1BH8A

Htafii18/htafii28 heterodimer crystal structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation complex
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh8A00
2F8NG 3X1VC 3NQUA 3W99C 5BNXB 3WTPB 1WWSA 5GXQA 4R8PD 3UTBB 5C3IB 4NE6A 4KUDA 5CPJD 1M18D 1M1AB 1P3IA 4KGCB 3REJD 2PYOB 1B6WA 1TZYD 1P3BD 5CP6A 2BYMB 4CAYB 1KX5B 1F66C 5CPIC 5G49B 4AWLB 3LZ0C 4R8PB 1HQ3B 1AOIB 1P3PC 3B6FC 3B0DC 5B2IC 3MNNC 4XZQC 4X23A 4J8WD 3REJB 5B33D 1M19C 2HUEC 3REKD 3MGRC 1U35C 1P3BB 3MGSC 3KXBC 3AV1D 5JRGB 3AZLC 3UT9D 3AZJA 4QLCB 1TAFA 3NQJB 4YM6D 3AYWC 1P3KD 1KX3C 4LD9C 4DRBA 2NZDD 2JSSA 3REKB 1P3OC 4H9RA 3AZNB 5B31B 5GT0B 5CPKD 3X1SC 1EQZA 3AN2A 2RVQC 5AV5A 3MVDB 5AVCB 5B0YA 3RELC 5E5AC 3REHA 3X1UB 3C1CA 5KDMB 3UTAB 5AV6A 3WTPE 2NQBD 5AY8A 5AV8C 4WU8A 5BS7C 4YS3C 4Z5TB 4J8UC 1S32D 1Q9CA 4XUJC 3MGPD 3W97D 3AV2A 3AZKA 5GXQC 3AZED 5B24D 4KUDC 4H9NB 5CHLB 1P3IC 3X1VA 3B6GD 1P3GA 4E45A 5B1LA 1ID3D 5CPIB 5DNMD 5BO0B 3W97B 1BH9A 5DNNA 3LZ0B 3KWQD 3B6FB 1P3PB 3AZEB 4ZUXD 1M19B 2HUEB 4X23C 3VH5W 5B32D 1U35B 1F66A 3MGSB 4NE5A 3KXBB 1ID3B 5GT3D 1P3AD 3W96D 4E44A 3AZGD 1BH8A 4KHAA 3WA9C 3LJAC 3KWQB 4J8XB 3AZJC 1KX4D 1KX3B 3AZMA 3AZHD 4G92B 5B1MA 4WZSB 5B32B 5GSUD 3AZLA 2CV5D 5GT3B 1P3AB 3W96B 1P3FD 4Z66D 3AZGB 3LELD 3X1TA 5B40D 3AN2C 3AYWA 3KUYD 4LD9A 5AV5C 5B2JA 3C1BD 3VH6W 1A7WA 1JFIB 3WKJA 1P3OA 3VH5A 4WU9D 1P3MA 3REHC 1N1JA 3MGQA 5AV8B 3A6NA 3AZID 2CV5B 4J8VA 5CPJC 5AV6C 1M18C 1B67A 1P3FB 5AY8C 5B40B 4WU8C 2YFWA 3WTPD 5AVBA 3UTBD 5GXQB 3AV2C 3AZKC 4KUDB 3AZIB 4XUJA 3WAAA 4Z2MH 5CP6B 5B33C 1P3GC 5B1LC 3VH6A 4JJNA 5BT1C 4UUZB 1HQ3D 4HGAC 1AOID 5JA4A 5AV9D 2F8NK 5DNNC 3W98D 3UT9C 4X23B 2HIOA 4H9QA 2NZDC 1H3OB 5JRGD 1P3LA 3R45A 3REID 5AV9B 4QLCD 3O62D 3W98B 1F1EA 5B0YD 3B0CW 1TAFB 3AZMC 3AZND 5B0ZD 5B31D 5GT0D 5B1MC 4H9RB 3WA9A 3LJAA 1ZLAA 5F99A 1EQZB 3AFAD 2F8ND 3MVDD 5AVCD 3AN2B 2IO5C 3REIB 3X1TC 3O62B 5BNXA 5B0YB 5B2JC 2AROC 3X1UD 4G91B 3MGPC 3WKJC 3REHB 3UTAD 3C1CB 1M1AA 5B0ZB 4KGCA 1P3MC 3X1VD 4Z5TD 3W99D 5AY8B 3A6NC 3MGQC 2F8NB 3AFAB 2BYMA 4J8VC 4WU8B 3TU4C 1KX5A 3V9RA 5AVBC 5DNMC 4R8PA 3AV2B 3LZ1C 3AZKB 4H9OA 5CPJA 4ZBJC 3AZFC 1M18A 3REJA 2BYKA 3X1VB 5CPID 4ZUXC 1TZYA 1P3BA 3W99B 3WAAC 3LZ0D 3B6FD 1P3PD 4JJNC 5B2ID 3MNND 1BH9B 4XZQD 1M19D 3MGRD 4J8WA 1U35D 5B33A 3MGSD 3KXBD 3REKA 1F66B 2HIOC 2FJ7C 3AV1A 1P3LC 3UT9A 4J8XD 3B0DB 5B2IB 3MNNB 4XZQB 1KX3D 3LELC 1P34C 4YM6A 3MGRB 3KUYC 1P3KA 3AZMB 2NZDA 5KDMA 3X1SD 2RVQD 3AZLB 5CPKA 1ZLAC 1ULYA 5F99C 2IO5B 3RELD 3X1TB 4H9PA 3AYWB 5E5AD 4LD9B 1P3OB 3WTPC 3UTBC 5C3IC 5AV8D 3X1SB 2NQBA 1M1AC 1N1JB 4NFTA 4YS3D 4J8UD 3MGQB 4KGCC 4J8VB 2PYOC 1S32A 2AROA 3RELB 1KX5C 3MGPA 5BO0A 2YFWB 5GXQD 5E5AB 2YFVA 3W97A 5AVBB 4AWLC 4KUDD 4WNNA 3AZEA 4ZBJB 5FUGA 4R8PC 1P3ID 5B24A 3TU4A 4YS3B 3B6GA 1WWIA 4J8UB 5CP6D 3REJC 4XUJB 3NQUB 1TZYC 5DNMA 1P3BC 3LZ1A 3AZFA 3KWQA 3B0BA 5BNVA 4X23D 1P3IB 4ZUXA 4J8WC 2HIOB 4H9QB 2F8NA 3REKC 5GT3A 3W96A 3LJAD 1P3AA 5GT0C 3AZJD 3AV1C 3R45B 1R4VA 4Z2MG 5AVCC 1KX4A 1JFIA 3AZHA 2FJ7A 2F8NH 1BFMA 4YM6C 1P3KC 5GSUA 3X1UC 1EQZD 2CV5A 5B31G 3WA9B 3LJAB 3AN2D 1P3FA 4Z66A 1ZLAB 5AV5D 5F99B 3AZJB 5CPKC 3LELA 5B40A 4Z5TC 1P34A 3KUYA 3C1BA 3REHD 3C1CD 4WU9A 5AV6D 4CSRA 5AY8D 3AZIA 4WU8D 2NQBC 1KU5A 5AV5B 4DRAA 3V9RB 3WTPA 1S32C 4UUZA 3UTBA 3AZKD 3AV2D 3W97C 3VH5T 4H9OB 3AZEC 5CPJB 2L5AA 5AV6B 1M18B 4WV4B 2PYOA 5B24C 1P3GD 2BYKB 5B1LD 4CAYA 1H3OA 3B6GC 5G49A 1TZYB 5BT1D 1ID3C 5DNND 1HQ3A 1AOIA 4EO5C 5AV9A 3W98A 3KWQC 4J8XC 4J8WB 1F66D 5B33B 4G92C 1P3GB 5B1LB 5B32C 5JRGA 4HGAB 3VH6T 5GT3C 3W96C 5DNNB 3AV1B 1P3AC 3UT9B 3AZGC 3REIA 4QLCA 3O62A 3NQJA 3AZMD 1KX4C 5B1MD 4YM6B 2CWEA 1P3KB 2NZDB 3AZHC 3AZLD 3AZNA 4M6BA 5B32G 5B0ZA 5B31A 5GT0A 5GSUC 5CPKB 1BH8B 4KHAB 3X1TD 3AFAA 5AVCA 3MVDA 3AYWD 2CV5C 1P3FC 4Z66C 4LD9D 5B2JD 2AROD 5B40C 4H9PB 1P3OD 3WKJD 3X1UA 3C1BC 5B1MB 1P3MD 3UTAA 2LY8A 4H9SA 4WU9C 3MGQD 3A6ND 4J8VD 3TU4D 2NQBB 4Z5TA 3W99A 3AZIC 5AVBD 5CP6C 1S32B 5B2JB 2AROB 3LZ1D 3MGPB 3WKJB 2YFVB 3AZFD 1P3MB 4WNNB 4H9NA 5FUGB 5B24B 3A6NB 4XUJD 3TU4B 3WAAD 3B6GB 5CPIA 4JJND 5DNMB 3B0CT 3LZ0A 3LZ1B 3B6FA 1P3PA 4EO5B 5B2IA 3MNNA 4XZQA 3AZFB 1HQ3C 1AOIC 1M19A 5AV9C 3W98C 1HTAA 5BNVB 3MGRA 1U35A 2HIOD 4ZUXB 2FJ7D 3MGSA 3KXBA 1ID3A 3WAAB 1P3LD 4JJNB 5JRGC 4J8XA 5JA4B 1EQZC 1P34D 1KX3A 3REIC 1KX4B 4QLCC 3O62C 5B0YC 5B32A 3AZHB 4G91C 2FJ7B 4NE3A 3X1SA 3KSYA 3WA9D 5GSUB 3C1CC 3AZNC 5B0ZC 1P3LB 1ZLAD 5B31C 5F99D 3AZGA 4Z66B 3AFAC 3LELB 3MVDC 3RELA 1P34B 5E5AA 3KUYB 3C1BB 1M1AD 4KGCD 4WU9B 5AV8A 2PYOD 3UTAC 4H9SC 4CSRB 5BS7A 4YS3A 4J8UA 1KX5D
