4X23C

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
b'SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 102
sequence length 102
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23C00
5DNND 5GT3B 5BS7A 3X1VB 5AV5C 1F1EA 3UT9C 4Z5TB 4YM6D 3W99A 1S32C 3W97D 3WKJB 5C3IB 1P3LC 3C1BA 2CV5C 2YFWA 3UTBB 3VH5T 3WTPA 1HTAA 3AZHD 4KGCC 3WKJC 5B24D 3UTBC 4X23B 3MGRA 4H9RA 4ZUXD 1AOIA 3B6FB 3AN2C 4KHAB 2PYOC 2F8ND 1P3KA 3AZGD 3B6FC 2L5AA 4WV4B 3W96C 3MGQC 1P3OC 2AROC 3AZFA 5B31D 3B0BA 2HUEC 3MNNA 3LZ0B 4J8VB 3REJB 1F66A 1P3BC 1EQZD 5BT1C 3LELD 3AZIC 5G49A 1H3OA 1BFMA 5CPIB 5CPKB 3AV2D 3LZ0C 4EO5B 4CSRB 1HQ3B 3AYWB 3REJC 3C1CA 3AZKD 1M19B 5AV5A 3UT9A 1B67A 1TAFB 4G92B 1U35A 1ZLAD 1TZYD 3TU4A 4WU9B 1P3PA 4UUZB 5B32C 5B1LD 5AVBA 4XZQD 5CPKC 1ID3C 3MGRD 3MGPD 1HQ3C 5GT3A 5JRGD 3KUYD 3X1VA 3REIC 4Z5TA 3REHD 4KGCA 4WU9C 3WKJA 5B1MD 4YM6B 3UTBA 5B2JC 1P34B 4AWLC 4J8WD 3X1TD 3MNND 5B32G 3AZHB 5B0ZD 5B24B 1P34C 3VH6T 4X23A 3B6FA 4KHAA 5AY8C 2BYKB 2AROA 4ZUXB 3B6GC 5AV5D 3UT9D 2F8NB 1S32D 1BH9B 1P3LD 2CV5D 3AZGB 4G91B 3LZ0A 5B31B 3A6NC 4J8VA 3REJA 4KGCD 5DNMC 3AZJC 3WKJD 1WWIA 4QLCC 3UTBD 3AZGC 3RELD 1EQZB 3LELB 4J8UC 5CPIA 5CPKA 3X1UD 4CSRA 1HQ3A 3AYWA 4H9SA 3AN2D 3AV2B 1M19A 1TAFA 2PYOD 4WU9A 4UUZA 3AZKB 5GSUB 4WU8B 4CAYB 1ZLAB 1TZYB 1KX3C 3B6FD 5B1LB 3MGQD 4XZQB 1P3OD 3AV2C 2AROD 3W96D 3MGPB 5JRGB 5GSUC 3KUYB 3AZKC 4WU8C 4E44A 1KX5B 4YM6A 2F8NK 3W98C 1TZYC 3REHB 1P3BD 1M1AC 1P34A 5BT1D 5B1MB 3AZID 4H9QB 4LD9D 4J8WB 3X1TB 1KX5C 3REJD 3AZHA 5B24A 1P3GB 2FJ7C 5B0ZB 5B32D 2BYKA 5CPKD 1ID3D 4ZUXA 3X1TC 5BO0B 3KWQC 3REID 1P3GC 2F8NA 5GT0C 1BH9A 1KU5A 3AZNB 1S32B 3AZGA 5B2JD 1P3LB 2CV5B 5B31A 3B0DB 4WNNB 3LJAD 3AZNC 4KGCB 1P3IC 1EQZA 3LELA 1P34D 1WWSA 5GXQC 5E5AB 3RELB 3AZED 3WA9B 5AY8D 3B0DC 3AV2A 3LZ1C 3X1UB 2NQBB 3AN2B 3B6GD 3AZKA 5GSUA 4WU8A 4JJNC 4CAYA 5E5AC 2PYOB 1ZLAA 1TZYA 3RELC 5B1LA 4R8PB 4XZQA 3WA9C 2YFVB 3X1UC 3MGPA 5F99D 2NQBC 3MGQB 1P3OB 3W96B 2AROB 5JRGA 3KUYA 4H9PB 3A6ND 1KX5A 3REHA 2HUEB 5DNMD 4DRBA 3AZJD 2HIOD 4R8PC 5B1MA 3MGSD 4H9QA 4QLCD 1P3MC 1P3BB 3KXBB 3REKB 4YS3C 4J8UD 3AZIB 4J8WA 3X1TA 4LD9B 2F8NH 1P3GA 5B0ZA 3KXBC 3REKC 3B0CT 2JSSA 1KX3D 5BNVB 4LD9C 5B32B 3AV1D 5BO0A 1ID3B 4J8XB 3W98D 5GSUD 4WU8D 3REIB 3VH5W 1A7WA 3V9RB 3AZNA 3AFAD 5B2IC 1S32A 1M1AD 3WAAB 1P3LA 2CV5A 1P3AB 5B2JB 4J8XC 4WNNA 4AWLB 5CP6D 1KX5D 3WAAC 2BYMB 4H9NB 2FJ7D 5E5AA 3LJAB 1P3AC 4KUDB 4E45A 3RELA 1Q9CA 3WA9A 3UTAC 3X1UA 1P3FB 2NQBA 3AN2A 3AZEB 5AY8B 3KWQD 2LY8A 5AV8C 5B0YC 1P3GD 2PYOA 3LJAC 3MVDC 3B6GB 5GT0D 4KUDC 4R8PA 2IO5C 2YFVA 1P3FC 3AZEC 3W96A 3MGQA 1P3OA 4H9PA 5F99B 3O62C 3A6NB 3AZND 1P3BA 3KXBA 5DNMB 3REKA 3AZJB 2HIOB 5GXQD 3MGSB 3AZIA 1P3ID 2RVQD 4QLCB 4LD9A 5F99C 4J8UB 3LZ1D 4JJND 2HIOC 3MGSC 5E5AD 4ZBJC 5BNVA 5B32A 3WA9D 1ID3A 2NQBD 1KX3B 4J8XA 3AV1B 3AZLC 3REIA 3V9RA 3WAAA 4NE6A 4XUJC 3W98B 4Z2MG 4R8PD 1P3AA 3AFAB 5AVCC 1P3MD 1M1AB 5B2JA 4YS3D 4WZSB 3AV1C 3VH6W 2BYMA 4H9NA 3AZMB 3R45B 5CP6B 3LJAA 3AFAC 4KUDA 1KX4C 2NZDB 3KXBD 3REKD 2FJ7B 1P3FA 3AZEA 5CPJC 5AY8A 5AV6B 3AZMC 5CP6C 3B6GA 3KWQB 5AV9C 2NZDC 3W99C 5B2ID 5GT0B 5AV6C 4HGAC 5F99A 4J8XD 1R4VA 3WTPC 3A6NA 3WAAD 1BH8B 5DNMA 3AZJA 2HIOA 3MGSA 1P3AD 4QLCA 3NQJB 1P3IB 4J8UA 5FUGB 5GXQB 3UTAD 1AOIC 3NQUB 5AV8D 5B0YD 4Z66D 5B40B 3LZ1B 3MVDD 4KUDD 4NE5A 1P3KC 5JA4B 4JJNB 1P3FD 2RVQC 1KX3A 3AV1A 1M18B 5KDMB 5B40C 3AZFC 3O62D 3W98A 3AFAA 1F66C 1M1AA 1M18C 1P3MB 5CHLB 4YS3B 3AZMA 3R45A 5CP6A 5AV9A 3C1CC 2NZDA 2FJ7A 1U35C 1ULYA 4Z2MH 3TU4C 1P3PC 5AV6A 5AVBC 3KWQA 5GT3C 3AZLD 3X1VC 4Z5TC 5GT0A 4XUJD 5C3IC 5B2IB 5AVCD 3X1SB 4DRAA 1BH8A 3NQJA 1KX4D 1P3IA 5FUGA 5GXQA 4X23C 3X1SC 5CPJD 3NQUA 3UTAB 1N1JB 5B40A 3LZ1A 3AZMD 5AV8B 4Z66B 5BNXB 5AV9D 5JA4A 5B0YB 4JJNA 2NZDD 3W99D 3MVDB 1M18A 5AV6D 2IO5B 3C1BD 5KDMA 4Z66C 3WTPD 4NFTA 5B33B 4J8VC 4H9OB 3O62B 4NE3A 1P3MA 4YS3A 5CPIC 4EO5C 1AOID 3AYWC 4H9SC 3B0CW 5B33C 1M19C 4G92C 3VH6A 5DNNB 1P3KD 4ZBJB 3W97B 5B40D 3AZFD 5DNNC 3AZLB 1F66D 5B2IA 4YM6C 4XUJB 3W97C 1M18D 5AVCB 3X1SA 3C1CD 3AZHC 5B24C 3KSYA 1U35D 1KX4B 3TU4D 1P3PD 5AVBD 1N1JA 3UTAA 1JFIB 4ZUXC 5CPJB 5GT3D 5AV8A 5BNXA 5B0YA 4Z66A 3X1VD 4Z5TD 3MVDA 5AV9B 3W99B 3C1BB 4G91C 4HGAB 2YFWB 5B31C 5B33A 4H9OA 3O62A 3WTPB 5BS7C 3WTPE 1EQZC 3LELC 3C1BC 4X23D 3X1SD 3MGRB 4H9RB 1AOIB 2F8NG 5DNNA 1B6WA 1ZLAC 3W97A 1P3KB 5B1LC 4XZQC 5B31G 3MGPC 3MGRC 2CWEA 3AZLA 3LZ0D 5JRGC 3KUYC 3AZFB 4J8VD 3REHC 4XUJA 3MNNB 5B1MC 1F66B 5AVCA 5CPID 5G49B 1H3OB 4J8WC 1HQ3D 3AYWD 5B33D 3MNNC 1M19D 1KX4A 4WU9D 3C1CB 5B0ZC 5AV5B 3UT9B 3VH5A 1JFIA 1U35B 3TU4B 1P3PB 5CPJA 5AVBB 4M6BA
