1BH8A

Htafii18/htafii28 heterodimer crystal structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
LFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAFII18
publication title Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation complex
total genus 13
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bh8A00
3LJAB 5G49A 5CPJA 4J8XC 5AV5B 1EQZC 3WA9B 3AZKD 3MGSC 4J8UC 3AZKB 4HGAC 1P3LC 5B31D 2PYOD 3NQJB 3AFAD 4ZUXC 5BS7A 5B31B 3MGQC 1M1AC 3AV2D 4Z2MH 3AFAB 4X23A 4QLCB 3AV2B 2F8NG 1M19A 5BNVB 1KX3A 5AY8C 1ID3D 5CP6A 1U35D 2NZDD 1A7WA 3V9RA 3X1VA 1ID3B 3WTPD 1N1JB 3AYWB 1U35B 3UTAB 3AZMA 2NZDB 5AVBD 5JRGD 3R45B 4ZBJB 3WTPB 5AVBB 3RELC 1B6WA 3LZ1A 1KU5A 3LJAC 5B2IA 1F66D 4J8WB 1F66B 3UTBD 5CPJC 3MVDD 1KX4A 3AZGA 4XZQA 3UTBB 4KUDB 1Q9CA 2AROD 3X1UD 3X1TA 1ZLAB 1P34B 3X1UB 5B31G 4QLCC 1P3BA 5B1LD 1M19C 4YM6A 1KX3C 1B67A 2BYMA 5B1LB 3WKJA 5CP6C 3AV1D 3AN2D 3KWQD 3AYWC 3UTAC 3REHA 4WU8A 3WTPC 3AN2B 3KWQB 3AV1B 3AZMC 1P3GC 5KDMA 5GSUD 3TU4A 3MNNA 1P3OA 2FJ7A 3W96D 2BYKA 3B6FB 4J8WC 5GSUB 5B2IC 1AOIB 5AV9D 3W96B 4WU9D 1P3PA 5B1MA 4KUDC 1KX4C 4WU9B 3B0CW 5BT1C 3O62D 4Z66A 1ZLAC 1P34C 5B32D 1WWSA 3O62B 4NE5A 3X1UC 3X1TC 5B32B 5BNXA 1P3MD 5CPID 4LD9D 4KHAA 1P3BC 5F99D 1P3MB 5CPIB 4LD9B 5B2JD 2YFWA 4YM6C 5F99B 3REJA 3WAAD 3WKJC 3LELA 2L5AA 3AV1C 4YS3B 3W98A 3WAAB 4H9SA 5BO0B 3B0CT 5B40D 5GT0D 4J8XA 3UT9C 1P3IA 5B40B 1P3FD 3B6FC 3B0DC 1AOIC 5GT0B 3TU4C 3AZJD 4XUJD 1P3OC 2FJ7C 3VH6A 1P3FB 3AZJB 4XUJB 5GT3D 3NQUB 5AVCD 2CV5D 5E5AD 2F8NA 3KUYB 3O62C 4Z66C 2CV5B 3B6GD 5E5AB 4NFTA 1H3OB 2RVQC 5AY8A 5B32G 3LZ0B 3B6GB 1BH8B 3MGRD 2NQBD 4KGCD 1M18D 4M6BA 3MGRB 1TZYD 1P3AA 5F99C 2NQBB 4KGCB 1TZYB 3REJC 4YS3C 3LELC 3C1CA 3LJAA 3W98C 5B33D 4H9SC 1S32B 5FUGB 5JA4B 5AV5A 3WA9A 5B33B 1P3KD 3AZED 4J8VD 1JFIB 1P3IC 3AZKA 5B0ZD 3AZEB 4J8VB 3NQJA 3AZND 5B0ZB 5CPKD 2F8NK 5B31A 3AZNB 3KXBD 3W99D 5CPKB 1HQ3D 3AFAA 3VH5A 2CWEA 4QLCA 3KUYC 2PYOB 3KXBB 3AV2A 3W99B 1HQ3B 5BNVA 2F8NH 5B24D 3REKD 1KX5D 3LZ0C 5B24B 5C3IB 3REKB 1KX5B 1ID3A 1N1JA 3AYWA 1U35A 3UTAA 3C1BD 2NZDA 3R45A 2HUEB 3WTPA 1P3AC 3C1BB 5AVBA 4WZSB 5JRGB 1S32C 3C1CC 4J8WA 1F66A 3WTPE 3AZHD 5AV5C 3WA9C 3UTBA 4KUDA 3AZEC 3AZHB 3AZKC 3REID 5AV6D 3MVDB 1ZLAA 1P34A 3REIB 3MGPD 3AZNC 5AV6B 3X1UA 4JJND 4EO5B 2AROB 5B31C 2PYOC 5AV8D 3MGPB 4Z5TD 3AFAC 5B0YD 4JJNB 5AV8B 3AV2C 4Z5TB 4H9NB 5B0YB 5C3IC 5B1LA 3LZ1D 3REKC 4CAYB 1ID3C 3AV1A 3AN2A 3KWQA 3AZID 1U35C 2NZDC 2IO5B 2LY8A 4ZBJC 3A6ND 3AZGD 4XZQD 3AZIB 3UT9A 5AVBC 5JRGC 3A6NB 3B6FA 1AOIA 5GSUA 3W96A 1F66C 4WU9A 4WV4B 3UTBC 3MVDC 5AV9B 3O62A 2AROC 1R4VA 5B32A 3REHD 4WU8D 2YFVB 1P3MA 5CPIA 4LD9A 2HIOD 5GXQD 5F99A 3MNND 5B1LC 2HIOB 4H9OB 3AZFD 5GXQB 4E44A 5DNMD 4R8PD 3WAAA 4YS3A 5BO0A 2IO5C 5B2JB 3AZFB 4R8PB 5DNMB 3AZLD 3KWQC 3AN2C 5B1MD 3AZLB 5B40A 5GT0A 1TAFB 1P3FA 5GSUC 3AZJA 4XUJA 3NQUA 3W96C 4CSRB 5AV9C 4WU9C 4H9RB 3KUYA 5GT3B 2CV5A 3X1SD 5DNND 5AVCB 3VH5W 5E5AA 1H3OA 1WWIA 5DNNB 3X1SB 3LZ0A 5B32C 3B6GA 1BH8A 1P3GD 3MGRA 1P3MC 5CPIC 4J8XD 1P3GB 1EQZD 2NQBA 4KGCA 4H9QB 4LD9C 1BFMA 1TZYA 3MGSD 4J8UD 1M18B 1EQZB 5B2JC 1BH9B 3WAAC 4NE3A 3MGSB 4J8UB 1P3LD 1S32A 5FUGA 5JA4A 4WNNB 4ZUXD 4HGAB 1P3LB 5B33A 3MGQD 1M1AD 1JFIA 4ZUXB 3VH5T 5B40C 3MGQB 3AZEA 5GT0C 1M1AB 4J8VA 1ULYA 1P3KB 1P3FC 5B0ZA 5AY8D 3AZJC 4XUJC 3AZNA 3W97D 5CPKA 2PYOA 5GT3C 3W97B 3KXBA 3W99A 1HQ3A 5AVCC 4NE6A 2CV5C 5E5AC 3RELD 4UUZB 5B24A 3REKA 1KX5A 3B6GC 3LJAD 3RELB 4H9PB 3MGRC 5CPJD 3C1BA 2NQBC 4KGCC 1M18C 1TZYC 5G49B 5CPJB 5JRGA 1F1EA 3KSYA 4QLCD 5B33C 3AZHA 4X23D 4Z2MG 1P3KC 3MVDA 4J8VC 1M19D 4X23B 1KX3D 3REIA 5B0ZC 5AV6A 5CP6D 1M19B 2AROA 1KX3B 3MGPA 3AYWD 3W97C 3UTAD 5CPKC 4JJNA 3X1VD 5CP6B 4G91B 5AV8A 3W99C 3KXBC 4Z5TA 4H9NA 1HQ3C 5B0YA 3V9RB 3AZMD 3X1VB 3AZMB 4DRBA 4CAYA 5B24C 1KX5C 4J8WD 5B2ID 3LZ1B 2HUEC 5B2IB 3AZIA 4KUDD 1KX4D 3C1BC 4G92B 3A6NA 5BT1D 1KX4B 1HTAA 1ZLAD 1P34D 3AZGB 3B0BA 4XZQB 3X1TD 4E45A 3X1TB 5BS7C 3AZHC 5AV9A 1P3BD 3VH6W 4DRAA 4X23C 4AWLB 1P3BB 4YM6D 3REIC 5AV6C 3WKJD 4EO5C 4YM6B 3MGPC 2BYMB 2YFVA 4G91C 4JJNC 3WKJB 3X1VC 5AV8C 4Z5TC 5B0YC 3UT9D 3REHB 4WU8B 2HIOA 4H9OA 3WA9D 5GXQA 3B6FD 1AOID 3UT9B 3TU4D 5KDMB 1P3OD 2FJ7D 3LZ1C 5B2JA 3AZFA 3B0DB 5DNMA 4R8PA 3TU4B 3MNNB 1P3OB 2FJ7B 2BYKB 3VH6T 4G92C 1P3PD 3AZLA 3AZIC 3A6NC 1P3PB 3AZGC 1TAFA 5B1MB 2JSSA 4XZQC 4Z66D 4CSRA 2RVQD 4Z66B 4H9RA 5GT3A 4AWLC 5BNXB 5AVCA 4KHAB 3X1SA 5DNNA 3REJD 4YS3D 3LELD 2YFWB 3REJB 3W98D 3LELB 1P3GA 3REHC 4WU8C 4H9QA 3W98B 5CHLB 1EQZA 1M18A 1P3ID 2HIOC 1BH9A 5GXQC 4J8XB 3MGSA 4J8UA 1P3IB 3MNNC 3AZFC 4R8PC 4WNNA 5DNMC 1P3LA 4ZUXA 3AZLC 1P3PC 5B1MC 3KUYD 3MGQA 1M1AA 2F8ND 1P3KA 3LZ0D 2F8NB 3W97A 5AY8B 1P3AD 4UUZA 3X1SC 5DNNC 1P3AB 3RELA 1S32D 4H9PA 3C1CD 5AV5D 3C1CB
