4X23C

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 102
sequence length 102
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23C00
1KX5B 5E5AC 5E5AD 3O62D 3REHC 5CPKB 4YS3A 5B0YC 1P3BB 5B0YD 3UT9D 1KX4C 1WWIA 1P3PB 4HGAB 1P3LA 1KX5C 4ZBJB 3AZFA 1P3BC 1P3BD 3WAAB 3UTAD 2NZDD 4YM6A 2HIOD 4HGAC 4WZSB 3MNNC 3MNND 3KWQA 4H9PA 4YS3B 4AWLC 3WAAC 1P3IA 5B2IA 3AFAB 3AZFB 3R45A 3X1UA 3B0CW 4YS3C 1P3OA 1HQ3D 1KU5A 5B31B 5B0ZB 2CWEA 5B1LA 5B2JB 1R4VA 3AZNA 3AZMA 4H9PB 1P3LC 1P3LD 3AZFC 3X1SA 3AZEB 3UTBA 2AROA 3TU4A 1P3IB 2BYKA 5CP6A 4KHAA 4DRAA 3NQUA 4XZQA 5BNVA 5B2IB 4YM6C 4YM6D 4J8UA 4E44A 4R8PA 3KWQC 3KWQD 2HUEB 3X1UB 3AYWA 3B6GB 2F8NK 1P3KA 2FJ7D 5JRGB 5B1LB 3AZGA 1P3IC 1BH8A 5C3IB 1S32A 5B2IC 5B1MB 5B2ID 4H9OA 3W98A 3X1SB 3X1UC 2BYMA 3KUYA 3TU4B 1P3OC 1P3OD 2CV5B 2BYKB 5CP6B 2PYOB 5B1LC 5B1LD 5C3IC 3B0CT 3W96D 3AZNC 3AZND 3AZMC 3AZMD 3AYWB 1P3KB 3X1SC 3UTBC 2AROC 3LZ0A 2AROD 3REKD 3UTBD 3TU4C 3AZGB 5CP6C 1BH8B 4XZQC 4XZQD 1S32B 1BH9B 4H9OB 4J8UC 4R8PC 4J8UD 4R8PD 1TAFB 3AYWC 3MVDD 2BYMB 3W99A 1P3KC 4WNNA 3LZ1A 3AZGC 4EO5C 3AV2B 4J8WA 1S32C 4QLCA 1S32D 4J8VA 3W98C 3W98D 3KUYC 1P3FA 3KUYD 4XUJA 4J8XA 5GT3A 4H9RB 1EQZD 5AV9D 3W99B 3X1TA 5AY8A 5GT0B 4WNNB 3LZ0C 3LZ0D 3RELA 3LZ1B 1Q9CA 2YFWA 4J8WB 5DNND 1P34B 4KGCB 1P3AA 5B32A 5KDMA 4LD9D 3W99C 5B24A 3AZKD 3MGSA 3W97A 3A6NA 1P3MD 3LJAA 3LZ1C 3LZ1D 3WTPA 4J8WC 4QLCC 4QLCD 4J8VC 4J8VD 4Z66D 3X1TB 5CPKA 1P3FC 4XUJC 1P3FD 4XUJD 4J8XC 4J8XD 2YFWB 5GT3C 5GT3D 1TZYA 3LELD 1P3PA 4Z2MG 5AV8B 5B32B 2IO5B 4Z2MH 3X1TC 5AY8C 3X1TD 5AY8D 3W97B 4E45A 3C1CB 3RELC 3AZHA 3LJAB 3RELD 4WU9B 1P3AC 5B32C 1P3AD 2IO5C 4G92B 5B24C 5AVCB 5B24D 4X23B 3REHD 3MGSC 3A6NC 3MGSD 3A6ND 3MGQB 3W97C 1BFMA 3NQJB 5CPJA 1KX4D 3LJAC 1M19B 1TZYB 5AV5A 3WTPD 3WTPC 4Z5TB 3AZIA 3AFAA 3WA9B 3KSYA 1KX5D 4G92C 5F99A 4JJNB 5CPKC 5CPKD 2F8NA 3AZHB 5B31A 5B0ZA 5B2JA 1TZYC 1B67A 1P3PC 1P3PD 3MGPA 5BNXB 4ZBJC 3AZEA 5BT1C 5CPJB 5BT1D 5CPIA 3AZHC 3AZHD 5AV5B 3WAAD 3AZIB 3B6GA 5F99B 3AZJB 2F8NB 4YS3D 4CSRA 5CPJC 5JRGA 5AV5C 1U35B 3MGPB 1ZLAA 3AZIC 3AZID 5B1MA 3AFAC 3AFAD 3AZFD 5F99C 5F99D 2NQBA 5CPIB 2CV5A 5B31C 5B31D 5B0ZC 3MGRA 5B0ZD 2PYOA 5B2JC 3WKJB 5B2JD 3MGPC 4M6BA 3MGPD 3AZEC 3AZED 4CSRB 5CPIC 3B0DB 1P3ID 1ZLAB 1BH9A 1TAFA 2HUEC 3WTPE 3C1BB 3X1UD 2F8NG 3B6GD 3B6GC 2NQBB 2F8NH 5B31G 4ZUXB 5JRGC 5JRGD 3MGRB 3B0DC 3AV2A 1ZLAC 5B1MC 5B1MD 4H9NB 1M1AA 3X1SD 3AZLB 2NQBC 3TU4D 1AOIA 2CV5C 2CV5D 3B6FA 5CP6D 3MGRC 2PYOC 2PYOD 4H9RA 5AVBA 3X1VB 5G49B 3AYWD 5B40A 5GT0A 1P3KD 4H9QB 3VH5A 3AZGD 3AV1A 1P34A 1ID3A 1B6WA 3AN2B 1M1AB 4KGCA 4NFTA 1AOIB 3B6FB 5DNMA 1KX3B 3AV2C 5B33A 3AV2D 5AVBB 2RVQC 2RVQD 5B40B 1M1AC 1AOIC 1M18A 1AOID 3B6FC 4G91B 3B6FD 1F1EA 3VH5W 3AV1B 4WU8B 5AVBC 5AVBD 1ID3B 5AV8A 5BS7A 5GSUA 3W99D 5B40C 5B40D 5GT0C 5GT0D 2LY8A 3C1CA 5DNMB 4G91C 4NE5A 5B33B 3AV1C 4J8WD 1P34C 1N1JB 4WU9A 1P34D 1ID3C 4KGCC 4H9SA 4KGCD 5AVCA 4X23A 3MGQA 1M18B 1JFIA 3NQJA 4KUDB 5GXQB 1M19A 5DNMC 3REIB 5B33C 5B33D 4Z5TA 5GSUB 3WA9A 4JJNA 3O62A 1M18C 3B0BA 3UT9A 5AV8C 5AV8D 5BS7C 5GSUC 5GSUD 5B32D 5BNXA 3VH5T 3W97D 1WWSA 1JFIB 3C1CC 3C1CD 3LJAD 5FUGB 1H3OA 4WU9C 4WU9D 3UTAA 1P3GB 2HIOA 4H9SC 2NZDA 5E5AB 5AVCC 5AVCD 4X23C 4X23D 5JA4A 3O62B 3MGQC 3AZJA 3MGQD 5B0YB 1M19C 3UT9B 1M19D 1TZYD 1U35A 5B32G 4Z5TC 4Z5TD 3WA9C 3WA9D 4JJNC 4JJND 3REJA 3O62C 1HQ3A 3UT9C 3WKJA 1H3OB 1ULYA 3UTAB 2NZDB 2HIOB 3MNNB 4DRBA 5JA4B 4NE6A 5CPJD 4AWLB 5AV5D 3UTAC 2NZDC 2HIOC 3C1BA 3AZJC 3REJB 3AZJD 2F8ND 4ZUXA 1HQ3B 2FJ7A 1U35C 1U35D 5AV6A 4H9NA 1P3LB 3KXBA 3AZLA 3REJC 3REJD 5CPID 1HQ3C 3WKJC 2JSSA 2L5AA 3WKJD 3X1VA 3W96A 5G49A 4YM6B 5BO0A 3KWQB 4H9QA 2FJ7B 3VH6A 3REKA 5AV6B 1ZLAD 3AN2A 4UUZA 3KXBB 3C1BC 3C1BD 3R45B 2YFVA 3MVDA 2NQBD 4ZUXC 4ZUXD 1P3OB 2FJ7C 3MGRD 1KX3A 5CHLB 5AV6C 1A7WA 5AV6D 3W96B 3AZNB 5BO0B 3AZMB 3KXBC 3AZLC 3KXBD 3AZLD 3UTBB 2AROB 3REKB 4WU8A 4KHAB 3VH6W 4XZQB 3NQUB 5BNVB 3X1VC 3X1VD 3W96C 1EQZA 4UUZB 5AV9A 4J8UB 4R8PB 2YFVB 4CAYA 3MVDB 3V9RA 3REKC 4EO5B 1N1JA 5DNNA 3AN2C 3AN2D 1M1AD 3W98B 4LD9A 3MVDC 3AZKA 3KUYB 4KUDA 5GXQA 1KX3C 1KX3D 3REIA 1P3MA 1EQZB 5AV9B 4CAYB 4Z66A 3V9RB 3LZ0B 4WV4B 4WU8C 3AV1D 4WU8D 1F66A 5DNNB 3LELA 1ID3D 1EQZC 5AV9C 4LD9B 3AZKB 3VH6T 5DNMD 1P3MB 5FUGA 5DNNC 1P3GA 4QLCB 5E5AA 4J8VB 4Z66B 4LD9C 3REHA 3AZKC 1P3FB 1M18D 4XUJB 4KUDC 5GXQC 5B0YA 5GXQD 4J8XB 4KUDD 3REIC 1P3MC 3REID 1KX4A 1F66B 5GT3B 3LELB 1KX5A 4Z66C 5AY8B 3RELB 1P3BA 1F66C 1F66D 3LELC 4NE3A 3MNNA 1P3AB 5KDMB 5B24B 3REHB 1HTAA 3MGSB 3A6NB 1KX4B 3WAAA 3WTPB 1P3GC 1P3GD