chains in the Genus database with same CATH superfamily
2F8NG 3X1VC 3NQUA 3W99C 5BNXB 3WTPB 1WWSA 5GXQA 4R8PD 3UTBB 5C3IB 4NE6A 4KUDA 5CPJD 1M18D 1M1AB 1P3IA 4KGCB 3REJD 2PYOB 1B6WA 1TZYD 1P3BD 5CP6A 2BYMB 4CAYB 1KX5B 1F66C 5CPIC 5G49B 4AWLB 3LZ0C 4R8PB 1HQ3B 1AOIB 1P3PC 3B6FC 3B0DC 5B2IC 3MNNC 4XZQC 4X23A 4J8WD 3REJB 5B33D 1M19C 2HUEC 4WJ3C 3REKD 3MGRC 1U35C 1P3BB 3MGSC 3KXBC 3AV1D 5JRGB 3AZLC 3UT9D 2JE5A 3AZJA 4QLCB 1TAFA 3NQJB 4YM6D 3AYWC 1P3KD 1KX3C 4LD9C 4DRBA 2NZDD 2JSSA 3REKB 1P3OC 4H9RA 3AZNB 5B31B 5GT0B 5CPKD 2W8SA 3X1SC 1EQZA 3AN2A 2RVQC 5AV5A 3MVDB 5AVCB 5B0YA 2UWXA 3RELC 5E5AC 3REHA 3X1UB 3C1CA 5KDMB 3UTAB 5AV6A 3WTPE 2NQBD 5AY8A 5AV8C 3EPHA 4WU8A 5BS7C 4YS3C 4Z5TB 4J8UC 1S32D 1Q9CA 4XUJC 3MGPD 3W97D 3AV2A 3AZKA 3IP4C 5GXQC 3AZED 5B24D 4KUDC 4H9NB 5CHLB 1P3IC 3X1VA 3B6GD 1P3GA 4E45A 5B1LA 1ID3D 5CPIB 5DNMD 5BO0B 3W97B 1BH9A 5DNNA 3LZ0B 3KWQD 3B6FB 1P3PB 2ZY4A 2XD5A 3AZEB 4ZUXD 1M19B 2HUEB 4X23C 3VH5W 5B32D 1U35B 1F66A 3MGSB 4NE5A 3KXBB 1ID3B 5GT3D 1P3AD 3W96D 4E44A 3AZGD 1BH8A 4KHAA 3WA9C 3LJAC 2G5IC 2DQNC 3KWQB 4J8XB 3AZJC 1KX4D 1KX3B 3AZMA 3AZHD 4G92B 2Y2LA 5B1MA 4WZSB 5B32B 5GSUD 3AZLA 2CV5D 5GT3B 1P3AB 3W96B 1P3FD 2Y2OA 4Z66D 3AZGB 3LELD 3X1TA 5B40D 3AN2C 3AYWA 3KUYD 4LD9A 5AV5C 5B2JA 3C1BD 3VH6W 1A7WA 1JFIB 3WKJA 1P3OA 3VH5A 1T3UA 3A1KA 4WU9D 1P3MA 3REHC 1N1JA 3MGQA 5AV8B 2Y2MA 3A6NA 3AZID 4J8VA 5CPJC 5AV6C 2CV5B 1M18C 1B67A 1P3FB 5AY8C 5B40B 4WU8C 2YFWA 3WTPD 5AVBA 3UTBD 5GXQB 3AV2C 3AZKC 4KUDB 2VQRA 3AZIB 4XUJA 3WAAA 4Z2MH 5CP6B 5B33C 1P3GC 5B1LC 3VH6A 4JJNA 5BT1C 4UUZB 1HQ3D 4HGAC 1AOID 5JA4A 5AV9D 2F8NK 5DNNC 3W98D 3UT9C 4X23B 2HIOA 4H9QA 3EPJA 2NZDC 1H3OB 5JRGD 1P3LA 3R45A 3REID 2ZM5A 5AV9B 4QLCD 3O62D 3W98B 1F1EA 5B0YD 3B0CW 1TAFB 3AZMC 3AZND 5B0ZD 5B31D 5GT0D 5B1MC 4H9RB 3WA9A 3LJAA 1ZLAA 5F99A 1EQZB 3AFAD 2XD1A 3MVDD 5AVCD 3AN2B 2F8ND 2IO5C 3REIB 3X1TC 3O62B 5BNXA 5B0YB 5B2JC 2AROC 3X1UD 4G91B 3MGPC 3WKJC 3REHB 3UTAD 3C1CB 1M1AA 5B0ZB 4KGCA 1P3MC 3H0RC 4Z5TD 3X1VD 3W99D 5AY8B 3A6NC 3MGQC 2F8NB 3AFAB 2BYMA 4J8VC 4WU8B 3TU4C 1KX5A 3V9RA 5AVBC 5DNMC 2ZY3A 4R8PA 3LZ1C 3AZKB 4H9OA 3AV2B 5CPJA 4ZBJC 3AZFC 1M18A 3REJA 2BYKA 2Y2PA 3X1VB 5CPID 4ZUXC 1TZYA 1P3BA 3W99B 3WAAC 3LZ0D 3B6FD 1P3PD 4JJNC 5B2ID 3MNND 1BH9B 4XZQD 1M19D 3MGRD 4J8WA 1U35D 5B33A 3MGSD 3KXBD 3REKA 1F66B 2HIOC 2FJ7C 3AV1A 1P3LC 3UT9A 4J8XD 3B0DB 5B2IB 3MNNB 4XZQB 1KX3D 3LELC 2Y2JA 4YM6A 3MGRB 3KUYC 1P34C 3AZMB 1P3KA 2NZDA 5KDMA 3X1SD 2RVQD 3AZLB 5CPKA 2F2AC 1ZLAC 1ULYA 2JCHA 5F99C 2IO5B 4UPKA 3RELD 2Y2IA 4H9PA 3X1TB 3AYWB 5E5AD 4LD9B 1P3OB 3WTPC 3UTBC 5C3IC 5AV8D 3X1SB 2NQBA 1M1AC 1N1JB 4NFTA 4YS3D 4J8UD 3MGQB 4KGCC 4J8VB 2PYOC 1S32A 2AROA 3RELB 1KX5C 3MGPA 5BO0A 2YFWB 5GXQD 5E5AB 2YFVA 3W97A 5AVBB 4AWLC 4KUDD 4WNNA 3AZEA 4ZBJB 5FUGA 4R8PC 1P3ID 5B24A 3TU4A 4YS3B 3B6GA 1WWIA 4J8UB 5CP6D 3REJC 4XUJB 3NQUB 1TZYC 5DNMA 1P3BC 3LZ1A 3AZFA 3KWQA 3B0BA 5BNVA 4X23D 1P3IB 4ZUXA 4J8WC 2HIOB 4H9QB 2F8NA 3REKC 3KFUG 5GT3A 3W96A 3LJAD 1P3AA 5GT0C 3AZJD 3AV1C 3R45B 1R4VA 4Z2MG 5AVCC 1KX4A 1JFIA 2RIQA 3AZHA 2FJ7A 2F8NH 1BFMA 4YM6C 1P3KC 5GSUA 3X1UC 1EQZD 2CV5A 5B31G 3WA9B 3LJAB 3AN2D 1P3FA 4Z66A 1ZLAB 5AV5D 5F99B 3AZJB 5CPKC 3LELA 5B40A 4Z5TC 1P34A 3KUYA 3C1BA 3AL0C 3REHD 3C1CD 4WU9A 3FDDA 5AV6D 3EPKA 4CSRA 5AY8D 3AZIA 4WU8D 2NQBC 1KU5A 5AV5B 4DRAA 3V9RB 3WTPA 1S32C 4UUZA 3UTBA 3AZKD 3AV2D 3W97C 2Y2KA 3VH5T 4H9OB 3AZEC 5CPJB 2L5AA 5AV6B 1M18B 4WV4B 2PYOA 5B24C 1P3GD 2BYKB 5B1LD 4CAYA 1H3OA 3B6GC 5G49A 5BT1D 1TZYB 1ID3C 3H0LC 5DNND 1HQ3A 1AOIA 4EO5C 5AV9A 3W98A 3KWQC 4J8XC 4J8WB 1F66D 5B33B 4G92C 1P3GB 5B1LB 5B32C 1Z2CB 5JRGA 4HGAB 3VH6T 5GT3C 3W96C 5DNNB 3AV1B 1P3AC 3UT9B 3P5JB 3AZGC 3REIA 4QLCA 1PZRA 3NQJA 3O62A 3AZMD 1KX4C 5B1MD 2Y2QA 2CWEA 4YM6B 1P3KB 2NZDB 3AZHC 3AZLD 3AZNA 4M6BA 2Y2NA 3F6TA 5B32G 5B31A 5GT0A 5B0ZA 5GSUC 5CPKB 1BH8B 4KHAB 3X1TD 3AFAA 5AVCA 3MVDA 3AYWD 2CV5C 1P3FC 4Z66C 4LD9D 5B2JD 2AROD 5B40C 4H9PB 1P3OD 3WKJD 3X1UA 2ZY5A 3C1BC 5B1MB 1P3MD 3UTAA 2LY8A 4H9SA 4WU9C 3MGQD 3A6ND 4J8VD 3TU4D 2NQBB 2G5HC 4Z5TA 3W99A 3AZIC 5AVBD 5CP6C 1S32B 5B2JB 2AROB 3LZ1D 3MGPB 3WKJB 2YFVB 3AZFD 1P3MB 4WNNB 4H9NA 5FUGB 1W2EA 5B24B 3A6NB 4XUJD 3TU4B 2DF4C 3WAAD 3B6GB 5CPIA 4JJND 2J8PA 5DNMB 3B0CT 3LZ0A 3LZ1B 3H0MC 4DQYB 1P3PA 4EO5B 5B2IA 3MNNA 3B6FA 4XZQA 3AZFB 1HQ3C 1AOIC 2Y2HA 1M19A 5AV9C 3W98C 1HTAA 5BNVB 3MGRA 1U35A 2HIOD 4ZUXB 3EPLA 2FJ7D 3MGSA 3KXBA 1ID3A 3WAAB 2BG1A 1P3LD 4JJNB 5JRGC 3A1IA 2FFFB 4J8XA 5JA4B 1EQZC 1P34D 3EG5B 1KX3A 3REIC 1KX4B 4QLCC 2ZY2A 3O62C 5B0YC 5B32A 3AZHB 4G91C 2FJ7B 4NE3A 3X1SA 3KSYA 2Y2GA 3WA9D 5GSUB 3C1CC 3AZNC 5B0ZC 1P3LB 1ZLAD 5B31C 5F99D 3AZGA 4Z66B 3AFAC 3LELB 3MVDC 3RELA 1P34B 5E5AA 3KUYB 3C1BB 1M1AD 4KGCD 4WU9B 5AV8A 2PYOD 3UTAC 4H9SC 4CSRB 5BS7A 4YS3A 4J8UA 1KX5D