chains in the Genus database with same CATH superfamily
3LJAB 5G49A 5CPJA 4J8XC 5AV5B 1EQZC 3WA9B 3AZKD 3MGSC 4J8UC 3AZKB 4HGAC 1P3LC 5B31D 2PYOD 3NQJB 3AFAD 4ZUXC 5BS7A 5B31B 3MGQC 1M1AC 3AV2D 4Z2MH 3AFAB 4X23A 4QLCB 3AV2B 2F8NG 1M19A 5BNVB 3EPLA 1KX3A 5AY8C 1ID3D 5CP6A 1U35D 2NZDD 1A7WA 3V9RA 3X1VA 1ID3B 3WTPD 1N1JB 3AYWB 1U35B 3UTAB 3AZMA 2NZDB 5AVBD 5JRGD 3R45B 4ZBJB 3WTPB 5AVBB 3RELC 1B6WA 3LZ1A 1KU5A 3LJAC 5B2IA 1F66D 2ZM5A 4J8WB 1F66B 3UTBD 5CPJC 3MVDD 1KX4A 2DF4C 3AZGA 4XZQA 3UTBB 4KUDB 1Q9CA 2AROD 3X1UD 3X1TA 1ZLAB 1P34B 3X1UB 5B31G 4QLCC 1P3BA 5B1LD 1M19C 4YM6A 1KX3C 1B67A 2BYMA 5B1LB 3F6TA 3WKJA 5CP6C 3AV1D 3AN2D 3KWQD 3AYWC 3UTAC 3REHA 4WU8A 3WTPC 3AN2B 3KWQB 3AV1B 3AZMC 1P3GC 5KDMA 5GSUD 3TU4A 3MNNA 1P3OA 2FJ7A 3W96D 3AL0C 2BYKA 3B6FB 4J8WC 5GSUB 5B2IC 1AOIB 5AV9D 3W96B 4WU9D 1P3PA 5B1MA 4KUDC 1KX4C 4WU9B 3B0CW 5BT1C 3O62D 4Z66A 1ZLAC 1P34C 5B32D 1WWSA 3O62B 4NE5A 3X1UC 3X1TC 2Y2GA 5B32B 5BNXA 1P3MD 5CPID 4LD9D 4KHAA 1P3BC 5F99D 1P3MB 5CPIB 4LD9B 5B2JD 2YFWA 4YM6C 5F99B 3REJA 3WAAD 3WKJC 3LELA 2L5AA 3AV1C 4YS3B 2XD5A 3W98A 3WAAB 4H9SA 5BO0B 3B0CT 5B40D 5GT0D 4J8XA 3UT9C 1P3IA 3A1IA 5B40B 1P3FD 3B6FC 3B0DC 1AOIC 5GT0B 3TU4C 3AZJD 4XUJD 1P3OC 2FJ7C 3VH6A 1P3FB 2BG1A 3H0MC 3AZJB 4XUJB 5GT3D 3NQUB 5AVCD 2CV5D 5E5AD 2F8NA 3KUYB 3O62C 4Z66C 2CV5B 3B6GD 2XD1A 5E5AB 4NFTA 1H3OB 2RVQC 5AY8A 5B32G 3LZ0B 3B6GB 1BH8B 3MGRD 2NQBD 4KGCD 1M18D 4M6BA 3MGRB 1TZYD 1P3AA 5F99C 2NQBB 4KGCB 1TZYB 2ZY3A 3REJC 4YS3C 3LELC 3C1CA 3LJAA 3W98C 5B33D 4H9SC 1S32B 5FUGB 5JA4B 5AV5A 3WA9A 5B33B 1P3KD 3AZED 4J8VD 1JFIB 1P3IC 3AZKA 5B0ZD 3AZEB 3H0RC 4J8VB 3NQJA 3AZND 5B0ZB 5CPKD 2F8NK 5B31A 3AZNB 3KXBD 3W99D 5CPKB 1HQ3D 3AFAA 3VH5A 2CWEA 4QLCA 3KUYC 2PYOB 3KXBB 3AV2A 4DQYB 3W99B 1HQ3B 5BNVA 2F8NH 5B24D 2ZY4A 3REKD 1KX5D 3LZ0C 5B24B 5C3IB 3REKB 1KX5B 1ID3A 1N1JA 3AYWA 1U35A 3UTAA 3C1BD 2NZDA 3R45A 2HUEB 3WTPA 1T3UA 1P3AC 3C1BB 2Y2HA 5AVBA 4WZSB 5JRGB 3IP4C 1S32C 3C1CC 4J8WA 1F66A 3WTPE 2G5IC 3AZHD 5AV5C 3WA9C 3UTBA 4KUDA 3AZEC 3AZHB 3AZKC 3REID 5AV6D 3MVDB 2Y2IA 1ZLAA 1P34A 3REIB 3MGPD 3AZNC 5AV6B 3X1UA 4JJND 4EO5B 2AROB 5B31C 2PYOC 5AV8D 3MGPB 4Z5TD 3AFAC 5B0YD 4JJNB 5AV8B 3AV2C 4Z5TB 4H9NB 5B0YB 5C3IC 5B1LA 3LZ1D 3REKC 2JCHA 4CAYB 1ID3C 3AV1A 3AN2A 3KWQA 3AZID 1U35C 2NZDC 3EPJA 2IO5B 2LY8A 4ZBJC 3KFUG 3A6ND 3AZGD 4XZQD 3AZIB 3UT9A 5AVBC 5JRGC 3P5JB 3A6NB 3B6FA 1AOIA 5GSUA 2ZY5A 3W96A 1F66C 4WU9A 4WV4B 3UTBC 3MVDC 5AV9B 3O62A 2AROC 1R4VA 2UWXA 5B32A 3REHD 4WU8D 2YFVB 1P3MA 5CPIA 4LD9A 2HIOD 5GXQD 5F99A 3MNND 5B1LC 2HIOB 4H9OB 3AZFD 5GXQB 4E44A 5DNMD 4R8PD 3WAAA 4YS3A 5BO0A 2IO5C 5B2JB 3AZFB 4R8PB 2W8SA 5DNMB 3AZLD 3KWQC 3FDDA 5B1MD 3AN2C 3EPKA 3AZLB 5B40A 5GT0A 1TAFB 1P3FA 5GSUC 3AZJA 4XUJA 3NQUA 3W96C 4CSRB 5AV9C 4WU9C 4UPKA 4H9RB 3KUYA 5GT3B 2CV5A 3X1SD 5DNND 5AVCB 3VH5W 5E5AA 1H3OA 1WWIA 5DNNB 3X1SB 3LZ0A 5B32C 3B6GA 1BH8A 1P3GD 2Y2OA 3MGRA 1P3MC 5CPIC 4J8XD 1P3GB 1EQZD 2NQBA 4KGCA 4H9QB 4LD9C 2JE5A 1BFMA 1TZYA 3MGSD 4J8UD 1M18B 1EQZB 5B2JC 1BH9B 3WAAC 4NE3A 3MGSB 4J8UB 1P3LD 1S32A 5FUGA 5JA4A 2Y2LA 4WNNB 4ZUXD 4HGAB 1P3LB 5B33A 3MGQD 1M1AD 1JFIA 4ZUXB 3VH5T 5B40C 3MGQB 3AZEA 5GT0C 1M1AB 4J8VA 1ULYA 1P3KB 1P3FC 5B0ZA 5AY8D 3AZJC 4XUJC 3AZNA 2DQNC 3W97D 5CPKA 2PYOA 5GT3C 3W97B 3KXBA 3W99A 1HQ3A 5AVCC 4NE6A 2CV5C 4WJ3C 5E5AC 3RELD 4UUZB 5B24A 3REKA 1KX5A 3B6GC 3LJAD 3RELB 2VQRA 4H9PB 2J8PA 2Y2PA 5CPJD 3MGRC 3C1BA 2NQBC 4KGCC 1M18C 3H0LC 1TZYC 5G49B 5CPJB 5JRGA 1F1EA 3KSYA 4QLCD 5B33C 3AZHA 4X23D 4Z2MG 1P3KC 3MVDA 4J8VC 1M19D 4X23B 1KX3D 3EPHA 3REIA 5B0ZC 5AV6A 5CP6D 1M19B 2AROA 1KX3B 3MGPA 3AYWD 3W97C 3UTAD 5CPKC 4JJNA 3X1VD 5CP6B 4G91B 5AV8A 3W99C 3KXBC 4Z5TA 4H9NA 1HQ3C 5B0YA 3V9RB 3AZMD 3X1VB 3AZMB 4DRBA 4CAYA 5B24C 1W2EA 1KX5C 4J8WD 5B2ID 3LZ1B 2HUEC 5B2IB 3AZIA 4KUDD 1KX4D 3C1BC 4G92B 3A6NA 5BT1D 1KX4B 1HTAA 1ZLAD 1P34D 3AZGB 3B0BA 4XZQB 3X1TD 4E45A 3X1TB 5BS7C 1PZRA 3AZHC 5AV9A 1P3BD 3VH6W 4DRAA 4X23C 2F2AC 4AWLB 1P3BB 4YM6D 3REIC 5AV6C 3WKJD 4EO5C 4YM6B 3MGPC 2BYMB 2YFVA 4G91C 4JJNC 3WKJB 3X1VC 5AV8C 4Z5TC 5B0YC 3UT9D 2RIQA 3REHB 4WU8B 