chains in the Genus database with same CATH superfamily
1KX5B 5E5AC 5E5AD 3EPKA 3EPJA 2Y2KA 3O62D 3REHC 5CPKB 4YS3A 5B0YC 1P3BB 5B0YD 3UT9D 1KX4C 1WWIA 1P3PB 4HGAB 1P3LA 1KX5C 4ZBJB 3AZFA 2RIQA 1P3BC 1P3BD 3WAAB 3H0MC 3UTAD 2NZDD 2HIOD 4HGAC 4YM6A 4WZSB 3MNNC 3MNND 3KWQA 4H9PA 4YS3B 4AWLC 2ZY2A 3WAAC 1P3IA 4UPKA 2W8SA 5B2IA 3AFAB 3AZFB 3R45A 3X1UA 3B0CW 4YS3C 1P3OA 1HQ3D 1KU5A 5B31B 5B0ZB 2CWEA 5B1LA 5B2JB 1R4VA 3AZNA 3AZMA 4H9PB 1P3LC 1P3LD 3AZFC 3X1SA 3AZEB 3UTBA 2AROA 3TU4A 1P3IB 2BYKA 5CP6A 4KHAA 4DRAA 3NQUA 4XZQA 5BNVA 5B2IB 4YM6C 4YM6D 4J8UA 4E44A 4R8PA 3KWQC 3KWQD 2HUEB 3X1UB 3AYWA 3B6GB 2F8NK 1P3KA 2FJ7D 5JRGB 5B1LB 3AZGA 1P3IC 1BH8A 5C3IB 1S32A 5B2IC 5B1MB 5B2ID 4H9OA 3AL0C 3W98A 3X1SB 3X1UC 2BYMA 3KUYA 3TU4B 1P3OC 1P3OD 2CV5B 2BYKB 5CP6B 2PYOB 5B1LC 5B1LD 5C3IC 3B0CT 3W96D 3AZNC 3AZND 3AZMC 3AZMD 3AYWB 1P3KB 3X1SC 3UTBC 2AROC 3LZ0A 2AROD 3REKD 3UTBD 3TU4C 3AZGB 5CP6C 1BH8B 4XZQC 3H0LC 4XZQD 1S32B 1BH9B 4H9OB 4J8UC 4R8PC 4J8UD 4R8PD 1TAFB 3AYWC 3MVDD 2BYMB 3W99A 1P3KC 4WNNA 1BFMA 3LZ1A 3AZGC 4EO5C 3AV2B 4J8WA 1S32C 4QLCA 1S32D 4J8VA 3W98C 3W98D 3KUYC 1P3FA 3KUYD 4XUJA 2G5IC 4J8XA 5GT3A 4H9RB 1EQZD 5AV9D 3W99B 3X1TA 5AY8A 5GT0B 4WNNB 3LZ0C 3LZ0D 2ZY5A 3RELA 3LZ1B 1Q9CA 2YFWA 4J8WB 5DNND 1P34B 3EPLA 4KGCB 1P3AA 5B32A 2DF4C 5KDMA 4LD9D 3W99C 5B24A 3AZKD 3MGSA 3W97A 3A6NA 1P3MD 3LJAA 3LZ1C 3LZ1D 3WTPA 4J8WC 2JE5A 2XD5A 2Y2NA 4QLCC 4QLCD 4J8VC 4J8VD 4Z66D 3X1TB 2Y2LA 2BG1A 5CPKA 1P3FC 4XUJC 1P3FD 4XUJD 4J8XC 4J8XD 2YFWB 5GT3C 5GT3D 1TZYA 3LELD 1P3PA 4Z2MG 5AV8B 5B32B 2IO5B 4Z2MH 3X1TC 5AY8C 3X1TD 5AY8D 3W97B 4E45A 3C1CB 3RELC 3AZHA 3LJAB 3RELD 3REHD 4WU9B 1P3AC 5B32C 1P3AD 2IO5C 4G92B 5B24C 2VQRA 5AVCB 5B24D 4X23B 2F2AC 3A6NC 3MGSC 3A6ND 3MGSD 3MGQB 3W97C 3NQJB 5CPJA 1KX4D 3LJAC 1M19B 1TZYB 5AV5A 3WTPD 3WTPC 4Z5TB 3AZIA 3AFAA 3WA9B 2Y2QA 3KSYA 1KX5D 4G92C 5F99A 4JJNB 5CPKC 5CPKD 2F8NA 3AZHB 3FDDA 5B31A 5B0ZA 5B2JA 1TZYC 1B67A 1P3PC 1P3PD 3MGPA 5BNXB 4ZBJC 3AZEA 5BT1C 5CPJB 5BT1D 5CPIA 3AZHC 3AZHD 5AV5B 3WAAD 3AZIB 2Y2GA 3B6GA 5F99B 2ZM5A 3AZJB 2F8NB 4YS3D 4CSRA 5CPJC 5JRGA 5AV5C 1U35B 3MGPB 1ZLAA 3AZIC 3AZID 5B1MA 3AFAC 3AFAD 3AZFD 5F99C 5F99D 2NQBA 5CPIB 2CV5A 5B31C 5B31D 5B0ZC 3MGRA 5B0ZD 2PYOA 5B2JC 3WKJB 2Y2PA 5B2JD 3MGPC 4M6BA 3MGPD 3AZEC 3AZED 4CSRB 5CPIC 3B0DB 1P3ID 1ZLAB 1BH9A 1TAFA 2HUEC 3WTPE 3C1BB 3X1UD 2F8NG 3B6GD 3B6GC 2NQBB 2F8NH 5B31G 4ZUXB 5JRGC 5JRGD 3MGRB 3B0DC 3AV2A 1ZLAC 5B1MC 5B1MD 4H9NB 1M1AA 3X1SD 3AZLB 2NQBC 3TU4D 1AOIA 2CV5C 2CV5D 3B6FA 5CP6D 3MGRC 2PYOC 2PYOD 4H9RA 5AVBA 3X1VB 5G49B 3AYWD 5B40A 5GT0A 1P3KD 4H9QB 3VH5A 3AZGD 3AV1A 1P34A 1ID3A 1B6WA 3AN2B 1M1AB 4KGCA 4NFTA 1AOIB 3B6FB 5DNMA 1KX3B 3AV2C 5B33A 3AV2D 5AVBB 2Y2MA 2RVQC 2RVQD 5B40B 1M1AC 1AOIC 1M18A 1AOID 3B6FC 4G91B 3B6FD 1F1EA 3VH5W 3AV1B 4WU8B 5AVBC 5AVBD 1ID3B 5AV8A 5BS7A 5GSUA 3W99D 5B40C 5B40D 5GT0C 5GT0D 2J8PA 3A1KA 2LY8A 3C1CA 2DQNC 5DNMB 4G91C 4NE5A 5B33B 3AV1C 4J8WD 1P34C 1N1JB 4WU9A 1P34D 1ID3C 4KGCC 4H9SA 4KGCD 5AVCA 4X23A 3MGQA 1M18B 1JFIA 3NQJA 4KUDB 5GXQB 1M19A 5DNMC 3REIB 5B33C 5B33D 4Z5TA 5GSUB 3WA9A 2ZY3A 4JJNA 3O62A 3IP4C 1M18C 3B0BA 3UT9A 5AV8C 5AV8D 5BS7C 5GSUC 5GSUD 5B32D 5BNXA 2G5HC 3VH5T 3W97D 1WWSA 1JFIB 1Z2CB 3C1CC 3C1CD 3LJAD 5FUGB 3H0RC 1H3OA 4WU9C 4WU9D 3UTAA 1P3GB 2HIOA 4H9SC 2NZDA 5E5AB 5AVCC 5AVCD 4X23C 4X23D 5JA4A 3O62B 3MGQC 3AZJA 3MGQD 5B0YB 1M19C 3UT9B 1M19D 1TZYD 1U35A 5B32G 4Z5TC 4Z5TD 3WA9C 3WA9D 4JJNC 4JJND 3REJA 3O62C 1HQ3A 3UT9C 3WKJA 1H3OB 1ULYA 3UTAB 2NZDB 2HIOB 3MNNB 4DRBA 5JA4B 4NE6A 5CPJD 4AWLB 5AV5D 3UTAC 2NZDC 2HIOC 3C1BA 3AZJC 3REJB 3AZJD 2F8ND 4ZUXA 1HQ3B 2FJ7A 3EPHA 1U35C 2Y2HA 1U35D 5AV6A 4H9NA 3KFUG 1P3LB 3KXBA 3AZLA 3REJC 3REJD 2Y2IA 5CPID 1HQ3C 3WKJC 2JSSA 2L5AA 3WKJD 3X1VA 3W96A 5G49A 4YM6B 5BO0A 3KWQB 4H9QA 2FJ7B 3VH6A 3REKA 5AV6B 1ZLAD 3AN2A 4UUZA 2JCHA 3KXBB 3C1BC 3C1BD 3R45B 2YFVA 3MVDA 2NQBD 4ZUXC 4ZUXD 1P3OB 2FJ7C 3MGRD 1KX3A 5CHLB 5AV6C 1A7WA 5AV6D 3W96B 3AZNB 5BO0B 3AZMB 1W2EA 3KXBC 3AZLC 3KXBD 3AZLD 3UTBB 2AROB 3REKB 4WU8A 4KHAB 3VH6W 5BNVB 3NQUB 2Y2OA 4XZQB 3X1VC 3X1VD 3W96C 3P5JB 4UUZB 1EQZA 5AV9A 3A1IA 4J8UB 2Y2JA 4R8PB 2YFVB 4CAYA 3MVDB 2XD1A 3V9RA 3REKC 4EO5B 1N1JA 5DNNA 3AN2C 3AN2D 1M1AD 3W98B 4LD9A 3MVDC 3AZKA 3KUYB 4KUDA 5GXQA 1KX3C 1KX3D 3REIA 1P3MA 1EQZB 5AV9B 4CAYB 4Z66A 3V9RB 3LZ0B 1T3UA 4WV4B 4WU8C 3AV1D 4WU8D 1F66A 5DNNB 3LELA 1ID3D 1EQZC 5AV9C 4LD9B 3AZKB 3VH6T 5DNMD 1P3MB 5FUGA 3F6TA 4DQYB 5DNNC 1P3GA 4QLCB 5E5AA 4J8VB 4Z66B 4LD9C 3REHA 3AZKC 1P3FB 1M18D 4XUJB 4KUDC 5GXQC 5B0YA 5GXQD 1PZRA 4J8XB 4KUDD 3REIC 1P3MC 3REID 1KX4A 1F66B 5GT3B 3LELB 4WJ3C 1KX5A 4Z66C 5AY8B 2ZY4A 3RELB 1P3BA 2FFFB 1F66C 1F66D 3LELC 4NE3A 3MNNA 1P3AB 5KDMB 2UWXA 5B24B 3REHB 1HTAA 3MGSB 3A6NB 3EG5B 1KX4B 3WAAA 3WTPB 1P3GC 1P3GD