chains in the Genus database with same CATH topology
2F8NG 3X1VC 3NQUA 3W99C 5BNXB 3WTPB 1WWSA 5GXQA 4R8PD 3UTBB 5C3IB 4NE6A 4KUDA 5CPJD 1M18D 1M1AB 1P3IA 4KGCB 3REJD 2PYOB 1B6WA 1TZYD 1P3BD 5CP6A 2BYMB 4CAYB 1KX5B 1F66C 5CPIC 5G49B 4AWLB 3LZ0C 4R8PB 1HQ3B 1AOIB 1P3PC 3B6FC 3B0DC 5B2IC 3MNNC 4XZQC 4X23A 4J8WD 3REJB 5B33D 1M19C 2HUEC 4WJ3C 3REKD 3MGRC 1U35C 1P3BB 3MGSC 3KXBC 3AV1D 5JRGB 3AZLC 3UT9D 2JE5A 3AZJA 4QLCB 1TAFA 3NQJB 4YM6D 3AYWC 1P3KD 1KX3C 4LD9C 4DRBA 2NZDD 2JSSA 3REKB 1P3OC 4H9RA 3AZNB 5B31B 5GT0B 5CPKD 2W8SA 3X1SC 1EQZA 3AN2A 2RVQC 5AV5A 3MVDB 5AVCB 5B0YA 2UWXA 3RELC 5E5AC 3REHA 3X1UB 3C1CA 5KDMB 3UTAB 5AV6A 3WTPE 2NQBD 5AY8A 5AV8C 3EPHA 4WU8A 5BS7C 4YS3C 4Z5TB 4J8UC 1S32D 1Q9CA 4XUJC 3MGPD 3W97D 3AV2A 3AZKA 3IP4C 5GXQC 3AZED 5B24D 4KUDC 4H9NB 5CHLB 1P3IC 3X1VA 3B6GD 1P3GA 4E45A 5B1LA 1ID3D 5CPIB 5DNMD 5BO0B 3W97B 1BH9A 5DNNA 3LZ0B 3KWQD 3B6FB 1P3PB 2ZY4A 2XD5A 3AZEB 4ZUXD 1M19B 2HUEB 4X23C 3VH5W 5B32D 1U35B 1F66A 3MGSB 4NE5A 3KXBB 1ID3B 5GT3D 1P3AD 3W96D 4E44A 3AZGD 1BH8A 4KHAA 3WA9C 3LJAC 2G5IC 2DQNC 3KWQB 4J8XB 3AZJC 1KX4D 1KX3B 3AZMA 3AZHD 4G92B 2Y2LA 5B1MA 4WZSB 5B32B 5GSUD 3AZLA 2CV5D 5GT3B 1P3AB 3W96B 1P3FD 2Y2OA 4Z66D 3AZGB 3LELD 3X1TA 5B40D 3AN2C 3AYWA 3KUYD 4LD9A 5AV5C 5B2JA 3C1BD 3VH6W 1A7WA 1JFIB 3WKJA 1P3OA 3VH5A 1T3UA 3A1KA 4WU9D 1P3MA 3REHC 1N1JA 3MGQA 5AV8B 2Y2MA 3A6NA 3AZID 4J8VA 5CPJC 5AV6C 2CV5B 1M18C 1B67A 1P3FB 5AY8C 5B40B 4WU8C 2YFWA 3WTPD 5AVBA 3UTBD 5GXQB 3AV2C 3AZKC 4KUDB 2VQRA 3AZIB 4XUJA 3WAAA 4Z2MH 5CP6B 5B33C 1P3GC 5B1LC 3VH6A 4JJNA 5BT1C 4UUZB 1HQ3D 4HGAC 1AOID 5JA4A 5AV9D 2F8NK 5DNNC 3W98D 3UT9C 4X23B 2HIOA 4H9QA 3EPJA 2NZDC 1H3OB 5JRGD 1P3LA 3R45A 3REID 2ZM5A 5AV9B 4QLCD 3O62D 3W98B 1F1EA 5B0YD 3B0CW 1TAFB 3AZMC 3AZND 5B0ZD 5B31D 5GT0D 5B1MC 4H9RB 3WA9A 3LJAA 1ZLAA 5F99A 1EQZB 3AFAD 2XD1A 3MVDD 5AVCD 3AN2B 2F8ND 2IO5C 3REIB 3X1TC 3O62B 5BNXA 5B0YB 5B2JC 2AROC 3X1UD 4G91B 3MGPC 3WKJC 3REHB 3UTAD 3C1CB 1M1AA 5B0ZB 4KGCA 1P3MC 3H0RC 4Z5TD 3X1VD 3W99D 5AY8B 3A6NC 3MGQC 2F8NB 3AFAB 2BYMA 4J8VC 4WU8B 3TU4C 1KX5A 3V9RA 5AVBC 5DNMC 2ZY3A 4R8PA 3LZ1C 3AZKB 4H9OA 3AV2B 5CPJA 4ZBJC 3AZFC 1M18A 3REJA 2BYKA 2Y2PA 3X1VB 5CPID 4ZUXC 1TZYA 1P3BA 3W99B 3WAAC 3LZ0D 3B6FD 1P3PD 4JJNC 5B2ID 3MNND 1BH9B 4XZQD 1M19D 3MGRD 4J8WA 1U35D 5B33A 3MGSD 3KXBD 3REKA 1F66B 2HIOC 2FJ7C 3AV1A 1P3LC 3UT9A 4J8XD 3B0DB 5B2IB 3MNNB 4XZQB 1KX3D 3LELC 2Y2JA 4YM6A 3MGRB 3KUYC 1P34C 3AZMB 1P3KA 2NZDA 5KDMA 3X1SD 2RVQD 3AZLB 5CPKA 2F2AC 1ZLAC 1ULYA 2JCHA 5F99C 2IO5B 4UPKA 3RELD 2Y2IA 4H9PA 3X1TB 3AYWB 5E5AD 4LD9B 1P3OB 3WTPC 3UTBC 5C3IC 5AV8D 3X1SB 2NQBA 1M1AC 1N1JB 4NFTA 4YS3D 4J8UD 3MGQB 4KGCC 4J8VB 2PYOC 1S32A 2AROA 3RELB 1KX5C 3MGPA 5BO0A 2YFWB 5GXQD 5E5AB 2YFVA 3W97A 5AVBB 4AWLC 4KUDD 4WNNA 3AZEA 4ZBJB 5FUGA 4R8PC 1P3ID 5B24A 3TU4A 4YS3B 3B6GA 1WWIA 4J8UB 5CP6D 3REJC 4XUJB 3NQUB 1TZYC 5DNMA 1P3BC 3LZ1A 3AZFA 3KWQA 3B0BA 5BNVA 4X23D 1P3IB 4ZUXA 4J8WC 2HIOB 4H9QB 2F8NA 3REKC 3KFUG 5GT3A 3W96A 3LJAD 1P3AA 5GT0C 3AZJD 3AV1C 3R45B 1R4VA 4Z2MG 5AVCC 1KX4A 1JFIA 2RIQA 3AZHA 2FJ7A 2F8NH 1BFMA 4YM6C 1P3KC 5GSUA 3X1UC 1EQZD 2CV5A 5B31G 3WA9B 3LJAB 3AN2D 1P3FA 4Z66A 1ZLAB 5AV5D 5F99B 3AZJB 5CPKC 3LELA 5B40A 4Z5TC 1P34A 3KUYA 3C1BA 3AL0C 3REHD 3C1CD 4WU9A 3FDDA 5AV6D 3EPKA 4CSRA 5AY8D 3AZIA 4WU8D 2NQBC 1KU5A 5AV5B 4DRAA 3V9RB 3WTPA 1S32C 4UUZA 3UTBA 3AZKD 3AV2D 3W97C 2Y2KA 3VH5T 4H9OB 3AZEC 5CPJB 2L5AA 5AV6B 1M18B 4WV4B 2PYOA 5B24C 1P3GD 2BYKB 5B1LD 4CAYA 1H3OA 3B6GC 5G49A 5BT1D 1TZYB 1ID3C 3H0LC 5DNND 1HQ3A 1AOIA 4EO5C 5AV9A 3W98A 3KWQC 4J8XC 4J8WB 1F66D 5B33B 4G92C 1P3GB 5B1LB 5B32C 1Z2CB 5JRGA 4HGAB 3VH6T 5GT3C 3W96C 5DNNB 3AV1B 1P3AC 3UT9B 3P5JB 3AZGC 3REIA 4QLCA 1PZRA 3NQJA 3O62A 3AZMD 1KX4C 5B1MD 2Y2QA 2CWEA 4YM6B 1P3KB 2NZDB 3AZHC 3AZLD 3AZNA 4M6BA 2Y2NA 3F6TA 