2HIOA 4H9OA 3WA9D 5GXQA 3B6FD 1AOID 3UT9B 3TU4D 5KDMB 1P3OD 2FJ7D 3LZ1C 5B2JA 3AZFA 3B0DB 5DNMA 4R8PA 3TU4B 3MNNB 1P3OB 2FJ7B 2BYKB 3VH6T 4G92C 1P3PD 3AZLA 3AZIC 3A6NC 1P3PB 3AZGC 1TAFA 5B1MB 2JSSA 4XZQC 4Z66D 4CSRA 2RVQD 4Z66B 4H9RA 5GT3A 4AWLC 5BNXB 5AVCA 4KHAB 1Z2CB 3X1SA 5DNNA 3REJD 4YS3D 3LELD 2YFWB 3REJB 3W98D 3LELB 1P3GA 3REHC 4WU8C 4H9QA 3W98B 5CHLB 1EQZA 1M18A 1P3ID 2Y2QA 2HIOC 1BH9A 5GXQC 4J8XB 3MGSA 4J8UA 1P3IB 3MNNC 3AZFC 4R8PC 4WNNA 5DNMC 1P3LA 4ZUXA 3AZLC 1P3PC 3A1KA 5B1MC 3KUYD 3MGQA 1M1AA 2Y2JA 2F8ND 1P3KA 3LZ0D 2F8NB 2Y2KA 3W97A 5AY8B 2Y2MA 2Y2NA 1P3AD 4UUZA 3EG5B 2G5HC 3X1SC 5DNNC 2FFFB 1P3AB 3RELA 1S32D 4H9PA 3C1CD 5AV5D 3C1CB 2ZY2A
chains in the Genus database with same CATH topology
3LJAB 5G49A 5CPJA 4J8XC 5AV5B 1EQZC 3WA9B 3AZKD 3MGSC 4J8UC 3AZKB 4HGAC 1P3LC 5B31D 2PYOD 3NQJB 3AFAD 4ZUXC 5BS7A 5B31B 3MGQC 1M1AC 3AV2D 4Z2MH 3AFAB 4X23A 4QLCB 3AV2B 2F8NG 1M19A 5BNVB 3EPLA 1KX3A 5AY8C 1ID3D 5CP6A 1U35D 2NZDD 1A7WA 3V9RA 3X1VA 1ID3B 3WTPD 1N1JB 3AYWB 1U35B 3UTAB 3AZMA 2NZDB 5AVBD 5JRGD 3R45B 4ZBJB 3WTPB 5AVBB 3RELC 1B6WA 3LZ1A 1KU5A 3LJAC 5B2IA 1F66D 2ZM5A 4J8WB 1F66B 3UTBD 5CPJC 3MVDD 1KX4A 2DF4C 3AZGA 4XZQA 3UTBB 4KUDB 1Q9CA 2AROD 3X1UD 3X1TA 1ZLAB 1P34B 3X1UB 5B31G 4QLCC 1P3BA 5B1LD 1M19C 4YM6A 1KX3C 1B67A 2BYMA 5B1LB 3F6TA 3WKJA 5CP6C 3AV1D 3AN2D 3KWQD 3AYWC 3UTAC 3REHA 4WU8A 3WTPC 3AN2B 3KWQB 3AV1B 3AZMC 1P3GC 5KDMA 5GSUD 3TU4A 3MNNA 1P3OA 2FJ7A 3W96D 3AL0C 2BYKA 3B6FB 4J8WC 5GSUB 5B2IC 1AOIB 5AV9D 3W96B 4WU9D 1P3PA 5B1MA 4KUDC 1KX4C 4WU9B 3B0CW 5BT1C 3O62D 4Z66A 1ZLAC 1P34C 5B32D 1WWSA 3O62B 4NE5A 3X1UC 3X1TC 2Y2GA 5B32B 5BNXA 1P3MD 5CPID 4LD9D 4KHAA 1P3BC 5F99D 1P3MB 5CPIB 4LD9B 5B2JD 2YFWA 4YM6C 5F99B 3REJA 3WAAD 3WKJC 3LELA 2L5AA 3AV1C 4YS3B 2XD5A 3W98A 3WAAB 4H9SA 5BO0B 3B0CT 5B40D 5GT0D 4J8XA 3UT9C 1P3IA 3A1IA 5B40B 1P3FD 3B6FC 3B0DC 1AOIC 5GT0B 3TU4C 3AZJD 4XUJD 1P3OC 2FJ7C 3VH6A 1P3FB 2BG1A 3H0MC 3AZJB 4XUJB 5GT3D 3NQUB 5AVCD 2CV5D 5E5AD 2F8NA 3KUYB 3O62C 4Z66C 2CV5B 3B6GD 2XD1A 5E5AB 4NFTA 1H3OB 2RVQC 5AY8A 5B32G 3LZ0B 3B6GB 1BH8B 3MGRD 2NQBD 4KGCD 1M18D 4M6BA 3MGRB 1TZYD 1P3AA 5F99C 2NQBB 4KGCB 1TZYB 2ZY3A 3REJC 4YS3C 3LELC 3C1CA 3LJAA 3W98C 5B33D 4H9SC 1S32B 5FUGB 5JA4B 5AV5A 3WA9A 5B33B 1P3KD 3AZED 4J8VD 1JFIB 1P3IC 3AZKA 5B0ZD 3AZEB 3H0RC 4J8VB 3NQJA 3AZND 5B0ZB 5CPKD 2F8NK 5B31A 3AZNB 3KXBD 3W99D 5CPKB 1HQ3D 3AFAA 3VH5A 2CWEA 4QLCA 3KUYC 2PYOB 3KXBB 3AV2A 4DQYB 3W99B 1HQ3B 5BNVA 2F8NH 5B24D 2ZY4A 3REKD 1KX5D 3LZ0C 5B24B 5C3IB 3REKB 1KX5B 1ID3A 1N1JA 3AYWA 1U35A 3UTAA 3C1BD 2NZDA 3R45A 2HUEB 3WTPA 1T3UA 1P3AC 3C1BB 2Y2HA 5AVBA 4WZSB 5JRGB 3IP4C 1S32C 3C1CC 4J8WA 1F66A 3WTPE 2G5IC 3AZHD 5AV5C 3WA9C 3UTBA 4KUDA 3AZEC 3AZHB 3AZKC 3REID 5AV6D 3MVDB 2Y2IA 1ZLAA 1P34A 3REIB 3MGPD 3AZNC 5AV6B 3X1UA 4JJND 4EO5B 2AROB 5B31C 2PYOC 5AV8D 3MGPB 4Z5TD 3AFAC 5B0YD 4JJNB 5AV8B 3AV2C 4Z5TB 4H9NB 5B0YB 5C3IC 5B1LA 3LZ1D 3REKC 2JCHA 4CAYB 1ID3C 3AV1A 3AN2A 3KWQA 3AZID 1U35C 2NZDC 3EPJA 2IO5B 2LY8A 4ZBJC 3KFUG 3A6ND 3AZGD 4XZQD 3AZIB 3UT9A 5AVBC 5JRGC 3P5JB 3A6NB 3B6FA 1AOIA 5GSUA 2ZY5A 3W96A 1F66C 4WU9A 4WV4B 3UTBC 3MVDC 5AV9B 3O62A 2AROC 1R4VA 2UWXA 5B32A 3REHD 4WU8D 2YFVB 1P3MA 5CPIA 4LD9A 2HIOD 5GXQD 5F99A 3MNND 5B1LC 2HIOB 4H9OB 3AZFD 5GXQB 4E44A 5DNMD 4R8PD 3WAAA 4YS3A 5BO0A 2IO5C 5B2JB 3AZFB 4R8PB 2W8SA 5DNMB 3AZLD 3KWQC 3FDDA 5B1MD 3AN2C 3EPKA 3AZLB 5B40A 5GT0A 1TAFB 1P3FA 5GSUC 3AZJA 4XUJA 3NQUA 3W96C 4CSRB 5AV9C 4WU9C 4UPKA 4H9RB 3KUYA 5GT3B 2CV5A 3X1SD 5DNND 5AVCB 3VH5W 5E5AA 1H3OA 1WWIA 5DNNB 3X1SB 3LZ0A 5B32C 3B6GA 1BH8A 1P3GD 2Y2OA 3MGRA 1P3MC 5CPIC 4J8XD 1P3GB 1EQZD 2NQBA 4KGCA 4H9QB 4LD9C 2JE5A 1BFMA 1TZYA 3MGSD 4J8UD 1M18B 1EQZB 5B2JC 1BH9B 3WAAC 4NE3A 3MGSB 4J8UB 1P3LD 1S32A 5FUGA 5JA4A 2Y2LA 4WNNB 4ZUXD 4HGAB 1P3LB 5B33A 3MGQD 1M1AD 1JFIA 4ZUXB 3VH5T 5B40C 3MGQB 3AZEA 5GT0C 1M1AB 4J8VA 1ULYA 1P3KB 1P3FC 5B0ZA 5AY8D 3AZJC 4XUJC 3AZNA 2DQNC 3W97D 5CPKA 2PYOA 5GT3C 3W97B 3KXBA 3W99A 1HQ3A 5AVCC 4NE6A 2CV5C 4WJ3C 5E5AC 3RELD 4UUZB 5B24A 3REKA 1KX5A 3B6GC 3LJAD 3RELB 2VQRA 4H9PB 2J8PA 2Y2PA 5CPJD 3MGRC 3C1BA 2NQBC 4KGCC 1M18C 3H0LC 1TZYC 5G49B 5CPJB 5JRGA 1F1EA 3KSYA 4QLCD 5B33C 3AZHA 4X23D 4Z2MG 1P3KC 3MVDA 4J8VC 1M19D 4X23B 1KX3D 3EPHA 3REIA 5B0ZC 5AV6A 5CP6D 1M19B 2AROA 1KX3B 3MGPA 3AYWD 3W97C 3UTAD 5CPKC 4JJNA 3X1VD 5CP6B 4G91B 5AV8A 3W99C 3KXBC 4Z5TA 4H9NA 1HQ3C 5B0YA 3V9RB 3AZMD 