chains in the Genus database with same CATH topology
1KX5B 5E5AC 5E5AD 3EPKA 3EPJA 2Y2KA 3O62D 3REHC 5CPKB 4YS3A 5B0YC 1P3BB 5B0YD 3UT9D 1KX4C 1WWIA 1P3PB 4HGAB 1P3LA 1KX5C 4ZBJB 3AZFA 2RIQA 1P3BC 1P3BD 3WAAB 3H0MC 3UTAD 2NZDD 2HIOD 4HGAC 4YM6A 4WZSB 3MNNC 3MNND 3KWQA 4H9PA 4YS3B 4AWLC 2ZY2A 3WAAC 1P3IA 4UPKA 2W8SA 5B2IA 3AFAB 3AZFB 3R45A 3X1UA 3B0CW 4YS3C 1P3OA 1HQ3D 1KU5A 5B31B 5B0ZB 2CWEA 5B1LA 5B2JB 1R4VA 3AZNA 3AZMA 4H9PB 1P3LC 1P3LD 3AZFC 3X1SA 3AZEB 3UTBA 2AROA 3TU4A 1P3IB 2BYKA 5CP6A 4KHAA 4DRAA 3NQUA 4XZQA 5BNVA 5B2IB 4YM6C 4YM6D 4J8UA 4E44A 4R8PA 3KWQC 3KWQD 2HUEB 3X1UB 3AYWA 3B6GB 2F8NK 1P3KA 2FJ7D 5JRGB 5B1LB 3AZGA 1P3IC 1BH8A 5C3IB 1S32A 5B2IC 5B1MB 5B2ID 4H9OA 3AL0C 3W98A 3X1SB 3X1UC 2BYMA 3KUYA 3TU4B 1P3OC 1P3OD 2CV5B 2BYKB 5CP6B 2PYOB 5B1LC 5B1LD 5C3IC 3B0CT 3W96D 3AZNC 3AZND 3AZMC 3AZMD 3AYWB 1P3KB 3X1SC 3UTBC 2AROC 3LZ0A 2AROD 3REKD 3UTBD 3TU4C 3AZGB 5CP6C 1BH8B 4XZQC 3H0LC 4XZQD 1S32B 1BH9B 4H9OB 4J8UC 4R8PC 4J8UD 4R8PD 1TAFB 3AYWC 3MVDD 2BYMB 3W99A 1P3KC 4WNNA 1BFMA 3LZ1A 3AZGC 4EO5C 3AV2B 4J8WA 1S32C 4QLCA 1S32D 4J8VA 3W98C 3W98D 3KUYC 1P3FA 3KUYD 4XUJA 2G5IC 4J8XA 5GT3A 4H9RB 1EQZD 5AV9D 3W99B 3X1TA 5AY8A 5GT0B 4WNNB 3LZ0C 3LZ0D 2ZY5A 3RELA 3LZ1B 1Q9CA 2YFWA 4J8WB 5DNND 1P34B 3EPLA 4KGCB 1P3AA 5B32A 2DF4C 5KDMA 4LD9D 3W99C 5B24A 3AZKD 3MGSA 3W97A 3A6NA 1P3MD 3LJAA 3LZ1C 3LZ1D 3WTPA 4J8WC 2JE5A 2XD5A 2Y2NA 4QLCC 4QLCD 4J8VC 4J8VD 4Z66D 3X1TB 2Y2LA 2BG1A 5CPKA 1P3FC 4XUJC 1P3FD 4XUJD 4J8XC 4J8XD 2YFWB 5GT3C 5GT3D 1TZYA 3LELD 1P3PA 4Z2MG 5AV8B 5B32B 2IO5B 4Z2MH 3X1TC 5AY8C 3X1TD 5AY8D 3W97B 4E45A 3C1CB 3RELC 3AZHA 3LJAB 3RELD 3REHD 4WU9B 1P3AC 5B32C 1P3AD 2IO5C 4G92B 5B24C 2VQRA 5AVCB 5B24D 4X23B 2F2AC 3A6NC 3MGSC 3A6ND 3MGSD 3MGQB 3W97C 3NQJB 5CPJA 1KX4D 3LJAC 1M19B 1TZYB 5AV5A 3WTPD 3WTPC 4Z5TB 3AZIA 3AFAA 3WA9B 2Y2QA 3KSYA 1KX5D 4G92C 5F99A 4JJNB 5CPKC 5CPKD 2F8NA 3AZHB 3FDDA 5B31A 5B0ZA 5B2JA 1TZYC 1B67A 1P3PC 1P3PD 3MGPA 5BNXB 4ZBJC 3AZEA 5BT1C 5CPJB 5BT1D 5CPIA 3AZHC 3AZHD 5AV5B 3WAAD 3AZIB 2Y2GA 3B6GA 5F99B 2ZM5A 3AZJB 2F8NB 4YS3D 4CSRA 5CPJC 5JRGA 5AV5C 1U35B 3MGPB 1ZLAA 3AZIC 3AZID 5B1MA 3AFAC 3AFAD 3AZFD 5F99C 5F99D 2NQBA 5CPIB 2CV5A 5B31C 5B31D 5B0ZC 3MGRA 5B0ZD 2PYOA 5B2JC 3WKJB 2Y2PA 5B2JD 3MGPC 4M6BA 3MGPD 3AZEC 3AZED 4CSRB 5CPIC 3B0DB 1P3ID 1ZLAB 1BH9A 1TAFA 2HUEC 3WTPE 3C1BB 3X1UD 2F8NG 3B6GD 3B6GC 2NQBB 2F8NH 5B31G 4ZUXB 5JRGC 5JRGD 3MGRB 3B0DC 3AV2A 1ZLAC 5B1MC 5B1MD 4H9NB 1M1AA 3X1SD 3AZLB 2NQBC 3TU4D 1AOIA 2CV5C 2CV5D 3B6FA 5CP6D 3MGRC 2PYOC 2PYOD 4H9RA 5AVBA 3X1VB 5G49B 3AYWD 5B40A 5GT0A 1P3KD 4H9QB 3VH5A 3AZGD 3AV1A 1P34A 1ID3A 1B6WA 3AN2B 1M1AB 4KGCA 4NFTA 1AOIB 3B6FB 5DNMA 1KX3B 3AV2C 5B33A 3AV2D 5AVBB 2Y2MA 2RVQC 2RVQD 5B40B 1M1AC 1AOIC 1M18A 1AOID 3B6FC 4G91B 3B6FD 1F1EA 3VH5W 3AV1B 4WU8B 5AVBC 5AVBD 1ID3B 5AV8A 5BS7A 5GSUA 3W99D 5B40C 5B40D 5GT0C 5GT0D 2J8PA 3A1KA 2LY8A 3C1CA 2DQNC 5DNMB 4G91C 4NE5A 5B33B 3AV1C 4J8WD 1P34C 1N1JB 4WU9A 1P34D 1ID3C 4KGCC 4H9SA 4KGCD 5AVCA 4X23A 3MGQA 1M18B 1JFIA 3NQJA 4KUDB 5GXQB 1M19A 5DNMC 3REIB 5B33C 5B33D 4Z5TA 5GSUB 3WA9A 2ZY3A 4JJNA 3O62A 3IP4C 1M18C 3B0BA 3UT9A 5AV8C 5AV8D 5BS7C 5GSUC 5GSUD 5B32D 5BNXA 2G5HC 3VH5T 3W97D 1WWSA 1JFIB 1Z2CB 3C1CC 3C1CD 3LJAD 5FUGB 3H0RC 1H3OA 4WU9C 4WU9D 3UTAA 1P3GB 2HIOA 4H9SC 2NZDA 5E5AB 5AVCC 5AVCD 4X23C 4X23D 5JA4A 3O62B 3MGQC 3AZJA 3MGQD 5B0YB 1M19C 3UT9B 1M19D 1TZYD 1U35A 5B32G 4Z5TC 4Z5TD 3WA9C 3WA9D 4JJNC 4JJND 3REJA 3O62C 1HQ3A 3UT9C 3WKJA 1H3OB 1ULYA 3UTAB 2NZDB 2HIOB 3MNNB 4DRBA 5JA4B 4NE6A 5CPJD 4AWLB 5AV5D 3UTAC 2NZDC 2HIOC 3C1BA 3AZJC 3REJB 3AZJD 2F8ND 4ZUXA 1HQ3B 2FJ7A 3EPHA 1U35C 2Y2HA 1U35D 5AV6A 4H9NA 3KFUG 1P3LB 3KXBA 3AZLA 3REJC 3REJD 2Y2IA 5CPID 1HQ3C 3WKJC 2JSSA 2L5AA 3WKJD 3X1VA 3W96A 5G49A 4YM6B 5BO0A 3KWQB 4H9QA 2FJ7B 3VH6A 3REKA 5AV6B 1ZLAD 3AN2A 4UUZA 2JCHA 