5B32G 5B31A 5GT0A 5B0ZA 5GSUC 5CPKB 1BH8B 4KHAB 3X1TD 3AFAA 5AVCA 3MVDA 3AYWD 2CV5C 1P3FC 4Z66C 4LD9D 5B2JD 2AROD 5B40C 4H9PB 1P3OD 3WKJD 3X1UA 2ZY5A 3C1BC 5B1MB 1P3MD 3UTAA 2LY8A 4H9SA 4WU9C 3MGQD 3A6ND 4J8VD 3TU4D 2NQBB 2G5HC 4Z5TA 3W99A 3AZIC 5AVBD 5CP6C 1S32B 5B2JB 2AROB 3LZ1D 3MGPB 3WKJB 2YFVB 3AZFD 1P3MB 4WNNB 4H9NA 5FUGB 1W2EA 5B24B 3A6NB 4XUJD 3TU4B 2DF4C 3WAAD 3B6GB 5CPIA 4JJND 2J8PA 5DNMB 3B0CT 3LZ0A 3LZ1B 3H0MC 4DQYB 1P3PA 4EO5B 5B2IA 3MNNA 3B6FA 4XZQA 3AZFB 1HQ3C 1AOIC 2Y2HA 1M19A 5AV9C 3W98C 1HTAA 5BNVB 3MGRA 1U35A 2HIOD 4ZUXB 3EPLA 2FJ7D 3MGSA 3KXBA 1ID3A 3WAAB 2BG1A 1P3LD 4JJNB 5JRGC 3A1IA 2FFFB 4J8XA 5JA4B 1EQZC 1P34D 3EG5B 1KX3A 3REIC 1KX4B 4QLCC 2ZY2A 3O62C 5B0YC 5B32A 3AZHB 4G91C 2FJ7B 4NE3A 3X1SA 3KSYA 2Y2GA 3WA9D 5GSUB 3C1CC 3AZNC 5B0ZC 1P3LB 1ZLAD 5B31C 5F99D 3AZGA 4Z66B 3AFAC 3LELB 3MVDC 3RELA 1P34B 5E5AA 3KUYB 3C1BB 1M1AD 4KGCD 4WU9B 5AV8A 2PYOD 3UTAC 4H9SC 4CSRB 5BS7A 4YS3A 4J8UA 1KX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N G;  3X1V C;  3NQU A;  3W99 C;  5BNX B;  3WTP B;  1WWS A;  5GXQ A;  4R8P D;  3UTB B;  5C3I B;  4NE6 A;  4KUD A;  5CPJ D;  1M18 D;  1M1A B;  1P3I A;  4KGC B;  3REJ D;  2PYO B;  1B6W A;  1TZY D;  1P3B D;  5CP6 A;  2BYM B;  4CAY B;  1KX5 B;  1F66 C;  5CPI C;  5G49 B;  4AWL B;  3LZ0 C;  4R8P B;  1HQ3 B;  1AOI B;  1P3P C;  3B6F C;  3B0D C;  5B2I C;  3MNN C;  4XZQ C;  4X23 A;  4J8W D;  3REJ B;  5B33 D;  1M19 C;  2HUE C;  3REK D;  3MGR C;  1U35 C;  1P3B B;  3MGS C;  3KXB C;  3AV1 D;  5JRG B;  3AZL C;  3UT9 D;  3AZJ A;  4QLC B;  1TAF A;  3NQJ B;  4YM6 D;  3AYW C;  1P3K D;  1KX3 C;  4LD9 C;  4DRB A;  2NZD D;  2JSS A;  3REK B;  1P3O C;  4H9R A;  3AZN B;  5B31 B;  5GT0 B;  5CPK D;  3X1S C;  1EQZ A;  3AN2 A;  2RVQ C;  5AV5 A;  3MVD B;  5AVC B;  5B0Y A;  3REL C;  5E5A C;  3REH A;  3X1U B;  3C1C A;  5KDM B;  3UTA B;  5AV6 A;  3WTP E;  2NQB D;  5AY8 A;  5AV8 C;  4WU8 A;  5BS7 C;  4YS3 C;  4Z5T B;  4J8U C;  1S32 D;  1Q9C A;  4XUJ C;  3MGP D;  3W97 D;  3AV2 A;  3AZK A;  5GXQ C;  3AZE D;  5B24 D;  4KUD C;  4H9N B;  5CHL B;  1P3I C;  3X1V A;  3B6G D;  1P3G A;  4E45 A;  5B1L A;  1ID3 D;  5CPI B;  5DNM D;  5BO0 B;  3W97 B;  1BH9 A;  5DNN A;  3LZ0 B;  3KWQ D;  3B6F B;  1P3P B;  3AZE B;  4ZUX D;  1M19 B;  2HUE B;  4X23 C;  3VH5 W;  5B32 D;  1U35 B;  1F66 A;  3MGS B;  4NE5 A;  3KXB B;  1ID3 B;  5GT3 D;  1P3A D;  3W96 D;  4E44 A;  3AZG D;  1BH8 A;  4KHA A;  3WA9 C;  3LJA C;  3KWQ B;  4J8X B;  3AZJ C;  1KX4 D;  1KX3 B;  3AZM A;  3AZH D;  4G92 B;  5B1M A;  4WZS B;  5B32 B;  5GSU D;  3AZL A;  2CV5 D;  5GT3 B;  1P3A B;  3W96 B;  1P3F D;  4Z66 D;  3AZG B;  3LEL D;  3X1T A;  5B40 D;  3AN2 C;  3AYW A;  3KUY D;  4LD9 A;  5AV5 C;  5B2J A;  3C1B D;  3VH6 W;  1A7W A;  1JFI B;  3WKJ A;  1P3O A;  3VH5 A;  4WU9 D;  1P3M A;  3REH C;  1N1J A;  3MGQ A;  5AV8 B;  3A6N A;  3AZI D;  2CV5 B;  4J8V A;  5CPJ C;  5AV6 C;  1M18 C;  1B67 A;  1P3F B;  5AY8 C;  5B40 B;  4WU8 C;  2YFW A;  3WTP D;  5AVB A;  3UTB D;  5GXQ B;  3AV2 C;  3AZK C;  4KUD B;  3AZI B;  4XUJ A;  3WAA A;  4Z2M H;  5CP6 B;  5B33 C;  1P3G C;  5B1L C;  3VH6 A;  4JJN A;  5BT1 C;  4UUZ B;  1HQ3 D;  4HGA C;  1AOI D;  5JA4 A;  5AV9 D;  2F8N K;  5DNN C;  3W98 D;  3UT9 C;  4X23 B;  2HIO A;  4H9Q A;  2NZD C;  1H3O B;  5JRG D;  1P3L A;  3R45 A;  3REI D;  5AV9 B;  4QLC D;  3O62 D;  3W98 B;  1F1E A;  5B0Y D;  3B0C W;  1TAF B;  3AZM C;  3AZN D;  5B0Z D;  5B31 D;  5GT0 D;  5B1M C;  4H9R B;  3WA9 A;  3LJA A;  1ZLA A;  5F99 A;  1EQZ B;  3AFA D;  2F8N D;  3MVD D;  5AVC D;  3AN2 B;  2IO5 C;  3REI B;  3X1T C;  3O62 B;  5BNX A;  5B0Y B;  5B2J C;  2ARO C;  3X1U D;  4G91 B;  3MGP C;  3WKJ C;  3REH B;  3UTA D;  3C1C B;  1M1A A;  5B0Z B;  4KGC A;  1P3M C;  3X1V D;  4Z5T D;  3W99 D;  5AY8 B;  3A6N C;  3MGQ C;  2F8N B;  3AFA B;  2BYM A;  4J8V C;  4WU8 B;  3TU4 C;  1KX5 A;  3V9R A;  5AVB C;  5DNM C;  4R8P A;  3AV2 B;  3LZ1 C;  3AZK B;  4H9O A;  5CPJ A;  4ZBJ C;  3AZF C;  1M18 A;  3REJ A;  2BYK A;  3X1V B;  5CPI D;  4ZUX C;  1TZY A;  1P3B A;  3W99 B;  3WAA C;  3LZ0 D;  3B6F D;  1P3P D;  4JJN C;  5B2I D;  3MNN D;  1BH9 B;  4XZQ D;  1M19 D;  3MGR D;  4J8W A;  1U35 D;  5B33 A;  3MGS D;  3KXB D;  3REK A;  1F66 B;  2HIO C;  2FJ7 C;  3AV1 A;  1P3L C;  3UT9 A;  4J8X D;  3B0D B;  5B2I B;  3MNN B;  4XZQ B;  1KX3 D;  3LEL C;  1P34 C;  4YM6 A;  3MGR B;  3KUY C;  