3X1VB 3AZMB 4DRBA 4CAYA 5B24C 1W2EA 1KX5C 4J8WD 5B2ID 3LZ1B 2HUEC 5B2IB 3AZIA 4KUDD 1KX4D 3C1BC 4G92B 3A6NA 5BT1D 1KX4B 1HTAA 1ZLAD 1P34D 3AZGB 3B0BA 4XZQB 3X1TD 4E45A 3X1TB 5BS7C 1PZRA 3AZHC 5AV9A 1P3BD 3VH6W 4DRAA 4X23C 2F2AC 4AWLB 1P3BB 4YM6D 3REIC 5AV6C 3WKJD 4EO5C 4YM6B 3MGPC 2BYMB 2YFVA 4G91C 4JJNC 3WKJB 3X1VC 5AV8C 4Z5TC 5B0YC 3UT9D 2RIQA 3REHB 4WU8B 2HIOA 4H9OA 3WA9D 5GXQA 3B6FD 1AOID 3UT9B 3TU4D 5KDMB 1P3OD 2FJ7D 3LZ1C 5B2JA 3AZFA 3B0DB 5DNMA 4R8PA 3TU4B 3MNNB 1P3OB 2FJ7B 2BYKB 3VH6T 4G92C 1P3PD 3AZLA 3AZIC 3A6NC 1P3PB 3AZGC 1TAFA 5B1MB 2JSSA 4XZQC 4Z66D 4CSRA 2RVQD 4Z66B 4H9RA 5GT3A 4AWLC 5BNXB 5AVCA 4KHAB 1Z2CB 3X1SA 5DNNA 3REJD 4YS3D 3LELD 2YFWB 3REJB 3W98D 3LELB 1P3GA 3REHC 4WU8C 4H9QA 3W98B 5CHLB 1EQZA 1M18A 1P3ID 2Y2QA 2HIOC 1BH9A 5GXQC 4J8XB 3MGSA 4J8UA 1P3IB 3MNNC 3AZFC 4R8PC 4WNNA 5DNMC 1P3LA 4ZUXA 3AZLC 1P3PC 3A1KA 5B1MC 3KUYD 3MGQA 1M1AA 2Y2JA 2F8ND 1P3KA 3LZ0D 2F8NB 2Y2KA 3W97A 5AY8B 2Y2MA 2Y2NA 1P3AD 4UUZA 3EG5B 2G5HC 3X1SC 5DNNC 2FFFB 1P3AB 3RELA 1S32D 4H9PA 3C1CD 5AV5D 3C1CB 2ZY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA B;  5G49 A;  5CPJ A;  4J8X C;  5AV5 B;  1EQZ C;  3WA9 B;  3AZK D;  3MGS C;  4J8U C;  3AZK B;  4HGA C;  1P3L C;  5B31 D;  2PYO D;  3NQJ B;  3AFA D;  4ZUX C;  5BS7 A;  5B31 B;  3MGQ C;  1M1A C;  3AV2 D;  4Z2M H;  3AFA B;  4X23 A;  4QLC B;  3AV2 B;  2F8N G;  1M19 A;  5BNV B;  1KX3 A;  5AY8 C;  1ID3 D;  5CP6 A;  1U35 D;  2NZD D;  1A7W A;  3V9R A;  3X1V A;  1ID3 B;  3WTP D;  1N1J B;  3AYW B;  1U35 B;  3UTA B;  3AZM A;  2NZD B;  5AVB D;  5JRG D;  3R45 B;  4ZBJ B;  3WTP B;  5AVB B;  3REL C;  1B6W A;  3LZ1 A;  1KU5 A;  3LJA C;  5B2I A;  1F66 D;  4J8W B;  1F66 B;  3UTB D;  5CPJ C;  3MVD D;  1KX4 A;  3AZG A;  4XZQ A;  3UTB B;  4KUD B;  1Q9C A;  2ARO D;  3X1U D;  3X1T A;  1ZLA B;  1P34 B;  3X1U B;  5B31 G;  4QLC C;  1P3B A;  5B1L D;  1M19 C;  4YM6 A;  1KX3 C;  1B67 A;  2BYM A;  5B1L B;  3WKJ A;  5CP6 C;  3AV1 D;  3AN2 D;  3KWQ D;  3AYW C;  3UTA C;  3REH A;  4WU8 A;  3WTP C;  3AN2 B;  3KWQ B;  3AV1 B;  3AZM C;  1P3G C;  5KDM A;  5GSU D;  3TU4 A;  3MNN A;  1P3O A;  2FJ7 A;  3W96 D;  2BYK A;  3B6F B;  4J8W C;  5GSU B;  5B2I C;  1AOI B;  5AV9 D;  3W96 B;  4WU9 D;  1P3P A;  5B1M A;  4KUD C;  1KX4 C;  4WU9 B;  3B0C W;  5BT1 C;  3O62 D;  4Z66 A;  1ZLA C;  1P34 C;  5B32 D;  1WWS A;  3O62 B;  4NE5 A;  3X1U C;  3X1T C;  5B32 B;  5BNX A;  1P3M D;  5CPI D;  4LD9 D;  4KHA A;  1P3B C;  5F99 D;  1P3M B;  5CPI B;  4LD9 B;  5B2J D;  2YFW A;  4YM6 C;  5F99 B;  3REJ A;  3WAA D;  3WKJ C;  3LEL A;  2L5A A;  3AV1 C;  4YS3 B;  3W98 A;  3WAA B;  4H9S A;  5BO0 B;  3B0C T;  5B40 D;  5GT0 D;  4J8X A;  3UT9 C;  1P3I A;  5B40 B;  1P3F D;  3B6F C;  3B0D C;  1AOI C;  5GT0 B;  3TU4 C;  3AZJ D;  4XUJ D;  1P3O C;  2FJ7 C;  3VH6 A;  1P3F B;  3AZJ B;  4XUJ B;  5GT3 D;  3NQU B;  5AVC D;  2CV5 D;  5E5A D;  2F8N A;  3KUY B;  3O62 C;  4Z66 C;  2CV5 B;  3B6G D;  5E5A B;  4NFT A;  1H3O B;  2RVQ C;  5AY8 A;  5B32 G;  3LZ0 B;  3B6G B;  1BH8 B;  3MGR D;  2NQB D;  4KGC D;  1M18 D;  4M6B A;  3MGR B;  1TZY D;  1P3A A;  5F99 C;  2NQB B;  4KGC B;  1TZY B;  3REJ C;  4YS3 C;  3LEL C;  3C1C A;  3LJA A;  3W98 C;  5B33 D;  4H9S C;  1S32 B;  5FUG B;  5JA4 B;  5AV5 A;  3WA9 A;  5B33 B;  1P3K D;  3AZE D;  4J8V D;  1JFI B;  1P3I C;  3AZK A;  5B0Z D;  3AZE B;  4J8V B;  3NQJ A;  3AZN D;  5B0Z B;  5CPK D;  2F8N K;  5B31 A;  3AZN B;  3KXB D;  3W99 D;  5CPK B;  1HQ3 D;  3AFA A;  3VH5 A;  2CWE A;  4QLC A;  3KUY C;  2PYO B;  3KXB B;  3AV2 A;  3W99 B;  1HQ3 B;  5BNV A;  2F8N H;  5B24 D;  3REK D;  1KX5 D;  3LZ0 C;  5B24 B;  5C3I B;  3REK B;  1KX5 B;  1ID3 A;  1N1J A;  3AYW A;  1U35 A;  3UTA A;  3C1B D;  2NZD A;  3R45 A;  2HUE B;  3WTP A;  1P3A C;  3C1B B;  5AVB A;  4WZS B;  5JRG B;  1S32 C;  3C1C C;  4J8W A;  1F66 A;  3WTP E;  3AZH D;  5AV5 C;  3WA9 C;  3UTB A;  4KUD A;  3AZE C;  3AZH B;  3AZK C;  3REI D;  5AV6 D;  3MVD B;  1ZLA A;  1P34 A;  3REI B;  3MGP D;  3AZN C;  5AV6 B;  3X1U A;  4JJN D;  4EO5 B;  2ARO B;  5B31 C;  2PYO C;  5AV8 D;  3MGP B;  4Z5T D;  3AFA C;  5B0Y D;  4JJN B;  5AV8 B;  3AV2 C;  4Z5T B;  4H9N B;  5B0Y B;  5C3I C;  5B1L A;  3LZ1 D;  3REK C;  4CAY B;  1ID3 C;  3AV1 A;  3AN2 A;  3KWQ A;  3AZI D;  1U35 C;  2NZD C;  2IO5 B;  2LY8 A;  4ZBJ C;  3A6N D;  3AZG D;  4XZQ D;  3AZI B;  3UT9 A;  5AVB C;  5JRG C;  3A6N B;  3B6F A;  1AOI A;  