G91 B;  4DRB A;  1M19 C;  4YS3 D;  3V9R A;  5CHL B;  5AV5 A;  2FFF B;  3F6T A;  3MVD A;  5CPJ A;  1P3B D;  3B0C W;  3REH C;  2JSS A;  3AV2 C;  3UTA B;  5AVB D;  5AV9 A;  3REL B;  3AZN D;  1ZLA D;  4LD9 D;  5JA4 A;  4YM6 C;  3REI B;  3REJ D;  2CV5 C;  3NQU B;  5GT3 C;  3AZL A;  5KDM B;  4Z2M G;  1P3P D;  3X1T D;  5GT0 D;  3W98 B;  4KGC C;  3AZI C;  5GXQ A;  5CPI A;  4H9N A;  2PYO A;  3WA9 A;  3MGQ C;  2ARO B;  2YFW A;  5CP6 B;  3LJA C;  3AYW A;  4ZUX A;  4J8X B;  1TZY C;  5AVC D;  2F8N D;  4UPK A;  5B32 C;  4HGA B;  1P3A D;  3UTB A;  3W96 B;  3MGS B;  3WKJ A;  5DNN D;  4XZQ A;  3LEL B;  2BYM A;  1P3L D;  3LZ0 D;  5B31 C;  3AZE A;  3W99 B;  4WU9 B;  5B2I C;  1P3K D;  3VH5 W;  2Y2H A;  1ID3 B;  3B0D B;  4J8U C;  3A6N A;  4Z66 A;  3AZF B;  5B2J C;  3C1B B;  2JCH A;  4WU8 A;  3TU4 A;  4QLC A;  5B1L B;  5BS7 C;  5BO0 A;  4ZBJ C;  2Y2L A;  2FJ7 C;  4KUD B;  2L5A A;  1R4V A;  5E5A B;  4H9Q A;  4YS3 A;  4XUJ B;  3LZ1 C;  2HIO D;  1Z2C B;  3AZH D;  3MNN B;  5CP6 D;  2F8N K;  5B0Z D;  1P3B A;  1M18 B;  1P3M B;  3A1I A;  3O62 D;  1KX4 B;  3W97 C;  2NQB B;  1WWS A;  3MGP D;  5AVB A;  3AZN A;  1ZLA A;  4LD9 A;  5GSU D;  1W2E A;  1HQ3 D;  3H0L C;  5B24 C;  3REJ A;  5F99 B;  1P3P A;  3KUY B;  5GT0 A;  3WTP C;  3AZG C;  1TAF B;  3X1T A;  1P3O B;  1KX3 B;  3B6F B;  4JJN C;  4Z5T C;  5AV6 D;  1U35 C;  3REK B;  3AFA B;  4EO5 B;  3AZM C;  3C1C B;  3R45 A;  5AVC A;  2F8N A;  4R8P D;  1P3A A;  2ZY5 A;  5DNN A;  3MVD C;  2IO5 B;  5BNX B;  5B1M B;  3UT9 B;  1P3L A;  1B6W A;  3LZ0 A;  3VH6 T;  3WTP E;  1P3G B;  1P3K A;  3AN2 B;  3WAA B;  5AV9 C;  4XUJ D;  4J8V D;  3KXB D;  3MNN D;  2XD1 A;  4H9R B;  1F66 B;  1EQZ C;  2LY8 A;  3A1K A;  3B6G D;  3AZL C;  2NZD B;  1KX4 D;  1M19 B;  1AOI C;  3MGR C;  5GXQ C;  5CPI C;  4H9P A;  5JRG D;  3WA9 C;  5B0Y D;  5C3I C;  4J8W D;  2Y2N A;  3AZJ C;  5B32 G;  2F8N H;  3AYW C;  4ZUX C;  3B0C T;  3AV1 D;  3REH B;  5BNV A;  1JFI B;  4CAY A;  3AV2 B;  2HIO A;  3AZH A;  1BH9 A;  5B31 G;  3UTB C;  3KWQ D;  3WKJ C;  3REK D;  5CP6 A;  5B0Z A;  4XZQ C;  5CPK D;  4YM6 B;  5B33 D;  3O62 A;  2CV5 B;  3B0B A;  4G92 C;  2Y2P A;  3MGP A;  4KGC B;  4M6B A;  2DQN C;  5GSU A;  2BYK A;  1HQ3 A;  3A6N C;  3MGQ B;  4Z66 C;  1P3I D;  1KX5 D;  3EPL A;  3LJA B;  4WU8 C;  3X1S D;  3TU4 C;  4QLC C;  3AN2 D;  1TZY B;  5AV6 A;  3X1U D;  5B32 B;  1F66 D;  5AY8 D;  2NZD D;  4AWL C;  4YS3 C;  5B31 B;  4R8P A;  1BFM A;  5AV8 D;  2Y2Q A;  3VH5 T;  5B2I B;  3H0M C;  2DF4 C;  4CSR A;  1T3U A;  1P3B C;  4WNN B;  4J8U B;  5B2J B;  4KHA B;  5AVB C;  4XUJ A;  1ZLA C;  4LD9 C;  4X23 D;  4J8V A;  3KXB A;  2YFV B;  3MNN A;  2ZY3 A;  3REJ C;  4ZBJ B;  1P3P C; 
