4X23C

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 102
sequence length 102
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23C00
5AVCB 4NE5A 5GSUB 5BT1C 1H3OA 5B1MB 5BO0B 5B24A 3AZNB 1P3PD 3MGPB 3REIB 5JRGB 2HIOA 5B31B 5B2ID 3LELA 4CAYB 4G92C 3B0CW 3C1CB 5AV6A 4WNNB 4J8UA 3REJC 3LELD 3A6NB 2NZDC 3TU4C 5AV6D 3AFAC 1P3AA 4ZBJC 4J8UD 1BH8A 1M19C 1ID3C 1N1JA 3KSYA 3LJAC 1P3GA 1P3LB 2NZDD 5CP6C 3LZ0B 1P3AD 4CSRA 3WTPB 2AROA 1P3GD 3AZMB 3B6FC 4YM6C 5B33A 5E5AB 4WU8A 5BNXB 3NQJB 4JJNB 2F8NK 5AV9B 3AZIB 4XZQC 5B33D 1BH9B 3RELA 3MGRA 1HQ3C 2JSSA 5AY8C 4UUZA 1P3MA 5DNNA 3MVDC 1P3FC 4M6BA 4G92B 5BNVA 3RELD 5C3IB 3MGRD 4XZQD 4KHAB 1P3MD 5DNND 3REJB 2NZDB 3TU4B 5B0YC 3AFAB 5F99C 1TZYC 4ZBJB 3V9RB 1M19B 3VH6W 3LJAB 3C1BC 5B0YD 3KUYA 1TZYD 1P3OC 3B6FB 5AVBA 3NQUA 4YM6B 4ZUXA 4H9RB 1HTAA 4NE3A 1AOIC 1U35C 5AVBD 3VH5W 4XZQB 1P3OD 4ZUXD 1EQZA 1HQ3B 3W97C 5AY8B 1M1AD 3AZLC 3MVDB 1KX5C 1U35D 1P3FB 1EQZD 3WA9C 5B32C 3REHC 5AV5A 5B1LA 5B0YB 1KX5D 4LD9C 4H9QA 1TZYB 5B1MC 4R8PC 5AV5D 3REIC 5B1LD 1P3KC 3C1BB 5FUGA 2F8NB 5GT3C 5B31G 2FJ7C 2NQBC 4J8WA 5GT0A 4DRBA 1P3OB 5B40A 3A6NC 5GXQC 4J8WD 5GT3D 5GT0D 5CPKC 1P34C 1KX4C 1M1AB 1U35B 5B40D 2FJ7D 3KXBC 2LY8A 5CPJA 3UTBD 3X1VC 3WTPC 3W97B 4X23C 3LZ1C 2YFVB 5B0ZA 3AZLB 1KX5B 5CPJD 3KXBD 1P3PC 5CPIC 5B32B 4QLCA 4EO5B 5B2IC 3REHB 5B0ZD 4KGCA 2L5AA 3W99A 3WAAA 5B24C 4QLCD 4J8XA 4LD9B 4WU9A 2HIOC 1F66A 5FUGB 4KGCD 3MNNA 3LELC 5CPID 5B2JA 3W99D 4R8PB 2CV5A 1P3KB 1B67A 2BYMB 5AV6C 3KWQA 4J8XD 5GT3B 4WU9D 4Z66A 3UTAA 4J8UC 5C3IC 5B24D 3MNND 5B2JD 2FJ7B 2NQBB 2CV5D 3AZKA 2HIOD 3KWQD 3AZGA 3B0CT 4Z66D 5GXQB 4XUJA 3UTBB 3UTAD 1P3AC 1P3IA 3AZKD 1KU5A 5CPKB 1P34B 1KX4B 