5GSU A;  3W96 A;  1F66 C;  4WU9 A;  4WV4 B;  3UTB C;  3MVD C;  5AV9 B;  3O62 A;  2ARO C;  1R4V A;  5B32 A;  3REH D;  4WU8 D;  2YFV B;  1P3M A;  5CPI A;  4LD9 A;  2HIO D;  5GXQ D;  5F99 A;  3MNN D;  5B1L C;  2HIO B;  4H9O B;  3AZF D;  5GXQ B;  4E44 A;  5DNM D;  4R8P D;  3WAA A;  4YS3 A;  5BO0 A;  2IO5 C;  5B2J B;  3AZF B;  4R8P B;  5DNM B;  3AZL D;  3KWQ C;  3AN2 C;  5B1M D;  3AZL B;  5B40 A;  5GT0 A;  1TAF B;  1P3F A;  5GSU C;  3AZJ A;  4XUJ A;  3NQU A;  3W96 C;  4CSR B;  5AV9 C;  4WU9 C;  4H9R B;  3KUY A;  5GT3 B;  2CV5 A;  3X1S D;  5DNN D;  5AVC B;  3VH5 W;  5E5A A;  1H3O A;  1WWI A;  5DNN B;  3X1S B;  3LZ0 A;  5B32 C;  3B6G A;  1BH8 A;  1P3G D;  3MGR A;  1P3M C;  5CPI C;  4J8X D;  1P3G B;  1EQZ D;  2NQB A;  4KGC A;  4H9Q B;  4LD9 C;  1BFM A;  1TZY A;  3MGS D;  4J8U D;  1M18 B;  1EQZ B;  5B2J C;  1BH9 B;  3WAA C;  4NE3 A;  3MGS B;  4J8U B;  1P3L D;  1S32 A;  5FUG A;  5JA4 A;  4WNN B;  4ZUX D;  4HGA B;  1P3L B;  5B33 A;  3MGQ D;  1M1A D;  1JFI A;  4ZUX B;  3VH5 T;  5B40 C;  3MGQ B;  3AZE A;  5GT0 C;  1M1A B;  4J8V A;  1ULY A;  1P3K B;  1P3F C;  5B0Z A;  5AY8 D;  3AZJ C;  4XUJ C;  3AZN A;  3W97 D;  5CPK A;  2PYO A;  5GT3 C;  3W97 B;  3KXB A;  3W99 A;  1HQ3 A;  5AVC C;  4NE6 A;  2CV5 C;  5E5A C;  3REL D;  4UUZ B;  5B24 A;  3REK A;  1KX5 A;  3B6G C;  3LJA D;  3REL B;  4H9P B;  3MGR C;  5CPJ D;  3C1B A;  2NQB C;  4KGC C;  1M18 C;  1TZY C;  5G49 B;  5CPJ B;  5JRG A;  1F1E A;  3KSY A;  4QLC D;  5B33 C;  3AZH A;  4X23 D;  4Z2M G;  1P3K C;  3MVD A;  4J8V C;  1M19 D;  4X23 B;  1KX3 D;  3REI A;  5B0Z C;  5AV6 A;  5CP6 D;  1M19 B;  2ARO A;  1KX3 B;  3MGP A;  3AYW D;  3W97 C;  3UTA D;  5CPK C;  4JJN A;  3X1V D;  5CP6 B;  4G91 B;  5AV8 A;  3W99 C;  3KXB C;  4Z5T A;  4H9N A;  1HQ3 C;  5B0Y A;  3V9R B;  3AZM D;  3X1V B;  3AZM B;  4DRB A;  4CAY A;  5B24 C;  1KX5 C;  4J8W D;  5B2I D;  3LZ1 B;  2HUE C;  5B2I B;  3AZI A;  4KUD D;  1KX4 D;  3C1B C;  4G92 B;  3A6N A;  5BT1 D;  1KX4 B;  1HTA A;  1ZLA D;  1P34 D;  3AZG B;  3B0B A;  4XZQ B;  3X1T D;  4E45 A;  3X1T B;  5BS7 C;  3AZH C;  5AV9 A;  1P3B D;  3VH6 W;  4DRA A;  4X23 C;  4AWL B;  1P3B B;  4YM6 D;  3REI C;  5AV6 C;  3WKJ D;  4EO5 C;  4YM6 B;  3MGP C;  2BYM B;  2YFV A;  4G91 C;  4JJN C;  3WKJ B;  3X1V C;  5AV8 C;  4Z5T C;  5B0Y C;  3UT9 D;  3REH B;  4WU8 B;  2HIO A;  4H9O A;  3WA9 D;  5GXQ A;  3B6F D;  1AOI D;  3UT9 B;  3TU4 D;  5KDM B;  1P3O D;  2FJ7 D;  3LZ1 C;  5B2J A;  3AZF A;  3B0D B;  5DNM A;  4R8P A;  3TU4 B;  3MNN B;  1P3O B;  2FJ7 B;  2BYK B;  3VH6 T;  4G92 C;  1P3P D;  3AZL A;  3AZI C;  3A6N C;  1P3P B;  3AZG C;  1TAF A;  5B1M B;  2JSS A;  4XZQ C;  4Z66 D;  4CSR A;  2RVQ D;  4Z66 B;  4H9R A;  5GT3 A;  4AWL C;  5BNX B;  5AVC A;  4KHA B;  3X1S A;  5DNN A;  3REJ D;  4YS3 D;  3LEL D;  2YFW B;  3REJ B;  3W98 D;  3LEL B;  1P3G A;  3REH C;  4WU8 C;  4H9Q A;  3W98 B;  5CHL B;  1EQZ A;  1M18 A;  1P3I D;  2HIO C;  1BH9 A;  5GXQ C;  4J8X B;  3MGS A;  4J8U A;  1P3I B;  3MNN C;  3AZF C;  4R8P C;  4WNN A;  5DNM C;  1P3L A;  4ZUX A;  3AZL C;  1P3P C;  5B1M C;  3KUY D;  3MGQ A;  1M1A A;  2F8N D;  1P3K A;  3LZ0 D;  2F8N B;  3W97 A;  5AY8 B;  1P3A D;  4UUZ A;  3X1S C;  5DNN C;  1P3A B;  3REL A;  1S32 D;  4H9P A;  3C1C D;  5AV5 D;  3C1C B; 
#chains in the Genus database with same CATH topology
 3LJA B;  5G49 A;  5CPJ A;  4J8X C;  5AV5 B;  1EQZ C;  3WA9 B;  3AZK D;  3MGS C;  4J8U C;  3AZK B;  4HGA C;  1P3L C;  5B31 D;  2PYO D;  3NQJ B;  3AFA D;  4ZUX C;  5BS7 A;  5B31 B;  3MGQ C;  1M1A C;  3AV2 D;  4Z2M H;  3AFA B;  4X23 A;  4QLC B;  3AV2 B;  2F8N G;  1M19 A;  5BNV B;  3EPL A;  1KX3 A;  5AY8 C;  1ID3 D;  5CP6 A;  1U35 D;  2NZD D;  1A7W A;  3V9R A;  3X1V A;  1ID3 B;  3WTP D;  1N1J B;  3AYW B;  1U35 B;  3UTA B;  3AZM A;  2NZD B;  5AVB D;  5JRG D;  3R45 B;  4ZBJ B;  3WTP B;  5AVB B;  3REL C;  1B6W A;  3LZ1 A;  1KU5 A;  3LJA C;  5B2I A;  1F66 D;  2ZM5 A;  4J8W B;  1F66 B;  3UTB D;  5CPJ C;  3MVD D;  1KX4 A;  2DF4 C;  3AZG A;  4XZQ A;  3UTB B;  4KUD B;  1Q9C A;  2ARO D;  3X1U D;  3X1T A;  1ZLA B;  1P34 B;  3X1U B;  5B31 G;  4QLC C;  1P3B A;  5B1L D;  1M19 C;  4YM6 A;  1KX3 C;  1B67 A;  2BYM A;  5B1L B;  3F6T A;  3WKJ A;  5CP6 C;  3AV1 D;  3AN2 D;  3KWQ D;  3AYW C;  3UTA C;  3REH A;  4WU8 A;  3WTP C;  3AN2 B;  3KWQ B;  3AV1 B;  3AZM C;  1P3G C;  5KDM A;  5GSU D;  3TU4 A;  3MNN A;  1P3O A;  2FJ7 A;  