chains in the Genus database with same CATH superfamily
5DNND 5GT3B 5BS7A 3X1VB 5AV5C 1F1EA 3UT9C 4Z5TB 4YM6D 3W99A 1S32C 3W97D 3WKJB 5C3IB 1P3LC 3C1BA 2CV5C 2YFWA 3UTBB 1W2EA 3VH5T 4UPKA 3WTPA 1HTAA 3AZHD 4KGCC 3WKJC 5B24D 3UTBC 2XD5A 4X23B 3MGRA 4H9RA 4ZUXD 1AOIA 3B6FB 3AN2C 4KHAB 2PYOC 2F8ND 1P3KA 3AZGD 3B6FC 2L5AA 3H0RC 4WV4B 3W96C 3MGQC 1P3OC 2AROC 3AZFA 5B31D 3B0BA 2HUEC 3MNNA 3LZ0B 4J8VB 3REJB 1F66A 1P3BC 1EQZD 2FFFB 5BT1C 3LELD 2BG1A 3AZIC 5G49A 1H3OA 1BFMA 5CPIB 5CPKB 3AV2D 3LZ0C 4EO5B 4CSRB 1HQ3B 3AYWB 3REJC 3C1CA 3AZKD 1M19B 5AV5A 3UT9A 1B67A 1TAFB 4G92B 1U35A 1ZLAD 1TZYD 3TU4A 4WU9B 1P3PA 4UUZB 5B32C 5B1LD 5AVBA 4XZQD 5CPKC 1ID3C 3MGRD 3MGPD 1HQ3C 5GT3A 5JRGD 3KUYD 3X1VA 3REIC 4Z5TA 3REHD 4KGCA 4WU9C 3WKJA 5B1MD 4YM6B 3UTBA 5B2JC 1P34B 4AWLC 4J8WD 3X1TD 3MNND 5B32G 3AZHB 5B0ZD 5B24B 1P34C 3VH6T 4X23A 3B6FA 4KHAA 5AY8C 2BYKB 2AROA 4ZUXB 2ZY4A 3B6GC 2Y2QA 5AV5D 3H0MC 3UT9D 2XD1A 2F8NB 3EPKA 1S32D 1BH9B 1P3LD 2CV5D 3AZGB 4G91B 3LZ0A 5B31B 3A6NC 4DQYB 4J8VA 3REJA 4KGCD 5DNMC 3AZJC 3WKJD 1WWIA 4QLCC 3UTBD 3AZGC 3RELD 1EQZB 3LELB 4J8UC 5CPIA 5CPKA 3X1UD 4CSRA 1HQ3A 1PZRA 4H9SA 3AYWA 3AN2D 3AV2B 1M19A 1TAFA 2PYOD 4WU9A 4UUZA 3AZKB 5GSUB 4WU8B 4CAYB 1ZLAB 1TZYB 2ZM5A 1KX3C 3B6FD 5B1LB 3MGQD 4XZQB 1P3OD 3A1KA 2AROD 3AV2C 3W96D 3MGPB 5JRGB 5GSUC 3KUYB 3AZKC 4WU8C 4E44A 1KX5B 4YM6A 2F8NK 3W98C 1TZYC 3REHB 1P3BD 1M1AC 1P34A 5BT1D 5B1MB 3H0LC 3AZID 4H9QB 4LD9D 2UWXA 4J8WB 3X1TB 1KX5C 3A1IA 3REJD 3AZHA 1Z2CB 5B24A 1P3GB 2FJ7C 5B0ZB 5B32D 2BYKA 5CPKD 1ID3D 4ZUXA 3X1TC 5BO0B 3KWQC 3REID 1P3GC 2F8NA 5GT0C 1BH9A 1KU5A 3AZNB 1S32B 3AZGA 5B2JD 1P3LB 2CV5B 5B31A 2Y2MA 3B0DB 4WNNB 2ZY5A 3LJAD 3AZNC 4KGCB 1P3IC 1EQZA 3LELA 1P34D 1WWSA 5GXQC 5E5AB 3RELB 3AZED 3WA9B 5AY8D 3B0DC 3AV2A 3LZ1C 3X1UB 2NQBB 3AN2B 3B6GD 3AZKA 5GSUA 4WU8A 4JJNC 4CAYA 5E5AC 2PYOB 1ZLAA 1TZYA 3P5JB 3RELC 5B1LA 4R8PB 4XZQA 3WA9C 2YFVB 3X1UC 3MGPA 5F99D 2NQBC 3MGQB 1P3OB 3W96B 2AROB 5JRGA 3KUYA 4H9PB 3A6ND 1KX5A 3REHA 2HUEB 5DNMD 4DRBA 3AZJD 2HIOD 4R8PC 5B1MA 3MGSD 4H9QA 4QLCD 1P3MC 1P3BB 2W8SA 3KXBB 4YS3C 4J8UD 3REKB 3AZIB 4J8WA 3X1TA 4LD9B 2F8NH 1P3GA 2Y2JA 3F6TA 5B0ZA 3KXBC 3REKC 3B0CT 2JSSA 1KX3D 5BNVB 4LD9C 5B32B 3AV1D 5BO0A 2F2AC 1ID3B 4J8XB 3W98D 5GSUD 4WU8D 3REIB 3VH5W 1A7WA 3V9RB 3AZNA 3AFAD 5B2IC 1S32A 1M1AD 3WAAB 1P3LA 2CV5A 1P3AB 5B2JB 4J8XC 4WNNA 4AWLB 5CP6D 1KX5D 3WAAC 2BYMB 2Y2PA 4H9NB 2FJ7D 5E5AA 3LJAB 1P3AC 4KUDB 4E45A 3RELA 1Q9CA 3WA9A 3UTAC 2G5HC 3X1UA 1P3FB 2NQBA 3AN2A 3AZEB 5AY8B 3KWQD 5B0YC 2LY8A 5AV8C 1P3GD 2PYOA 3LJAC 3MVDC 3B6GB 2DQNC 5GT0D 4KUDC 3FDDA 4R8PA 2IO5C 2YFVA 1P3FC 3AZEC 3W96A 3MGQA 1P3OA 4H9PA 5F99B 3O62C 3A6NB 3AZND 1P3BA 3KXBA 5DNMB 3REKA 3AZJB 2HIOB 5GXQD 3MGSB 3AZIA 1P3ID 2RVQD 4QLCB 4LD9A 5F99C 4J8UB 3LZ1D 3KFUG 4JJND 2HIOC 3MGSC 5E5AD 4ZBJC 5BNVA 5B32A 3WA9D 1ID3A 2NQBD 1KX3B 4J8XA 3AV1B 3AZLC 3REIA 3V9RA 3WAAA 4NE6A 4XUJC 3W98B 4Z2MG 4R8PD 1P3AA 3AFAB 5AVCC 1P3MD 1M1AB 5B2JA 4YS3D 4WZSB 3AV1C 3VH6W 2BYMA 4H9NA 3AZMB 3R45B 5CP6B 3LJAA 3AFAC 4KUDA 1KX4C 2NZDB 3KXBD 3REKD 2FJ7B 1P3FA 3AZEA 5CPJC 5AY8A 5AV6B 3AZMC 5CP6C 3B6GA 3EPJA 3KWQB 5AV9C 2NZDC 3W99C 5B2ID 5GT0B 5AV6C 4HGAC 5F99A 2JE5A 4J8XD 1R4VA 3WTPC 3A6NA 3WAAD 1BH8B 2DF4C 5DNMA 3EPLA 2HIOA 3MGSA 3AZJA 1P3AD 4QLCA 3NQJB 1P3IB 4J8UA 5FUGB 5GXQB 3UTAD 1AOIC 2ZY3A 3NQUB 5AV8D 5B0YD 4Z66D 5B40B 3LZ1B 2VQRA 3MVDD 4KUDD 4NE5A 1P3KC 5JA4B 4JJNB 1P3FD 2RVQC 1KX3A 3AV1A 1M18B 5KDMB 5B40C 3AZFC 3O62D 3W98A 3AFAA 1F66C 1M1AA 1M18C 2Y2HA 1P3MB 5CHLB 4YS3B 3AZMA 3R45A 5CP6A 5AV9A 3C1CC 2NZDA 2FJ7A 1U35C 1ULYA 4Z2MH 3TU4C 1P3PC 5AV6A 5AVBC 3KWQA 5GT3C 3AZLD 3X1VC 4Z5TC 5GT0A 2RIQA 4XUJD 5C3IC 5B2IB 5AVCD 3X1SB 4DRAA 1BH8A 3NQJA 1KX4D 1P3IA 5FUGA 5GXQA 4X23C 3X1SC 3IP4C 5CPJD 3NQUA 3UTAB 1N1JB 5B40A 3LZ1A 3AZMD 5AV8B 4Z66B 5BNXB 5AV9D 5JA4A 5B0YB 4JJNA 2NZDD 3W99D 3MVDB 2G5IC 1M18A 5AV6D 2IO5B 3C1BD 5KDMA 4Z66C 3WTPD 2JCHA 4NFTA 5B33B 4J8VC 4H9OB 3O62B 4NE3A 4WJ3C 1P3MA 4YS3A 5CPIC 4EO5C 1AOID 3AYWC 4H9SC 3B0CW 5B33C 1M19C 4G92C 3VH6A 5DNNB 1P3KD 4ZBJB 3W97B 5B40D 3AZFD 5DNNC 3AZLB 1T3UA 1F66D 5B2IA 4YM6C 4XUJB 3W97C 1M18D 5AVCB 3X1SA 2Y2KA 3C1CD 3AZHC 5B24C 3KSYA 1U35D 1KX4B 3TU4D 1P3PD 5AVBD 1N1JA 3UTAA 1JFIB 4ZUXC 5CPJB 5GT3D 5AV8A 5BNXA 5B0YA 4Z66A 3X1VD 4Z5TD 3MVDA 5AV9B 3W99B 3C1BB 4G91C 4HGAB 2Y2LA 2YFWB 5B31C 5B33A 4H9OA 3O62A 3WTPB 5BS7C 3WTPE 1EQZC 3LELC 3C1BC 4X23D 3X1SD 3EPHA 3MGRB 4H9RB 1AOIB 2F8NG 5DNNA 1B6WA 1ZLAC 3W97A 1P3KB 5B1LC 4XZQC 5B31G 3MGPC 3MGRC 2CWEA 3AL0C 3AZLA 3LZ0D 5JRGC 3KUYC 3AZFB 4J8VD 2Y2GA 3REHC 4XUJA 3MNNB 5B1MC 1F66B 5AVCA 5CPID 5G49B 1H3OB 4J8WC 1HQ3D 3AYWD 5B33D 2Y2IA 3MNNC 1M19D 2J8PA 2Y2OA 1KX4A 4WU9D 3C1CB 5B0ZC 2Y2NA 5AV5B 3UT9B 3VH5A 1JFIA 2ZY2A 1U35B 3TU4B 1P3PB 3EG5B 5CPJA 5AVBB 4M6BA
