4X23C

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
total genus 25
structure length 102
sequence length 102
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23C00
5B31G 3AYWA 5BO0A 3NQUB 2CV5A 5B1LC 5AV9D 5B24B 2NQBD 3REKD 1P3AB 1JFIB 3UT9C 3W98B 1P3PD 3MGQD 4J8WC 1KX4D 1HQ3B 3X1SB 5CPID 4XZQA 3B0BA 1S32C 2FJ7C 3MNNA 3MVDD 3AZHA 2RVQD 3AZLB 2LY8A 4G91C 4J8UC 5DNMC 4AWLB 3LZ0C 3WTPC 3C1BA 3UTBC 1M1AC 1HQ3C 3AZHB 3X1TD 3MNNC 1U35B 3AZEC 5AY8A 4KHAB 3LZ1A 3B6GD 1P3BA 3WAAC 1ID3A 4X23A 4J8UA 1EQZB 4E44A 5AV5C 3UT9B 3LZ0A 3C1BC 1P3AC 3UTBA 3B0CT 5GXQB 5B31D 2NQBA 5AY8C 3WA9A 5AV6C 1ZLAC 4R8PB 5B24A 5KDMA 1ID3C 4H9NA 2HIOB 5AV5A 3UTBB 3NQJA 4ZBJB 4ZUXB 4J8VA 3AZJB 1P3MD 3MGSC 5B32A 4X23D 3X1UC 3WKJB 1M19C 5AV6A 5AV5B 4J8XC 3AV1A 1P3LB 3MGSD 2CV5D 5G49A 2F8NB 3AV2A 4KGCA 3AZNC 5DNND 3KWQA 4WU8A 4J8XB 4YM6C 3REJD 5GT3B 5B32C 1P3PA 3X1UA 3AZFB 3AZMB 4J8XA 3REKA 4G91B 1TZYD 4J8UB 5B0ZA 3AV1C 4NFTA 5B1LB 1KX3D 1F66D 3AZNA 4KGCC 5F99D 4Z2MH 4Z66D 1WWSA 1BH9A 4R8PC 5B1MB 4CSRA 1ZLAB 5B33A 3REHD 5B2JC 4G92B 3KUYB 3AZED 1A7WA 1M18D 3AZGD 5B0ZC 4YS3D 4J8WB 3MGRB 4JJNB 3B6FA 2HUEB 5B0YB 3X1UB 3W99D 3WKJC 1AOIB 5B0YD 4XUJD 4Z5TD 5AVCD 1KX4A 3LELB 3WA9B 4WZSB 4H9SC 4WNNA 1U35C 5E5AA 5F99A 1S32D 3WTPB 5DNMB 4AWLC 5CP6D 4EO5C 3AZIA 4H9RB 5JA4A 1KX4C 3LZ1B 5AVCA 4WU9A 1P3OA 4H9SA 3REJA 2FJ7B 5BS7A 2HIOA 4H9NB 5JRGD 1P3FC 3TU4A 3AN2A 3AZGC 5CP6C 1P3OB 1M18C 2F8NK 5B2JD 4H9RA 5JA4B 3KUYA 3O62D 3AZKC 3REHC 2F8ND 3KXBA 5B33B 5AVCC 4WU9C 5CP6B 1P3OC 1P3FB 2NZDA 5BS7C 1P3BD 4X23B 5B1LA 1P3BB 1KU5A 1M18A 4KHAA 3AZKA 1F1EA 3UTAB 5GT0C 5B40C 3KXBC 2HIOD 3O62B 4J8WA 5CHLB 5B2ID 4KGCB 2PYOC 4H9PA 4XZQC 4H9OA 1P3LA 1S32A 1M19D 2FJ7A 4CSRB 3LZ1D 5B1MD 5B40A 3AV1D 5B32B 4Z66B 4XZQD 3RELB 4XZQB 3RELD 5B0ZB 5B32D 5DNMA 3AYWD 1TZYB 4G92C 3WTPA 1P3GB 2PYOA 3AFAC 3B6FD 1P3LC 3RELC 5B2IB 3AZEA 4HGAC 4J8XD 3LZ1C 3AV2B 3MVDA 1AOID 1P3BC 3X1UD 4X23C 3UTAD 4YS3B 5AV5D 5GT0B 4HGAB 5CPIA 5B2IC 3O62C 3AZIB 3REHB 3KSYA 5CPIB 3MNND 3WA9C 1HQ3D 1P3FD 2F8NH 1ZLAA 3W97C 5AY8D 5AVBC 3UTBD 4DRAA 3KWQD 4J8VC 4J8UD 3AV2D 5B2IA 5DNNA 1P3AD 3O62A 5JRGB 3VH6W 3UTAA 1M19A 2FJ7D 3B6FB 3W97A 1P3GD 5DNNB 5AVBA 2YFWA 3KWQB 1M1AB 5AY8B 5JRGC 4WU8C 3AV1B 3WTPD 1P3PC 5B32G 5GSUA 3WTPE 3WA9D 3REKC 4Z5TB 4ZUXD 3LELD 1P3GC 3R45B 3VH5W 5AV9A 4R8PA 3MVDB 4Z66C 4KUDA 1M18B 1B67A 3AZGB 5B2JA 3KUYD 1AOIC 5G49B 2HUEC 5B0YC 3W99C 3A6NB 2NZDB 4ZBJC 5F99B 3VH6A 5B0ZD 3WKJA 1R4VA 5AV9C 4WNNB 5B1LD 4CAYB 1KX3B 1F66B 3W98D 4Z66A 3AZFD 1U35A 1AOIA 5B0YA 3R45A 5F99C 3REJB 5GT3D 4KGCD 4CAYA 3MGSB 5GXQA 1P3LD 1TAFA 3REJC 3MNNB 2HIOC 5B40D 3AZID 4M6BA 3X1VD 3AZGA 2YFWB 3X1SD 3LJAA 4LD9C 3AZJD 5CPJC 5B1MC 5B33D 5GXQC 1P3PB 3MGPC 2NZDC 3MGRD 4JJND 1P3OD 3WAAD 3AZFC 5B31B 1H3OA 2BYMA 5CPKA 3AZLA 4LD9A 5FUGB 5CPJA 1BH9B 2AROB 5B1MA 3AYWB 5GT0A 1ZLAD 1P3IB 3C1CA 1Q9CA 3MGPA 2YFVA 3B6GB 3VH5T 5DNMD 1KX5A 3AZMD 1M19B 5CPKC 2IO5B 3AZLC 5KDMB 2CWEA 3B6GC 4EO5B 3C1CC 3AZKD 4XUJB 4ZUXC 2CV5B 1WWIA 4J8WD 5AV6B 4XUJC 1N1JB 3AFAA 3WKJD 3VH5A 3RELA 1KX3A 1F66A 3B6GA 1P3KC 1P3MB 3AZJA 3NQJB 4ZUXA 3MVDC 4J8VB 3B0DC 1ULYA 1P34A 4H9PB 5B2JB 4R8PD 5CPIC 1P3IC 3REKB 3B0DB 2AROC 1KX3C 1F66C 5AV9B 3W96C 4NE5A 5AV8D 1P3KA 3LZ0B 5AVBD 3REIA 4WU8B 3W97D 3UT9D 1P34C 5BNVA 4YM6D 3X1SA 3LJAD 1P3IA 3W96B 1BH8A 5DNNC 2AROA 1S32B 4LD9B 3AZHD 3UTAC 3AZNB 3REIC 3A6NC 3W99B 1P3KB 1P3MC 5JRGA 5BNXB 5BO0B 4KUDD 3AFAD 4NE6A 3MGPD 3AZEB 3AYWC 5GXQD 5GSUC 2F8NA 3AZND 2CV5C 4LD9D 1TAFB 1P3GA 5B31C 3X1TA 1KX5B 3A6NA 1EQZD 1B6WA 5GSUD 5E5AB 4QLCD 2L5AA 2YFVB 4KUDC 2PYOD 5CPJB 3W99A 4E45A 4QLCC 5B31A 3X1TC 3VH6T 3REID 5AVCB 5GT0D 4WU9B 5C3IB 3AZHC 4NE3A 1KX5D 3W98C 2RVQC 5BNVB 1P34D 4QLCA 1M1AA 3MGPB 3LELA 1KX4B 1HQ3A 4UUZA 3MGQB 4H9OB 3W98A 3WAAA 5B24D 1P3AA 1JFIA 3TU4B 3AN2B 3LJAC 3LELC 4UUZB 3MGQA 2NQBC 1BH8B 3B0CW 3LJAB 4YM6B 5B24C 5AV8C 5C3IC 3AZMA 3AZFA 4WU8D 2BYKB 1U35D 3X1TB 3W97B 2AROD 3V9RA 4Z5TC 5AV8B 2F8NG 3KXBB 3MGSA 3MGQC 3TU4D 3AN2D 4KUDB 4YS3C 3AZLD 5AV8A 1P3KD 5CPKD 4H9QB 3AZMC 1HTAA 1KX5C 3AV2C 3MGRA 4DRBA 4JJNA 3KWQC 4J8VD 4Z5TA 1ID3B 4YM6A 3X1VB 2JSSA 5B40B 4YS3A 1TZYC 4H9QA 3C1CD 4WV4B 2IO5C 1H3OB 2BYMB 5CPKB 4XUJA 3MGRC 4JJNC 5AVBB 2NQBB 3REIB 5B33C 5BNXA 3V9RB 5CPJD 3AZJC 4Z2MG 2PYOB 1TZYA 5BT1D 1EQZA 4QLCB 3B6FC 5GSUB 1BFMA 5E5AD 3C1CB 5FUGA 3W96A 2NZDD 3A6ND 5E5AC 3C1BB 1ID3D 1EQZC 5AV6D 3AFAB 3WAAB 1N1JA 5BT1C 3NQUA 3X1SC 5GT3A 3X1VC 3AZIC 3AZKB 3C1BD 3KXBD 1P34B 1P3FA 3TU4C 3AN2C 5CP6A 2BYKA 3UT9A 3W96D 1P3MA 3KUYC 5GT3C 3REHA 3X1VA 1P3ID 1M1AD 3LZ0D 4WU9D