#chains in the Genus database with same CATH homology
 2FJ7 B;  3X1T C;  5GT0 C;  1KX4 A;  4H9O A;  3X1V B;  5GT3 D;  1PZR A;  5JRG A;  4Z2M H;  1M1A D;  1BH8 B;  5B0Y A;  3AZI D;  5DNM D;  4J8W A;  3LZ1 B;  1P34 D;  4UUZ B;  3LJA D;  1TAF A;  5AVC C;  5G49 A;  2W8S A;  2RIQ A;  5B40 C;  3AZK C;  3AV1 A;  3W97 B;  1P3A C;  3NQJ A;  3KWQ A;  3REK A;  5DNN C;  5CPK A;  1P3L C;  3LZ0 C;  5B33 A;  5B24 B;  1P3F C;  4WZS B;  3UTA D;  3VH6 A;  5B31 D;  1P3K C;  3WTP B;  3REL D;  3AZG B;  4JJN B;  4DQY B;  3REI D;  1N1J B;  4Z5T B;  3EPJ A;  3UT9 A;  1U35 B;  3X1V C;  1P3I A;  1KX5 A;  4J8U D;  3W98 D;  3AZM B;  3X1S A;  3AN2 A;  3H0R C;  3V9R B;  3X1U A;  2ARO D;  1S32 C;  1F66 A;  3MVD B;  5AY8 A;  2NZD A;  4J8X D;  5FUG A;  2Y2I A;  5AV8 A;  2HIO C;  3AZH C;  3W96 D;  4NE6 A;  3MGS D;  5AV9 B;  5B0Z C;  3LEL D;  5JA4 B;  1EQZ B;  3W99 D;  3O62 C;  4WU9 D;  3AZL B;  3MGP C;  1JFI A;  4X23 A;  1AOI B;  3MGR B;  5GXQ B;  1H3O A;  5GSU C;  5CPI B;  2F2A C;  1ID3 D;  4H9N B;  1HQ3 C;  3WA9 B;  5C3I B;  3AZF D;  3AZJ B;  3C1B D;  2YFW B;  5B24 D;  5B1L D;  5GT3 A;  5AV5 C;  3AYW B;  3P5J B;  4ZUX B;  1M1A A;  3AZI A;  5AV6 C;  5DNM A;  5CPJ C;  3UTB B;  1P34 A;  4KUD D;  3WKJ B;  5E5A D;  4XZQ B;  3LJA A;  2BYM B;  4R8P C;  4G92 B;  3VH5 A;  1M18 D;  1P3M D;  3A6N B;  4Z66 B;  2NQB D;  4WJ3 C;  3UTA A;  2Y2M A;  5B31 A;  4WU8 B;  3REL A;  2PYO C;  3TU4 B;  4QLC B;  4J8V C;  3KXB C;  3REI A;  5BO0 B;  3NQU A;  5F99 D;  4J8U A;  5KDM A;  3B6G C;  1EQZ D;  3KUY D;  3B6F D;  3W98 A;  1P3O D;  3AL0 C;  4WV4 B;  1KX3 D;  2HUE C;  3KFU G;  4AWL B;  5JRG C;  4H9Q B;  4YS3 B;  5B0Y C;  1AOI D;  2ARO A;  3MGR D;  4J8W C;  3AFA D;  2F8N G;  4E45 A;  3C1C D;  3AZJ D;  3AZE C;  1P3B B;  5BT1 C;  3IP4 C;  4J8X A;  3AV1 C;  3W96 A;  5AVB B;  3KWQ C;  3MGS A;  1ZLA B;  4LD9 B;  2Y2G A;  3LEL A;  5B1M D;  3UT9 D;  5CPK C;  2RVQ D;  4UUZ A;  5B33 C;  3W99 A;  3REJ B;  1P3G D;  4WU9 A;  1P3P B;  3WAA D;  4DRA A;  5GT0 B;  3X1T B;  1ID3 A;  3AZF A;  1P3I C;  1KX5 C;  3C1B A;  5B24 A;  3X1S C;  3B6G A;  5B1L A;  1M19 D;  3R45 B;  5AVC B;  5B40 B;  2F8N B;  3AZK B;  2UWX A;  1P3A B;  4KUD A;  5DNN B;  5AY8 C;  3FDD A;  5E5A A;  1P3L B;  