chains in the Genus database with same CATH topology
5DNND 5GT3B 5BS7A 3X1VB 5AV5C 1F1EA 3UT9C 4Z5TB 4YM6D 3W99A 1S32C 3W97D 3WKJB 5C3IB 1P3LC 3C1BA 2CV5C 2YFWA 3UTBB 1W2EA 3VH5T 4UPKA 3WTPA 1HTAA 3AZHD 4KGCC 3WKJC 5B24D 3UTBC 2XD5A 4X23B 3MGRA 4H9RA 4ZUXD 1AOIA 3B6FB 3AN2C 4KHAB 2PYOC 2F8ND 1P3KA 3AZGD 3B6FC 2L5AA 3H0RC 4WV4B 3W96C 3MGQC 1P3OC 2AROC 3AZFA 5B31D 3B0BA 2HUEC 3MNNA 3LZ0B 4J8VB 3REJB 1F66A 1P3BC 1EQZD 2FFFB 5BT1C 3LELD 2BG1A 3AZIC 5G49A 1H3OA 1BFMA 5CPIB 5CPKB 3AV2D 3LZ0C 4EO5B 4CSRB 1HQ3B 3AYWB 3REJC 3C1CA 3AZKD 1M19B 5AV5A 3UT9A 1B67A 1TAFB 4G92B 1U35A 1ZLAD 1TZYD 3TU4A 4WU9B 1P3PA 4UUZB 5B32C 5B1LD 5AVBA 4XZQD 5CPKC 1ID3C 3MGRD 3MGPD 1HQ3C 5GT3A 5JRGD 3KUYD 3X1VA 3REIC 4Z5TA 3REHD 4KGCA 4WU9C 3WKJA 5B1MD 4YM6B 3UTBA 5B2JC 1P34B 4AWLC 4J8WD 3X1TD 3MNND 5B32G 3AZHB 5B0ZD 5B24B 1P34C 3VH6T 4X23A 3B6FA 4KHAA 5AY8C 2BYKB 2AROA 4ZUXB 2ZY4A 3B6GC 2Y2QA 5AV5D 3H0MC 3UT9D 2XD1A 2F8NB 3EPKA 1S32D 1BH9B 1P3LD 2CV5D 3AZGB 4G91B 3LZ0A 5B31B 3A6NC 4DQYB 4J8VA 3REJA 4KGCD 5DNMC 3AZJC 3WKJD 1WWIA 4QLCC 3UTBD 3AZGC 3RELD 1EQZB 3LELB 4J8UC 5CPIA 5CPKA 3X1UD 4CSRA 1HQ3A 1PZRA 4H9SA 3AYWA 3AN2D 3AV2B 1M19A 1TAFA 2PYOD 4WU9A 4UUZA 3AZKB 5GSUB 4WU8B 4CAYB 1ZLAB 1TZYB 2ZM5A 1KX3C 3B6FD 5B1LB 3MGQD 4XZQB 1P3OD 3A1KA 2AROD 3AV2C 3W96D 3MGPB 5JRGB 5GSUC 3KUYB 3AZKC 4WU8C 4E44A 1KX5B 4YM6A 2F8NK 3W98C 1TZYC 3REHB 1P3BD 1M1AC 1P34A 5BT1D 5B1MB 3H0LC 3AZID 4H9QB 4LD9D 2UWXA 4J8WB 3X1TB 1KX5C 3A1IA 3REJD 3AZHA 1Z2CB 5B24A 1P3GB 2FJ7C 5B0ZB 5B32D 2BYKA 5CPKD 1ID3D 4ZUXA 3X1TC 5BO0B 3KWQC 3REID 1P3GC 2F8NA 5GT0C 1BH9A 1KU5A 3AZNB 1S32B 3AZGA 5B2JD 1P3LB 2CV5B 5B31A 2Y2MA 3B0DB 4WNNB 2ZY5A 3LJAD 3AZNC 4KGCB 1P3IC 1EQZA 3LELA 1P34D 1WWSA 5GXQC 5E5AB 3RELB 3AZED 3WA9B 5AY8D 3B0DC 3AV2A 3LZ1C 3X1UB 2NQBB 3AN2B 3B6GD 3AZKA 5GSUA 4WU8A 4JJNC 4CAYA 5E5AC 2PYOB 1ZLAA 1TZYA 3P5JB 3RELC 5B1LA 4R8PB 4XZQA 3WA9C 2YFVB 3X1UC 3MGPA 5F99D 2NQBC 3MGQB 1P3OB 3W96B 2AROB 5JRGA 3KUYA 4H9PB 3A6ND 1KX5A 3REHA 2HUEB 5DNMD 4DRBA 3AZJD 2HIOD 4R8PC 5B1MA 3MGSD 4H9QA 4QLCD 1P3MC 1P3BB 2W8SA 3KXBB 4YS3C 4J8UD 3REKB 3AZIB 4J8WA 3X1TA 4LD9B 2F8NH 1P3GA 2Y2JA 3F6TA 5B0ZA 3KXBC 3REKC 3B0CT 2JSSA 1KX3D 5BNVB 4LD9C 5B32B 3AV1D 5BO0A 2F2AC 1ID3B 4J8XB 3W98D 5GSUD 4WU8D 3REIB 3VH5W 1A7WA 3V9RB 3AZNA 3AFAD 5B2IC 1S32A 1M1AD 3WAAB 1P3LA 2CV5A 1P3AB 5B2JB 4J8XC 4WNNA 4AWLB 5CP6D 1KX5D 3WAAC 2BYMB 2Y2PA 4H9NB 2FJ7D 5E5AA 3LJAB 1P3AC 4KUDB 4E45A 3RELA 1Q9CA 3WA9A 3UTAC 2G5HC 3X1UA 1P3FB 2NQBA 3AN2A 3AZEB 5AY8B 3KWQD 5B0YC 2LY8A 5AV8C 1P3GD 2PYOA 3LJAC 3MVDC 3B6GB 2DQNC 5GT0D 4KUDC 3FDDA 4R8PA 2IO5C 2YFVA 1P3FC 3AZEC 3W96A 3MGQA 1P3OA 4H9PA 5F99B 3O62C 3A6NB 3AZND 1P3BA 3KXBA 5DNMB 3REKA 3AZJB 2HIOB 5GXQD 3MGSB 3AZIA 1P3ID 2RVQD 4QLCB 4LD9A 5F99C 4J8UB 3LZ1D 3KFUG 4JJND 2HIOC 3MGSC 5E5AD 4ZBJC 5BNVA 5B32A 3WA9D 1ID3A 2NQBD 1KX3B 4J8XA 3AV1B 3AZLC 3REIA 3V9RA 3WAAA 4NE6A 4XUJC 3W98B 4Z2MG 4R8PD 1P3AA 3AFAB 5AVCC 1P3MD 1M1AB 5B2JA 4YS3D 4WZSB 3AV1C 3VH6W 2BYMA 4H9NA 3AZMB 3R45B 5CP6B 3LJAA 3AFAC 4KUDA 1KX4C 2NZDB 3KXBD 3REKD 2FJ7B 1P3FA 3AZEA 5CPJC 5AY8A 5AV6B 3AZMC 5CP6C 3B6GA 3EPJA 3KWQB 5AV9C 2NZDC 3W99C 5B2ID 5GT0B 5AV6C 4HGAC 5F99A 2JE5A 4J8XD 1R4VA 3WTPC 3A6NA 3WAAD 1BH8B 2DF4C 5DNMA 3EPLA 2HIOA 3MGSA 3AZJA 1P3AD 4QLCA 3NQJB 1P3IB 4J8UA 5FUGB 5GXQB 3UTAD 1AOIC 2ZY3A 3NQUB 5AV8D 5B0YD 4Z66D 5B40B 3LZ1B 2VQRA 3MVDD 4KUDD 4NE5A 1P3KC 5JA4B 4JJNB 1P3FD 2RVQC 1KX3A 3AV1A 1M18B 5KDMB 5B40C 3AZFC 3O62D 3W98A 3AFAA 1F66C 1M1AA 1M18C 2Y2HA 1P3MB 5CHLB 4YS3B 3AZMA 3R45A 5CP6A 5AV9A 3C1CC 2NZDA 2FJ7A 1U35C 1ULYA 4Z2MH 3TU4C 1P3PC 5AV6A 5AVBC 3KWQA 5GT3C 3AZLD 3X1VC 4Z5TC 5GT0A 2RIQA 4XUJD 5C3IC 5B2IB 5AVCD 3X1SB 4DRAA 1BH8A 3NQJA 1KX4D 1P3IA 5FUGA 5GXQA 4X23C 3X1SC 3IP4C 5CPJD 3NQUA 3UTAB 1N1JB 5B40A 3LZ1A 