3KXBB 3C1BC 3C1BD 3R45B 2YFVA 3MVDA 2NQBD 4ZUXC 4ZUXD 1P3OB 2FJ7C 3MGRD 1KX3A 5CHLB 5AV6C 1A7WA 5AV6D 3W96B 3AZNB 5BO0B 3AZMB 1W2EA 3KXBC 3AZLC 3KXBD 3AZLD 3UTBB 2AROB 3REKB 4WU8A 4KHAB 3VH6W 5BNVB 3NQUB 2Y2OA 4XZQB 3X1VC 3X1VD 3W96C 3P5JB 4UUZB 1EQZA 5AV9A 3A1IA 4J8UB 2Y2JA 4R8PB 2YFVB 4CAYA 3MVDB 2XD1A 3V9RA 3REKC 4EO5B 1N1JA 5DNNA 3AN2C 3AN2D 1M1AD 3W98B 4LD9A 3MVDC 3AZKA 3KUYB 4KUDA 5GXQA 1KX3C 1KX3D 3REIA 1P3MA 1EQZB 5AV9B 4CAYB 4Z66A 3V9RB 3LZ0B 1T3UA 4WV4B 4WU8C 3AV1D 4WU8D 1F66A 5DNNB 3LELA 1ID3D 1EQZC 5AV9C 4LD9B 3AZKB 3VH6T 5DNMD 1P3MB 5FUGA 3F6TA 4DQYB 5DNNC 1P3GA 4QLCB 5E5AA 4J8VB 4Z66B 4LD9C 3REHA 3AZKC 1P3FB 1M18D 4XUJB 4KUDC 5GXQC 5B0YA 5GXQD 1PZRA 4J8XB 4KUDD 3REIC 1P3MC 3REID 1KX4A 1F66B 5GT3B 3LELB 4WJ3C 1KX5A 4Z66C 5AY8B 2ZY4A 3RELB 1P3BA 2FFFB 1F66C 1F66D 3LELC 4NE3A 3MNNA 1P3AB 5KDMB 2UWXA 5B24B 3REHB 1HTAA 3MGSB 3A6NB 3EG5B 1KX4B 3WAAA 3WTPB 1P3GC 1P3GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX5 B;  5E5A C;  5E5A D;  3O62 D;  3REH C;  5CPK B;  4YS3 A;  5B0Y C;  1P3B B;  5B0Y D;  3UT9 D;  1KX4 C;  1WWI A;  1P3P B;  4HGA B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZF A;  1P3B C;  1P3B D;  3WAA B;  3UTA D;  2NZD D;  4YM6 A;  2HIO D;  4HGA C;  4WZS B;  3MNN C;  3MNN D;  3KWQ A;  4H9P A;  4YS3 B;  4AWL C;  3WAA C;  1P3I A;  5B2I A;  3AFA B;  3AZF B;  3R45 A;  3X1U A;  3B0C W;  4YS3 C;  1P3O A;  1HQ3 D;  1KU5 A;  5B31 B;  5B0Z B;  2CWE A;  5B1L A;  5B2J B;  1R4V A;  3AZN A;  3AZM A;  4H9P B;  1P3L C;  1P3L D;  3AZF C;  3X1S A;  3AZE B;  3UTB A;  2ARO A;  3TU4 A;  1P3I B;  2BYK A;  5CP6 A;  4KHA A;  4DRA A;  3NQU A;  4XZQ A;  5BNV A;  5B2I B;  4YM6 C;  4YM6 D;  4J8U A;  4E44 A;  4R8P A;  3KWQ C;  3KWQ D;  2HUE B;  3X1U B;  3AYW A;  3B6G B;  2F8N K;  1P3K A;  2FJ7 D;  5JRG B;  5B1L B;  3AZG A;  1P3I C;  1BH8 A;  5C3I B;  1S32 A;  5B2I C;  5B1M B;  5B2I D;  4H9O A;  3W98 A;  3X1S B;  3X1U C;  2BYM A;  3KUY A;  3TU4 B;  1P3O C;  1P3O D;  2CV5 B;  2BYK B;  5CP6 B;  2PYO B;  5B1L C;  5B1L D;  5C3I C;  3B0C T;  3W96 D;  3AZN C;  3AZN D;  3AZM C;  3AZM D;  3AYW B;  1P3K B;  3X1S C;  3UTB C;  2ARO C;  3LZ0 A;  2ARO D;  3REK D;  3UTB D;  3TU4 C;  3AZG B;  5CP6 C;  1BH8 B;  4XZQ C;  4XZQ D;  1S32 B;  1BH9 B;  4H9O B;  4J8U C;  4R8P C;  4J8U D;  4R8P D;  1TAF B;  3AYW C;  3MVD D;  2BYM B;  3W99 A;  1P3K C;  4WNN A;  3LZ1 A;  3AZG C;  4EO5 C;  3AV2 B;  4J8W A;  1S32 C;  4QLC A;  1S32 D;  4J8V A;  3W98 C;  3W98 D;  3KUY C;  1P3F A;  3KUY D;  4XUJ A;  4J8X A;  5GT3 A;  4H9R B;  1EQZ D;  5AV9 D;  3W99 B;  3X1T A;  5AY8 A;  5GT0 B;  4WNN B;  3LZ0 C;  3LZ0 D;  3REL A;  3LZ1 B;  1Q9C A;  2YFW A;  4J8W B;  5DNN D;  1P34 B;  4KGC B;  1P3A A;  5B32 A;  5KDM A;  4LD9 D;  3W99 C;  5B24 A;  3AZK D;  3MGS A;  3W97 A;  3A6N A;  1P3M D;  3LJA A;  3LZ1 C;  3LZ1 D;  3WTP A;  4J8W C;  4QLC C;  4QLC D;  4J8V C;  4J8V D;  4Z66 D;  3X1T B;  5CPK A;  1P3F C;  4XUJ C;  1P3F D;  4XUJ D;  4J8X C;  4J8X D;  2YFW B;  5GT3 C;  5GT3 D;  1TZY A;  3LEL D;  1P3P A;  4Z2M G;  5AV8 B;  5B32 B;  2IO5 B;  4Z2M H;  3X1T C;  5AY8 C;  3X1T D;  5AY8 D;  3W97 B;  4E45 A;  3C1C B;  3REL C;  3AZH A;  3LJA B;  3REL D;  4WU9 B;  1P3A C;  5B32 C;  1P3A D;  2IO5 C;  4G92 B;  5B24 C;  5AVC B;  5B24 D;  4X23 B;  3REH D;  3MGS C;  3A6N C;  3MGS D;  3A6N D;  3MGQ B;  3W97 C;  1BFM A;  3NQJ B;  5CPJ A;  1KX4 D;  3LJA C;  1M19 B;  1TZY B;  5AV5 A;  3WTP D;  3WTP C;  4Z5T B;  3AZI A;  3AFA A;  3WA9 B;  3KSY A;  1KX5 D;  4G92 C;  5F99 A;  4JJN B;  5CPK C;  5CPK D;  2F8N A;  3AZH B;  5B31 A;  5B0Z A;  5B2J A;  1TZY C;  1B67 A;  1P3P C;  1P3P D;  3MGP A;  5BNX B;  4ZBJ C;  3AZE A;  5BT1 C;  5CPJ B;  5BT1 D;  5CPI A;  3AZH C;  3AZH D;  5AV5 B;  3WAA D;  3AZI B;  3B6G A;  5F99 B;  3AZJ B;  2F8N B;  4YS3 D;  4CSR A;  5CPJ C;  5JRG A;  5AV5 C;  1U35 B;  3MGP B;  1ZLA A;  3AZI C;  3AZI D;  5B1M A;  3AFA C;  3AFA D;  3AZF D;  5F99 C;  5F99 D;  2NQB A;  5CPI B;  2CV5 A;  5B31 C;  5B31 D;  5B0Z C;  3MGR A;  5B0Z D;  2PYO A;  5B2J C;  3WKJ B;  5B2J D;  3MGP C;  4M6B A;  3MGP D;  3AZE C;  3AZE D;  4CSR B;  5CPI C;  3B0D B;  1P3I D;  1ZLA B;  1BH9 A;  1TAF A;  2HUE C;  3WTP E;  3C1B B;  3X1U D;  2F8N G;  3B6G D;  3B6G C;  2NQB B;  2F8N H;  5B31 G;  4ZUX B;  5JRG C;  5JRG D;  3MGR B;  3B0D C;  3AV2 A;  1ZLA C;  5B1M C;  5B1M D;  4H9N B;  1M1A A;  