chains in the Genus database with same CATH superfamily
5B31G 3AYWA 5BO0A 3NQUB 2CV5A 5B1LC 5AV9D 5B24B 2NQBD 3REKD 1P3AB 1JFIB 3UT9C 2Y2QA 3W98B 1P3PD 3MGQD 1PZRA 4J8WC 1KX4D 1HQ3B 3X1SB 5CPID 4XZQA 3B0BA 1S32C 2FJ7C 3MNNA 3MVDD 3AZHA 2RVQD 3AZLB 1T3UA 3EPKA 2LY8A 4G91C 4J8UC 5DNMC 4AWLB 3LZ0C 3WTPC 3C1BA 3UTBC 1M1AC 1HQ3C 3AZHB 3X1TD 3MNNC 3A1IA 1U35B 3AZEC 5AY8A 4KHAB 3LZ1A 4DQYB 3B6GD 2Y2NA 1P3BA 3WAAC 1ID3A 4X23A 4J8UA 1EQZB 4E44A 5AV5C 3UT9B 3LZ0A 3C1BC 1P3AC 3UTBA 3B0CT 5GXQB 5B31D 2NQBA 5AY8C 3WA9A 5AV6C 1ZLAC 4R8PB 5B24A 5KDMA 1ID3C 2HIOB 4H9NA 5AV5A 3UTBB 3NQJA 4ZBJB 4ZUXB 4J8VA 3AZJB 1P3MD 3MGSC 3P5JB 5B32A 4X23D 3X1UC 3WKJB 1M19C 5AV6A 5AV5B 4J8XC 3AV1A 1P3LB 3MGSD 2CV5D 5G49A 2F8NB 3AV2A 4KGCA 3AZNC 5DNND 3KWQA 4WU8A 4J8XB 4YM6C 3REJD 5GT3B 5B32C 1P3PA 3X1UA 3AZFB 3AZMB 4J8XA 3REKA 4G91B 1TZYD 4J8UB 5B0ZA 3AV1C 4NFTA 5B1LB 2ZM5A 1KX3D 3AZNA 2Y2KA 1F66D 4KGCC 5F99D 4Z2MH 4Z66D 1WWSA 1BH9A 4R8PC 5B1MB 4CSRA 1ZLAB 1Z2CB 5B33A 3REHD 2ZY2A 4UPKA 5B2JC 4G92B 3KUYB 3AZED 1A7WA 1M18D 2Y2GA 3AZGD 5B0ZC 4YS3D 4J8WB 3MGRB 4JJNB 3B6FA 2HUEB 5B0YB 3X1UB 3W99D 3WKJC 1AOIB 5B0YD 4XUJD 4Z5TD 5AVCD 1KX4A 3LELB 3WA9B 4WZSB 4H9SC 4WNNA 1U35C 5E5AA 4WJ3C 5F99A 1S32D 3WTPB 5DNMB 4AWLC 5CP6D 4EO5C 3AZIA 4H9RB 5JA4A 1KX4C 3LZ1B 5AVCA 4WU9A 2G5HC 1P3OA 4H9SA 3REJA 2FJ7B 5BS7A 2HIOA 4H9NB 5JRGD 1P3FC 3TU4A 3AN2A 3AZGC 5CP6C 1P3OB 1M18C 2F8NK 5B2JD 4H9RA 5JA4B 3KUYA 3O62D 3AZKC 3REHC 2F8ND 3KXBA 5B33B 5AVCC 4WU9C 5CP6B 1P3OC 1P3FB 2NZDA 5BS7C 1P3BD 4X23B 5B1LA 1P3BB 1KU5A 1M18A 4KHAA 3AZKA 1F1EA 3UTAB 5GT0C 5B40C 3KXBC 2HIOD 3O62B 4J8WA 5CHLB 2JE5A 5B2ID 4KGCB 2PYOC 4H9PA 4XZQC 4H9OA 1P3LA 1S32A 1M19D 2FJ7A 4CSRB 3LZ1D 5B1MD 5B40A 3AV1D 5B32B 4Z66B 4XZQD 3RELB 4XZQB 3RELD 5B0ZB 5B32D 5DNMA 3AYWD 1TZYB 4G92C 3WTPA 1P3GB 2PYOA 3AFAC 3B6FD 1P3LC 3RELC 5B2IB 3AZEA 4HGAC 4J8XD 2Y2IA 3LZ1C 3AV2B 3MVDA 1AOID 1P3BC 3X1UD 4X23C 3UTAD 4YS3B 5AV5D 5GT0B 4HGAB 5CPIA 3AL0C 5B2IC 3O62C 3AZIB 3REHB 3KSYA 2JCHA 5CPIB 3MNND 3WA9C 1HQ3D 1P3FD 2F8NH 1ZLAA 3W97C 5AY8D 5AVBC 3KFUG 3UTBD 4DRAA 3KWQD 4J8VC 4J8UD 3AV2D 5B2IA 5DNNA 1P3AD 3O62A 3H0MC 5JRGB 3VH6W 3UTAA 1M19A 2FJ7D 3B6FB 3W97A 1P3GD 5DNNB 5AVBA 2YFWA 3KWQB 1M1AB 5AY8B 5JRGC 4WU8C 3AV1B 3WTPD 1P3PC 5B32G 2ZY4A 5GSUA 3WTPE 3WA9D 3REKC 4Z5TB 4ZUXD 3LELD 1P3GC 3R45B 3VH5W 5AV9A 4R8PA 3MVDB 4Z66C 2FFFB 1M18B 4KUDA 1B67A 3AZGB 5B2JA 3KUYD 2XD5A 1AOIC 5G49B 2HUEC 5B0YC 3W99C 3A6NB 2NZDB 4ZBJC 5F99B 3VH6A 5B0ZD 3WKJA 1R4VA 5AV9C 4WNNB 5B1LD 4CAYB 1KX3B 1F66B 3W98D 4Z66A 3AZFD 1U35A 1AOIA 2Y2OA 5B0YA 3R45A 5F99C 3REJB 5GT3D 4KGCD 4CAYA 3MGSB 5GXQA 2RIQA 1P3LD 1TAFA 3REJC 3MNNB 2F2AC 2HIOC 5B40D 3AZID 4M6BA 2BG1A 3X1VD 3AZGA 2YFWB 3X1SD 3LJAA 2Y2HA 4LD9C 3AZJD 5CPJC 5B1MC 5B33D 5GXQC 1P3PB 3MGPC 2NZDC 3MGRD 4JJND 1P3OD 3WAAD 3AZFC 5B31B 1H3OA 2BYMA 5CPKA 3AZLA 4LD9A 5FUGB 5CPJA 1BH9B 2AROB 5B1MA 3AYWB 5GT0A 1ZLAD 1P3IB 3C1CA 1Q9CA 3MGPA 2YFVA 3B6GB 3VH5T 5DNMD 1KX5A 3AZMD 1M19B 5CPKC 2IO5B 3AZLC 5KDMB 3IP4C 2J8PA 2CWEA 3B6GC 4EO5B 3C1CC 3AZKD 4XUJB 4ZUXC 2CV5B 1WWIA 4J8WD 5AV6B 4XUJC 1N1JB 3AFAA 3WKJD 3VH5A 3RELA 1KX3A 1F66A 3B6GA 1P3KC 1P3MB 3AZJA 2XD1A 3NQJB 4ZUXA 3MVDC 4J8VB 3B0DC 3EPHA 1ULYA 1P34A 4H9PB 5B2JB 4R8PD 5CPIC 1P3IC 3REKB 3B0DB 2AROC 2W8SA 2ZY5A 1KX3C 1F66C 5AV9B 3W96C 4NE5A 5AV8D 1P3KA 3LZ0B 5AVBD 3REIA 3A1KA 4WU8B 3W97D 3UT9D 1P34C 5BNVA 4YM6D 3X1SA 3LJAD 1P3IA 3W96B 1BH8A 5DNNC 2AROA 1S32B 4LD9B 3AZHD 3UTAC 3AZNB 3REIC 3A6NC 3W99B 1P3KB 1P3MC 5JRGA 5BNXB 5BO0B 4KUDD 3AFAD 4NE6A 3MGPD 3AZEB 3AYWC 5GXQD 5GSUC 2F8NA 3AZND 2CV5C 2ZY3A 4LD9D 1TAFB 1P3GA 5B31C 3X1TA 1KX5B 3A6NA 1EQZD 1B6WA 3H0RC 5GSUD 5E5AB 4QLCD 2L5AA 2YFVB 4KUDC 2PYOD 5CPJB 3W99A 3EPJA 4E45A 2DF4C 4QLCC 5B31A 3X1TC 3VH6T 3REID 5AVCB 5GT0D 4WU9B 5C3IB 3AZHC 2VQRA 4NE3A 1KX5D 3W98C 2DQNC 2RVQC 3EG5B 5BNVB 1P34D 4QLCA 3FDDA 1M1AA 3MGPB 3LELA 1KX4B 1HQ3A 4UUZA 3MGQB 2Y2PA 4H9OB 3W98A 3WAAA 5B24D 1P3AA 1JFIA 3TU4B 3AN2B 3LJAC 3LELC 1M1AD 4UUZB 3MGQA 2NQBC 1BH8B 3B0CW 3LJAB 4YM6B 5B24C 5AV8C 5C3IC 3AZMA 3AZFA 4WU8D 2BYKB 1U35D 3X1TB 3W97B 2AROD 3V9RA 4Z5TC 5AV8B 2F8NG 3KXBB 3MGSA 3MGQC 3TU4D 3AN2D 4KUDB 4YS3C 3AZLD 5AV8A 2Y2JA 1P3KD 5CPKD 4H9QB 3AZMC 1HTAA 1KX5C 3AV2C 3MGRA 4DRBA 4JJNA 3KWQC 4J8VD 4Z5TA 1ID3B 1W2EA 3EPLA 4YM6A 3X1VB 2JSSA 5B40B 2G5IC 4YS3A 1TZYC 4H9QA 3C1CD 4WV4B 2IO5C 1H3OB 2BYMB 5CPKB 4XUJA 3MGRC 4JJNC 5AVBB 2NQBB 3REIB 5B33C 5BNXA 3F6TA 3V9RB 5CPJD 3AZJC 4Z2MG 2Y2LA 2PYOB 1TZYA 5BT1D 1EQZA 4QLCB 3B6FC 5GSUB 1BFMA 5E5AD 3C1CB 5FUGA 3W96A 2NZDD 3A6ND 5E5AC 3C1BB 1ID3D 1EQZC 5AV6D 3AFAB 3WAAB 1N1JA 5BT1C 3NQUA 3X1SC 5GT3A 3X1VC 2Y2MA 3AZIC 3AZKB 3C1BD 3KXBD 1P34B 1P3FA 3TU4C 3AN2C 5CP6A 2BYKA 3UT9A 3W96D 1P3MA 3KUYC 5GT3C 3REHA 3X1VA 2UWXA 3H0LC 1P3ID 3LZ0D 4WU9D