3AZMD 5AV8B 4Z66B 5BNXB 5AV9D 5JA4A 5B0YB 4JJNA 2NZDD 3W99D 3MVDB 2G5IC 1M18A 5AV6D 2IO5B 3C1BD 5KDMA 4Z66C 3WTPD 2JCHA 4NFTA 5B33B 4J8VC 4H9OB 3O62B 4NE3A 4WJ3C 1P3MA 4YS3A 5CPIC 4EO5C 1AOID 3AYWC 4H9SC 3B0CW 5B33C 1M19C 4G92C 3VH6A 5DNNB 1P3KD 4ZBJB 3W97B 5B40D 3AZFD 5DNNC 3AZLB 1T3UA 1F66D 5B2IA 4YM6C 4XUJB 3W97C 1M18D 5AVCB 3X1SA 2Y2KA 3C1CD 3AZHC 5B24C 3KSYA 1U35D 1KX4B 3TU4D 1P3PD 5AVBD 1N1JA 3UTAA 1JFIB 4ZUXC 5CPJB 5GT3D 5AV8A 5BNXA 5B0YA 4Z66A 3X1VD 4Z5TD 3MVDA 5AV9B 3W99B 3C1BB 4G91C 4HGAB 2Y2LA 2YFWB 5B31C 5B33A 4H9OA 3O62A 3WTPB 5BS7C 3WTPE 1EQZC 3LELC 3C1BC 4X23D 3X1SD 3EPHA 3MGRB 4H9RB 1AOIB 2F8NG 5DNNA 1B6WA 1ZLAC 3W97A 1P3KB 5B1LC 4XZQC 5B31G 3MGPC 3MGRC 2CWEA 3AL0C 3AZLA 3LZ0D 5JRGC 3KUYC 3AZFB 4J8VD 2Y2GA 3REHC 4XUJA 3MNNB 5B1MC 1F66B 5AVCA 5CPID 5G49B 1H3OB 4J8WC 1HQ3D 3AYWD 5B33D 2Y2IA 3MNNC 1M19D 2J8PA 2Y2OA 1KX4A 4WU9D 3C1CB 5B0ZC 2Y2NA 5AV5B 3UT9B 3VH5A 1JFIA 2ZY2A 1U35B 3TU4B 1P3PB 3EG5B 5CPJA 5AVBB 4M6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN D;  5GT3 B;  5BS7 A;  3X1V B;  5AV5 C;  1F1E A;  3UT9 C;  4Z5T B;  4YM6 D;  3W99 A;  1S32 C;  3W97 D;  3WKJ B;  5C3I B;  1P3L C;  3C1B A;  2CV5 C;  2YFW A;  3UTB B;  3VH5 T;  3WTP A;  1HTA A;  3AZH D;  4KGC C;  3WKJ C;  5B24 D;  3UTB C;  4X23 B;  3MGR A;  4H9R A;  4ZUX D;  1AOI A;  3B6F B;  3AN2 C;  4KHA B;  2PYO C;  2F8N D;  1P3K A;  3AZG D;  3B6F C;  2L5A A;  4WV4 B;  3W96 C;  3MGQ C;  1P3O C;  2ARO C;  3AZF A;  5B31 D;  3B0B A;  2HUE C;  3MNN A;  3LZ0 B;  4J8V B;  3REJ B;  1F66 A;  1P3B C;  1EQZ D;  5BT1 C;  3LEL D;  3AZI C;  5G49 A;  1H3O A;  1BFM A;  5CPI B;  5CPK B;  3AV2 D;  3LZ0 C;  4EO5 B;  4CSR B;  1HQ3 B;  3AYW B;  3REJ C;  3C1C A;  3AZK D;  1M19 B;  5AV5 A;  3UT9 A;  1B67 A;  1TAF B;  4G92 B;  1U35 A;  1ZLA D;  1TZY D;  3TU4 A;  4WU9 B;  1P3P A;  4UUZ B;  5B32 C;  5B1L D;  5AVB A;  4XZQ D;  5CPK C;  1ID3 C;  3MGR D;  3MGP D;  1HQ3 C;  5GT3 A;  5JRG D;  3KUY D;  3X1V A;  3REI C;  4Z5T A;  3REH D;  4KGC A;  4WU9 C;  3WKJ A;  5B1M D;  4YM6 B;  3UTB A;  5B2J C;  1P34 B;  4AWL C;  4J8W D;  3X1T D;  3MNN D;  5B32 G;  3AZH B;  5B0Z D;  5B24 B;  1P34 C;  3VH6 T;  4X23 A;  3B6F A;  4KHA A;  5AY8 C;  2BYK B;  2ARO A;  4ZUX B;  3B6G C;  5AV5 D;  3UT9 D;  2F8N B;  1S32 D;  1BH9 B;  1P3L D;  2CV5 D;  3AZG B;  4G91 B;  3LZ0 A;  5B31 B;  3A6N C;  4J8V A;  3REJ A;  4KGC D;  5DNM C;  3AZJ C;  3WKJ D;  1WWI A;  4QLC C;  3UTB D;  3AZG C;  3REL D;  1EQZ B;  3LEL B;  4J8U C;  5CPI A;  5CPK A;  3X1U D;  4CSR A;  1HQ3 A;  3AYW A;  4H9S A;  3AN2 D;  3AV2 B;  1M19 A;  1TAF A;  2PYO D;  4WU9 A;  4UUZ A;  3AZK B;  5GSU B;  4WU8 B;  4CAY B;  1ZLA B;  1TZY B;  1KX3 C;  3B6F D;  5B1L B;  3MGQ D;  4XZQ B;  1P3O D;  3AV2 C;  2ARO D;  3W96 D;  3MGP B;  5JRG B;  5GSU C;  3KUY B;  3AZK C;  4WU8 C;  4E44 A;  1KX5 B;  4YM6 A;  2F8N K;  3W98 C;  1TZY C;  3REH B;  1P3B D;  1M1A C;  1P34 A;  5BT1 D;  5B1M B;  3AZI D;  4H9Q B;  4LD9 D;  4J8W B;  3X1T B;  1KX5 C;  3REJ D;  3AZH A;  5B24 A;  1P3G B;  2FJ7 C;  5B0Z B;  5B32 D;  2BYK A;  5CPK D;  1ID3 D;  4ZUX A;  3X1T C;  5BO0 B;  3KWQ C;  3REI D;  1P3G C;  2F8N A;  5GT0 C;  1BH9 A;  1KU5 A;  3AZN B;  1S32 B;  3AZG A;  5B2J D;  1P3L B;  2CV5 B;  5B31 A;  3B0D B;  4WNN B;  3LJA D;  3AZN C;  4KGC B;  1P3I C;  1EQZ A;  3LEL A;  1P34 D;  1WWS A;  5GXQ C;  5E5A B;  3REL B;  3AZE D;  3WA9 B;  5AY8 D;  3B0D C;  3AV2 A;  3LZ1 C;  3X1U B;  2NQB B;  3AN2 B;  3B6G D;  3AZK A;  5GSU A;  4WU8 A;  4JJN C;  4CAY A;  5E5A C;  2PYO B;  1ZLA A;  1TZY A;  3REL C;  5B1L A;  4R8P B;  4XZQ A;  3WA9 C;  2YFV B;  3X1U C;  3MGP A;  5F99 D;  2NQB C;  3MGQ B;  1P3O B;  3W96 B;  2ARO B;  5JRG A;  3KUY A;  4H9P B;  3A6N D;  1KX5 A;  3REH A;  2HUE B;  5DNM D;  4DRB A;  3AZJ D;  2HIO D;  4R8P C;  5B1M A;  3MGS D;  4H9Q A;  4QLC D;  1P3M C;  1P3B B;  3KXB B;  3REK B;  4YS3 C;  4J8U D;  3AZI B;  4J8W A;  3X1T A;  4LD9 B;  2F8N H;  1P3G A;  5B0Z A;  3KXB C;  3REK C;  3B0C T;  2JSS A;  1KX3 D;  5BNV B;  4LD9 C;  5B32 B;  3AV1 D;  5BO0 A;  1ID3 B;  4J8X B;  3W98 D;  5GSU D;  4WU8 D;  3REI B;  3VH5 W;  1A7W A;  3V9R B;  3AZN A;  3AFA D;  5B2I C;  1S32 A;  1M1A D;  3WAA B;  1P3L A;  2CV5 A;  1P3A B;  5B2J B;  4J8X C;  4WNN A;  4AWL B;  5CP6 D;  1KX5 D;  3WAA C;  2BYM B;  4H9N B;  2FJ7 D;  5E5A A;  3LJA B;  1P3A C;  4KUD B;  4E45 A;  3REL A;  1Q9C A;  