3X1S D;  3AZL B;  2NQB C;  3TU4 D;  1AOI A;  2CV5 C;  2CV5 D;  3B6F A;  5CP6 D;  3MGR C;  2PYO C;  2PYO D;  4H9R A;  5AVB A;  3X1V B;  5G49 B;  3AYW D;  5B40 A;  5GT0 A;  1P3K D;  4H9Q B;  3VH5 A;  3AZG D;  3AV1 A;  1P34 A;  1ID3 A;  1B6W A;  3AN2 B;  1M1A B;  4KGC A;  4NFT A;  1AOI B;  3B6F B;  5DNM A;  1KX3 B;  3AV2 C;  5B33 A;  3AV2 D;  5AVB B;  2RVQ C;  2RVQ D;  5B40 B;  1M1A C;  1AOI C;  1M18 A;  1AOI D;  3B6F C;  4G91 B;  3B6F D;  1F1E A;  3VH5 W;  3AV1 B;  4WU8 B;  5AVB C;  5AVB D;  1ID3 B;  5AV8 A;  5BS7 A;  5GSU A;  3W99 D;  5B40 C;  5B40 D;  5GT0 C;  5GT0 D;  2LY8 A;  3C1C A;  5DNM B;  4G91 C;  4NE5 A;  5B33 B;  3AV1 C;  4J8W D;  1P34 C;  1N1J B;  4WU9 A;  1P34 D;  1ID3 C;  4KGC C;  4H9S A;  4KGC D;  5AVC A;  4X23 A;  3MGQ A;  1M18 B;  1JFI A;  3NQJ A;  4KUD B;  5GXQ B;  1M19 A;  5DNM C;  3REI B;  5B33 C;  5B33 D;  4Z5T A;  5GSU B;  3WA9 A;  4JJN A;  3O62 A;  1M18 C;  3B0B A;  3UT9 A;  5AV8 C;  5AV8 D;  5BS7 C;  5GSU C;  5GSU D;  5B32 D;  5BNX A;  3VH5 T;  3W97 D;  1WWS A;  1JFI B;  3C1C C;  3C1C D;  3LJA D;  5FUG B;  1H3O A;  4WU9 C;  4WU9 D;  3UTA A;  1P3G B;  2HIO A;  4H9S C;  2NZD A;  5E5A B;  5AVC C;  5AVC D;  4X23 C;  4X23 D;  5JA4 A;  3O62 B;  3MGQ C;  3AZJ A;  3MGQ D;  5B0Y B;  1M19 C;  3UT9 B;  1M19 D;  1TZY D;  1U35 A;  5B32 G;  4Z5T C;  4Z5T D;  3WA9 C;  3WA9 D;  4JJN C;  4JJN D;  3REJ A;  3O62 C;  1HQ3 A;  3UT9 C;  3WKJ A;  1H3O B;  1ULY A;  3UTA B;  2NZD B;  2HIO B;  3MNN B;  4DRB A;  5JA4 B;  4NE6 A;  5CPJ D;  4AWL B;  5AV5 D;  3UTA C;  2NZD C;  2HIO C;  3C1B A;  3AZJ C;  3REJ B;  3AZJ D;  2F8N D;  4ZUX A;  1HQ3 B;  2FJ7 A;  1U35 C;  1U35 D;  5AV6 A;  4H9N A;  1P3L B;  3KXB A;  3AZL A;  3REJ C;  3REJ D;  5CPI D;  1HQ3 C;  3WKJ C;  2JSS A;  2L5A A;  3WKJ D;  3X1V A;  3W96 A;  5G49 A;  4YM6 B;  5BO0 A;  3KWQ B;  4H9Q A;  2FJ7 B;  3VH6 A;  3REK A;  5AV6 B;  1ZLA D;  3AN2 A;  4UUZ A;  3KXB B;  3C1B C;  3C1B D;  3R45 B;  2YFV A;  3MVD A;  2NQB D;  4ZUX C;  4ZUX D;  1P3O B;  2FJ7 C;  3MGR D;  1KX3 A;  5CHL B;  5AV6 C;  1A7W A;  5AV6 D;  3W96 B;  3AZN B;  5BO0 B;  3AZM B;  3KXB C;  3AZL C;  3KXB D;  3AZL D;  3UTB B;  2ARO B;  3REK B;  4WU8 A;  4KHA B;  3VH6 W;  4XZQ B;  3NQU B;  5BNV B;  3X1V C;  3X1V D;  3W96 C;  1EQZ A;  4UUZ B;  5AV9 A;  4J8U B;  4R8P B;  2YFV B;  4CAY A;  3MVD B;  3V9R A;  3REK C;  4EO5 B;  1N1J A;  5DNN A;  3AN2 C;  3AN2 D;  1M1A D;  3W98 B;  4LD9 A;  3MVD C;  3AZK A;  3KUY B;  4KUD A;  5GXQ A;  1KX3 C;  1KX3 D;  3REI A;  1P3M A;  1EQZ B;  5AV9 B;  4CAY B;  4Z66 A;  3V9R B;  3LZ0 B;  4WV4 B;  4WU8 C;  3AV1 D;  4WU8 D;  1F66 A;  5DNN B;  3LEL A;  1ID3 D;  1EQZ C;  5AV9 C;  4LD9 B;  3AZK B;  3VH6 T;  5DNM D;  1P3M B;  5FUG A;  5DNN C;  1P3G A;  4QLC B;  5E5A A;  4J8V B;  4Z66 B;  4LD9 C;  3REH A;  3AZK C;  1P3F B;  1M18 D;  4XUJ B;  4KUD C;  5GXQ C;  5B0Y A;  5GXQ D;  4J8X B;  4KUD D;  3REI C;  1P3M C;  3REI D;  1KX4 A;  1F66 B;  5GT3 B;  3LEL B;  1KX5 A;  4Z66 C;  5AY8 B;  3REL B;  1P3B A;  1F66 C;  1F66 D;  3LEL C;  4NE3 A;  3MNN A;  1P3A B;  5KDM B;  5B24 B;  3REH B;  1HTA A;  3MGS B;  3A6N B;  1KX4 B;  3WAA A;  3WTP B;  1P3G C;  1P3G D; 
#chains in the Genus database with same CATH topology
 1KX5 B;  5E5A C;  5E5A D;  3EPK A;  3EPJ A;  2Y2K A;  3O62 D;  3REH C;  5CPK B;  4YS3 A;  5B0Y C;  1P3B B;  5B0Y D;  3UT9 D;  1KX4 C;  1WWI A;  1P3P B;  4HGA B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZF A;  2RIQ A;  1P3B C;  1P3B D;  3WAA B;  3H0M C;  3UTA D;  2NZD D;  2HIO D;  4HGA C;  4YM6 A;  4WZS B;  3MNN C;  3MNN D;  3KWQ A;  4H9P A;  4YS3 B;  4AWL C;  2ZY2 A;  3WAA C;  1P3I A;  4UPK A;  2W8S A;  5B2I A;  3AFA B;  3AZF B;  3R45 A;  3X1U A;  3B0C W;  4YS3 C;  1P3O A;  1HQ3 D;  1KU5 A;  5B31 B;  5B0Z B;  2CWE A;  5B1L A;  5B2J B;  1R4V A;  3AZN A;  3AZM A;  4H9P B;  1P3L C;  1P3L D;  3AZF C;  3X1S A;  3AZE B;  3UTB A;  2ARO A;  3TU4 A;  1P3I B;  2BYK A;  5CP6 A;  4KHA A;  4DRA A;  3NQU A;  4XZQ A;  5BNV A;  5B2I B;  4YM6 C;  4YM6 D;  4J8U A;  4E44 A;  4R8P A;  3KWQ C;  3KWQ D;  2HUE B;  3X1U B;  3AYW A;  3B6G B;  2F8N K;  1P3K A;  2FJ7 D;  5JRG B;  5B1L B;  3AZG A;  1P3I C;  1BH8 A;  5C3I B;  1S32 A;  5B2I C;  5B1M B;  5B2I D;  4H9O A;  3AL0 C;  3W98 A;  3X1S B;  3X1U C;  2BYM A;  3KUY A;  3TU4 B;  1P3O C;  1P3O D;  2CV5 B;  2BYK B;  5CP6 B;  2PYO B;  5B1L C;  