1P3K A;  3AZM B;  2NZD A;  5KDM A;  3X1S D;  2RVQ D;  3AZL B;  5CPK A;  1ZLA C;  1ULY A;  5F99 C;  2IO5 B;  3REL D;  3X1T B;  4H9P A;  3AYW B;  5E5A D;  4LD9 B;  1P3O B;  3WTP C;  3UTB C;  5C3I C;  5AV8 D;  3X1S B;  2NQB A;  1M1A C;  1N1J B;  4NFT A;  4YS3 D;  4J8U D;  3MGQ B;  4KGC C;  4J8V B;  2PYO C;  1S32 A;  2ARO A;  3REL B;  1KX5 C;  3MGP A;  5BO0 A;  2YFW B;  5GXQ D;  5E5A B;  2YFV A;  3W97 A;  5AVB B;  4AWL C;  4KUD D;  4WNN A;  3AZE A;  4ZBJ B;  5FUG A;  4R8P C;  1P3I D;  5B24 A;  3TU4 A;  4YS3 B;  3B6G A;  1WWI A;  4J8U B;  5CP6 D;  3REJ C;  4XUJ B;  3NQU B;  1TZY C;  5DNM A;  1P3B C;  3LZ1 A;  3AZF A;  3KWQ A;  3B0B A;  5BNV A;  4X23 D;  1P3I B;  4ZUX A;  4J8W C;  2HIO B;  4H9Q B;  2F8N A;  3REK C;  5GT3 A;  3W96 A;  3LJA D;  1P3A A;  5GT0 C;  3AZJ D;  3AV1 C;  3R45 B;  1R4V A;  4Z2M G;  5AVC C;  1KX4 A;  1JFI A;  3AZH A;  2FJ7 A;  2F8N H;  1BFM A;  4YM6 C;  1P3K C;  5GSU A;  3X1U C;  1EQZ D;  2CV5 A;  5B31 G;  3WA9 B;  3LJA B;  3AN2 D;  1P3F A;  4Z66 A;  1ZLA B;  5AV5 D;  5F99 B;  3AZJ B;  5CPK C;  3LEL A;  5B40 A;  4Z5T C;  1P34 A;  3KUY A;  3C1B A;  3REH D;  3C1C D;  4WU9 A;  5AV6 D;  4CSR A;  5AY8 D;  3AZI A;  4WU8 D;  2NQB C;  1KU5 A;  5AV5 B;  4DRA A;  3V9R B;  3WTP A;  1S32 C;  4UUZ A;  3UTB A;  3AZK D;  3AV2 D;  3W97 C;  3VH5 T;  4H9O B;  3AZE C;  5CPJ B;  2L5A A;  5AV6 B;  1M18 B;  4WV4 B;  2PYO A;  5B24 C;  1P3G D;  2BYK B;  5B1L D;  4CAY A;  1H3O A;  3B6G C;  5G49 A;  1TZY B;  5BT1 D;  1ID3 C;  5DNN D;  1HQ3 A;  1AOI A;  4EO5 C;  5AV9 A;  3W98 A;  3KWQ C;  4J8X C;  4J8W B;  1F66 D;  5B33 B;  4G92 C;  1P3G B;  5B1L B;  5B32 C;  5JRG A;  4HGA B;  3VH6 T;  5GT3 C;  3W96 C;  5DNN B;  3AV1 B;  1P3A C;  3UT9 B;  3AZG C;  3REI A;  4QLC A;  3O62 A;  3NQJ A;  3AZM D;  1KX4 C;  5B1M D;  4YM6 B;  2CWE A;  1P3K B;  2NZD B;  3AZH C;  3AZL D;  3AZN A;  4M6B A;  5B32 G;  5B0Z A;  5B31 A;  5GT0 A;  5GSU C;  5CPK B;  1BH8 B;  4KHA B;  3X1T D;  3AFA A;  5AVC A;  3MVD A;  3AYW D;  2CV5 C;  1P3F C;  4Z66 C;  4LD9 D;  5B2J D;  2ARO D;  5B40 C;  4H9P B;  1P3O D;  3WKJ D;  3X1U A;  3C1B C;  5B1M B;  1P3M D;  3UTA A;  2LY8 A;  4H9S A;  4WU9 C;  3MGQ D;  3A6N D;  4J8V D;  3TU4 D;  2NQB B;  4Z5T A;  3W99 A;  3AZI C;  5AVB D;  5CP6 C;  1S32 B;  5B2J B;  2ARO B;  3LZ1 D;  3MGP B;  3WKJ B;  2YFV B;  3AZF D;  1P3M B;  4WNN B;  4H9N A;  5FUG B;  5B24 B;  3A6N B;  4XUJ D;  3TU4 B;  3WAA D;  3B6G B;  5CPI A;  4JJN D;  5DNM B;  3B0C T;  3LZ0 A;  3LZ1 B;  3B6F A;  1P3P A;  4EO5 B;  5B2I A;  3MNN A;  4XZQ A;  3AZF B;  1HQ3 C;  1AOI C;  1M19 A;  5AV9 C;  3W98 C;  1HTA A;  5BNV B;  3MGR A;  1U35 A;  2HIO D;  4ZUX B;  2FJ7 D;  3MGS A;  3KXB A;  1ID3 A;  3WAA B;  1P3L D;  4JJN B;  5JRG C;  4J8X A;  5JA4 B;  1EQZ C;  1P34 D;  1KX3 A;  3REI C;  1KX4 B;  4QLC C;  3O62 C;  5B0Y C;  5B32 A;  3AZH B;  4G91 C;  2FJ7 B;  4NE3 A;  3X1S A;  3KSY A;  3WA9 D;  5GSU B;  3C1C C;  3AZN C;  5B0Z C;  1P3L B;  1ZLA D;  5B31 C;  5F99 D;  3AZG A;  4Z66 B;  3AFA C;  3LEL B;  3MVD C;  3REL A;  1P34 B;  5E5A A;  3KUY B;  3C1B B;  1M1A D;  4KGC D;  4WU9 B;  5AV8 A;  2PYO D;  3UTA C;  4H9S C;  4CSR B;  5BS7 A;  4YS3 A;  4J8U A;  1KX5 D; 
#chains in the Genus database with same CATH topology
 2F8N G;  3X1V C;  3NQU A;  3W99 C;  5BNX B;  3WTP B;  1WWS A;  5GXQ A;  4R8P D;  3UTB B;  5C3I B;  4NE6 A;  4KUD A;  5CPJ D;  1M18 D;  1M1A B;  1P3I A;  4KGC B;  3REJ D;  2PYO B;  1B6W A;  1TZY D;  1P3B D;  5CP6 A;  2BYM B;  4CAY B;  1KX5 B;  1F66 C;  5CPI C;  5G49 B;  4AWL B;  3LZ0 C;  4R8P B;  1HQ3 B;  1AOI B;  1P3P C;  3B6F C;  3B0D C;  5B2I C;  3MNN C;  4XZQ C;  4X23 A;  4J8W D;  3REJ B;  5B33 D;  1M19 C;  2HUE C;  4WJ3 C;  3REK D;  3MGR C;  1U35 C;  1P3B B;  3MGS C;  3KXB C;  3AV1 D;  5JRG B;  3AZL C;  3UT9 D;  2JE5 A;  3AZJ A;  4QLC B;  1TAF A;  3NQJ B;  4YM6 D;  3AYW C;  1P3K D;  1KX3 C;  4LD9 C;  4DRB A;  2NZD D;  2JSS A;  3REK B;  1P3O C;  4H9R A;  3AZN B;  5B31 B;  5GT0 B;  5CPK D;  2W8S A;  3X1S C;  1EQZ A;  3AN2 A;  2RVQ C;  5AV5 A;  3MVD B;  5AVC B;  5B0Y A;  2UWX A;  3REL C;  5E5A C;  3REH A;  3X1U B;  3C1C A;  5KDM B;  3UTA B;  5AV6 A;  3WTP E;  2NQB D;  5AY8 A;  5AV8 C;  3EPH A;  4WU8 A;  5BS7 C;  4YS3 C;  4Z5T B;  4J8U C;  1S32 D;  1Q9C A;  4XUJ C;  3MGP D;  3W97 D;  3AV2 A;  3AZK A;  3IP4 C;  5GXQ C;  3AZE D;  5B24 D;  4KUD C;  4H9N B;  