3WA9 A;  3UTA C;  3X1U A;  1P3F B;  2NQB A;  3AN2 A;  3AZE B;  5AY8 B;  3KWQ D;  2LY8 A;  5AV8 C;  5B0Y C;  1P3G D;  2PYO A;  3LJA C;  3MVD C;  3B6G B;  5GT0 D;  4KUD C;  4R8P A;  2IO5 C;  2YFV A;  1P3F C;  3AZE C;  3W96 A;  3MGQ A;  1P3O A;  4H9P A;  5F99 B;  3O62 C;  3A6N B;  3AZN D;  1P3B A;  3KXB A;  5DNM B;  3REK A;  3AZJ B;  2HIO B;  5GXQ D;  3MGS B;  3AZI A;  1P3I D;  2RVQ D;  4QLC B;  4LD9 A;  5F99 C;  4J8U B;  3LZ1 D;  4JJN D;  2HIO C;  3MGS C;  5E5A D;  4ZBJ C;  5BNV A;  5B32 A;  3WA9 D;  1ID3 A;  2NQB D;  1KX3 B;  4J8X A;  3AV1 B;  3AZL C;  3REI A;  3V9R A;  3WAA A;  4NE6 A;  4XUJ C;  3W98 B;  4Z2M G;  4R8P D;  1P3A A;  3AFA B;  5AVC C;  1P3M D;  1M1A B;  5B2J A;  4YS3 D;  4WZS B;  3AV1 C;  3VH6 W;  2BYM A;  4H9N A;  3AZM B;  3R45 B;  5CP6 B;  3LJA A;  3AFA C;  4KUD A;  1KX4 C;  2NZD B;  3KXB D;  3REK D;  2FJ7 B;  1P3F A;  3AZE A;  5CPJ C;  5AY8 A;  5AV6 B;  3AZM C;  5CP6 C;  3B6G A;  3KWQ B;  5AV9 C;  2NZD C;  3W99 C;  5B2I D;  5GT0 B;  5AV6 C;  4HGA C;  5F99 A;  4J8X D;  1R4V A;  3WTP C;  3A6N A;  3WAA D;  1BH8 B;  5DNM A;  3AZJ A;  2HIO A;  3MGS A;  1P3A D;  4QLC A;  3NQJ B;  1P3I B;  4J8U A;  5FUG B;  5GXQ B;  3UTA D;  1AOI C;  3NQU B;  5AV8 D;  5B0Y D;  4Z66 D;  5B40 B;  3LZ1 B;  3MVD D;  4KUD D;  4NE5 A;  1P3K C;  5JA4 B;  4JJN B;  1P3F D;  2RVQ C;  1KX3 A;  3AV1 A;  1M18 B;  5KDM B;  5B40 C;  3AZF C;  3O62 D;  3W98 A;  3AFA A;  1F66 C;  1M1A A;  1M18 C;  1P3M B;  5CHL B;  4YS3 B;  3AZM A;  3R45 A;  5CP6 A;  5AV9 A;  3C1C C;  2NZD A;  2FJ7 A;  1U35 C;  1ULY A;  4Z2M H;  3TU4 C;  1P3P C;  5AV6 A;  5AVB C;  3KWQ A;  5GT3 C;  3AZL D;  3X1V C;  4Z5T C;  5GT0 A;  4XUJ D;  5C3I C;  5B2I B;  5AVC D;  3X1S B;  4DRA A;  1BH8 A;  3NQJ A;  1KX4 D;  1P3I A;  5FUG A;  5GXQ A;  4X23 C;  3X1S C;  5CPJ D;  3NQU A;  3UTA B;  1N1J B;  5B40 A;  3LZ1 A;  3AZM D;  5AV8 B;  4Z66 B;  5BNX B;  5AV9 D;  5JA4 A;  5B0Y B;  4JJN A;  2NZD D;  3W99 D;  3MVD B;  1M18 A;  5AV6 D;  2IO5 B;  3C1B D;  5KDM A;  4Z66 C;  3WTP D;  4NFT A;  5B33 B;  4J8V C;  4H9O B;  3O62 B;  4NE3 A;  1P3M A;  4YS3 A;  5CPI C;  4EO5 C;  1AOI D;  3AYW C;  4H9S C;  3B0C W;  5B33 C;  1M19 C;  4G92 C;  3VH6 A;  5DNN B;  1P3K D;  4ZBJ B;  3W97 B;  5B40 D;  3AZF D;  5DNN C;  3AZL B;  1F66 D;  5B2I A;  4YM6 C;  4XUJ B;  3W97 C;  1M18 D;  5AVC B;  3X1S A;  3C1C D;  3AZH C;  5B24 C;  3KSY A;  1U35 D;  1KX4 B;  3TU4 D;  1P3P D;  5AVB D;  1N1J A;  3UTA A;  1JFI B;  4ZUX C;  5CPJ B;  5GT3 D;  5AV8 A;  5BNX A;  5B0Y A;  4Z66 A;  3X1V D;  4Z5T D;  3MVD A;  5AV9 B;  3W99 B;  3C1B B;  4G91 C;  4HGA B;  2YFW B;  5B31 C;  5B33 A;  4H9O A;  3O62 A;  3WTP B;  5BS7 C;  3WTP E;  1EQZ C;  3LEL C;  3C1B C;  4X23 D;  3X1S D;  3MGR B;  4H9R B;  1AOI B;  2F8N G;  5DNN A;  1B6W A;  1ZLA C;  3W97 A;  1P3K B;  5B1L C;  4XZQ C;  5B31 G;  3MGP C;  3MGR C;  2CWE A;  3AZL A;  3LZ0 D;  5JRG C;  3KUY C;  3AZF B;  4J8V D;  3REH C;  4XUJ A;  3MNN B;  5B1M C;  1F66 B;  5AVC A;  5CPI D;  5G49 B;  1H3O B;  4J8W C;  1HQ3 D;  3AYW D;  5B33 D;  3MNN C;  1M19 D;  1KX4 A;  4WU9 D;  3C1C B;  5B0Z C;  5AV5 B;  3UT9 B;  3VH5 A;  1JFI A;  1U35 B;  3TU4 B;  1P3P B;  5CPJ A;  5AVB B;  4M6B A; 
#chains in the Genus database with same CATH topology
 5DNN D;  5GT3 B;  5BS7 A;  3X1V B;  5AV5 C;  1F1E A;  3UT9 C;  4Z5T B;  4YM6 D;  3W99 A;  1S32 C;  3W97 D;  3WKJ B;  5C3I B;  1P3L C;  3C1B A;  2CV5 C;  2YFW A;  3UTB B;  1W2E A;  3VH5 T;  4UPK A;  3WTP A;  1HTA A;  3AZH D;  4KGC C;  3WKJ C;  5B24 D;  3UTB C;  2XD5 A;  4X23 B;  3MGR A;  4H9R A;  4ZUX D;  1AOI A;  3B6F B;  3AN2 C;  4KHA B;  2PYO C;  2F8N D;  1P3K A;  3AZG D;  3B6F C;  2L5A A;  3H0R C;  4WV4 B;  3W96 C;  3MGQ C;  1P3O C;  2ARO C;  3AZF A;  5B31 D;  3B0B A;  2HUE C;  3MNN A;  3LZ0 B;  4J8V B;  3REJ B;  1F66 A;  1P3B C;  1EQZ D;  2FFF B;  5BT1 C;  3LEL D;  2BG1 A;  3AZI C;  5G49 A;  1H3O A;  1BFM A;  5CPI B;  5CPK B;  3AV2 D;  3LZ0 C;  4EO5 B;  4CSR B;  1HQ3 B;  3AYW B;  3REJ C;  3C1C A;  3AZK D;  1M19 B;  5AV5 A;  3UT9 A;  1B67 A;  1TAF B;  4G92 B;  1U35 A;  1ZLA D;  1TZY D;  3TU4 A;  4WU9 B;  1P3P A;  4UUZ B;  5B32 C;  5B1L D;  5AVB A;  4XZQ D;  5CPK C;  1ID3 C;  3MGR D;  3MGP D;  1HQ3 C;  5GT3 A;  5JRG D;  3KUY D;  3X1V A;  3REI C;  4Z5T A;  3REH D;  4KGC A;  4WU9 C;  3WKJ A;  5B1M D;  4YM6 B;  3UTB A;  5B2J C;  1P34 B;  4AWL C;  