5B1L D;  5C3I C;  3B0C T;  3W96 D;  3AZN C;  3AZN D;  3AZM C;  3AZM D;  3AYW B;  1P3K B;  3X1S C;  3UTB C;  2ARO C;  3LZ0 A;  2ARO D;  3REK D;  3UTB D;  3TU4 C;  3AZG B;  5CP6 C;  1BH8 B;  4XZQ C;  3H0L C;  4XZQ D;  1S32 B;  1BH9 B;  4H9O B;  4J8U C;  4R8P C;  4J8U D;  4R8P D;  1TAF B;  3AYW C;  3MVD D;  2BYM B;  3W99 A;  1P3K C;  4WNN A;  1BFM A;  3LZ1 A;  3AZG C;  4EO5 C;  3AV2 B;  4J8W A;  1S32 C;  4QLC A;  1S32 D;  4J8V A;  3W98 C;  3W98 D;  3KUY C;  1P3F A;  3KUY D;  4XUJ A;  2G5I C;  4J8X A;  5GT3 A;  4H9R B;  1EQZ D;  5AV9 D;  3W99 B;  3X1T A;  5AY8 A;  5GT0 B;  4WNN B;  3LZ0 C;  3LZ0 D;  2ZY5 A;  3REL A;  3LZ1 B;  1Q9C A;  2YFW A;  4J8W B;  5DNN D;  1P34 B;  3EPL A;  4KGC B;  1P3A A;  5B32 A;  2DF4 C;  5KDM A;  4LD9 D;  3W99 C;  5B24 A;  3AZK D;  3MGS A;  3W97 A;  3A6N A;  1P3M D;  3LJA A;  3LZ1 C;  3LZ1 D;  3WTP A;  4J8W C;  2JE5 A;  2XD5 A;  2Y2N A;  4QLC C;  4QLC D;  4J8V C;  4J8V D;  4Z66 D;  3X1T B;  2Y2L A;  2BG1 A;  5CPK A;  1P3F C;  4XUJ C;  1P3F D;  4XUJ D;  4J8X C;  4J8X D;  2YFW B;  5GT3 C;  5GT3 D;  1TZY A;  3LEL D;  1P3P A;  4Z2M G;  5AV8 B;  5B32 B;  2IO5 B;  4Z2M H;  3X1T C;  5AY8 C;  3X1T D;  5AY8 D;  3W97 B;  4E45 A;  3C1C B;  3REL C;  3AZH A;  3LJA B;  3REL D;  3REH D;  4WU9 B;  1P3A C;  5B32 C;  1P3A D;  2IO5 C;  4G92 B;  5B24 C;  2VQR A;  5AVC B;  5B24 D;  4X23 B;  2F2A C;  3A6N C;  3MGS C;  3A6N D;  3MGS D;  3MGQ B;  3W97 C;  3NQJ B;  5CPJ A;  1KX4 D;  3LJA C;  1M19 B;  1TZY B;  5AV5 A;  3WTP D;  3WTP C;  4Z5T B;  3AZI A;  3AFA A;  3WA9 B;  2Y2Q A;  3KSY A;  1KX5 D;  4G92 C;  5F99 A;  4JJN B;  5CPK C;  5CPK D;  2F8N A;  3AZH B;  3FDD A;  5B31 A;  5B0Z A;  5B2J A;  1TZY C;  1B67 A;  1P3P C;  1P3P D;  3MGP A;  5BNX B;  4ZBJ C;  3AZE A;  5BT1 C;  5CPJ B;  5BT1 D;  5CPI A;  3AZH C;  3AZH D;  5AV5 B;  3WAA D;  3AZI B;  2Y2G A;  3B6G A;  5F99 B;  2ZM5 A;  3AZJ B;  2F8N B;  4YS3 D;  4CSR A;  5CPJ C;  5JRG A;  5AV5 C;  1U35 B;  3MGP B;  1ZLA A;  3AZI C;  3AZI D;  5B1M A;  3AFA C;  3AFA D;  3AZF D;  5F99 C;  5F99 D;  2NQB A;  5CPI B;  2CV5 A;  5B31 C;  5B31 D;  5B0Z C;  3MGR A;  5B0Z D;  2PYO A;  5B2J C;  3WKJ B;  2Y2P A;  5B2J D;  3MGP C;  4M6B A;  3MGP D;  3AZE C;  3AZE D;  4CSR B;  5CPI C;  3B0D B;  1P3I D;  1ZLA B;  1BH9 A;  1TAF A;  2HUE C;  3WTP E;  3C1B B;  3X1U D;  2F8N G;  3B6G D;  3B6G C;  2NQB B;  2F8N H;  5B31 G;  4ZUX B;  5JRG C;  5JRG D;  3MGR B;  3B0D C;  3AV2 A;  1ZLA C;  5B1M C;  5B1M D;  4H9N B;  1M1A A;  3X1S D;  3AZL B;  2NQB C;  3TU4 D;  1AOI A;  2CV5 C;  2CV5 D;  3B6F A;  5CP6 D;  3MGR C;  2PYO C;  2PYO D;  4H9R A;  5AVB A;  3X1V B;  5G49 B;  3AYW D;  5B40 A;  5GT0 A;  1P3K D;  4H9Q B;  3VH5 A;  3AZG D;  3AV1 A;  1P34 A;  1ID3 A;  1B6W A;  3AN2 B;  1M1A B;  4KGC A;  4NFT A;  1AOI B;  3B6F B;  5DNM A;  1KX3 B;  3AV2 C;  5B33 A;  3AV2 D;  5AVB B;  2Y2M A;  2RVQ C;  2RVQ D;  5B40 B;  1M1A C;  1AOI C;  1M18 A;  1AOI D;  3B6F C;  4G91 B;  3B6F D;  1F1E A;  3VH5 W;  3AV1 B;  4WU8 B;  5AVB C;  5AVB D;  1ID3 B;  5AV8 A;  5BS7 A;  5GSU A;  3W99 D;  5B40 C;  5B40 D;  5GT0 C;  5GT0 D;  2J8P A;  3A1K A;  2LY8 A;  3C1C A;  2DQN C;  5DNM B;  4G91 C;  4NE5 A;  5B33 B;  3AV1 C;  4J8W D;  1P34 C;  1N1J B;  4WU9 A;  1P34 D;  1ID3 C;  4KGC C;  4H9S A;  4KGC D;  5AVC A;  4X23 A;  3MGQ A;  1M18 B;  1JFI A;  3NQJ A;  4KUD B;  5GXQ B;  1M19 A;  5DNM C;  3REI B;  5B33 C;  5B33 D;  4Z5T A;  5GSU B;  3WA9 A;  2ZY3 A;  4JJN A;  3O62 A;  3IP4 C;  1M18 C;  3B0B A;  3UT9 A;  5AV8 C;  5AV8 D;  5BS7 C;  5GSU C;  5GSU D;  5B32 D;  5BNX A;  2G5H C;  3VH5 T;  3W97 D;  1WWS A;  1JFI B;  1Z2C B;  3C1C C;  3C1C D;  3LJA D;  5FUG B;  3H0R C;  1H3O A;  4WU9 C;  4WU9 D;  3UTA A;  1P3G B;  2HIO A;  4H9S C;  2NZD A;  5E5A B;  5AVC C;  5AVC D;  4X23 C;  4X23 D;  5JA4 A;  3O62 B;  3MGQ C;  3AZJ A;  3MGQ D;  5B0Y B;  1M19 C;  3UT9 B;  1M19 D;  1TZY D;  1U35 A;  5B32 G;  4Z5T C;  4Z5T D;  3WA9 C;  3WA9 D;  4JJN C;  4JJN D;  3REJ A;  3O62 C;  1HQ3 A;  3UT9 C;  3WKJ A;  1H3O B;  1ULY A;  3UTA B;  2NZD B;  2HIO B;  3MNN B;  4DRB A;  5JA4 B;  4NE6 A;  5CPJ D;  4AWL B;  5AV5 D;  3UTA C;  2NZD C;  2HIO C;  3C1B A;  3AZJ C;  3REJ B;  3AZJ D;  2F8N D;  4ZUX A;  1HQ3 B;  2FJ7 A;  3EPH A;  1U35 C;  2Y2H A;  1U35 D;  5AV6 A;  4H9N A;  3KFU G;  1P3L B;  3KXB A;  3AZL A;  3REJ C;  3REJ D;  2Y2I A;  5CPI D;  1HQ3 C;  