chains in the Genus database with same CATH topology
5B31G 3AYWA 5BO0A 3NQUB 2CV5A 5B1LC 5AV9D 5B24B 2NQBD 3REKD 1P3AB 1JFIB 3UT9C 2Y2QA 3W98B 1P3PD 3MGQD 1PZRA 4J8WC 1KX4D 1HQ3B 3X1SB 5CPID 4XZQA 3B0BA 1S32C 2FJ7C 3MNNA 3MVDD 3AZHA 2RVQD 3AZLB 1T3UA 3EPKA 2LY8A 4G91C 4J8UC 5DNMC 4AWLB 3LZ0C 3WTPC 3C1BA 3UTBC 1M1AC 1HQ3C 3AZHB 3X1TD 3MNNC 3A1IA 1U35B 3AZEC 5AY8A 4KHAB 3LZ1A 4DQYB 3B6GD 2Y2NA 1P3BA 3WAAC 1ID3A 4X23A 4J8UA 1EQZB 4E44A 5AV5C 3UT9B 3LZ0A 3C1BC 1P3AC 3UTBA 3B0CT 5GXQB 5B31D 2NQBA 5AY8C 3WA9A 5AV6C 1ZLAC 4R8PB 5B24A 5KDMA 1ID3C 2HIOB 4H9NA 5AV5A 3UTBB 3NQJA 4ZBJB 4ZUXB 4J8VA 3AZJB 1P3MD 3MGSC 3P5JB 5B32A 4X23D 3X1UC 3WKJB 1M19C 5AV6A 5AV5B 4J8XC 3AV1A 1P3LB 3MGSD 2CV5D 5G49A 2F8NB 3AV2A 4KGCA 3AZNC 5DNND 3KWQA 4WU8A 4J8XB 4YM6C 3REJD 5GT3B 5B32C 1P3PA 3X1UA 3AZFB 3AZMB 4J8XA 3REKA 4G91B 1TZYD 4J8UB 5B0ZA 3AV1C 4NFTA 5B1LB 2ZM5A 1KX3D 3AZNA 2Y2KA 1F66D 4KGCC 5F99D 4Z2MH 4Z66D 1WWSA 1BH9A 4R8PC 5B1MB 4CSRA 1ZLAB 1Z2CB 5B33A 3REHD 2ZY2A 4UPKA 5B2JC 4G92B 3KUYB 3AZED 1A7WA 1M18D 2Y2GA 3AZGD 5B0ZC 4YS3D 4J8WB 3MGRB 4JJNB 3B6FA 2HUEB 5B0YB 3X1UB 3W99D 3WKJC 1AOIB 5B0YD 4XUJD 4Z5TD 5AVCD 1KX4A 3LELB 3WA9B 4WZSB 4H9SC 4WNNA 1U35C 5E5AA 4WJ3C 5F99A 1S32D 3WTPB 5DNMB 4AWLC 5CP6D 4EO5C 3AZIA 4H9RB 5JA4A 1KX4C 3LZ1B 5AVCA 4WU9A 2G5HC 1P3OA 4H9SA 3REJA 2FJ7B 5BS7A 2HIOA 4H9NB 5JRGD 1P3FC 3TU4A 3AN2A 3AZGC 5CP6C 1P3OB 1M18C 2F8NK 5B2JD 4H9RA 5JA4B 3KUYA 3O62D 3AZKC 3REHC 2F8ND 3KXBA 5B33B 5AVCC 4WU9C 5CP6B 1P3OC 1P3FB 2NZDA 5BS7C 1P3BD 4X23B 5B1LA 1P3BB 1KU5A 1M18A 4KHAA 3AZKA 1F1EA 3UTAB 5GT0C 5B40C 3KXBC 2HIOD 3O62B 4J8WA 5CHLB 2JE5A 5B2ID 4KGCB 2PYOC 4H9PA 4XZQC 4H9OA 1P3LA 1S32A 1M19D 2FJ7A 4CSRB 3LZ1D 5B1MD 5B40A 3AV1D 5B32B 4Z66B 4XZQD 3RELB 4XZQB 3RELD 5B0ZB 5B32D 5DNMA 3AYWD 1TZYB 4G92C 3WTPA 1P3GB 2PYOA 3AFAC 3B6FD 1P3LC 3RELC 5B2IB 3AZEA 4HGAC 4J8XD 2Y2IA 3LZ1C 3AV2B 3MVDA 1AOID 1P3BC 3X1UD 4X23C 3UTAD 4YS3B 5AV5D 5GT0B 4HGAB 5CPIA 3AL0C 5B2IC 3O62C 3AZIB 3REHB 3KSYA 2JCHA 5CPIB 3MNND 3WA9C 1HQ3D 1P3FD 2F8NH 1ZLAA 3W97C 5AY8D 5AVBC 3KFUG 3UTBD 4DRAA 3KWQD 4J8VC 4J8UD 3AV2D 5B2IA 5DNNA 1P3AD 3O62A 3H0MC 5JRGB 3VH6W 3UTAA 1M19A 2FJ7D 3B6FB 3W97A 1P3GD 5DNNB 5AVBA 2YFWA 3KWQB 1M1AB 5AY8B 5JRGC 4WU8C 3AV1B 3WTPD 1P3PC 5B32G 2ZY4A 5GSUA 3WTPE 3WA9D 3REKC 4Z5TB 4ZUXD 3LELD 1P3GC 3R45B 3VH5W 5AV9A 4R8PA 3MVDB 4Z66C 2FFFB 1M18B 4KUDA 1B67A 3AZGB 5B2JA 3KUYD 2XD5A 1AOIC 5G49B 2HUEC 5B0YC 3W99C 3A6NB 2NZDB 4ZBJC 5F99B 3VH6A 5B0ZD 3WKJA 1R4VA 5AV9C 4WNNB 5B1LD 4CAYB 1KX3B 1F66B 3W98D 4Z66A 3AZFD 1U35A 1AOIA 2Y2OA 5B0YA 3R45A 5F99C 3REJB 5GT3D 4KGCD 4CAYA 3MGSB 5GXQA 2RIQA 1P3LD 1TAFA 3REJC 3MNNB 2F2AC 2HIOC 5B40D 3AZID 4M6BA 2BG1A 3X1VD 3AZGA 2YFWB 3X1SD 3LJAA 2Y2HA 4LD9C 3AZJD 5CPJC 5B1MC 5B33D 5GXQC 1P3PB 3MGPC 2NZDC 3MGRD 4JJND 1P3OD 3WAAD 3AZFC 5B31B 1H3OA 2BYMA 5CPKA 3AZLA 4LD9A 5FUGB 5CPJA 1BH9B 2AROB 5B1MA 3AYWB 5GT0A 1ZLAD 1P3IB 3C1CA 1Q9CA 3MGPA 2YFVA 3B6GB 3VH5T 5DNMD 1KX5A 3AZMD 1M19B 5CPKC 2IO5B 3AZLC 5KDMB 3IP4C 2J8PA 2CWEA 3B6GC 4EO5B 3C1CC 3AZKD 4XUJB 4ZUXC 2CV5B 1WWIA 4J8WD 5AV6B 4XUJC 1N1JB 3AFAA 3WKJD 3VH5A 3RELA 1KX3A 1F66A 3B6GA 1P3KC 1P3MB 3AZJA 2XD1A 3NQJB 4ZUXA 3MVDC 4J8VB 3B0DC 3EPHA 1ULYA 1P34A 4H9PB 5B2JB 4R8PD 5CPIC 1P3IC 3REKB 3B0DB 2AROC 2W8SA 2ZY5A 1KX3C 1F66C 5AV9B 3W96C 4NE5A 5AV8D 1P3KA 3LZ0B 5AVBD 3REIA 3A1KA 4WU8B 3W97D 3UT9D 1P34C 5BNVA 4YM6D 3X1SA 3LJAD 1P3IA 3W96B 1BH8A 5DNNC 2AROA 1S32B 4LD9B 3AZHD 3UTAC 3AZNB 3REIC 3A6NC 3W99B 1P3KB 1P3MC 5JRGA 5BNXB 5BO0B 4KUDD 3AFAD 4NE6A 3MGPD 3AZEB 3AYWC 5GXQD 5GSUC 2F8NA 3AZND 2CV5C 2ZY3A 4LD9D 1TAFB 1P3GA 5B31C 3X1TA 1KX5B 3A6NA 1EQZD 1B6WA 3H0RC 5GSUD 5E5AB 4QLCD 2L5AA 2YFVB 4KUDC 2PYOD 5CPJB 3W99A 3EPJA 4E45A 2DF4C 4QLCC 5B31A 3X1TC 3VH6T 3REID 5AVCB 5GT0D 4WU9B 5C3IB 3AZHC 2VQRA 4NE3A 