4J8W D;  3X1T D;  3MNN D;  5B32 G;  3AZH B;  5B0Z D;  5B24 B;  1P34 C;  3VH6 T;  4X23 A;  3B6F A;  4KHA A;  5AY8 C;  2BYK B;  2ARO A;  4ZUX B;  2ZY4 A;  3B6G C;  2Y2Q A;  5AV5 D;  3H0M C;  3UT9 D;  2XD1 A;  2F8N B;  3EPK A;  1S32 D;  1BH9 B;  1P3L D;  2CV5 D;  3AZG B;  4G91 B;  3LZ0 A;  5B31 B;  3A6N C;  4DQY B;  4J8V A;  3REJ A;  4KGC D;  5DNM C;  3AZJ C;  3WKJ D;  1WWI A;  4QLC C;  3UTB D;  3AZG C;  3REL D;  1EQZ B;  3LEL B;  4J8U C;  5CPI A;  5CPK A;  3X1U D;  4CSR A;  1HQ3 A;  1PZR A;  4H9S A;  3AYW A;  3AN2 D;  3AV2 B;  1M19 A;  1TAF A;  2PYO D;  4WU9 A;  4UUZ A;  3AZK B;  5GSU B;  4WU8 B;  4CAY B;  1ZLA B;  1TZY B;  2ZM5 A;  1KX3 C;  3B6F D;  5B1L B;  3MGQ D;  4XZQ B;  1P3O D;  3A1K A;  2ARO D;  3AV2 C;  3W96 D;  3MGP B;  5JRG B;  5GSU C;  3KUY B;  3AZK C;  4WU8 C;  4E44 A;  1KX5 B;  4YM6 A;  2F8N K;  3W98 C;  1TZY C;  3REH B;  1P3B D;  1M1A C;  1P34 A;  5BT1 D;  5B1M B;  3H0L C;  3AZI D;  4H9Q B;  4LD9 D;  2UWX A;  4J8W B;  3X1T B;  1KX5 C;  3A1I A;  3REJ D;  3AZH A;  1Z2C B;  5B24 A;  1P3G B;  2FJ7 C;  5B0Z B;  5B32 D;  2BYK A;  5CPK D;  1ID3 D;  4ZUX A;  3X1T C;  5BO0 B;  3KWQ C;  3REI D;  1P3G C;  2F8N A;  5GT0 C;  1BH9 A;  1KU5 A;  3AZN B;  1S32 B;  3AZG A;  5B2J D;  1P3L B;  2CV5 B;  5B31 A;  2Y2M A;  3B0D B;  4WNN B;  2ZY5 A;  3LJA D;  3AZN C;  4KGC B;  1P3I C;  1EQZ A;  3LEL A;  1P34 D;  1WWS A;  5GXQ C;  5E5A B;  3REL B;  3AZE D;  3WA9 B;  5AY8 D;  3B0D C;  3AV2 A;  3LZ1 C;  3X1U B;  2NQB B;  3AN2 B;  3B6G D;  3AZK A;  5GSU A;  4WU8 A;  4JJN C;  4CAY A;  5E5A C;  2PYO B;  1ZLA A;  1TZY A;  3P5J B;  3REL C;  5B1L A;  4R8P B;  4XZQ A;  3WA9 C;  2YFV B;  3X1U C;  3MGP A;  5F99 D;  2NQB C;  3MGQ B;  1P3O B;  3W96 B;  2ARO B;  5JRG A;  3KUY A;  4H9P B;  3A6N D;  1KX5 A;  3REH A;  2HUE B;  5DNM D;  4DRB A;  3AZJ D;  2HIO D;  4R8P C;  5B1M A;  3MGS D;  4H9Q A;  4QLC D;  1P3M C;  1P3B B;  2W8S A;  3KXB B;  4YS3 C;  4J8U D;  3REK B;  3AZI B;  4J8W A;  3X1T A;  4LD9 B;  2F8N H;  1P3G A;  2Y2J A;  3F6T A;  5B0Z A;  3KXB C;  3REK C;  3B0C T;  2JSS A;  1KX3 D;  5BNV B;  4LD9 C;  5B32 B;  3AV1 D;  5BO0 A;  2F2A C;  1ID3 B;  4J8X B;  3W98 D;  5GSU D;  4WU8 D;  3REI B;  3VH5 W;  1A7W A;  3V9R B;  3AZN A;  3AFA D;  5B2I C;  1S32 A;  1M1A D;  3WAA B;  1P3L A;  2CV5 A;  1P3A B;  5B2J B;  4J8X C;  4WNN A;  4AWL B;  5CP6 D;  1KX5 D;  3WAA C;  2BYM B;  2Y2P A;  4H9N B;  2FJ7 D;  5E5A A;  3LJA B;  1P3A C;  4KUD B;  4E45 A;  3REL A;  1Q9C A;  3WA9 A;  3UTA C;  2G5H C;  3X1U A;  1P3F B;  2NQB A;  3AN2 A;  3AZE B;  5AY8 B;  3KWQ D;  5B0Y C;  2LY8 A;  5AV8 C;  1P3G D;  2PYO A;  3LJA C;  3MVD C;  3B6G B;  2DQN C;  5GT0 D;  4KUD C;  3FDD A;  4R8P A;  2IO5 C;  2YFV A;  1P3F C;  3AZE C;  3W96 A;  3MGQ A;  1P3O A;  4H9P A;  5F99 B;  3O62 C;  3A6N B;  3AZN D;  1P3B A;  3KXB A;  5DNM B;  3REK A;  3AZJ B;  2HIO B;  5GXQ D;  3MGS B;  3AZI A;  1P3I D;  2RVQ D;  4QLC B;  4LD9 A;  5F99 C;  4J8U B;  3LZ1 D;  3KFU G;  4JJN D;  2HIO C;  3MGS C;  5E5A D;  4ZBJ C;  5BNV A;  5B32 A;  3WA9 D;  1ID3 A;  2NQB D;  1KX3 B;  4J8X A;  3AV1 B;  3AZL C;  3REI A;  3V9R A;  3WAA A;  4NE6 A;  4XUJ C;  3W98 B;  4Z2M G;  4R8P D;  1P3A A;  3AFA B;  5AVC C;  1P3M D;  1M1A B;  5B2J A;  4YS3 D;  4WZS B;  3AV1 C;  3VH6 W;  2BYM A;  4H9N A;  3AZM B;  3R45 B;  5CP6 B;  3LJA A;  3AFA C;  4KUD A;  1KX4 C;  2NZD B;  3KXB D;  3REK D;  2FJ7 B;  1P3F A;  3AZE A;  5CPJ C;  5AY8 A;  5AV6 B;  3AZM C;  5CP6 C;  3B6G A;  3EPJ A;  3KWQ B;  5AV9 C;  2NZD C;  3W99 C;  5B2I D;  5GT0 B;  5AV6 C;  4HGA C;  5F99 A;  2JE5 A;  4J8X D;  1R4V A;  3WTP C;  3A6N A;  3WAA D;  1BH8 B;  2DF4 C;  5DNM A;  3EPL A;  2HIO A;  3MGS A;  3AZJ A;  1P3A D;  4QLC A;  3NQJ B;  1P3I B;  4J8U A;  5FUG B;  5GXQ B;  3UTA D;  1AOI C;  2ZY3 A;  3NQU B;  5AV8 D;  5B0Y D;  4Z66 D;  5B40 B;  3LZ1 B;  2VQR A;  3MVD D;  4KUD D;  4NE5 A;  1P3K C;  5JA4 B;  4JJN B;  1P3F D;  2RVQ C;  1KX3 A;  3AV1 A;  1M18 B;  5KDM B;  5B40 C;  3AZF C;  3O62 D;  3W98 A;  3AFA A;  1F66 C;  1M1A A;  1M18 C;  2Y2H A;  1P3M B;  5CHL B;  4YS3 B;  3AZM A;  3R45 A;  5CP6 A;  5AV9 A;  3C1C C;  2NZD A;  2FJ7 A;  1U35 C;  1ULY A;  4Z2M H;  3TU4 C;  1P3P C;  5AV6 A;  5AVB C;  3KWQ A;  5GT3 C;  3AZL D;  3X1V C;  4Z5T C;  5GT0 A;  2RIQ A;  4XUJ D;  5C3I C;  5B2I B;  5AVC D;  3X1S B;  4DRA A;  1BH8 A;  3NQJ A;  1KX4 D;  1P3I A;  5FUG