3WKJ C;  2JSS A;  2L5A A;  3WKJ D;  3X1V A;  3W96 A;  5G49 A;  4YM6 B;  5BO0 A;  3KWQ B;  4H9Q A;  2FJ7 B;  3VH6 A;  3REK A;  5AV6 B;  1ZLA D;  3AN2 A;  4UUZ A;  2JCH A;  3KXB B;  3C1B C;  3C1B D;  3R45 B;  2YFV A;  3MVD A;  2NQB D;  4ZUX C;  4ZUX D;  1P3O B;  2FJ7 C;  3MGR D;  1KX3 A;  5CHL B;  5AV6 C;  1A7W A;  5AV6 D;  3W96 B;  3AZN B;  5BO0 B;  3AZM B;  1W2E A;  3KXB C;  3AZL C;  3KXB D;  3AZL D;  3UTB B;  2ARO B;  3REK B;  4WU8 A;  4KHA B;  3VH6 W;  5BNV B;  3NQU B;  2Y2O A;  4XZQ B;  3X1V C;  3X1V D;  3W96 C;  3P5J B;  4UUZ B;  1EQZ A;  5AV9 A;  3A1I A;  4J8U B;  2Y2J A;  4R8P B;  2YFV B;  4CAY A;  3MVD B;  2XD1 A;  3V9R A;  3REK C;  4EO5 B;  1N1J A;  5DNN A;  3AN2 C;  3AN2 D;  1M1A D;  3W98 B;  4LD9 A;  3MVD C;  3AZK A;  3KUY B;  4KUD A;  5GXQ A;  1KX3 C;  1KX3 D;  3REI A;  1P3M A;  1EQZ B;  5AV9 B;  4CAY B;  4Z66 A;  3V9R B;  3LZ0 B;  1T3U A;  4WV4 B;  4WU8 C;  3AV1 D;  4WU8 D;  1F66 A;  5DNN B;  3LEL A;  1ID3 D;  1EQZ C;  5AV9 C;  4LD9 B;  3AZK B;  3VH6 T;  5DNM D;  1P3M B;  5FUG A;  3F6T A;  4DQY B;  5DNN C;  1P3G A;  4QLC B;  5E5A A;  4J8V B;  4Z66 B;  4LD9 C;  3REH A;  3AZK C;  1P3F B;  1M18 D;  4XUJ B;  4KUD C;  5GXQ C;  5B0Y A;  5GXQ D;  1PZR A;  4J8X B;  4KUD D;  3REI C;  1P3M C;  3REI D;  1KX4 A;  1F66 B;  5GT3 B;  3LEL B;  4WJ3 C;  1KX5 A;  4Z66 C;  5AY8 B;  2ZY4 A;  3REL B;  1P3B A;  2FFF B;  1F66 C;  1F66 D;  3LEL C;  4NE3 A;  3MNN A;  1P3A B;  5KDM B;  2UWX A;  5B24 B;  3REH B;  1HTA A;  3MGS B;  3A6N B;  3EG5 B;  1KX4 B;  3WAA A;  3WTP B;  1P3G C;  1P3G D; 
#chains in the Genus database with same CATH homology
 1KX5 B;  5E5A C;  5E5A D;  3EPK A;  3EPJ A;  2Y2K A;  3O62 D;  3REH C;  5CPK B;  4YS3 A;  5B0Y C;  1P3B B;  5B0Y D;  3UT9 D;  1KX4 C;  1WWI A;  1P3P B;  4HGA B;  1P3L A;  1KX5 C;  4ZBJ B;  3AZF A;  2RIQ A;  1P3B C;  1P3B D;  3WAA B;  3H0M C;  3UTA D;  2NZD D;  2HIO D;  4HGA C;  4YM6 A;  4WZS B;  3MNN C;  3MNN D;  3KWQ A;  4H9P A;  4YS3 B;  4AWL C;  2ZY2 A;  3WAA C;  1P3I A;  4UPK A;  2W8S A;  5B2I A;  3AFA B;  3AZF B;  3R45 A;  3X1U A;  3B0C W;  4YS3 C;  1P3O A;  1HQ3 D;  1KU5 A;  5B31 B;  5B0Z B;  2CWE A;  5B1L A;  5B2J B;  1R4V A;  3AZN A;  3AZM A;  4H9P B;  1P3L C;  1P3L D;  3AZF C;  3X1S A;  3AZE B;  3UTB A;  2ARO A;  3TU4 A;  1P3I B;  2BYK A;  5CP6 A;  4KHA A;  4DRA A;  3NQU A;  4XZQ A;  5BNV A;  5B2I B;  4YM6 C;  4YM6 D;  4J8U A;  4E44 A;  4R8P A;  3KWQ C;  3KWQ D;  2HUE B;  3X1U B;  3AYW A;  3B6G B;  2F8N K;  1P3K A;  2FJ7 D;  5JRG B;  5B1L B;  3AZG A;  1P3I C;  1BH8 A;  5C3I B;  1S32 A;  5B2I C;  5B1M B;  5B2I D;  4H9O A;  3AL0 C;  3W98 A;  3X1S B;  3X1U C;  2BYM A;  3KUY A;  3TU4 B;  1P3O C;  1P3O D;  2CV5 B;  2BYK B;  5CP6 B;  2PYO B;  5B1L C;  5B1L D;  5C3I C;  3B0C T;  3W96 D;  3AZN C;  3AZN D;  3AZM C;  3AZM D;  3AYW B;  1P3K B;  3X1S C;  3UTB C;  2ARO C;  3LZ0 A;  2ARO D;  3REK D;  3UTB D;  3TU4 C;  3AZG B;  5CP6 C;  1BH8 B;  4XZQ C;  3H0L C;  4XZQ D;  1S32 B;  1BH9 B;  4H9O B;  4J8U C;  4R8P C;  4J8U D;  4R8P D;  1TAF B;  3AYW C;  3MVD D;  2BYM B;  3W99 A;  1P3K C;  4WNN A;  1BFM A;  3LZ1 A;  3AZG C;  4EO5 C;  3AV2 B;  4J8W A;  1S32 C;  4QLC A;  1S32 D;  4J8V A;  3W98 C;  3W98 D;  3KUY C;  1P3F A;  3KUY D;  4XUJ A;  2G5I C;  4J8X A;  5GT3 A;  4H9R B;  1EQZ D;  5AV9 D;  3W99 B;  3X1T A;  5AY8 A;  5GT0 B;  4WNN B;  3LZ0 C;  3LZ0 D;  2ZY5 A;  3REL A;  3LZ1 B;  1Q9C A;  2YFW A;  4J8W B;  5DNN D;  1P34 B;  3EPL A;  4KGC B;  1P3A A;  5B32 A;  2DF4 C;  5KDM A;  4LD9 D;  3W99 C;  5B24 A;  3AZK D;  3MGS A;  3W97 A;  3A6N A;  1P3M D;  3LJA A;  3LZ1 C;  3LZ1 D;  3WTP A;  4J8W C;  2JE5 A;  2XD5 A;  2Y2N A;  4QLC C;  4QLC D;  4J8V C;  4J8V D;  4Z66 D;  3X1T B;  2Y2L A;  2BG1 A;  5CPK A;  1P3F C;  4XUJ C;  1P3F D;  4XUJ D;  4J8X C;  4J8X D;  2YFW B;  5GT3 C;  5GT3 D;  1TZY A;  3LEL D;  1P3P A;  4Z2M G;  5AV8 B;  5B32 B;  2IO5 B;  4Z2M H;  3X1T C;  5AY8 C;  3X1T D;  5AY8 D;  3W97 B;  4E45 A;  3C1C B;  3REL C;  3AZH A;  3LJA B;  3REL D;  3REH D;  4WU9 B;  1P3A C;  5B32 C;  1P3A D;  2IO5 C;  4G92 B;  5B24 C;  2VQR A;  5AVC B;  5B24 D;  4X23 B;  2F2A C;  3A6N C;  3MGS C;  3A6N D;  3MGS D;  3MGQ B;  3W97 C;  3NQJ B;  5CPJ A;  1KX4 D;  3LJA C;  1M19 B;  1TZY B;  5AV5 A;  3WTP D;  3WTP C;  4Z5T B;  3AZI A;  3AFA A;  3WA9 B;  2Y2Q A;  3KSY A;  1KX5 D;  4G92 C;  5F99 A;  4JJN B;  5CPK