1KX5D 3W98C 2DQNC 2RVQC 3EG5B 5BNVB 1P34D 4QLCA 3FDDA 1M1AA 3MGPB 3LELA 1KX4B 1HQ3A 4UUZA 3MGQB 2Y2PA 4H9OB 3W98A 3WAAA 5B24D 1P3AA 1JFIA 3TU4B 3AN2B 3LJAC 3LELC 1M1AD 4UUZB 3MGQA 2NQBC 1BH8B 3B0CW 3LJAB 4YM6B 5B24C 5AV8C 5C3IC 3AZMA 3AZFA 4WU8D 2BYKB 1U35D 3X1TB 3W97B 2AROD 3V9RA 4Z5TC 5AV8B 2F8NG 3KXBB 3MGSA 3MGQC 3TU4D 3AN2D 4KUDB 4YS3C 3AZLD 5AV8A 2Y2JA 1P3KD 5CPKD 4H9QB 3AZMC 1HTAA 1KX5C 3AV2C 3MGRA 4DRBA 4JJNA 3KWQC 4J8VD 4Z5TA 1ID3B 1W2EA 3EPLA 4YM6A 3X1VB 2JSSA 5B40B 2G5IC 4YS3A 1TZYC 4H9QA 3C1CD 4WV4B 2IO5C 1H3OB 2BYMB 5CPKB 4XUJA 3MGRC 4JJNC 5AVBB 2NQBB 3REIB 5B33C 5BNXA 3F6TA 3V9RB 5CPJD 3AZJC 4Z2MG 2Y2LA 2PYOB 1TZYA 5BT1D 1EQZA 4QLCB 3B6FC 5GSUB 1BFMA 5E5AD 3C1CB 5FUGA 3W96A 2NZDD 3A6ND 5E5AC 3C1BB 1ID3D 1EQZC 5AV6D 3AFAB 3WAAB 1N1JA 5BT1C 3NQUA 3X1SC 5GT3A 3X1VC 2Y2MA 3AZIC 3AZKB 3C1BD 3KXBD 1P34B 1P3FA 3TU4C 3AN2C 5CP6A 2BYKA 3UT9A 3W96D 1P3MA 3KUYC 5GT3C 3REHA 3X1VA 2UWXA 3H0LC 1P3ID 3LZ0D 4WU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 G;  3AYW A;  5BO0 A;  3NQU B;  2CV5 A;  5B1L C;  5AV9 D;  5B24 B;  2NQB D;  3REK D;  1P3A B;  1JFI B;  3UT9 C;  3W98 B;  1P3P D;  3MGQ D;  4J8W C;  1KX4 D;  1HQ3 B;  3X1S B;  5CPI D;  4XZQ A;  3B0B A;  1S32 C;  2FJ7 C;  3MNN A;  3MVD D;  3AZH A;  2RVQ D;  3AZL B;  2LY8 A;  4G91 C;  4J8U C;  5DNM C;  4AWL B;  3LZ0 C;  3WTP C;  3C1B A;  3UTB C;  1M1A C;  1HQ3 C;  3AZH B;  3X1T D;  3MNN C;  1U35 B;  3AZE C;  5AY8 A;  4KHA B;  3LZ1 A;  3B6G D;  1P3B A;  3WAA C;  1ID3 A;  4X23 A;  4J8U A;  1EQZ B;  4E44 A;  5AV5 C;  3UT9 B;  3LZ0 A;  3C1B C;  1P3A C;  3UTB A;  3B0C T;  5GXQ B;  5B31 D;  2NQB A;  5AY8 C;  3WA9 A;  5AV6 C;  1ZLA C;  4R8P B;  5B24 A;  5KDM A;  1ID3 C;  4H9N A;  2HIO B;  5AV5 A;  3UTB B;  3NQJ A;  4ZBJ B;  4ZUX B;  4J8V A;  3AZJ B;  1P3M D;  3MGS C;  5B32 A;  4X23 D;  3X1U C;  3WKJ B;  1M19 C;  5AV6 A;  5AV5 B;  4J8X C;  3AV1 A;  1P3L B;  3MGS D;  2CV5 D;  5G49 A;  2F8N B;  3AV2 A;  4KGC A;  3AZN C;  5DNN D;  3KWQ A;  4WU8 A;  4J8X B;  4YM6 C;  3REJ D;  5GT3 B;  5B32 C;  1P3P A;  3X1U A;  3AZF B;  3AZM B;  4J8X A;  3REK A;  4G91 B;  1TZY D;  4J8U B;  5B0Z A;  3AV1 C;  4NFT A;  5B1L B;  1KX3 D;  1F66 D;  3AZN A;  4KGC C;  5F99 D;  4Z2M H;  4Z66 D;  1WWS A;  1BH9 A;  4R8P C;  5B1M B;  4CSR A;  1ZLA B;  5B33 A;  3REH D;  5B2J C;  4G92 B;  3KUY B;  3AZE D;  1A7W A;  1M18 D;  3AZG D;  5B0Z C;  4YS3 D;  4J8W B;  3MGR B;  4JJN B;  3B6F A;  2HUE B;  5B0Y B;  3X1U B;  3W99 D;  3WKJ C;  1AOI B;  5B0Y D;  4XUJ D;  4Z5T D;  5AVC D;  1KX4 A;  3LEL B;  3WA9 B;  4WZS B;  4H9S C;  4WNN A;  1U35 C;  5E5A A;  5F99 A;  1S32 D;  3WTP B;  5DNM B;  4AWL C;  5CP6 D;  4EO5 C;  3AZI A;  4H9R B;  5JA4 A;  1KX4 C;  3LZ1 B;  5AVC A;  4WU9 A;  1P3O A;  4H9S A;  3REJ A;  2FJ7 B;  5BS7 A;  2HIO A;  4H9N B;  5JRG D;  1P3F C;  3TU4 A;  3AN2 A;  3AZG C;  5CP6 C;  1P3O B;  1M18 C;  2F8N K;  5B2J D;  4H9R A;  5JA4 B;  3KUY A;  3O62 D;  3AZK C;  3REH C;  2F8N D;  3KXB A;  5B33 B;  5AVC C;  4WU9 C;  5CP6 B;  1P3O C;  1P3F B;  2NZD A;  5BS7 C;  1P3B D;  4X23 B;  5B1L A;  1P3B B;  1KU5 A;  1M18 A;  4KHA A;  3AZK A;  1F1E A;  3UTA B;  5GT0 C;  5B40 C;  3KXB C;  2HIO D;  3O62 B;  4J8W A;  5CHL B;  5B2I D;  4KGC B;  2PYO C;  4H9P A;  4XZQ C;  4H9O A;  1P3L A;  1S32 A;  1M19 D;  2FJ7 A;  4CSR B;  3LZ1 D;  5B1M D;  5B40 A;  3AV1 D;  5B32 B;  4Z66 B;  4XZQ D;  3REL B;  4XZQ B;  3REL D;  5B0Z B;  5B32 D;  5DNM A;  3AYW D;  1TZY B;  4G92 C;  3WTP A;  1P3G B;  2PYO A;  3AFA C;  3B6F D;  1P3L C;  3REL C;  5B2I B;  3AZE A;  4HGA C;  4J8X D;  3LZ1 C;  3AV2 B;  3MVD A;  1AOI D;  1P3B C;  3X1U D;  4X23 C;  3UTA D;  4YS3 B;  5AV5 D;  5GT0 B;  4HGA B;  5CPI A;  5B2I C;  3O62 C;  3AZI B;  3REH B;  3KSY A;  5CPI B;  3MNN D;  3WA9 C;  1HQ3 D;  1P3F D;  2F8N H;  1ZLA A;  3W97 C;  5AY8 D;  5AVB C;  3UTB D;  4DRA A;  3KWQ D;  4J8V C;  4J8U D;  3AV2 D;  5B2I A;  5DNN A;  1P3A D;  3O62 A;  5JRG B;  3VH6 W;  3UTA A;  1M19 A;  2FJ7 D;  3B6F B;  3W97 A;  1P3G D;  5DNN B;  5AVB A;  2YFW A;  3KWQ B;  1M1A B;  5AY8 B;  5JRG C;  4WU8 C;  3AV1 B;  3WTP D;  1P3P C;  5B32 G;  5GSU A;  3WTP E;  3WA9 D;  3REK C;  4Z5T B;  4ZUX D;  3LEL D;  1P3G C;  3R45 B;  3VH5 W;  5AV9 A;  4R8P A;  3MVD B;  4Z66 C;  4KUD A;  1M18 B;  1B67 A;  3AZG B;  5B2J A;  3KUY D;  1AOI C;  5G49 B;  2HUE C;  5B0Y C;  3W99 C;  3A6N B;  2NZD