3LZ0 B;  3REH D;  3AZN C;  5AV8 C;  3AV2 D;  1P3F B;  1P3K B;  1M18 A;  1P3M A;  4YM6 D;  2Y2J A;  2NQB A;  2CV5 D;  4KGC D;  2G5I C;  4X23 C;  4H9P B;  3MGQ D;  1S32 B;  5F99 A;  1EQZ A;  3KUY A;  3B6F A;  1P3O A;  1KX3 A;  4H9S A;  1M1A C;  1TZY D;  1AOI A;  5BNV B;  3MGR A;  5B32 D;  5DNM C;  4CAY B;  3EPH A;  2HIO B;  3AFA A;  3AZH B;  1BH9 B;  3C1C A;  1P34 C;  2BG1 A;  3AZJ A;  4G91 C;  5B0Z B;  2J8P A;  3O62 B;  2XD5 A;  5B2I D;  5B40 D;  3MGP B;  3AZK D;  4NFT A;  5BNX A;  5B1M A;  5GSU B;  2BYK B;  1HQ3 B;  2VQR A;  5B2J D;  1P3G A;  3UTA C;  3WAA A;  3REL C;  1P3F D;  5AV5 B;  4H9R A;  3REI C;  5AV6 B;  3EPK A;  1A7W A;  5CPJ B;  4NE5 A;  2FJ7 D;  3W98 C;  3X1V D;  1M19 A;  2Y2O A;  4R8P B;  2ARO C;  3LZ1 D;  5CP6 C;  1S32 D;  4CSR B;  4J8X C;  3REH A;  4HGA C;  3AV2 A;  3W97 D;  3W96 C;  3MGS C;  2PYO B;  4J8V B;  3KXB B;  3LEL C;  4YM6 A;  2CWE A;  2ZY2 A;  3EG5 B;  3W99 C;  2CV5 A;  3B6G B;  4WU9 C;  4KGC A;  3WTP D;  3AZG D;  4H9O B;  4NE3 A;  2Y2K A;  2HUE B;  1ID3 C;  5JRG B;  4JJN D;  3B0D C;  5B0Y B;  4Z5T D;  3MGQ A;  3AZF C;  4J8W B;  1U35 D;  3C1B C;  3AZM D;  5B1L C;  3AZE B;  1TZY A;  3AV1 B;  5G49 B;  5AV5 D;  5B32 A;  3NQJ B;  3KWQ B;  4KUD C;  3MVD D;  5CPJ D;  5E5A C;  5CPK B;  1B67 A;  5B33 B;  4XUJ C;  2G5H C;  5B40 A;  5B2I A;  3AZK A;  5AV9 D;  3MNN C;  1M18 C;  4WNN A;  1P3M C;  2ZM5 A;  1KX4 C;  5B2J A;  2ZY4 A;  1P3I B;  1KX5 B;  2NQB C;  3AZL D;  4KHA A;  3X1S B;  1P3F A;  5GXQ D;  2YFV A;  5CPI D;  5BS7 A;  2PYO D;  1ULY A;  2JE5 A;  3WA9 D;  4E44 A;  3X1U B;  5F99 C;  2FJ7 A;  3KSY A;  3KUY C;  3B6F C;  1P3O C;  3X1V A;  1KX3 C;  5AY8 B;  3AYW D;  4H9S C;  4ZUX D;  1BH8 A;  1WWI A;  3AZN B;  5FUG B;  3LZ1 A;  5AV8 B;  3REK C;  3AFA C;  4EO5 C;  3UTB D;  3C1C C;  1S32 A;  3WKJ D;  4XZQ D;  1HTA A;  3AZE D;  1KU5 A;  3W97 A;  5BT1 D;  2IO5 C;  4X23 B;  5B1M C;  1H3O B;  3UT9 C;  2RVQ C;  3A6N D;  4Z66 D;  3VH6 W;  1P3G C;  3WAA C;  3WTP A;  3AN2 C;  3AZG A;  4WU8 D;  1F1E A;  4QLC D;  3TU4 D;  5GT3 B;  1Q9C A;  3X1U C;  4JJN A;  1M1A B;  1F66 C;  3AZI B;  1N1J A;  4Z5T A;  5DNM B;  1U35 A;  3AZM A;  2NZD C;  1P34 B;  4G91 B;  4DRB A;  1M19 C;  4YS3 D;  3V9R A;  5CHL B;  5AV5 A;  2FFF B;  3F6T A;  3MVD A;  5CPJ A;  1P3B D;  3B0C W;  3REH C;  2JSS A;  3AV2 C;  3UTA B;  5AVB D;  5AV9 A;  3REL B;  3AZN D;  1ZLA D;  4LD9 D;  5JA4 A;  4YM6 C;  3REI B;  3REJ D;  2CV5 C;  3NQU B;  5GT3 