3W96 D;  3AL0 C;  2BYK A;  3B6F B;  4J8W C;  5GSU B;  5B2I C;  1AOI B;  5AV9 D;  3W96 B;  4WU9 D;  1P3P A;  5B1M A;  4KUD C;  1KX4 C;  4WU9 B;  3B0C W;  5BT1 C;  3O62 D;  4Z66 A;  1ZLA C;  1P34 C;  5B32 D;  1WWS A;  3O62 B;  4NE5 A;  3X1U C;  3X1T C;  2Y2G A;  5B32 B;  5BNX A;  1P3M D;  5CPI D;  4LD9 D;  4KHA A;  1P3B C;  5F99 D;  1P3M B;  5CPI B;  4LD9 B;  5B2J D;  2YFW A;  4YM6 C;  5F99 B;  3REJ A;  3WAA D;  3WKJ C;  3LEL A;  2L5A A;  3AV1 C;  4YS3 B;  2XD5 A;  3W98 A;  3WAA B;  4H9S A;  5BO0 B;  3B0C T;  5B40 D;  5GT0 D;  4J8X A;  3UT9 C;  1P3I A;  3A1I A;  5B40 B;  1P3F D;  3B6F C;  3B0D C;  1AOI C;  5GT0 B;  3TU4 C;  3AZJ D;  4XUJ D;  1P3O C;  2FJ7 C;  3VH6 A;  1P3F B;  2BG1 A;  3H0M C;  3AZJ B;  4XUJ B;  5GT3 D;  3NQU B;  5AVC D;  2CV5 D;  5E5A D;  2F8N A;  3KUY B;  3O62 C;  4Z66 C;  2CV5 B;  3B6G D;  2XD1 A;  5E5A B;  4NFT A;  1H3O B;  2RVQ C;  5AY8 A;  5B32 G;  3LZ0 B;  3B6G B;  1BH8 B;  3MGR D;  2NQB D;  4KGC D;  1M18 D;  4M6B A;  3MGR B;  1TZY D;  1P3A A;  5F99 C;  2NQB B;  4KGC B;  1TZY B;  2ZY3 A;  3REJ C;  4YS3 C;  3LEL C;  3C1C A;  3LJA A;  3W98 C;  5B33 D;  4H9S C;  1S32 B;  5FUG B;  5JA4 B;  5AV5 A;  3WA9 A;  5B33 B;  1P3K D;  3AZE D;  4J8V D;  1JFI B;  1P3I C;  3AZK A;  5B0Z D;  3AZE B;  3H0R C;  4J8V B;  3NQJ A;  3AZN D;  5B0Z B;  5CPK D;  2F8N K;  5B31 A;  3AZN B;  3KXB D;  3W99 D;  5CPK B;  1HQ3 D;  3AFA A;  3VH5 A;  2CWE A;  4QLC A;  3KUY C;  2PYO B;  3KXB B;  3AV2 A;  4DQY B;  3W99 B;  1HQ3 B;  5BNV A;  2F8N H;  5B24 D;  2ZY4 A;  3REK D;  1KX5 D;  3LZ0 C;  5B24 B;  5C3I B;  3REK B;  1KX5 B;  1ID3 A;  1N1J A;  3AYW A;  1U35 A;  3UTA A;  3C1B D;  2NZD A;  3R45 A;  2HUE B;  3WTP A;  1T3U A;  1P3A C;  3C1B B;  2Y2H A;  5AVB A;  4WZS B;  5JRG B;  3IP4 C;  1S32 C;  3C1C C;  4J8W A;  1F66 A;  3WTP E;  2G5I C;  3AZH D;  5AV5 C;  3WA9 C;  3UTB A;  4KUD A;  3AZE C;  3AZH B;  3AZK C;  3REI D;  5AV6 D;  3MVD B;  2Y2I A;  1ZLA A;  1P34 A;  3REI B;  3MGP D;  3AZN C;  5AV6 B;  3X1U A;  4JJN D;  4EO5 B;  2ARO B;  5B31 C;  2PYO C;  5AV8 D;  3MGP B;  4Z5T D;  3AFA C;  5B0Y D;  4JJN B;  5AV8 B;  3AV2 C;  4Z5T B;  4H9N B;  5B0Y B;  5C3I C;  5B1L A;  3LZ1 D;  3REK C;  2JCH A;  4CAY B;  1ID3 C;  3AV1 A;  3AN2 A;  3KWQ A;  3AZI D;  1U35 C;  2NZD C;  3EPJ A;  2IO5 B;  2LY8 A;  4ZBJ C;  3KFU G;  3A6N D;  3AZG D;  4XZQ D;  3AZI B;  3UT9 A;  5AVB C;  5JRG C;  3P5J B;  3A6N B;  3B6F A;  1AOI A;  5GSU A;  2ZY5 A;  3W96 A;  1F66 C;  4WU9 A;  4WV4 B;  3UTB C;  3MVD C;  5AV9 B;  3O62 A;  2ARO C;  1R4V A;  2UWX A;  5B32 A;  3REH D;  4WU8 D;  2YFV B;  1P3M A;  5CPI A;  4LD9 A;  2HIO D;  5GXQ D;  5F99 A;  3MNN D;  5B1L C;  2HIO B;  4H9O B;  3AZF D;  5GXQ B;  4E44 A;  5DNM D;  4R8P D;  3WAA A;  4YS3 A;  5BO0 A;  2IO5 C;  5B2J B;  3AZF B;  4R8P B;  2W8S A;  5DNM B;  3AZL D;  3KWQ C;  3FDD A;  5B1M D;  3AN2 C;  3EPK A;  3AZL B;  5B40 A;  5GT0 A;  1TAF B;  1P3F A;  5GSU C;  3AZJ A;  4XUJ A;  3NQU A;  3W96 C;  4CSR B;  5AV9 C;  4WU9 C;  4UPK A;  4H9R B;  3KUY A;  5GT3 B;  2CV5 A;  3X1S D;  5DNN D;  5AVC B;  3VH5 W;  5E5A A;  1H3O A;  1WWI A;  5DNN B;  3X1S B;  3LZ0 A;  5B32 C;  3B6G A;  1BH8 A;  1P3G D;  2Y2O A;  3MGR A;  1P3M C;  5CPI C;  4J8X D;  1P3G B;  1EQZ D;  2NQB A;  4KGC A;  4H9Q B;  4LD9 C;  2JE5 A;  1BFM A;  1TZY A;  3MGS D;  4J8U D;  1M18 B;  1EQZ B;  5B2J C;  1BH9 B;  3WAA C;  4NE3 A;  3MGS B;  4J8U B;  1P3L D;  1S32 A;  5FUG A;  5JA4 A;  2Y2L A;  4WNN B;  4ZUX D;  4HGA B;  1P3L B;  5B33 A;  3MGQ D;  1M1A D;  1JFI A;  4ZUX B;  3VH5 T;  5B40 C;  3MGQ B;  3AZE A;  5GT0 C;  1M1A B;  4J8V A;  1ULY A;  1P3K B;  1P3F C;  5B0Z A;  5AY8 D;  3AZJ C;  4XUJ C;  3AZN A;  2DQN C;  3W97 D;  5CPK A;  2PYO A;  5GT3 C;  3W97 B;  3KXB A;  3W99 A;  1HQ3 A;  5AVC C;  4NE6 A;  2CV5 C;  4WJ3 C;  5E5A C;  3REL D;  4UUZ B;  5B24 A;  3REK A;  1KX5 A;  3B6G C;  3LJA D;  3REL B;  2VQR A;  4H9P B;  2J8P A;  2Y2P A;  5CPJ D;  3MGR C;  3C1B A;  2NQB C;  4KGC C;  1M18 C;  3H0L C;  1TZY C;  5G49 B;  5CPJ B;  5JRG A;  1F1E A;  3KSY A;  4QLC D;  5B33 C;  3AZH A;  4X23 D;  4Z2M G;  1P3K C;  3MVD A;  4J8V C;  1M19 D;  4X23 B;  1KX3 D;  3EPH A;  3REI A;  5B0Z C;  5AV6 A;  5CP6 D;  1M19 B;  2ARO A;  1KX3 B;  3MGP A;  3AYW D;  3W97 C;  3UTA D;  5CPK C;  4JJN A;  3X1V D;  5CP6 B;  4G91 B;  5AV8 A;  3W99 C;  3KXB C;  4Z5T A;  4H9N A;  1HQ3 C;  5B0Y A;  3V9R B;  