1P3GC 3AZGD 5DNMA 3AYWA 5CPJB 4XUJD 4E45A 3KXBB 3AZFA 2AROC 3W96A 3X1VB 5DNMD 3AYWD 3R45A 4X23B 3LZ1B 5KDMB 3AZFD 5B33C 4WU8C 3W96D 3B0BA 1P3PB 3AZJA 2AROD 5CPIB 3W99B 5B2IB 3MGQA 1P3BA 1H3OB 3RELC 5B24B 3O62A 3MGRC 3AZJD 4H9NA 5B2JB 1P3MC 4WU8D 2HIOB 5DNNC 2PYOA 3LELB 4NFTA 3AZEA 1P3BD 3UT9A 3O62D 5AV6B 3AZKB 1ID3A 4WZSB 4J8UB 3AZGB 2PYOD 3AZED 3AZHA 3UT9D 3AN2A 1P3AB 3AYWB 1BH8B 2RVQD 1N1JB 3W98A 1P3GB 3AN2D 3MGSA 1Q9CA 3X1TA 4CSRB 2AROB 3X1SA 3KUYC 3W98D 1ZLAA 5AV8A 2F8NG 3VH6T 5AVBC 3MGSD 3X1TD 1S32A 3X1SD 5B33B 4ZUXC 4WU8B 5AV8D 2BYKA 3KUYD 3B0DC 4YS3A 2YFWA 1M18A 1S32D 1M1AC 1EQZC 5JA4A 3RELB 3MGRB 4YS3D 4UUZB 1P3MB 5DNNB 3B6GA 5BNVB 1TAFA 3VH5T 3REKA 4H9PA 3B6GD 4KUDA 5AV5C 5B1LC 4EO5C 5B32G 3REKD 4KUDD 3AV1A 3X1SB 4Z5TA 5BS7A 3KUYB 4J8WC 5GT0C 3AV1D 3WKJA 3AV2A 4Z5TD 3X1UA 5AVBB 4Z2MG 5B40C 5G49A 4J8VA 1KX3A 3NQUB 4YS3B 4ZUXB 3UTBC 3WKJD 3AV2D 3X1UD 3B0DB 5JA4B 1KX3D 3WA9A 4WV4B 1A7WA 5CPJC 1EQZB 1JFIA 4H9OA 1TAFB 5B0ZC 5AVCA 5GSUA 5B1MA 5BO0A 3AZNA 4QLCC 3MGPA 5JRGA 5B31A 4KGCC 5AV5B 3WAAC 3W99C 5B1LB 4CAYA 1R4VA 5GSUD 3C1CA 4J8XC 3MGPD 4WNNA 4WU9C 4H9QB 5JRGD 5B31D 1F66C 3MNNC 4Z5TB 5B2JC 3A6NA 2CV5C 3C1CD 3KWQC 3WAAD 4Z66C 3UTAC 3WKJB 4J8WB 3AZKC 5GT0B 1F66D 3AZGC 5B40B 1P3LA 4XUJC 3LZ0A 1P3IC 2F8NH 4H9SA 5DNMC 3AYWC 1P3LD 3AZMA 3AZFC 3W96C 5E5AA 3NQJA 4JJNA 1P3ID 5AV9A 3AZMD 5B0ZB 3AZIA 1BH9A 5E5AD 1WWSA 4DRAA 4JJND 2HUEC 5AV9D 3AZJC 4QLCB 3MGQC 3AZID 4KGCB 1P3BC 3WAAB 5BT1D 3O62C 4J8XB 4KHAA 4WU9B 1F66B 2PYOC 3MNNB 3REJA 3AZEC 3UT9C 2CV5B 2NZDA 3TU4A 3MGQD 3KWQB 3AFAA 4Z66B 3UTAB 3V9RA 3REJD 3AZHC 2CWEA 2RVQC 3TU4D 1M19A 3LJAA 1F1EA 3AFAD 3AN2C 4XUJB 5CP6A 1P3IB 4Z2MH 1M19D 1ID3D 