A;  5GXQ A;  4X23 C;  3X1S C;  3IP4 C;  5CPJ D;  3NQU A;  3UTA B;  1N1J B;  5B40 A;  3LZ1 A;  3AZM D;  5AV8 B;  4Z66 B;  5BNX B;  5AV9 D;  5JA4 A;  5B0Y B;  4JJN A;  2NZD D;  3W99 D;  3MVD B;  2G5I C;  1M18 A;  5AV6 D;  2IO5 B;  3C1B D;  5KDM A;  4Z66 C;  3WTP D;  2JCH A;  4NFT A;  5B33 B;  4J8V C;  4H9O B;  3O62 B;  4NE3 A;  4WJ3 C;  1P3M A;  4YS3 A;  5CPI C;  4EO5 C;  1AOI D;  3AYW C;  4H9S C;  3B0C W;  5B33 C;  1M19 C;  4G92 C;  3VH6 A;  5DNN B;  1P3K D;  4ZBJ B;  3W97 B;  5B40 D;  3AZF D;  5DNN C;  3AZL B;  1T3U A;  1F66 D;  5B2I A;  4YM6 C;  4XUJ B;  3W97 C;  1M18 D;  5AVC B;  3X1S A;  2Y2K A;  3C1C D;  3AZH C;  5B24 C;  3KSY A;  1U35 D;  1KX4 B;  3TU4 D;  1P3P D;  5AVB D;  1N1J A;  3UTA A;  1JFI B;  4ZUX C;  5CPJ B;  5GT3 D;  5AV8 A;  5BNX A;  5B0Y A;  4Z66 A;  3X1V D;  4Z5T D;  3MVD A;  5AV9 B;  3W99 B;  3C1B B;  4G91 C;  4HGA B;  2Y2L A;  2YFW B;  5B31 C;  5B33 A;  4H9O A;  3O62 A;  3WTP B;  5BS7 C;  3WTP E;  1EQZ C;  3LEL C;  3C1B C;  4X23 D;  3X1S D;  3EPH A;  3MGR B;  4H9R B;  1AOI B;  2F8N G;  5DNN A;  1B6W A;  1ZLA C;  3W97 A;  1P3K B;  5B1L C;  4XZQ C;  5B31 G;  3MGP C;  3MGR C;  2CWE A;  3AL0 C;  3AZL A;  3LZ0 D;  5JRG C;  3KUY C;  3AZF B;  4J8V D;  2Y2G A;  3REH C;  4XUJ A;  3MNN B;  5B1M C;  1F66 B;  5AVC A;  5CPI D;  5G49 B;  1H3O B;  4J8W C;  1HQ3 D;  3AYW D;  5B33 D;  2Y2I A;  3MNN C;  1M19 D;  2J8P A;  2Y2O A;  1KX4 A;  4WU9 D;  3C1C B;  5B0Z C;  2Y2N A;  5AV5 B;  3UT9 B;  3VH5 A;  1JFI A;  2ZY2 A;  1U35 B;  3TU4 B;  1P3P B;  3EG5 B;  5CPJ A;  5AVB B;  4M6B A; 
#chains in the Genus database with same CATH homology
 5DNN D;  5GT3 B;  5BS7 A;  3X1V B;  5AV5 C;  1F1E A;  3UT9 C;  4Z5T B;  4YM6 D;  3W99 A;  1S32 C;  3W97 D;  3WKJ B;  5C3I B;  1P3L C;  3C1B A;  2CV5 C;  2YFW A;  3UTB B;  1W2E A;  3VH5 T;  4UPK A;  3WTP A;  1HTA A;  3AZH D;  4KGC C;  3WKJ C;  5B24 D;  3UTB C;  2XD5 A;  4X23 B;  3MGR A;  4H9R A;  4ZUX D;  1AOI A;  3B6F B;  3AN2 C;  4KHA B;  2PYO C;  2F8N D;  1P3K A;  3AZG D;  3B6F C;  2L5A A;  3H0R C;  4WV4 B;  3W96 C;  3MGQ C;  1P3O C;  2ARO C;  3AZF A;  5B31 D;  3B0B A;  2HUE C;  3MNN A;  3LZ0 B;  4J8V B;  3REJ B;  1F66 A;  1P3B C;  1EQZ D;  2FFF B;  5BT1 C;  3LEL D;  2BG1 A;  3AZI C;  5G49 A;  1H3O A;  1BFM A;  5CPI B;  5CPK B;  3AV2 D;  3LZ0 C;  4EO5 B;  4CSR B;  1HQ3 B;  3AYW B;  3REJ C;  3C1C A;  3AZK D;  1M19 B;  5AV5 A;  3UT9 A;  1B67 A;  1TAF B;  4G92 B;  1U35 A;  1ZLA D;  1TZY D;  3TU4 A;  4WU9 B;  1P3P A;  4UUZ B;  5B32 C;  5B1L D;  5AVB A;  4XZQ D;  5CPK C;  1ID3 C;  3MGR D;  3MGP D;  1HQ3 C;  5GT3 A;  5JRG D;  3KUY D;  3X1V A;  3REI C;  4Z5T A;  3REH D;  4KGC A;  4WU9 C;  3WKJ A;  5B1M D;  4YM6 B;  3UTB A;  5B2J C;  1P34 B;  4AWL C;  4J8W D;  3X1T D;  3MNN D;  5B32 G;  3AZH B;  5B0Z D;  5B24 B;  1P34 C;  3VH6 T;  4X23 A;  3B6F A;  4KHA A;  5AY8 C;  2BYK B;  2ARO A;  4ZUX B;  2ZY4 A;  3B6G C;  2Y2Q A;  5AV5 D;  3H0M C;  3UT9 D;  2XD1 A;  2F8N B;  3EPK A;  1S32 D;  1BH9 B;  1P3L D;  2CV5 D;  3AZG B;  4G91 B;  3LZ0 A;  5B31 B;  3A6N C;  4DQY B;  4J8V A;  3REJ A;  4KGC D;  5DNM C;  3AZJ C;  3WKJ D;  1WWI A;  4QLC C;  3UTB D;  3AZG C;  3REL D;  1EQZ B;  3LEL B;  4J8U C;  5CPI A;  5CPK A;  3X1U D;  4CSR A;  1HQ3 A;  1PZR A;  4H9S A;  3AYW A;  3AN2 D;  3AV2 B;  1M19 A;  1TAF A;  2PYO D;  4WU9 A;  4UUZ A;  3AZK B;  5GSU B;  4WU8 B;  4CAY B;  1ZLA B;  1TZY B;  2ZM5 A;  1KX3 C;  3B6F D;  5B1L B;  3MGQ D;  4XZQ B;  1P3O D;  3A1K A;  2ARO D;  3AV2 C;  3W96 D;  3MGP B;  5JRG B;  5GSU C;  3KUY B;  3AZK C;  4WU8 C;  4E44 A;  1KX5 B;  4YM6 A;  2F8N K;  3W98 C;  1TZY C;  3REH B;  1P3B D;  1M1A C;  1P34 A;  5BT1 D;  5B1M B;  3H0L C;  3AZI D;  4H9Q B;  4LD9 D;  2UWX A;  4J8W B;  3X1T B;  1KX5 C;  3A1I A;  3REJ D;  3AZH A;  1Z2C B;  5B24 A;  1P3G B;  2FJ7 C;  5B0Z B;  5B32 D;  2BYK A;  5CPK D;  1ID3 D;  4ZUX A;  3X1T C;  5BO0 B;  3KWQ C;  3REI D;  1P3G C;  2F8N A;  5GT0 C;  1BH9 A;  1KU5 A;  3AZN B;  1S32 B;  3AZG A;  5B2J D;  1P3L B;  2CV5 B;  5B31 A;  2Y2M A;  3B0D B;  4WNN B;  2ZY5 A;  3LJA D;  3AZN C;  4KGC B;  1P3I C;  1EQZ A;  3LEL A;  1P34 D;  1WWS A;  5GXQ C;  5E5A B;  3REL B;  3AZE D;  3WA9 B;  5AY8 D;  3B0D C;  3AV2 A;  3LZ1 C;  3X1U B;  2NQB B;  3AN2 B;  3B6G D;  3AZK A;  5GSU A;  4WU8 A;  4JJN C;  4CAY A;  5E5A C;  2PYO B;  1ZLA A;  1TZY A;  3P5J B;  3REL C;  5B1L A;  