B;  4ZBJ C;  5F99 B;  3VH6 A;  5B0Z D;  3WKJ A;  1R4V A;  5AV9 C;  4WNN B;  5B1L D;  4CAY B;  1KX3 B;  1F66 B;  3W98 D;  4Z66 A;  3AZF D;  1U35 A;  1AOI A;  5B0Y A;  3R45 A;  5F99 C;  3REJ B;  5GT3 D;  4KGC D;  4CAY A;  3MGS B;  5GXQ A;  1P3L D;  1TAF A;  3REJ C;  3MNN B;  2HIO C;  5B40 D;  3AZI D;  4M6B A;  3X1V D;  3AZG A;  2YFW B;  3X1S D;  3LJA A;  4LD9 C;  3AZJ D;  5CPJ C;  5B1M C;  5B33 D;  5GXQ C;  1P3P B;  3MGP C;  2NZD C;  3MGR D;  4JJN D;  1P3O D;  3WAA D;  3AZF C;  5B31 B;  1H3O A;  2BYM A;  5CPK A;  3AZL A;  4LD9 A;  5FUG B;  5CPJ A;  1BH9 B;  2ARO B;  5B1M A;  3AYW B;  5GT0 A;  1ZLA D;  1P3I B;  3C1C A;  1Q9C A;  3MGP A;  2YFV A;  3B6G B;  3VH5 T;  5DNM D;  1KX5 A;  3AZM D;  1M19 B;  5CPK C;  2IO5 B;  3AZL C;  5KDM B;  2CWE A;  3B6G C;  4EO5 B;  3C1C C;  3AZK D;  4XUJ B;  4ZUX C;  2CV5 B;  1WWI A;  4J8W D;  5AV6 B;  4XUJ C;  1N1J B;  3AFA A;  3WKJ D;  3VH5 A;  3REL A;  1KX3 A;  1F66 A;  3B6G A;  1P3K C;  1P3M B;  3AZJ A;  3NQJ B;  4ZUX A;  3MVD C;  4J8V B;  3B0D C;  1ULY A;  1P34 A;  4H9P B;  5B2J B;  4R8P D;  5CPI C;  1P3I C;  3REK B;  3B0D B;  2ARO C;  1KX3 C;  1F66 C;  5AV9 B;  3W96 C;  4NE5 A;  5AV8 D;  1P3K A;  3LZ0 B;  5AVB D;  3REI A;  4WU8 B;  3W97 D;  3UT9 D;  1P34 C;  5BNV A;  4YM6 D;  3X1S A;  3LJA D;  1P3I A;  3W96 B;  1BH8 A;  5DNN C;  2ARO A;  1S32 B;  4LD9 B;  3AZH D;  3UTA C;  3AZN B;  3REI C;  3A6N C;  3W99 B;  1P3K B;  1P3M C;  5JRG A;  5BNX B;  5BO0 B;  4KUD D;  3AFA D;  4NE6 A;  3MGP D;  3AZE B;  3AYW C;  5GXQ D;  5GSU C;  2F8N A;  3AZN D;  2CV5 C;  4LD9 D;  1TAF B;  1P3G A;  5B31 C;  3X1T A;  1KX5 B;  3A6N A;  1EQZ D;  1B6W A;  5GSU D;  5E5A B;  4QLC D;  2L5A A;  2YFV B;  4KUD C;  2PYO D;  5CPJ B;  3W99 A;  4E45 A;  4QLC C;  5B31 A;  3X1T C;  3VH6 T;  3REI D;  5AVC B;  5GT0 D;  4WU9 B;  5C3I B;  3AZH C;  4NE3 A;  1KX5 D;  3W98 C;  2RVQ C;  5BNV B;  1P34 D;  4QLC A;  1M1A A;  3MGP B;  3LEL A;  1KX4 B;  1HQ3 A;  4UUZ A;  3MGQ B;  4H9O B;  3W98 A;  3WAA A;  5B24 D;  1P3A A;  1JFI A;  3TU4 B;  3AN2 B;  3LJA C;  3LEL C;  4UUZ B;  3MGQ A;  2NQB C;  1BH8 B;  3B0C W;  3LJA B;  4YM6 B;  5B24 C;  5AV8 C;  5C3I C;  3AZM A;  3AZF A;  4WU8 D;  2BYK B;  1U35 D;  3X1T B;  3W97 B;  2ARO D;  3V9R A;  4Z5T C;  5AV8 B;  2F8N G;  3KXB B;  3MGS A;  3MGQ C;  3TU4 D;  3AN2 D;  4KUD B;  4YS3 C;  3AZL D;  5AV8 A;  1P3K D;  5CPK D;  4H9Q B;  3AZM C;  1HTA A;  1KX5 C;  3AV2 C;  3MGR A;  4DRB A;  4JJN A;  3KWQ C;  4J8V D;  4Z5T A;  1ID3 B;  4YM6 A;  3X1V B;  2JSS A;  5B40 B;  4YS3 A;  1TZY C;  4H9Q A;  3C1C D;  4WV4 B;  2IO5 C;  1H3O B;  2BYM B;  5CPK B;  4XUJ A;  3MGR C;  4JJN C;  5AVB B;  2NQB B;  3REI B;  5B33 C;  5BNX A;  3V9R B;  5CPJ D;  3AZJ C;  4Z2M G;  2PYO B;  1TZY A;  5BT1 D;  1EQZ A;  4QLC B;  3B6F C;  5GSU B;  1BFM A;  5E5A D;  3C1C B;  5FUG A;  3W96 A;  2NZD D;  3A6N D;  5E5A C;  3C1B B;  1ID3 D;  1EQZ C;  5AV6 D;  3AFA B;  3WAA B;  1N1J A;  5BT1 C;  3NQU A;  3X1S C;  5GT3 A;  3X1V C;  3AZI C;  3AZK B;  3C1B D;  3KXB D;  1P34 B;  1P3F A;  3TU4 C;  3AN2 C;  5CP6 A;  2BYK A;  3UT9 A;  3W96 D;  1P3M A;  3KUY C;  5GT3 C;  3REH A;  3X1V A;  1P3I D;  1M1A D;  3LZ0 D;  4WU9 D; 
#chains in the Genus database with same CATH topology
 5B31 G;  3AYW A;  5BO0 A;  3NQU B;  2CV5 A;  5B1L C;  5AV9 D;  5B24 B;  2NQB D;  3REK D;  1P3A B;  1JFI B;  3UT9 C;  2Y2Q A;  3W98 B;  1P3P D;  3MGQ D;  1PZR A;  4J8W C;  1KX4 D;  1HQ3 B;  3X1S B;  5CPI D;  4XZQ A;  3B0B A;  1S32 C;  2FJ7 C;  3MNN A;  3MVD D;  3AZH A;  2RVQ D;  3AZL B;  1T3U A;  3EPK A;  2LY8 A;  4G91 C;  4J8U C;  5DNM C;  4AWL B;  3LZ0 C;  3WTP C;  3C1B A;  3UTB C;  1M1A C;  1HQ3 C;  3AZH B;  3X1T D;  3MNN C;  3A1I A;  1U35 B;  3AZE C;  5AY8 A;  4KHA B;  3LZ1 A;  4DQY B;  3B6G D;  2Y2N A;  1P3B A;  3WAA C;  1ID3 A;  4X23 A;  4J8U A;  1EQZ B;  4E44 A;  5AV5 C;  3UT9 B;  3LZ0 A;  3C1B C;  1P3A C;  3UTB A;  3B0C T;  5GXQ B;  5B31 D;  2NQB A;  5AY8 C;  3WA9 A;  5AV6 C;  1ZLA C;  4R8P B;  5B24 A;  5KDM A;  1ID3 C;  2HIO B;  4H9N A;  5AV5 A;  3UTB B;  3NQJ A;  4ZBJ B;  4ZUX B;  4J8V A;  3AZJ B;  1P3M D;  3MGS C;  3P5J B;  5B32 A;  4X23 D;  3X1U C;  3WKJ B;  1M19 C;  5AV6 A;  5AV5 B;  4J8X C;  3AV1 A;  1P3L B;  3MGS D;  2CV5 D;  5G49 A;  2F8N B;  3AV2 A;  4KGC A;  3AZN C;  5DNN D;  3KWQ A;  4WU8 A;  4J8X B;  4YM6 C;  3REJ D;  5GT3 B;  5B32 C;  1P3P