5CHL B;  1P3I C;  3X1V A;  3B6G D;  1P3G A;  4E45 A;  5B1L A;  1ID3 D;  5CPI B;  5DNM D;  5BO0 B;  3W97 B;  1BH9 A;  5DNN A;  3LZ0 B;  3KWQ D;  3B6F B;  1P3P B;  2ZY4 A;  2XD5 A;  3AZE B;  4ZUX D;  1M19 B;  2HUE B;  4X23 C;  3VH5 W;  5B32 D;  1U35 B;  1F66 A;  3MGS B;  4NE5 A;  3KXB B;  1ID3 B;  5GT3 D;  1P3A D;  3W96 D;  4E44 A;  3AZG D;  1BH8 A;  4KHA A;  3WA9 C;  3LJA C;  2G5I C;  2DQN C;  3KWQ B;  4J8X B;  3AZJ C;  1KX4 D;  1KX3 B;  3AZM A;  3AZH D;  4G92 B;  2Y2L A;  5B1M A;  4WZS B;  5B32 B;  5GSU D;  3AZL A;  2CV5 D;  5GT3 B;  1P3A B;  3W96 B;  1P3F D;  2Y2O A;  4Z66 D;  3AZG B;  3LEL D;  3X1T A;  5B40 D;  3AN2 C;  3AYW A;  3KUY D;  4LD9 A;  5AV5 C;  5B2J A;  3C1B D;  3VH6 W;  1A7W A;  1JFI B;  3WKJ A;  1P3O A;  3VH5 A;  1T3U A;  3A1K A;  4WU9 D;  1P3M A;  3REH C;  1N1J A;  3MGQ A;  5AV8 B;  2Y2M A;  3A6N A;  3AZI D;  4J8V A;  5CPJ C;  5AV6 C;  2CV5 B;  1M18 C;  1B67 A;  1P3F B;  5AY8 C;  5B40 B;  4WU8 C;  2YFW A;  3WTP D;  5AVB A;  3UTB D;  5GXQ B;  3AV2 C;  3AZK C;  4KUD B;  2VQR A;  3AZI B;  4XUJ A;  3WAA A;  4Z2M H;  5CP6 B;  5B33 C;  1P3G C;  5B1L C;  3VH6 A;  4JJN A;  5BT1 C;  4UUZ B;  1HQ3 D;  4HGA C;  1AOI D;  5JA4 A;  5AV9 D;  2F8N K;  5DNN C;  3W98 D;  3UT9 C;  4X23 B;  2HIO A;  4H9Q A;  3EPJ A;  2NZD C;  1H3O B;  5JRG D;  1P3L A;  3R45 A;  3REI D;  2ZM5 A;  5AV9 B;  4QLC D;  3O62 D;  3W98 B;  1F1E A;  5B0Y D;  3B0C W;  1TAF B;  3AZM C;  3AZN D;  5B0Z D;  5B31 D;  5GT0 D;  5B1M C;  4H9R B;  3WA9 A;  3LJA A;  1ZLA A;  5F99 A;  1EQZ B;  3AFA D;  2XD1 A;  3MVD D;  5AVC D;  3AN2 B;  2F8N D;  2IO5 C;  3REI B;  3X1T C;  3O62 B;  5BNX A;  5B0Y B;  5B2J C;  2ARO C;  3X1U D;  4G91 B;  3MGP C;  3WKJ C;  3REH B;  3UTA D;  3C1C B;  1M1A A;  5B0Z B;  4KGC A;  1P3M C;  3H0R C;  4Z5T D;  3X1V D;  3W99 D;  5AY8 B;  3A6N C;  3MGQ C;  2F8N B;  3AFA B;  2BYM A;  4J8V C;  4WU8 B;  3TU4 C;  1KX5 A;  3V9R A;  5AVB C;  5DNM C;  2ZY3 A;  4R8P A;  3LZ1 C;  3AZK B;  4H9O A;  3AV2 B;  5CPJ A;  4ZBJ C;  3AZF C;  1M18 A;  3REJ A;  2BYK A;  2Y2P A;  3X1V B;  5CPI D;  4ZUX C;  1TZY A;  1P3B A;  3W99 B;  3WAA C;  3LZ0 D;  3B6F D;  1P3P D;  4JJN C;  5B2I D;  3MNN D;  1BH9 B;  4XZQ D;  1M19 D;  3MGR D;  4J8W A;  1U35 D;  5B33 A;  3MGS D;  3KXB D;  3REK A;  1F66 B;  2HIO C;  2FJ7 C;  3AV1 A;  1P3L C;  3UT9 A;  4J8X D;  3B0D B;  5B2I B;  3MNN B;  4XZQ B;  1KX3 D;  3LEL C;  2Y2J A;  4YM6 A;  3MGR B;  3KUY C;  1P34 C;  3AZM B;  1P3K A;  2NZD A;  5KDM A;  3X1S D;  2RVQ D;  3AZL B;  5CPK A;  2F2A C;  1ZLA C;  1ULY A;  2JCH A;  5F99 C;  2IO5 B;  4UPK A;  3REL D;  2Y2I A;  4H9P A;  3X1T B;  3AYW B;  5E5A D;  4LD9 B;  1P3O B;  3WTP C;  3UTB C;  5C3I C;  5AV8 D;  3X1S B;  2NQB A;  1M1A C;  1N1J B;  4NFT A;  4YS3 D;  4J8U D;  3MGQ B;  4KGC C;  4J8V B;  2PYO C;  1S32 A;  2ARO A;  3REL B;  1KX5 C;  3MGP A;  5BO0 A;  2YFW B;  5GXQ D;  5E5A B;  2YFV A;  3W97 A;  5AVB B;  4AWL C;  4KUD D;  4WNN A;  3AZE A;  4ZBJ B;  5FUG A;  4R8P C;  1P3I D;  5B24 A;  3TU4 A;  4YS3 B;  3B6G A;  1WWI A;  4J8U B;  5CP6 D;  3REJ C;  4XUJ B;  3NQU B;  1TZY C;  5DNM A;  1P3B C;  3LZ1 A;  3AZF A;  3KWQ A;  3B0B A;  5BNV A;  4X23 D;  1P3I B;  4ZUX A;  4J8W C;  2HIO B;  4H9Q B;  2F8N A;  3REK C;  3KFU G;  5GT3 A;  3W96 A;  3LJA D;  1P3A A;  5GT0 C;  3AZJ D;  3AV1 C;  3R45 B;  1R4V A;  4Z2M G;  5AVC C;  1KX4 A;  1JFI A;  2RIQ A;  3AZH A;  2FJ7 A;  2F8N H;  1BFM A;  4YM6 C;  1P3K C;  5GSU A;  3X1U C;  1EQZ D;  2CV5 A;  5B31 G;  3WA9 B;  3LJA B;  3AN2 D;  1P3F A;  4Z66 A;  1ZLA B;  5AV5 D;  5F99 B;  3AZJ B;  5CPK C;  3LEL A;  5B40 A;  4Z5T C;  1P34 A;  3KUY A;  3C1B A;  3AL0 C;  3REH D;  3C1C D;  4WU9 A;  3FDD A;  5AV6 D;  3EPK A;  4CSR A;  5AY8 D;  3AZI A;  4WU8 D;  2NQB C;  1KU5 A;  5AV5 B;  4DRA A;  3V9R B;  3WTP A;  1S32 C;  4UUZ A;  3UTB A;  3AZK D;  3AV2 D;  3W97 C;  2Y2K A;  3VH5 T;  4H9O B;  3AZE C;  5CPJ B;  2L5A A;  5AV6 B;  1M18 B;  4WV4 B;  2PYO A;  5B24 C;  1P3G D;  2BYK B;  5B1L D;  4CAY A;  1H3O A;  3B6G C;  5G49 A;  5BT1 D;  1TZY B;  1ID3 C;  3H0L C;  5DNN D;  1HQ3 A;  1AOI A;  4EO5 C;  5AV9 A;  3W98 A;  3KWQ C;  4J8X C;  4J8W B;  1F66 D;  5B33 B;  4G92 C;  1P3G B;  5B1L B;  5B32 C;  1Z2C B;  5JRG A;  4HGA B;  3VH6 T;  5GT3 C;  3W96 C;  5DNN B;  3AV1 B;  1P3A C;  3UT9 B;  3P5J B;  3AZG C;  3REI A;  4QLC A;  1PZR A;  3NQJ A;  3O62 A;  3AZM D;  1KX4 