4R8P B;  4XZQ A;  3WA9 C;  2YFV B;  3X1U C;  3MGP A;  5F99 D;  2NQB C;  3MGQ B;  1P3O B;  3W96 B;  2ARO B;  5JRG A;  3KUY A;  4H9P B;  3A6N D;  1KX5 A;  3REH A;  2HUE B;  5DNM D;  4DRB A;  3AZJ D;  2HIO D;  4R8P C;  5B1M A;  3MGS D;  4H9Q A;  4QLC D;  1P3M C;  1P3B B;  2W8S A;  3KXB B;  4YS3 C;  4J8U D;  3REK B;  3AZI B;  4J8W A;  3X1T A;  4LD9 B;  2F8N H;  1P3G A;  2Y2J A;  3F6T A;  5B0Z A;  3KXB C;  3REK C;  3B0C T;  2JSS A;  1KX3 D;  5BNV B;  4LD9 C;  5B32 B;  3AV1 D;  5BO0 A;  2F2A C;  1ID3 B;  4J8X B;  3W98 D;  5GSU D;  4WU8 D;  3REI B;  3VH5 W;  1A7W A;  3V9R B;  3AZN A;  3AFA D;  5B2I C;  1S32 A;  1M1A D;  3WAA B;  1P3L A;  2CV5 A;  1P3A B;  5B2J B;  4J8X C;  4WNN A;  4AWL B;  5CP6 D;  1KX5 D;  3WAA C;  2BYM B;  2Y2P A;  4H9N B;  2FJ7 D;  5E5A A;  3LJA B;  1P3A C;  4KUD B;  4E45 A;  3REL A;  1Q9C A;  3WA9 A;  3UTA C;  2G5H C;  3X1U A;  1P3F B;  2NQB A;  3AN2 A;  3AZE B;  5AY8 B;  3KWQ D;  5B0Y C;  2LY8 A;  5AV8 C;  1P3G D;  2PYO A;  3LJA C;  3MVD C;  3B6G B;  2DQN C;  5GT0 D;  4KUD C;  3FDD A;  4R8P A;  2IO5 C;  2YFV A;  1P3F C;  3AZE C;  3W96 A;  3MGQ A;  1P3O A;  4H9P A;  5F99 B;  3O62 C;  3A6N B;  3AZN D;  1P3B A;  3KXB A;  5DNM B;  3REK A;  3AZJ B;  2HIO B;  5GXQ D;  3MGS B;  3AZI A;  1P3I D;  2RVQ D;  4QLC B;  4LD9 A;  5F99 C;  4J8U B;  3LZ1 D;  3KFU G;  4JJN D;  2HIO C;  3MGS C;  5E5A D;  4ZBJ C;  5BNV A;  5B32 A;  3WA9 D;  1ID3 A;  2NQB D;  1KX3 B;  4J8X A;  3AV1 B;  3AZL C;  3REI A;  3V9R A;  3WAA A;  4NE6 A;  4XUJ C;  3W98 B;  4Z2M G;  4R8P D;  1P3A A;  3AFA B;  5AVC C;  1P3M D;  1M1A B;  5B2J A;  4YS3 D;  4WZS B;  3AV1 C;  3VH6 W;  2BYM A;  4H9N A;  3AZM B;  3R45 B;  5CP6 B;  3LJA A;  3AFA C;  4KUD A;  1KX4 C;  2NZD B;  3KXB D;  3REK D;  2FJ7 B;  1P3F A;  3AZE A;  5CPJ C;  5AY8 A;  5AV6 B;  3AZM C;  5CP6 C;  3B6G A;  3EPJ A;  3KWQ B;  5AV9 C;  2NZD C;  3W99 C;  5B2I D;  5GT0 B;  5AV6 C;  4HGA C;  5F99 A;  2JE5 A;  4J8X D;  1R4V A;  3WTP C;  3A6N A;  3WAA D;  1BH8 B;  2DF4 C;  5DNM A;  3EPL A;  2HIO A;  3MGS A;  3AZJ A;  1P3A D;  4QLC A;  3NQJ B;  1P3I B;  4J8U A;  5FUG B;  5GXQ B;  3UTA D;  1AOI C;  2ZY3 A;  3NQU B;  5AV8 D;  5B0Y D;  4Z66 D;  5B40 B;  3LZ1 B;  2VQR A;  3MVD D;  4KUD D;  4NE5 A;  1P3K C;  5JA4 B;  4JJN B;  1P3F D;  2RVQ C;  1KX3 A;  3AV1 A;  1M18 B;  5KDM B;  5B40 C;  3AZF C;  3O62 D;  3W98 A;  3AFA A;  1F66 C;  1M1A A;  1M18 C;  2Y2H A;  1P3M B;  5CHL B;  4YS3 B;  3AZM A;  3R45 A;  5CP6 A;  5AV9 A;  3C1C C;  2NZD A;  2FJ7 A;  1U35 C;  1ULY A;  4Z2M H;  3TU4 C;  1P3P C;  5AV6 A;  5AVB C;  3KWQ A;  5GT3 C;  3AZL D;  3X1V C;  4Z5T C;  5GT0 A;  2RIQ A;  4XUJ D;  5C3I C;  5B2I B;  5AVC D;  3X1S B;  4DRA A;  1BH8 A;  3NQJ A;  1KX4 D;  1P3I A;  5FUG A;  5GXQ A;  4X23 C;  3X1S C;  3IP4 C;  5CPJ D;  3NQU A;  3UTA B;  1N1J B;  5B40 A;  3LZ1 A;  3AZM D;  5AV8 B;  4Z66 B;  5BNX B;  5AV9 D;  5JA4 A;  5B0Y B;  4JJN A;  2NZD D;  3W99 D;  3MVD B;  2G5I C;  1M18 A;  5AV6 D;  2IO5 B;  3C1B D;  5KDM A;  4Z66 C;  3WTP D;  2JCH A;  4NFT A;  5B33 B;  4J8V C;  4H9O B;  3O62 B;  4NE3 A;  4WJ3 C;  1P3M A;  4YS3 A;  5CPI C;  4EO5 C;  1AOI D;  3AYW C;  4H9S C;  3B0C W;  5B33 C;  1M19 C;  4G92 C;  3VH6 A;  5DNN B;  1P3K D;  4ZBJ B;  3W97 B;  5B40 D;  3AZF D;  5DNN C;  3AZL B;  1T3U A;  1F66 D;  5B2I A;  4YM6 C;  4XUJ B;  3W97 C;  1M18 D;  5AVC B;  3X1S A;  2Y2K A;  3C1C D;  3AZH C;  5B24 C;  3KSY A;  1U35 D;  1KX4 B;  3TU4 D;  1P3P D;  5AVB D;  1N1J A;  3UTA A;  1JFI B;  4ZUX C;  5CPJ B;  5GT3 D;  5AV8 A;  5BNX A;  5B0Y A;  4Z66 A;  3X1V D;  4Z5T D;  3MVD A;  5AV9 B;  3W99 B;  3C1B B;  4G91 C;  4HGA B;  2Y2L A;  2YFW B;  5B31 C;  5B33 A;  4H9O A;  3O62 A;  3WTP B;  5BS7 C;  3WTP E;  1EQZ C;  3LEL C;  3C1B C;  4X23 D;  3X1S D;  3EPH A;  3MGR B;  4H9R B;  1AOI B;  2F8N G;  5DNN A;  1B6W A;  1ZLA C;  3W97 A;  1P3K B;  5B1L C;  4XZQ C;  5B31 G;  3MGP C;  3MGR C;  2CWE A;  3AL0 C;  3AZL A;  3LZ0 D;  5JRG C;  3KUY C;  3AZF B;  4J8V D;  2Y2G A;  3REH C;  4XUJ A;  3MNN B;  5B1M C;  1F66 B;  5AVC A;  5CPI D;  5G49 B;  1H3O B;  4J8W C;  1HQ3 D;  3AYW D;  5B33 D;  2Y2I A;  3MNN C;  1M19 D;  2J8P A;  2Y2O A;  1KX4 A;  4WU9 D;  3C1C B;  5B0Z C;  2Y2N A;  5AV5 B;  3UT9 B;  3VH5 A;  1JFI A;  2ZY2 A;  1U35 B;  3TU4 B;  1P3P B;  3EG5 B;  5CPJ A;  5AVB B;  4M6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...