A;  3X1U A;  3AZF B;  3AZM B;  4J8X A;  3REK A;  4G91 B;  1TZY D;  4J8U B;  5B0Z A;  3AV1 C;  4NFT A;  5B1L B;  2ZM5 A;  1KX3 D;  3AZN A;  2Y2K A;  1F66 D;  4KGC C;  5F99 D;  4Z2M H;  4Z66 D;  1WWS A;  1BH9 A;  4R8P C;  5B1M B;  4CSR A;  1ZLA B;  1Z2C B;  5B33 A;  3REH D;  2ZY2 A;  4UPK A;  5B2J C;  4G92 B;  3KUY B;  3AZE D;  1A7W A;  1M18 D;  2Y2G A;  3AZG D;  5B0Z C;  4YS3 D;  4J8W B;  3MGR B;  4JJN B;  3B6F A;  2HUE B;  5B0Y B;  3X1U B;  3W99 D;  3WKJ C;  1AOI B;  5B0Y D;  4XUJ D;  4Z5T D;  5AVC D;  1KX4 A;  3LEL B;  3WA9 B;  4WZS B;  4H9S C;  4WNN A;  1U35 C;  5E5A A;  4WJ3 C;  5F99 A;  1S32 D;  3WTP B;  5DNM B;  4AWL C;  5CP6 D;  4EO5 C;  3AZI A;  4H9R B;  5JA4 A;  1KX4 C;  3LZ1 B;  5AVC A;  4WU9 A;  2G5H C;  1P3O A;  4H9S A;  3REJ A;  2FJ7 B;  5BS7 A;  2HIO A;  4H9N B;  5JRG D;  1P3F C;  3TU4 A;  3AN2 A;  3AZG C;  5CP6 C;  1P3O B;  1M18 C;  2F8N K;  5B2J D;  4H9R A;  5JA4 B;  3KUY A;  3O62 D;  3AZK C;  3REH C;  2F8N D;  3KXB A;  5B33 B;  5AVC C;  4WU9 C;  5CP6 B;  1P3O C;  1P3F B;  2NZD A;  5BS7 C;  1P3B D;  4X23 B;  5B1L A;  1P3B B;  1KU5 A;  1M18 A;  4KHA A;  3AZK A;  1F1E A;  3UTA B;  5GT0 C;  5B40 C;  3KXB C;  2HIO D;  3O62 B;  4J8W A;  5CHL B;  2JE5 A;  5B2I D;  4KGC B;  2PYO C;  4H9P A;  4XZQ C;  4H9O A;  1P3L A;  1S32 A;  1M19 D;  2FJ7 A;  4CSR B;  3LZ1 D;  5B1M D;  5B40 A;  3AV1 D;  5B32 B;  4Z66 B;  4XZQ D;  3REL B;  4XZQ B;  3REL D;  5B0Z B;  5B32 D;  5DNM A;  3AYW D;  1TZY B;  4G92 C;  3WTP A;  1P3G B;  2PYO A;  3AFA C;  3B6F D;  1P3L C;  3REL C;  5B2I B;  3AZE A;  4HGA C;  4J8X D;  2Y2I A;  3LZ1 C;  3AV2 B;  3MVD A;  1AOI D;  1P3B C;  3X1U D;  4X23 C;  3UTA D;  4YS3 B;  5AV5 D;  5GT0 B;  4HGA B;  5CPI A;  3AL0 C;  5B2I C;  3O62 C;  3AZI B;  3REH B;  3KSY A;  2JCH A;  5CPI B;  3MNN D;  3WA9 C;  1HQ3 D;  1P3F D;  2F8N H;  1ZLA A;  3W97 C;  5AY8 D;  5AVB C;  3KFU G;  3UTB D;  4DRA A;  3KWQ D;  4J8V C;  4J8U D;  3AV2 D;  5B2I A;  5DNN A;  1P3A D;  3O62 A;  3H0M C;  5JRG B;  3VH6 W;  3UTA A;  1M19 A;  2FJ7 D;  3B6F B;  3W97 A;  1P3G D;  5DNN B;  5AVB A;  2YFW A;  3KWQ B;  1M1A B;  5AY8 B;  5JRG C;  4WU8 C;  3AV1 B;  3WTP D;  1P3P C;  5B32 G;  2ZY4 A;  5GSU A;  3WTP E;  3WA9 D;  3REK C;  4Z5T B;  4ZUX D;  3LEL D;  1P3G C;  3R45 B;  3VH5 W;  5AV9 A;  4R8P A;  3MVD B;  4Z66 C;  2FFF B;  1M18 B;  4KUD A;  1B67 A;  3AZG B;  5B2J A;  3KUY D;  2XD5 A;  1AOI C;  5G49 B;  2HUE C;  5B0Y C;  3W99 C;  3A6N B;  2NZD B;  4ZBJ C;  5F99 B;  3VH6 A;  5B0Z D;  3WKJ A;  1R4V A;  5AV9 C;  4WNN B;  5B1L D;  4CAY B;  1KX3 B;  1F66 B;  3W98 D;  4Z66 A;  3AZF D;  1U35 A;  1AOI A;  2Y2O A;  5B0Y A;  3R45 A;  5F99 C;  3REJ B;  5GT3 D;  4KGC D;  4CAY A;  3MGS B;  5GXQ A;  2RIQ A;  1P3L D;  1TAF A;  3REJ C;  3MNN B;  2F2A C;  2HIO C;  5B40 D;  3AZI D;  4M6B A;  2BG1 A;  3X1V D;  3AZG A;  2YFW B;  3X1S D;  3LJA A;  2Y2H A;  4LD9 C;  3AZJ D;  5CPJ C;  5B1M C;  5B33 D;  5GXQ C;  1P3P B;  3MGP C;  2NZD C;  3MGR D;  4JJN D;  1P3O D;  3WAA D;  3AZF C;  5B31 B;  1H3O A;  2BYM A;  5CPK A;  3AZL A;  4LD9 A;  5FUG B;  5CPJ A;  1BH9 B;  2ARO B;  5B1M A;  3AYW B;  5GT0 A;  1ZLA D;  1P3I B;  3C1C A;  1Q9C A;  3MGP A;  2YFV A;  3B6G B;  3VH5 T;  5DNM D;  1KX5 A;  3AZM D;  1M19 B;  5CPK C;  2IO5 B;  3AZL C;  5KDM B;  3IP4 C;  2J8P A;  2CWE A;  3B6G C;  4EO5 B;  3C1C C;  3AZK D;  4XUJ B;  4ZUX C;  2CV5 B;  1WWI A;  4J8W D;  5AV6 B;  4XUJ C;  1N1J B;  3AFA A;  3WKJ D;  3VH5 A;  3REL A;  1KX3 A;  1F66 A;  3B6G A;  1P3K C;  1P3M B;  3AZJ A;  2XD1 A;  3NQJ B;  4ZUX A;  3MVD C;  4J8V B;  3B0D C;  3EPH A;  1ULY A;  1P34 A;  4H9P B;  5B2J B;  4R8P D;  5CPI C;  1P3I C;  3REK B;  3B0D B;  2ARO C;  2W8S A;  2ZY5 A;  1KX3 C;  1F66 C;  5AV9 B;  3W96 C;  4NE5 A;  5AV8 D;  1P3K A;  3LZ0 B;  5AVB D;  3REI A;  3A1K A;  4WU8 B;  3W97 D;  3UT9 D;  1P34 C;  5BNV A;  4YM6 D;  3X1S A;  3LJA D;  1P3I A;  3W96 B;  1BH8 A;  5DNN C;  2ARO A;  1S32 B;  4LD9 B;  3AZH D;  3UTA C;  3AZN B;  3REI C;  3A6N C;  3W99 B;  1P3K B;  1P3M C;  5JRG A;  5BNX B;  5BO0 B;  4KUD D;  3AFA D;  4NE6 A;  3MGP D;  3AZE B;  3AYW C;  5GXQ D;  5GSU C;  2F8N A;  3AZN D;  2CV5 C;  2ZY3 A;  4LD9 D;  1TAF B;  1P3G A;  5B31 C;  3X1T A;  1KX5 B;  3A6N A;  1EQZ D;  1B6W A;  3H0R C;  5GSU D;  5E5A B;  4QLC D;  2L5A A;  2YFV B;  4KUD C;  2PYO D;  5CPJ B;  3W99 A;  3EPJ A;  4E45 A;  2DF4 