C;  5B1M D;  2Y2Q A;  2CWE A;  4YM6 B;  1P3K B;  2NZD B;  3AZH C;  3AZL D;  3AZN A;  4M6B A;  2Y2N A;  3F6T A;  5B32 G;  5B31 A;  5GT0 A;  5B0Z A;  5GSU C;  5CPK B;  1BH8 B;  4KHA B;  3X1T D;  3AFA A;  5AVC A;  3MVD A;  3AYW D;  2CV5 C;  1P3F C;  4Z66 C;  4LD9 D;  5B2J D;  2ARO D;  5B40 C;  4H9P B;  1P3O D;  3WKJ D;  3X1U A;  2ZY5 A;  3C1B C;  5B1M B;  1P3M D;  3UTA A;  2LY8 A;  4H9S A;  4WU9 C;  3MGQ D;  3A6N D;  4J8V D;  3TU4 D;  2NQB B;  2G5H C;  4Z5T A;  3W99 A;  3AZI C;  5AVB D;  5CP6 C;  1S32 B;  5B2J B;  2ARO B;  3LZ1 D;  3MGP B;  3WKJ B;  2YFV B;  3AZF D;  1P3M B;  4WNN B;  4H9N A;  5FUG B;  1W2E A;  5B24 B;  3A6N B;  4XUJ D;  3TU4 B;  2DF4 C;  3WAA D;  3B6G B;  5CPI A;  4JJN D;  2J8P A;  5DNM B;  3B0C T;  3LZ0 A;  3LZ1 B;  3H0M C;  4DQY B;  1P3P A;  4EO5 B;  5B2I A;  3MNN A;  3B6F A;  4XZQ A;  3AZF B;  1HQ3 C;  1AOI C;  2Y2H A;  1M19 A;  5AV9 C;  3W98 C;  1HTA A;  5BNV B;  3MGR A;  1U35 A;  2HIO D;  4ZUX B;  3EPL A;  2FJ7 D;  3MGS A;  3KXB A;  1ID3 A;  3WAA B;  2BG1 A;  1P3L D;  4JJN B;  5JRG C;  3A1I A;  2FFF B;  4J8X A;  5JA4 B;  1EQZ C;  1P34 D;  3EG5 B;  1KX3 A;  3REI C;  1KX4 B;  4QLC C;  2ZY2 A;  3O62 C;  5B0Y C;  5B32 A;  3AZH B;  4G91 C;  2FJ7 B;  4NE3 A;  3X1S A;  3KSY A;  2Y2G A;  3WA9 D;  5GSU B;  3C1C C;  3AZN C;  5B0Z C;  1P3L B;  1ZLA D;  5B31 C;  5F99 D;  3AZG A;  4Z66 B;  3AFA C;  3LEL B;  3MVD C;  3REL A;  1P34 B;  5E5A A;  3KUY B;  3C1B B;  1M1A D;  4KGC D;  4WU9 B;  5AV8 A;  2PYO D;  3UTA C;  4H9S C;  4CSR B;  5BS7 A;  4YS3 A;  4J8U A;  1KX5 D; 
#chains in the Genus database with same CATH homology
 2F8N G;  3X1V C;  3NQU A;  3W99 C;  5BNX B;  3WTP B;  1WWS A;  5GXQ A;  4R8P D;  3UTB B;  5C3I B;  4NE6 A;  4KUD A;  5CPJ D;  1M18 D;  1M1A B;  1P3I A;  4KGC B;  3REJ D;  2PYO B;  1B6W A;  1TZY D;  1P3B D;  5CP6 A;  2BYM B;  4CAY B;  1KX5 B;  1F66 C;  5CPI C;  5G49 B;  4AWL B;  3LZ0 C;  4R8P B;  1HQ3 B;  1AOI B;  1P3P C;  3B6F C;  3B0D C;  5B2I C;  3MNN C;  4XZQ C;  4X23 A;  4J8W D;  3REJ B;  5B33 D;  1M19 C;  2HUE C;  4WJ3 C;  3REK D;  3MGR C;  1U35 C;  1P3B B;  3MGS C;  3KXB C;  3AV1 D;  5JRG B;  3AZL C;  3UT9 D;  2JE5 A;  3AZJ A;  4QLC B;  1TAF A;  3NQJ B;  4YM6 D;  3AYW C;  1P3K D;  1KX3 C;  4LD9 C;  4DRB A;  2NZD D;  2JSS A;  3REK B;  1P3O C;  4H9R A;  3AZN B;  5B31 B;  5GT0 B;  5CPK D;  2W8S A;  3X1S C;  1EQZ A;  3AN2 A;  2RVQ C;  5AV5 A;  3MVD B;  5AVC B;  5B0Y A;  2UWX A;  3REL C;  5E5A C;  3REH A;  3X1U B;  3C1C A;  5KDM B;  3UTA B;  5AV6 A;  3WTP E;  2NQB D;  5AY8 A;  5AV8 C;  3EPH A;  4WU8 A;  5BS7 C;  4YS3 C;  4Z5T B;  4J8U C;  1S32 D;  1Q9C A;  4XUJ C;  3MGP D;  3W97 D;  3AV2 A;  3AZK A;  3IP4 C;  5GXQ C;  3AZE D;  5B24 D;  4KUD C;  4H9N B;  5CHL B;  1P3I C;  3X1V A;  3B6G D;  1P3G A;  4E45 A;  5B1L A;  1ID3 D;  5CPI B;  5DNM D;  5BO0 B;  3W97 B;  1BH9 A;  5DNN A;  3LZ0 B;  3KWQ D;  3B6F B;  1P3P B;  2ZY4 A;  2XD5 A;  3AZE B;  4ZUX D;  1M19 B;  2HUE B;  4X23 C;  3VH5 W;  5B32 D;  1U35 B;  1F66 A;  3MGS B;  4NE5 A;  3KXB B;  1ID3 B;  5GT3 D;  1P3A D;  3W96 D;  4E44 A;  3AZG D;  1BH8 A;  4KHA A;  3WA9 C;  3LJA C;  2G5I C;  2DQN C;  3KWQ B;  4J8X B;  3AZJ C;  1KX4 D;  1KX3 B;  3AZM A;  3AZH D;  4G92 B;  2Y2L A;  5B1M A;  4WZS B;  5B32 B;  5GSU D;  3AZL A;  2CV5 D;  5GT3 B;  1P3A B;  3W96 B;  1P3F D;  2Y2O A;  4Z66 D;  3AZG B;  3LEL D;  3X1T A;  5B40 D;  3AN2 C;  3AYW A;  3KUY D;  4LD9 A;  5AV5 C;  5B2J A;  3C1B D;  3VH6 W;  1A7W A;  1JFI B;  3WKJ A;  1P3O A;  3VH5 A;  1T3U A;  3A1K A;  4WU9 D;  1P3M A;  3REH C;  1N1J A;  3MGQ A;  5AV8 B;  2Y2M A;  3A6N A;  3AZI D;  4J8V A;  5CPJ C;  5AV6 C;  2CV5 B;  1M18 C;  1B67 A;  1P3F B;  5AY8 C;  5B40 B;  4WU8 C;  2YFW A;  3WTP D;  5AVB A;  3UTB D;  5GXQ B;  3AV2 C;  3AZK C;  4KUD B;  2VQR A;  3AZI B;  4XUJ A;  3WAA A;  4Z2M H;  5CP6 B;  5B33 C;  1P3G C;  5B1L C;  3VH6 A;  4JJN A;  5BT1 C;  4UUZ B;  1HQ3 D;  4HGA C;  1AOI D;  5JA4 A;  5AV9 D;  2F8N K;  5DNN C;  3W98 D;  3UT9 C;  4X23 B;  2HIO A;  4H9Q A;  3EPJ A;  2NZD C;  1H3O B;  5JRG D;  1P3L A;  3R45 A;  3REI D;  2ZM5 A;  5AV9 B;  4QLC D;  3O62 D;  3W98 B;  1F1E A;  5B0Y D;  3B0C W;  1TAF B;  3AZM C;  3AZN D;  5B0Z D;  5B31 D;  5GT0 D;  5B1M C;  4H9R B;  3WA9 A;  3LJA A;  1ZLA A;  5F99 A;  1EQZ B;  3AFA D;  2XD1 A;  3MVD D;  5AVC D;  3AN2 B;  2F8N D;  2IO5 C;  3REI B;  3X1T