3LJAD 3W98C 5DNMB 3AZHD 3B6FA 5CP6D 3MGSC 3X1TC 4AWLC 3AZFB 3X1SC 4YM6A 3W96B 1ZLAC 4H9RA 5AV8C 3R45B 1ULYA 3B6FD 1S32C 4XZQA 4YM6D 2HUEB 3AZJB 4YS3C 1HQ3A 5AY8A 3MGQB 1M18C 1ZLAD 3MVDA 1P3BB 1P3FA 3O62B 4H9NB 1HQ3D 5AY8D 2IO5C 2PYOB 3WTPE 3B6GC 3MVDD 3AZEB 1P3FD 3UT9B 1M18D 5CHLB 5B0YA 3REKC 1ID3B 5F99A 4KUDC 1TZYA 4G91C 4HGAC 3AZHB 4NE6A 5CP6B 3C1BA 1BFMA 2F8NA 3AN2B 5F99D 1WWIA 3C1BD 3W98B 3AV1C 4Z5TC 1P3OA 2F8ND 3MGSB 3X1TB 4AWLB 5BS7C 1ZLAB 5AV8B 3WKJC 3AV2C 1M1AA 1AOIA 3X1UC 1U35A 3VH6A 4J8VC 1S32B 1KX3C 1AOID 2BYKB 3W97A 2YFWB 1M18B 2YFVA 3AZLA 1KX5A 4J8VD 3W97D 5B32A 2IO5B 3REHA 3B6GB 3AZLD 5AVCC 5GSUC 5F99B 3WA9D 3AZNC 3REKB 5B32D 3MGPC 3VH5A 4LD9A 4H9PB 5JRGC 5B31C 4G91B 3REHD 4KUDB 4HGAB 4R8PA 3REIA 3C1CC 1P3KA 2BYMA 5AVCD 4LD9D 5GT3A 5B1MD 3AZND 4R8PD 3REID 2FJ7A 2NQBA 1P3KD 3AV1B 4E44A 5GXQA 3UTBA 1AOIB 2NQBD 5CPKA 1P34A 1KX4A 3AV2B 1P3LC 3X1UB 3A6ND 5G49B 5GXQD 3LZ0C 3KXBA 4J8VB 1KX3B 4H9SC 5CPKD 1P34D 1KX4D 3X1VA 3WTPA 3AZMC 4X23A 3LZ1A 3WA9B 1B6WA 5KDMA 5E5AC 1JFIB 4H9OB 3LZ0D 4JJNC 3X1VD 5AV9C 1P3PA 3WTPD 5CPIA 4X23D 3LZ1D 5BNXA 5B2IA 3AZIC
chains in the Genus database with same CATH superfamily
5AVCB 4NE5A 5GSUB 5BT1C 3H0LC 1H3OA 5B1MB 5BO0B 5B24A 3AZNB 2VQRA 3MGPB 3REIB 1P3PD 5JRGB 2HIOA 5B31B 5B2ID 3AL0C 3LELA 4CAYB 4G92C 3B0CW 3C1CB 5AV6A 4WNNB 1PZRA 4J8UA 3REJC 3LELD 3A6NB 2NZDC 3TU4C 5AV6D 3AFAC 1P3AA 4ZBJC 4J8UD 1BH8A 1M19C 1ID3C 1N1JA 3KSYA 3LJAC 1P3GA 1P3LB 2NZDD 5CP6C 3LZ0B 1P3AD 4CSRA 3WTPB 2AROA 1P3GD 3AZMB 3B6FC 2Y2HA 4YM6C 5B33A 5E5AB 5BNXB 4WU8A 3NQJB 4JJNB 2F8NK 5AV9B 3AZIB 2ZY4A 4XZQC 5B33D 1BH9B 3RELA 3MGRA 1HQ3C 2JSSA 5AY8C 4UUZA 1P3MA 3FDDA 5DNNA 3MVDC 2FFFB 