C;  5CPK D;  2F8N A;  3AZH B;  3FDD A;  5B31 A;  5B0Z A;  5B2J A;  1TZY C;  1B67 A;  1P3P C;  1P3P D;  3MGP A;  5BNX B;  4ZBJ C;  3AZE A;  5BT1 C;  5CPJ B;  5BT1 D;  5CPI A;  3AZH C;  3AZH D;  5AV5 B;  3WAA D;  3AZI B;  2Y2G A;  3B6G A;  5F99 B;  2ZM5 A;  3AZJ B;  2F8N B;  4YS3 D;  4CSR A;  5CPJ C;  5JRG A;  5AV5 C;  1U35 B;  3MGP B;  1ZLA A;  3AZI C;  3AZI D;  5B1M A;  3AFA C;  3AFA D;  3AZF D;  5F99 C;  5F99 D;  2NQB A;  5CPI B;  2CV5 A;  5B31 C;  5B31 D;  5B0Z C;  3MGR A;  5B0Z D;  2PYO A;  5B2J C;  3WKJ B;  2Y2P A;  5B2J D;  3MGP C;  4M6B A;  3MGP D;  3AZE C;  3AZE D;  4CSR B;  5CPI C;  3B0D B;  1P3I D;  1ZLA B;  1BH9 A;  1TAF A;  2HUE C;  3WTP E;  3C1B B;  3X1U D;  2F8N G;  3B6G D;  3B6G C;  2NQB B;  2F8N H;  5B31 G;  4ZUX B;  5JRG C;  5JRG D;  3MGR B;  3B0D C;  3AV2 A;  1ZLA C;  5B1M C;  5B1M D;  4H9N B;  1M1A A;  3X1S D;  3AZL B;  2NQB C;  3TU4 D;  1AOI A;  2CV5 C;  2CV5 D;  3B6F A;  5CP6 D;  3MGR C;  2PYO C;  2PYO D;  4H9R A;  5AVB A;  3X1V B;  5G49 B;  3AYW D;  5B40 A;  5GT0 A;  1P3K D;  4H9Q B;  3VH5 A;  3AZG D;  3AV1 A;  1P34 A;  1ID3 A;  1B6W A;  3AN2 B;  1M1A B;  4KGC A;  4NFT A;  1AOI B;  3B6F B;  5DNM A;  1KX3 B;  3AV2 C;  5B33 A;  3AV2 D;  5AVB B;  2Y2M A;  2RVQ C;  2RVQ D;  5B40 B;  1M1A C;  1AOI C;  1M18 A;  1AOI D;  3B6F C;  4G91 B;  3B6F D;  1F1E A;  3VH5 W;  3AV1 B;  4WU8 B;  5AVB C;  5AVB D;  1ID3 B;  5AV8 A;  5BS7 A;  5GSU A;  3W99 D;  5B40 C;  5B40 D;  5GT0 C;  5GT0 D;  2J8P A;  3A1K A;  2LY8 A;  3C1C A;  2DQN C;  5DNM B;  4G91 C;  4NE5 A;  5B33 B;  3AV1 C;  4J8W D;  1P34 C;  1N1J B;  4WU9 A;  1P34 D;  1ID3 C;  4KGC C;  4H9S A;  4KGC D;  5AVC A;  4X23 A;  3MGQ A;  1M18 B;  1JFI A;  3NQJ A;  4KUD B;  5GXQ B;  1M19 A;  5DNM C;  3REI B;  5B33 C;  5B33 D;  4Z5T A;  5GSU B;  3WA9 A;  2ZY3 A;  4JJN A;  3O62 A;  3IP4 C;  1M18 C;  3B0B A;  3UT9 A;  5AV8 C;  5AV8 D;  5BS7 C;  5GSU C;  5GSU D;  5B32 D;  5BNX A;  2G5H C;  3VH5 T;  3W97 D;  1WWS A;  1JFI B;  1Z2C B;  3C1C C;  3C1C D;  3LJA D;  5FUG B;  3H0R C;  1H3O A;  4WU9 C;  4WU9 D;  3UTA A;  1P3G B;  2HIO A;  4H9S C;  2NZD A;  5E5A B;  5AVC C;  5AVC D;  4X23 C;  4X23 D;  5JA4 A;  3O62 B;  3MGQ C;  3AZJ A;  3MGQ D;  5B0Y B;  1M19 C;  3UT9 B;  1M19 D;  1TZY D;  1U35 A;  5B32 G;  4Z5T C;  4Z5T D;  3WA9 C;  3WA9 D;  4JJN C;  4JJN D;  3REJ A;  3O62 C;  1HQ3 A;  3UT9 C;  3WKJ A;  1H3O B;  1ULY A;  3UTA B;  2NZD B;  2HIO B;  3MNN B;  4DRB A;  5JA4 B;  4NE6 A;  5CPJ D;  4AWL B;  5AV5 D;  3UTA C;  2NZD C;  2HIO C;  3C1B A;  3AZJ C;  3REJ B;  3AZJ D;  2F8N D;  4ZUX A;  1HQ3 B;  2FJ7 A;  3EPH A;  1U35 C;  2Y2H A;  1U35 D;  5AV6 A;  4H9N A;  3KFU G;  1P3L B;  3KXB A;  3AZL A;  3REJ C;  3REJ D;  2Y2I A;  5CPI D;  1HQ3 C;  3WKJ C;  2JSS A;  2L5A A;  3WKJ D;  3X1V A;  3W96 A;  5G49 A;  4YM6 B;  5BO0 A;  3KWQ B;  4H9Q A;  2FJ7 B;  3VH6 A;  3REK A;  5AV6 B;  1ZLA D;  3AN2 A;  4UUZ A;  2JCH A;  3KXB B;  3C1B C;  3C1B D;  3R45 B;  2YFV A;  3MVD A;  2NQB D;  4ZUX C;  4ZUX D;  1P3O B;  2FJ7 C;  3MGR D;  1KX3 A;  5CHL B;  5AV6 C;  1A7W A;  5AV6 D;  3W96 B;  3AZN B;  5BO0 B;  3AZM B;  1W2E A;  3KXB C;  3AZL C;  3KXB D;  3AZL D;  3UTB B;  2ARO B;  3REK B;  4WU8 A;  4KHA B;  3VH6 W;  5BNV B;  3NQU B;  2Y2O A;  4XZQ B;  3X1V C;  3X1V D;  3W96 C;  3P5J B;  4UUZ B;  1EQZ A;  5AV9 A;  3A1I A;  4J8U B;  2Y2J A;  4R8P B;  2YFV B;  4CAY A;  3MVD B;  2XD1 A;  3V9R A;  3REK C;  4EO5 B;  1N1J A;  5DNN A;  3AN2 C;  3AN2 D;  1M1A D;  3W98 B;  4LD9 A;  3MVD C;  3AZK A;  3KUY B;  4KUD A;  5GXQ A;  1KX3 C;  1KX3 D;  3REI A;  1P3M A;  1EQZ B;  5AV9 B;  4CAY B;  4Z66 A;  3V9R B;  3LZ0 B;  1T3U A;  4WV4 B;  4WU8 C;  3AV1 D;  4WU8 D;  1F66 A;  5DNN B;  3LEL A;  1ID3 D;  1EQZ C;  5AV9 C;  4LD9 B;  3AZK B;  3VH6 T;  5DNM D;  1P3M B;  5FUG A;  3F6T A;  4DQY B;  5DNN C;  1P3G A;  4QLC B;  5E5A A;  4J8V B;  4Z66 B;  4LD9 C;  3REH A;  3AZK C;  1P3F B;  1M18 D;  4XUJ B;  4KUD C;  5GXQ C;  5B0Y A;  5GXQ D;  1PZR A;  4J8X B;  4KUD D;  3REI C;  1P3M C;  3REI D;  1KX4 A;  1F66 B;  5GT3 B;  3LEL B;  4WJ3 C;  1KX5 A;  4Z66 C;  5AY8 B;  2ZY4 A;  3REL B;  1P3B A;  2FFF B;  1F66 C;  1F66 D;  3LEL C;  4NE3 A;  3MNN A;  1P3A B;  5KDM B;  2UWX A;  5B24 B;  3REH B;  1HTA A;  3MGS B;  3A6N B;  3EG5 B;  1KX4 B;  3WAA A;  3WTP B;  1P3G C;  1P3G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...