C;  3O62 B;  5BNX A;  5B0Y B;  5B2J C;  2ARO C;  3X1U D;  4G91 B;  3MGP C;  3WKJ C;  3REH B;  3UTA D;  3C1C B;  1M1A A;  5B0Z B;  4KGC A;  1P3M C;  3H0R C;  4Z5T D;  3X1V D;  3W99 D;  5AY8 B;  3A6N C;  3MGQ C;  2F8N B;  3AFA B;  2BYM A;  4J8V C;  4WU8 B;  3TU4 C;  1KX5 A;  3V9R A;  5AVB C;  5DNM C;  2ZY3 A;  4R8P A;  3LZ1 C;  3AZK B;  4H9O A;  3AV2 B;  5CPJ A;  4ZBJ C;  3AZF C;  1M18 A;  3REJ A;  2BYK A;  2Y2P A;  3X1V B;  5CPI D;  4ZUX C;  1TZY A;  1P3B A;  3W99 B;  3WAA C;  3LZ0 D;  3B6F D;  1P3P D;  4JJN C;  5B2I D;  3MNN D;  1BH9 B;  4XZQ D;  1M19 D;  3MGR D;  4J8W A;  1U35 D;  5B33 A;  3MGS D;  3KXB D;  3REK A;  1F66 B;  2HIO C;  2FJ7 C;  3AV1 A;  1P3L C;  3UT9 A;  4J8X D;  3B0D B;  5B2I B;  3MNN B;  4XZQ B;  1KX3 D;  3LEL C;  2Y2J A;  4YM6 A;  3MGR B;  3KUY C;  1P34 C;  3AZM B;  1P3K A;  2NZD A;  5KDM A;  3X1S D;  2RVQ D;  3AZL B;  5CPK A;  2F2A C;  1ZLA C;  1ULY A;  2JCH A;  5F99 C;  2IO5 B;  4UPK A;  3REL D;  2Y2I A;  4H9P A;  3X1T B;  3AYW B;  5E5A D;  4LD9 B;  1P3O B;  3WTP C;  3UTB C;  5C3I C;  5AV8 D;  3X1S B;  2NQB A;  1M1A C;  1N1J B;  4NFT A;  4YS3 D;  4J8U D;  3MGQ B;  4KGC C;  4J8V B;  2PYO C;  1S32 A;  2ARO A;  3REL B;  1KX5 C;  3MGP A;  5BO0 A;  2YFW B;  5GXQ D;  5E5A B;  2YFV A;  3W97 A;  5AVB B;  4AWL C;  4KUD D;  4WNN A;  3AZE A;  4ZBJ B;  5FUG A;  4R8P C;  1P3I D;  5B24 A;  3TU4 A;  4YS3 B;  3B6G A;  1WWI A;  4J8U B;  5CP6 D;  3REJ C;  4XUJ B;  3NQU B;  1TZY C;  5DNM A;  1P3B C;  3LZ1 A;  3AZF A;  3KWQ A;  3B0B A;  5BNV A;  4X23 D;  1P3I B;  4ZUX A;  4J8W C;  2HIO B;  4H9Q B;  2F8N A;  3REK C;  3KFU G;  5GT3 A;  3W96 A;  3LJA D;  1P3A A;  5GT0 C;  3AZJ D;  3AV1 C;  3R45 B;  1R4V A;  4Z2M G;  5AVC C;  1KX4 A;  1JFI A;  2RIQ A;  3AZH A;  2FJ7 A;  2F8N H;  1BFM A;  4YM6 C;  1P3K C;  5GSU A;  3X1U C;  1EQZ D;  2CV5 A;  5B31 G;  3WA9 B;  3LJA B;  3AN2 D;  1P3F A;  4Z66 A;  1ZLA B;  5AV5 D;  5F99 B;  3AZJ B;  5CPK C;  3LEL A;  5B40 A;  4Z5T C;  1P34 A;  3KUY A;  3C1B A;  3AL0 C;  3REH D;  3C1C D;  4WU9 A;  3FDD A;  5AV6 D;  3EPK A;  4CSR A;  5AY8 D;  3AZI A;  4WU8 D;  2NQB C;  1KU5 A;  5AV5 B;  4DRA A;  3V9R B;  3WTP A;  1S32 C;  4UUZ A;  3UTB A;  3AZK D;  3AV2 D;  3W97 C;  2Y2K A;  3VH5 T;  4H9O B;  3AZE C;  5CPJ B;  2L5A A;  5AV6 B;  1M18 B;  4WV4 B;  2PYO A;  5B24 C;  1P3G D;  2BYK B;  5B1L D;  4CAY A;  1H3O A;  3B6G C;  5G49 A;  5BT1 D;  1TZY B;  1ID3 C;  3H0L C;  5DNN D;  1HQ3 A;  1AOI A;  4EO5 C;  5AV9 A;  3W98 A;  3KWQ C;  4J8X C;  4J8W B;  1F66 D;  5B33 B;  4G92 C;  1P3G B;  5B1L B;  5B32 C;  1Z2C B;  5JRG A;  4HGA B;  3VH6 T;  5GT3 C;  3W96 C;  5DNN B;  3AV1 B;  1P3A C;  3UT9 B;  3P5J B;  3AZG C;  3REI A;  4QLC A;  1PZR A;  3NQJ A;  3O62 A;  3AZM D;  1KX4 C;  5B1M D;  2Y2Q A;  2CWE A;  4YM6 B;  1P3K B;  2NZD B;  3AZH C;  3AZL D;  3AZN A;  4M6B A;  2Y2N A;  3F6T A;  5B32 G;  5B31 A;  5GT0 A;  5B0Z A;  5GSU C;  5CPK B;  1BH8 B;  4KHA B;  3X1T D;  3AFA A;  5AVC A;  3MVD A;  3AYW D;  2CV5 C;  1P3F C;  4Z66 C;  4LD9 D;  5B2J D;  2ARO D;  5B40 C;  4H9P B;  1P3O D;  3WKJ D;  3X1U A;  2ZY5 A;  3C1B C;  5B1M B;  1P3M D;  3UTA A;  2LY8 A;  4H9S A;  4WU9 C;  3MGQ D;  3A6N D;  4J8V D;  3TU4 D;  2NQB B;  2G5H C;  4Z5T A;  3W99 A;  3AZI C;  5AVB D;  5CP6 C;  1S32 B;  5B2J B;  2ARO B;  3LZ1 D;  3MGP B;  3WKJ B;  2YFV B;  3AZF D;  1P3M B;  4WNN B;  4H9N A;  5FUG B;  1W2E A;  5B24 B;  3A6N B;  4XUJ D;  3TU4 B;  2DF4 C;  3WAA D;  3B6G B;  5CPI A;  4JJN D;  2J8P A;  5DNM B;  3B0C T;  3LZ0 A;  3LZ1 B;  3H0M C;  4DQY B;  1P3P A;  4EO5 B;  5B2I A;  3MNN A;  3B6F A;  4XZQ A;  3AZF B;  1HQ3 C;  1AOI C;  2Y2H A;  1M19 A;  5AV9 C;  3W98 C;  1HTA A;  5BNV B;  3MGR A;  1U35 A;  2HIO D;  4ZUX B;  3EPL A;  2FJ7 D;  3MGS A;  3KXB A;  1ID3 A;  3WAA B;  2BG1 A;  1P3L D;  4JJN B;  5JRG C;  3A1I A;  2FFF B;  4J8X A;  5JA4 B;  1EQZ C;  1P34 D;  3EG5 B;  1KX3 A;  3REI C;  1KX4 B;  4QLC C;  2ZY2 A;  3O62 C;  5B0Y C;  5B32 A;  3AZH B;  4G91 C;  2FJ7 B;  4NE3 A;  3X1S A;  3KSY A;  2Y2G A;  3WA9 D;  5GSU B;  3C1C C;  3AZN C;  5B0Z C;  1P3L B;  1ZLA D;  5B31 C;  5F99 D;  3AZG A;  4Z66 B;  3AFA C;  3LEL B;  3MVD C;  3REL A;  1P34 B;  5E5A A;  3KUY B;  3C1B B;  1M1A D;  4KGC D;  4WU9 B;  5AV8 A;  2PYO D;  3UTA C;  4H9S C;  4CSR B;  5BS7 A;  4YS3 A;  4J8U A;  1KX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...