3AZM D;  3X1V B;  3AZM B;  4DRB A;  4CAY A;  5B24 C;  1W2E A;  1KX5 C;  4J8W D;  5B2I D;  3LZ1 B;  2HUE C;  5B2I B;  3AZI A;  4KUD D;  1KX4 D;  3C1B C;  4G92 B;  3A6N A;  5BT1 D;  1KX4 B;  1HTA A;  1ZLA D;  1P34 D;  3AZG B;  3B0B A;  4XZQ B;  3X1T D;  4E45 A;  3X1T B;  5BS7 C;  1PZR A;  3AZH C;  5AV9 A;  1P3B D;  3VH6 W;  4DRA A;  4X23 C;  2F2A C;  4AWL B;  1P3B B;  4YM6 D;  3REI C;  5AV6 C;  3WKJ D;  4EO5 C;  4YM6 B;  3MGP C;  2BYM B;  2YFV A;  4G91 C;  4JJN C;  3WKJ B;  3X1V C;  5AV8 C;  4Z5T C;  5B0Y C;  3UT9 D;  2RIQ A;  3REH B;  4WU8 B;  2HIO A;  4H9O A;  3WA9 D;  5GXQ A;  3B6F D;  1AOI D;  3UT9 B;  3TU4 D;  5KDM B;  1P3O D;  2FJ7 D;  3LZ1 C;  5B2J A;  3AZF A;  3B0D B;  5DNM A;  4R8P A;  3TU4 B;  3MNN B;  1P3O B;  2FJ7 B;  2BYK B;  3VH6 T;  4G92 C;  1P3P D;  3AZL A;  3AZI C;  3A6N C;  1P3P B;  3AZG C;  1TAF A;  5B1M B;  2JSS A;  4XZQ C;  4Z66 D;  4CSR A;  2RVQ D;  4Z66 B;  4H9R A;  5GT3 A;  4AWL C;  5BNX B;  5AVC A;  4KHA B;  1Z2C B;  3X1S A;  5DNN A;  3REJ D;  4YS3 D;  3LEL D;  2YFW B;  3REJ B;  3W98 D;  3LEL B;  1P3G A;  3REH C;  4WU8 C;  4H9Q A;  3W98 B;  5CHL B;  1EQZ A;  1M18 A;  1P3I D;  2Y2Q A;  2HIO C;  1BH9 A;  5GXQ C;  4J8X B;  3MGS A;  4J8U A;  1P3I B;  3MNN C;  3AZF C;  4R8P C;  4WNN A;  5DNM C;  1P3L A;  4ZUX A;  3AZL C;  1P3P C;  3A1K A;  5B1M C;  3KUY D;  3MGQ A;  1M1A A;  2Y2J A;  2F8N D;  1P3K A;  3LZ0 D;  2F8N B;  2Y2K A;  3W97 A;  5AY8 B;  2Y2M A;  2Y2N A;  1P3A D;  4UUZ A;  3EG5 B;  2G5H C;  3X1S C;  5DNN C;  2FFF B;  1P3A B;  3REL A;  1S32 D;  4H9P A;  3C1C D;  5AV5 D;  3C1C B;  2ZY2 A; 
#chains in the Genus database with same CATH homology
 3LJA B;  5G49 A;  5CPJ A;  4J8X C;  5AV5 B;  1EQZ C;  3WA9 B;  3AZK D;  3MGS C;  4J8U C;  3AZK B;  4HGA C;  1P3L C;  5B31 D;  2PYO D;  3NQJ B;  3AFA D;  4ZUX C;  5BS7 A;  5B31 B;  3MGQ C;  1M1A C;  3AV2 D;  4Z2M H;  3AFA B;  4X23 A;  4QLC B;  3AV2 B;  2F8N G;  1M19 A;  5BNV B;  3EPL A;  1KX3 A;  5AY8 C;  1ID3 D;  5CP6 A;  1U35 D;  2NZD D;  1A7W A;  3V9R A;  3X1V A;  1ID3 B;  3WTP D;  1N1J B;  3AYW B;  1U35 B;  3UTA B;  3AZM A;  2NZD B;  5AVB D;  5JRG D;  3R45 B;  4ZBJ B;  3WTP B;  5AVB B;  3REL C;  1B6W A;  3LZ1 A;  1KU5 A;  3LJA C;  5B2I A;  1F66 D;  2ZM5 A;  4J8W B;  1F66 B;  3UTB D;  5CPJ C;  3MVD D;  1KX4 A;  2DF4 C;  3AZG A;  4XZQ A;  3UTB B;  4KUD B;  1Q9C A;  2ARO D;  3X1U D;  3X1T A;  1ZLA B;  1P34 B;  3X1U B;  5B31 G;  4QLC C;  1P3B A;  5B1L D;  1M19 C;  4YM6 A;  1KX3 C;  1B67 A;  2BYM A;  5B1L B;  3F6T A;  3WKJ A;  5CP6 C;  3AV1 D;  3AN2 D;  3KWQ D;  3AYW C;  3UTA C;  3REH A;  4WU8 A;  3WTP C;  3AN2 B;  3KWQ B;  3AV1 B;  3AZM C;  1P3G C;  5KDM A;  5GSU D;  3TU4 A;  3MNN A;  1P3O A;  2FJ7 A;  3W96 D;  3AL0 C;  2BYK A;  3B6F B;  4J8W C;  5GSU B;  5B2I C;  1AOI B;  5AV9 D;  3W96 B;  4WU9 D;  1P3P A;  5B1M A;  4KUD C;  1KX4 C;  4WU9 B;  3B0C W;  5BT1 C;  3O62 D;  4Z66 A;  1ZLA C;  1P34 C;  5B32 D;  1WWS A;  3O62 B;  4NE5 A;  3X1U C;  3X1T C;  2Y2G A;  5B32 B;  5BNX A;  1P3M D;  5CPI D;  4LD9 D;  4KHA A;  1P3B C;  5F99 D;  1P3M B;  5CPI B;  4LD9 B;  5B2J D;  2YFW A;  4YM6 C;  5F99 B;  3REJ A;  3WAA D;  3WKJ C;  3LEL A;  2L5A A;  3AV1 C;  4YS3 B;  2XD5 A;  3W98 A;  3WAA B;  4H9S A;  5BO0 B;  3B0C T;  5B40 D;  5GT0 D;  4J8X A;  3UT9 C;  1P3I A;  3A1I A;  5B40 B;  1P3F D;  3B6F C;  3B0D C;  1AOI C;  5GT0 B;  3TU4 C;  3AZJ D;  4XUJ D;  1P3O C;  2FJ7 C;  3VH6 A;  1P3F B;  2BG1 A;  3H0M C;  3AZJ B;  4XUJ B;  5GT3 D;  3NQU B;  5AVC D;  2CV5 D;  5E5A D;  2F8N A;  3KUY B;  3O62 C;  4Z66 C;  2CV5 B;  3B6G D;  2XD1 A;  5E5A B;  4NFT A;  1H3O B;  2RVQ C;  5AY8 A;  5B32 G;  3LZ0 B;  3B6G B;  1BH8 B;  3MGR D;  2NQB D;  4KGC D;  1M18 D;  4M6B A;  3MGR B;  1TZY D;  1P3A A;  5F99 C;  2NQB B;  4KGC B;  1TZY B;  2ZY3 A;  3REJ C;  4YS3 C;  3LEL C;  3C1C A;  3LJA A;  3W98 C;  5B33 D;  4H9S C;  1S32 B;  5FUG B;  5JA4 B;  5AV5 A;  3WA9 A;  5B33 B;  1P3K D;  3AZE D;  4J8V D;  1JFI B;  1P3I C;  3AZK A;  5B0Z D;  3AZE B;  3H0R C;  4J8V B;  3NQJ A;  3AZN D;  5B0Z B;  5CPK D;  2F8N K;  5B31 A;  3AZN B;  3KXB D;  3W99 D;  5CPK B;  1HQ3 D;  3AFA A;  3VH5 A;  2CWE A;  4QLC A;  3KUY C;  2PYO B;  3KXB B;  3AV2 A;  4DQY B;  3W99 B;  1HQ3 B;  5BNV A;  2F8N H;  5B24 D;  2ZY4 A;  3REK D;  1KX5 D;  3LZ0 C;  5B24 B;  5C3I B;  3REK B;  1KX5 B;  1ID3 A;  1N1J A;  3AYW A;  1U35 A;  3UTA A;  3C1B