C;  3AZL A;  5KDM B;  4Z2M G;  1P3P D;  3X1T D;  5GT0 D;  3W98 B;  4KGC C;  3AZI C;  5GXQ A;  5CPI A;  4H9N A;  2PYO A;  3WA9 A;  3MGQ C;  2ARO B;  2YFW A;  5CP6 B;  3LJA C;  3AYW A;  4ZUX A;  4J8X B;  1TZY C;  5AVC D;  2F8N D;  4UPK A;  5B32 C;  4HGA B;  1P3A D;  3UTB A;  3W96 B;  3MGS B;  3WKJ A;  5DNN D;  4XZQ A;  3LEL B;  2BYM A;  1P3L D;  3LZ0 D;  5B31 C;  3AZE A;  3W99 B;  4WU9 B;  5B2I C;  1P3K D;  3VH5 W;  2Y2H A;  1ID3 B;  3B0D B;  4J8U C;  3A6N A;  4Z66 A;  3AZF B;  5B2J C;  3C1B B;  2JCH A;  4WU8 A;  3TU4 A;  4QLC A;  5B1L B;  5BS7 C;  5BO0 A;  4ZBJ C;  2Y2L A;  2FJ7 C;  4KUD B;  2L5A A;  1R4V A;  5E5A B;  4H9Q A;  4YS3 A;  4XUJ B;  3LZ1 C;  2HIO D;  1Z2C B;  3AZH D;  3MNN B;  5CP6 D;  2F8N K;  5B0Z D;  1P3B A;  1M18 B;  1P3M B;  3A1I A;  3O62 D;  1KX4 B;  3W97 C;  2NQB B;  1WWS A;  3MGP D;  5AVB A;  3AZN A;  1ZLA A;  4LD9 A;  5GSU D;  1W2E A;  1HQ3 D;  3H0L C;  5B24 C;  3REJ A;  5F99 B;  1P3P A;  3KUY B;  5GT0 A;  3WTP C;  3AZG C;  1TAF B;  3X1T A;  1P3O B;  1KX3 B;  3B6F B;  4JJN C;  4Z5T C;  5AV6 D;  1U35 C;  3REK B;  3AFA B;  4EO5 B;  3AZM C;  3C1C B;  3R45 A;  5AVC A;  2F8N A;  4R8P D;  1P3A A;  2ZY5 A;  5DNN A;  3MVD C;  2IO5 B;  5BNX B;  5B1M B;  3UT9 B;  1P3L A;  1B6W A;  3LZ0 A;  3VH6 T;  3WTP E;  1P3G B;  1P3K A;  3AN2 B;  3WAA B;  5AV9 C;  4XUJ D;  4J8V D;  3KXB D;  3MNN D;  2XD1 A;  4H9R B;  1F66 B;  1EQZ C;  2LY8 A;  3A1K A;  3B6G D;  3AZL C;  2NZD B;  1KX4 D;  1M19 B;  1AOI C;  3MGR C;  5GXQ C;  5CPI C;  4H9P A;  5JRG D;  3WA9 C;  5B0Y D;  5C3I C;  4J8W D;  2Y2N A;  3AZJ C;  5B32 G;  2F8N H;  3AYW C;  4ZUX C;  3B0C T;  3AV1 D;  3REH B;  5BNV A;  1JFI B;  4CAY A;  3AV2 B;  2HIO A;  3AZH A;  1BH9 A;  5B31 G;  3UTB C;  3KWQ D;  3WKJ C;  3REK D;  5CP6 A;  5B0Z A;  4XZQ C;  5CPK D;  4YM6 B;  5B33 D;  3O62 A;  2CV5 B;  3B0B A;  4G92 C;  2Y2P A;  3MGP A;  4KGC B;  4M6B A;  2DQN C;  5GSU A;  2BYK A;  1HQ3 A;  3A6N C;  3MGQ B;  4Z66 C;  1P3I D;  1KX5 D;  3EPL A;  3LJA B;  4WU8 C;  3X1S D;  3TU4 C;  4QLC C;  3AN2 D;  1TZY B;  5AV6 A;  3X1U D;  5B32 B;  1F66 D;  5AY8 D;  2NZD D;  4AWL C;  4YS3 C;  5B31 B;  4R8P A;  1BFM A;  5AV8 D;  2Y2Q A;  3VH5 T;  5B2I B;  3H0M C;  2DF4 C;  4CSR A;  1T3U A;  1P3B C;  4WNN B;  4J8U B;  5B2J B;  4KHA B;  5AVB C;  4XUJ A;  1ZLA C;  4LD9 C;  4X23 D;  4J8V A;  3KXB A;  2YFV B;  3MNN A;  2ZY3 A;  3REJ C;  4ZBJ B;  1P3P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...