C;  4QLC C;  5B31 A;  3X1T C;  3VH6 T;  3REI D;  5AVC B;  5GT0 D;  4WU9 B;  5C3I B;  3AZH C;  2VQR A;  4NE3 A;  1KX5 D;  3W98 C;  2DQN C;  2RVQ C;  3EG5 B;  5BNV B;  1P34 D;  4QLC A;  3FDD A;  1M1A A;  3MGP B;  3LEL A;  1KX4 B;  1HQ3 A;  4UUZ A;  3MGQ B;  2Y2P A;  4H9O B;  3W98 A;  3WAA A;  5B24 D;  1P3A A;  1JFI A;  3TU4 B;  3AN2 B;  3LJA C;  3LEL C;  1M1A D;  4UUZ B;  3MGQ A;  2NQB C;  1BH8 B;  3B0C W;  3LJA B;  4YM6 B;  5B24 C;  5AV8 C;  5C3I C;  3AZM A;  3AZF A;  4WU8 D;  2BYK B;  1U35 D;  3X1T B;  3W97 B;  2ARO D;  3V9R A;  4Z5T C;  5AV8 B;  2F8N G;  3KXB B;  3MGS A;  3MGQ C;  3TU4 D;  3AN2 D;  4KUD B;  4YS3 C;  3AZL D;  5AV8 A;  2Y2J A;  1P3K D;  5CPK D;  4H9Q B;  3AZM C;  1HTA A;  1KX5 C;  3AV2 C;  3MGR A;  4DRB A;  4JJN A;  3KWQ C;  4J8V D;  4Z5T A;  1ID3 B;  1W2E A;  3EPL A;  4YM6 A;  3X1V B;  2JSS A;  5B40 B;  2G5I C;  4YS3 A;  1TZY C;  4H9Q A;  3C1C D;  4WV4 B;  2IO5 C;  1H3O B;  2BYM B;  5CPK B;  4XUJ A;  3MGR C;  4JJN C;  5AVB B;  2NQB B;  3REI B;  5B33 C;  5BNX A;  3F6T A;  3V9R B;  5CPJ D;  3AZJ C;  4Z2M G;  2Y2L A;  2PYO B;  1TZY A;  5BT1 D;  1EQZ A;  4QLC B;  3B6F C;  5GSU B;  1BFM A;  5E5A D;  3C1C B;  5FUG A;  3W96 A;  2NZD D;  3A6N D;  5E5A C;  3C1B B;  1ID3 D;  1EQZ C;  5AV6 D;  3AFA B;  3WAA B;  1N1J A;  5BT1 C;  3NQU A;  3X1S C;  5GT3 A;  3X1V C;  2Y2M A;  3AZI C;  3AZK B;  3C1B D;  3KXB D;  1P34 B;  1P3F A;  3TU4 C;  3AN2 C;  5CP6 A;  2BYK A;  3UT9 A;  3W96 D;  1P3M A;  3KUY C;  5GT3 C;  3REH A;  3X1V A;  2UWX A;  3H0L C;  1P3I D;  3LZ0 D;  4WU9 D; 
#chains in the Genus database with same CATH homology
 5B31 G;  3AYW A;  5BO0 A;  3NQU B;  2CV5 A;  5B1L C;  5AV9 D;  5B24 B;  2NQB D;  3REK D;  1P3A B;  1JFI B;  3UT9 C;  2Y2Q A;  3W98 B;  1P3P D;  3MGQ D;  1PZR A;  4J8W C;  1KX4 D;  1HQ3 B;  3X1S B;  5CPI D;  4XZQ A;  3B0B A;  1S32 C;  2FJ7 C;  3MNN A;  3MVD D;  3AZH A;  2RVQ D;  3AZL B;  1T3U A;  3EPK A;  2LY8 A;  4G91 C;  4J8U C;  5DNM C;  4AWL B;  3LZ0 C;  3WTP C;  3C1B A;  3UTB C;  1M1A C;  1HQ3 C;  3AZH B;  3X1T D;  3MNN C;  3A1I A;  1U35 B;  3AZE C;  5AY8 A;  4KHA B;  3LZ1 A;  4DQY B;  3B6G D;  2Y2N A;  1P3B A;  3WAA C;  1ID3 A;  4X23 A;  4J8U A;  1EQZ B;  4E44 A;  5AV5 C;  3UT9 B;  3LZ0 A;  3C1B C;  1P3A C;  3UTB A;  3B0C T;  5GXQ B;  5B31 D;  2NQB A;  5AY8 C;  3WA9 A;  5AV6 C;  1ZLA C;  4R8P B;  5B24 A;  5KDM A;  1ID3 C;  2HIO B;  4H9N A;  5AV5 A;  3UTB B;  3NQJ A;  4ZBJ B;  4ZUX B;  4J8V A;  3AZJ B;  1P3M D;  3MGS C;  3P5J B;  5B32 A;  4X23 D;  3X1U C;  3WKJ B;  1M19 C;  5AV6 A;  5AV5 B;  4J8X C;  3AV1 A;  1P3L B;  3MGS D;  2CV5 D;  5G49 A;  2F8N B;  3AV2 A;  4KGC A;  3AZN C;  5DNN D;  3KWQ A;  4WU8 A;  4J8X B;  4YM6 C;  3REJ D;  5GT3 B;  5B32 C;  1P3P A;  3X1U A;  3AZF B;  3AZM B;  4J8X A;  3REK A;  4G91 B;  1TZY D;  4J8U B;  5B0Z A;  3AV1 C;  4NFT A;  5B1L B;  2ZM5 A;  1KX3 D;  3AZN A;  2Y2K A;  1F66 D;  4KGC C;  5F99 D;  4Z2M H;  4Z66 D;  1WWS A;  1BH9 A;  4R8P C;  5B1M B;  4CSR A;  1ZLA B;  1Z2C B;  5B33 A;  3REH D;  2ZY2 A;  4UPK A;  5B2J C;  4G92 B;  3KUY B;  3AZE D;  1A7W A;  1M18 D;  2Y2G A;  3AZG D;  5B0Z C;  4YS3 D;  4J8W B;  3MGR B;  4JJN B;  3B6F A;  2HUE B;  5B0Y B;  3X1U B;  3W99 D;  3WKJ C;  1AOI B;  5B0Y D;  4XUJ D;  4Z5T D;  5AVC D;  1KX4 A;  3LEL B;  3WA9 B;  4WZS B;  4H9S C;  4WNN A;  1U35 C;  5E5A A;  4WJ3 C;  5F99 A;  1S32 D;  3WTP B;  5DNM B;  4AWL C;  5CP6 D;  4EO5 C;  3AZI A;  4H9R B;  5JA4 A;  1KX4 C;  3LZ1 B;  5AVC A;  4WU9 A;  2G5H C;  1P3O A;  4H9S A;  3REJ A;  2FJ7 B;  5BS7 A;  2HIO A;  4H9N B;  5JRG D;  1P3F C;  3TU4 A;  3AN2 A;  3AZG C;  5CP6 C;  1P3O B;  1M18 C;  2F8N K;  5B2J D;  4H9R A;  5JA4 B;  3KUY A;  3O62 D;  3AZK C;  3REH C;  2F8N D;  3KXB A;  5B33 B;  5AVC C;  4WU9 C;  5CP6 B;  1P3O C;  1P3F B;  2NZD A;  5BS7 C;  1P3B D;  4X23 B;  5B1L A;  1P3B B;  1KU5 A;  1M18 A;  4KHA A;  3AZK A;  1F1E A;  3UTA B;  5GT0 C;  5B40 C;  3KXB C;  2HIO D;  3O62 B;  4J8W A;  5CHL B;  2JE5 A;  5B2I D;  4KGC B;  2PYO C;  4H9P A;  4XZQ C;  4H9O A;  1P3L A;  1S32 A;  1M19 D;  2FJ7 A;  4CSR B;  3LZ1 D;  5B1M D;  5B40 A;  3AV1 D;  5B32 B;  4Z66 B;  4XZQ D;  3REL B;  4XZQ B;  3REL D;  5B0Z B;  5B32 D;  5DNM A;  3AYW D;  1TZY B;  4G92 C;  3WTP A;  1P3G B;  2PYO A;  3AFA C;  3B6F D;  1P3L C;  3REL C;  5B2I B;  3AZE A;  4HGA C;  4J8X D;  2Y2I A;  3LZ1 C;  3AV2 