D;  2NZD A;  3R45 A;  2HUE B;  3WTP A;  1T3U A;  1P3A C;  3C1B B;  2Y2H A;  5AVB A;  4WZS B;  5JRG B;  3IP4 C;  1S32 C;  3C1C C;  4J8W A;  1F66 A;  3WTP E;  2G5I C;  3AZH D;  5AV5 C;  3WA9 C;  3UTB A;  4KUD A;  3AZE C;  3AZH B;  3AZK C;  3REI D;  5AV6 D;  3MVD B;  2Y2I A;  1ZLA A;  1P34 A;  3REI B;  3MGP D;  3AZN C;  5AV6 B;  3X1U A;  4JJN D;  4EO5 B;  2ARO B;  5B31 C;  2PYO C;  5AV8 D;  3MGP B;  4Z5T D;  3AFA C;  5B0Y D;  4JJN B;  5AV8 B;  3AV2 C;  4Z5T B;  4H9N B;  5B0Y B;  5C3I C;  5B1L A;  3LZ1 D;  3REK C;  2JCH A;  4CAY B;  1ID3 C;  3AV1 A;  3AN2 A;  3KWQ A;  3AZI D;  1U35 C;  2NZD C;  3EPJ A;  2IO5 B;  2LY8 A;  4ZBJ C;  3KFU G;  3A6N D;  3AZG D;  4XZQ D;  3AZI B;  3UT9 A;  5AVB C;  5JRG C;  3P5J B;  3A6N B;  3B6F A;  1AOI A;  5GSU A;  2ZY5 A;  3W96 A;  1F66 C;  4WU9 A;  4WV4 B;  3UTB C;  3MVD C;  5AV9 B;  3O62 A;  2ARO C;  1R4V A;  2UWX A;  5B32 A;  3REH D;  4WU8 D;  2YFV B;  1P3M A;  5CPI A;  4LD9 A;  2HIO D;  5GXQ D;  5F99 A;  3MNN D;  5B1L C;  2HIO B;  4H9O B;  3AZF D;  5GXQ B;  4E44 A;  5DNM D;  4R8P D;  3WAA A;  4YS3 A;  5BO0 A;  2IO5 C;  5B2J B;  3AZF B;  4R8P B;  2W8S A;  5DNM B;  3AZL D;  3KWQ C;  3FDD A;  5B1M D;  3AN2 C;  3EPK A;  3AZL B;  5B40 A;  5GT0 A;  1TAF B;  1P3F A;  5GSU C;  3AZJ A;  4XUJ A;  3NQU A;  3W96 C;  4CSR B;  5AV9 C;  4WU9 C;  4UPK A;  4H9R B;  3KUY A;  5GT3 B;  2CV5 A;  3X1S D;  5DNN D;  5AVC B;  3VH5 W;  5E5A A;  1H3O A;  1WWI A;  5DNN B;  3X1S B;  3LZ0 A;  5B32 C;  3B6G A;  1BH8 A;  1P3G D;  2Y2O A;  3MGR A;  1P3M C;  5CPI C;  4J8X D;  1P3G B;  1EQZ D;  2NQB A;  4KGC A;  4H9Q B;  4LD9 C;  2JE5 A;  1BFM A;  1TZY A;  3MGS D;  4J8U D;  1M18 B;  1EQZ B;  5B2J C;  1BH9 B;  3WAA C;  4NE3 A;  3MGS B;  4J8U B;  1P3L D;  1S32 A;  5FUG A;  5JA4 A;  2Y2L A;  4WNN B;  4ZUX D;  4HGA B;  1P3L B;  5B33 A;  3MGQ D;  1M1A D;  1JFI A;  4ZUX B;  3VH5 T;  5B40 C;  3MGQ B;  3AZE A;  5GT0 C;  1M1A B;  4J8V A;  1ULY A;  1P3K B;  1P3F C;  5B0Z A;  5AY8 D;  3AZJ C;  4XUJ C;  3AZN A;  2DQN C;  3W97 D;  5CPK A;  2PYO A;  5GT3 C;  3W97 B;  3KXB A;  3W99 A;  1HQ3 A;  5AVC C;  4NE6 A;  2CV5 C;  4WJ3 C;  5E5A C;  3REL D;  4UUZ B;  5B24 A;  3REK A;  1KX5 A;  3B6G C;  3LJA D;  3REL B;  2VQR A;  4H9P B;  2J8P A;  2Y2P A;  5CPJ D;  3MGR C;  3C1B A;  2NQB C;  4KGC C;  1M18 C;  3H0L C;  1TZY C;  5G49 B;  5CPJ B;  5JRG A;  1F1E A;  3KSY A;  4QLC D;  5B33 C;  3AZH A;  4X23 D;  4Z2M G;  1P3K C;  3MVD A;  4J8V C;  1M19 D;  4X23 B;  1KX3 D;  3EPH A;  3REI A;  5B0Z C;  5AV6 A;  5CP6 D;  1M19 B;  2ARO A;  1KX3 B;  3MGP A;  3AYW D;  3W97 C;  3UTA D;  5CPK C;  4JJN A;  3X1V D;  5CP6 B;  4G91 B;  5AV8 A;  3W99 C;  3KXB C;  4Z5T A;  4H9N A;  1HQ3 C;  5B0Y A;  3V9R B;  3AZM D;  3X1V B;  3AZM B;  4DRB A;  4CAY A;  5B24 C;  1W2E A;  1KX5 C;  4J8W D;  5B2I D;  3LZ1 B;  2HUE C;  5B2I B;  3AZI A;  4KUD D;  1KX4 D;  3C1B C;  4G92 B;  3A6N A;  5BT1 D;  1KX4 B;  1HTA A;  1ZLA D;  1P34 D;  3AZG B;  3B0B A;  4XZQ B;  3X1T D;  4E45 A;  3X1T B;  5BS7 C;  1PZR A;  3AZH C;  5AV9 A;  1P3B D;  3VH6 W;  4DRA A;  4X23 C;  2F2A C;  4AWL B;  1P3B B;  4YM6 D;  3REI C;  5AV6 C;  3WKJ D;  4EO5 C;  4YM6 B;  3MGP C;  2BYM B;  2YFV A;  4G91 C;  4JJN C;  3WKJ B;  3X1V C;  5AV8 C;  4Z5T C;  5B0Y C;  3UT9 D;  2RIQ A;  3REH B;  4WU8 B;  2HIO A;  4H9O A;  3WA9 D;  5GXQ A;  3B6F D;  1AOI D;  3UT9 B;  3TU4 D;  5KDM B;  1P3O D;  2FJ7 D;  3LZ1 C;  5B2J A;  3AZF A;  3B0D B;  5DNM A;  4R8P A;  3TU4 B;  3MNN B;  1P3O B;  2FJ7 B;  2BYK B;  3VH6 T;  4G92 C;  1P3P D;  3AZL A;  3AZI C;  3A6N C;  1P3P B;  3AZG C;  1TAF A;  5B1M B;  2JSS A;  4XZQ C;  4Z66 D;  4CSR A;  2RVQ D;  4Z66 B;  4H9R A;  5GT3 A;  4AWL C;  5BNX B;  5AVC A;  4KHA B;  1Z2C B;  3X1S A;  5DNN A;  3REJ D;  4YS3 D;  3LEL D;  2YFW B;  3REJ B;  3W98 D;  3LEL B;  1P3G A;  3REH C;  4WU8 C;  4H9Q A;  3W98 B;  5CHL B;  1EQZ A;  1M18 A;  1P3I D;  2Y2Q A;  2HIO C;  1BH9 A;  5GXQ C;  4J8X B;  3MGS A;  4J8U A;  1P3I B;  3MNN C;  3AZF C;  4R8P C;  4WNN A;  5DNM C;  1P3L A;  4ZUX A;  3AZL C;  1P3P C;  3A1K A;  5B1M C;  3KUY D;  3MGQ A;  1M1A A;  2Y2J A;  2F8N D;  1P3K A;  3LZ0 D;  2F8N B;  2Y2K A;  3W97 A;  5AY8 B;  2Y2M A;  2Y2N A;  1P3A D;  4UUZ A;  3EG5 B;  2G5H C;  3X1S C;  5DNN C;  2FFF B;  1P3A B;  3REL A;  1S32 D;  4H9P A;  3C1C D;  5AV5 D;  3C1C B;  2ZY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...