B;  3MVD A;  1AOI D;  1P3B C;  3X1U D;  4X23 C;  3UTA D;  4YS3 B;  5AV5 D;  5GT0 B;  4HGA B;  5CPI A;  3AL0 C;  5B2I C;  3O62 C;  3AZI B;  3REH B;  3KSY A;  2JCH A;  5CPI B;  3MNN D;  3WA9 C;  1HQ3 D;  1P3F D;  2F8N H;  1ZLA A;  3W97 C;  5AY8 D;  5AVB C;  3KFU G;  3UTB D;  4DRA A;  3KWQ D;  4J8V C;  4J8U D;  3AV2 D;  5B2I A;  5DNN A;  1P3A D;  3O62 A;  3H0M C;  5JRG B;  3VH6 W;  3UTA A;  1M19 A;  2FJ7 D;  3B6F B;  3W97 A;  1P3G D;  5DNN B;  5AVB A;  2YFW A;  3KWQ B;  1M1A B;  5AY8 B;  5JRG C;  4WU8 C;  3AV1 B;  3WTP D;  1P3P C;  5B32 G;  2ZY4 A;  5GSU A;  3WTP E;  3WA9 D;  3REK C;  4Z5T B;  4ZUX D;  3LEL D;  1P3G C;  3R45 B;  3VH5 W;  5AV9 A;  4R8P A;  3MVD B;  4Z66 C;  2FFF B;  1M18 B;  4KUD A;  1B67 A;  3AZG B;  5B2J A;  3KUY D;  2XD5 A;  1AOI C;  5G49 B;  2HUE C;  5B0Y C;  3W99 C;  3A6N B;  2NZD B;  4ZBJ C;  5F99 B;  3VH6 A;  5B0Z D;  3WKJ A;  1R4V A;  5AV9 C;  4WNN B;  5B1L D;  4CAY B;  1KX3 B;  1F66 B;  3W98 D;  4Z66 A;  3AZF D;  1U35 A;  1AOI A;  2Y2O A;  5B0Y A;  3R45 A;  5F99 C;  3REJ B;  5GT3 D;  4KGC D;  4CAY A;  3MGS B;  5GXQ A;  2RIQ A;  1P3L D;  1TAF A;  3REJ C;  3MNN B;  2F2A C;  2HIO C;  5B40 D;  3AZI D;  4M6B A;  2BG1 A;  3X1V D;  3AZG A;  2YFW B;  3X1S D;  3LJA A;  2Y2H A;  4LD9 C;  3AZJ D;  5CPJ C;  5B1M C;  5B33 D;  5GXQ C;  1P3P B;  3MGP C;  2NZD C;  3MGR D;  4JJN D;  1P3O D;  3WAA D;  3AZF C;  5B31 B;  1H3O A;  2BYM A;  5CPK A;  3AZL A;  4LD9 A;  5FUG B;  5CPJ A;  1BH9 B;  2ARO B;  5B1M A;  3AYW B;  5GT0 A;  1ZLA D;  1P3I B;  3C1C A;  1Q9C A;  3MGP A;  2YFV A;  3B6G B;  3VH5 T;  5DNM D;  1KX5 A;  3AZM D;  1M19 B;  5CPK C;  2IO5 B;  3AZL C;  5KDM B;  3IP4 C;  2J8P A;  2CWE A;  3B6G C;  4EO5 B;  3C1C C;  3AZK D;  4XUJ B;  4ZUX C;  2CV5 B;  1WWI A;  4J8W D;  5AV6 B;  4XUJ C;  1N1J B;  3AFA A;  3WKJ D;  3VH5 A;  3REL A;  1KX3 A;  1F66 A;  3B6G A;  1P3K C;  1P3M B;  3AZJ A;  2XD1 A;  3NQJ B;  4ZUX A;  3MVD C;  4J8V B;  3B0D C;  3EPH A;  1ULY A;  1P34 A;  4H9P B;  5B2J B;  4R8P D;  5CPI C;  1P3I C;  3REK B;  3B0D B;  2ARO C;  2W8S A;  2ZY5 A;  1KX3 C;  1F66 C;  5AV9 B;  3W96 C;  4NE5 A;  5AV8 D;  1P3K A;  3LZ0 B;  5AVB D;  3REI A;  3A1K A;  4WU8 B;  3W97 D;  3UT9 D;  1P34 C;  5BNV A;  4YM6 D;  3X1S A;  3LJA D;  1P3I A;  3W96 B;  1BH8 A;  5DNN C;  2ARO A;  1S32 B;  4LD9 B;  3AZH D;  3UTA C;  3AZN B;  3REI C;  3A6N C;  3W99 B;  1P3K B;  1P3M C;  5JRG A;  5BNX B;  5BO0 B;  4KUD D;  3AFA D;  4NE6 A;  3MGP D;  3AZE B;  3AYW C;  5GXQ D;  5GSU C;  2F8N A;  3AZN D;  2CV5 C;  2ZY3 A;  4LD9 D;  1TAF B;  1P3G A;  5B31 C;  3X1T A;  1KX5 B;  3A6N A;  1EQZ D;  1B6W A;  3H0R C;  5GSU D;  5E5A B;  4QLC D;  2L5A A;  2YFV B;  4KUD C;  2PYO D;  5CPJ B;  3W99 A;  3EPJ A;  4E45 A;  2DF4 C;  4QLC C;  5B31 A;  3X1T C;  3VH6 T;  3REI D;  5AVC B;  5GT0 D;  4WU9 B;  5C3I B;  3AZH C;  2VQR A;  4NE3 A;  1KX5 D;  3W98 C;  2DQN C;  2RVQ C;  3EG5 B;  5BNV B;  1P34 D;  4QLC A;  3FDD A;  1M1A A;  3MGP B;  3LEL A;  1KX4 B;  1HQ3 A;  4UUZ A;  3MGQ B;  2Y2P A;  4H9O B;  3W98 A;  3WAA A;  5B24 D;  1P3A A;  1JFI A;  3TU4 B;  3AN2 B;  3LJA C;  3LEL C;  1M1A D;  4UUZ B;  3MGQ A;  2NQB C;  1BH8 B;  3B0C W;  3LJA B;  4YM6 B;  5B24 C;  5AV8 C;  5C3I C;  3AZM A;  3AZF A;  4WU8 D;  2BYK B;  1U35 D;  3X1T B;  3W97 B;  2ARO D;  3V9R A;  4Z5T C;  5AV8 B;  2F8N G;  3KXB B;  3MGS A;  3MGQ C;  3TU4 D;  3AN2 D;  4KUD B;  4YS3 C;  3AZL D;  5AV8 A;  2Y2J A;  1P3K D;  5CPK D;  4H9Q B;  3AZM C;  1HTA A;  1KX5 C;  3AV2 C;  3MGR A;  4DRB A;  4JJN A;  3KWQ C;  4J8V D;  4Z5T A;  1ID3 B;  1W2E A;  3EPL A;  4YM6 A;  3X1V B;  2JSS A;  5B40 B;  2G5I C;  4YS3 A;  1TZY C;  4H9Q A;  3C1C D;  4WV4 B;  2IO5 C;  1H3O B;  2BYM B;  5CPK B;  4XUJ A;  3MGR C;  4JJN C;  5AVB B;  2NQB B;  3REI B;  5B33 C;  5BNX A;  3F6T A;  3V9R B;  5CPJ D;  3AZJ C;  4Z2M G;  2Y2L A;  2PYO B;  1TZY A;  5BT1 D;  1EQZ A;  4QLC B;  3B6F C;  5GSU B;  1BFM A;  5E5A D;  3C1C B;  5FUG A;  3W96 A;  2NZD D;  3A6N D;  5E5A C;  3C1B B;  1ID3 D;  1EQZ C;  5AV6 D;  3AFA B;  3WAA B;  1N1J A;  5BT1 C;  3NQU A;  3X1S C;  5GT3 A;  3X1V C;  2Y2M A;  3AZI C;  3AZK B;  3C1B D;  3KXB D;  1P34 B;  1P3F A;  3TU4 C;  3AN2 C;  5CP6 A;  2BYK A;  3UT9 A;  3W96 D;  1P3M A;  3KUY C;  5GT3 C;  3REH A;  3X1V A;  2UWX A;  3H0L C;  1P3I D;  3LZ0 D;  4WU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...