1P3FC 4M6BA 4G92B 5BNVA 3RELD 5C3IB 3MGRD 4XZQD 4KHAB 1P3MD 5DNND 3REJB 2NZDB 3TU4B 5B0YC 3AFAB 5F99C 1TZYC 4ZBJB 3V9RB 1M19B 3VH6W 3LJAB 3C1BC 2UWXA 5B0YD 2XD1A 2W8SA 3KUYA 1TZYD 1P3OC 3B6FB 5AVBA 3NQUA 4YM6B 4ZUXA 4H9RB 1HTAA 4NE3A 1AOIC 1U35C 5AVBD 3VH5W 4XZQB 1P3OD 4ZUXD 1EQZA 1HQ3B 3W97C 5AY8B 1M1AD 3AZLC 3MVDB 1KX5C 1U35D 1P3FB 1EQZD 3WA9C 5B32C 3REHC 5AV5A 5B1LA 5B0YB 1KX5D 4LD9C 4H9QA 1TZYB 5B1MC 4R8PC 5AV5D 3REIC 5B1LD 1P3KC 3C1BB 3EPKA 5FUGA 2F8NB 5GT3C 5B31G 2FJ7C 2NQBC 2Y2MA 4J8WA 5GT0A 4DRBA 1P3OB 5B40A 3A6NC 5GXQC 4J8WD 5GT3D 5GT0D 5CPKC 1P34C 1KX4C 1M1AB 2DF4C 5B40D 1U35B 2FJ7D 3KXBC 3F6TA 2LY8A 5CPJA 2RIQA 3UTBD 3X1VC 3WTPC 3W97B 2ZM5A 4X23C 3LZ1C 2Y2KA 1Z2CB 2YFVB 5B0ZA 3AZLB 1KX5B 5CPJD 3KXBD 1P3PC 2JCHA 5CPIC 4QLCA 5B32B 4EO5B 5B2IC 3REHB 5B0ZD 4KGCA 2L5AA 3W99A 3WAAA 5B24C 4QLCD 4J8XA 4LD9B 4WU9A 2HIOC 1F66A 5FUGB 4KGCD 3MNNA 3LELC 5CPID 5B2JA 3W99D 4R8PB 2CV5A 1P3KB 1B67A 2BYMB 5AV6C 3KWQA 4J8XD 5GT3B 4WU9D 4Z66A 3UTAA 4J8UC 5C3IC 5B24D 3MNND 5B2JD 2FJ7B 2NQBB 2CV5D 3AZKA 2HIOD 3KWQD 3AZGA 3B0CT 4Z66D 5GXQB 4XUJA 3UTBB 3UTAD 1P3AC 1P3IA 3P5JB 3AZKD 1KU5A 2Y2NA 5CPKB 1P34B 1P3GC 3AZGD 1KX4B 5DNMA 3AYWA 5CPJB 4XUJD 4E45A 3KXBB 3AZFA 2AROC 3W96A 3X1VB 5DNMD 3AYWD 3R45A 4X23B 3LZ1B 3EPLA 5KDMB 2F2AC 3AZFD 5B33C 4WU8C 3W96D 3B0BA 1P3PB 3AZJA 2AROD 5CPIB 3W99B 5B2IB 3MGQA 1P3BA 1H3OB 3RELC 2Y2OA 5B24B 3O62A 3MGRC 3AZJD 4H9NA 5B2JB 1P3MC 4WU8D 2HIOB 5DNNC 2PYOA 3LELB 4NFTA 3AZEA 1P3BD 3UT9A 3O62D 5AV6B 3AZKB 1ID3A 4WZSB 4J8UB 3AZGB 2PYOD 3AZED 3AZHA 3UT9D 3AN2A 1P3AB 3AYWB 1BH8B 2RVQD 1N1JB 3W98A 1P3GB 3AN2D 3EPHA 3MGSA 1Q9CA 3X1TA 4CSRB 2AROB 3X1SA 3KUYC 3W98D 1ZLAA 5AV8A 3IP4C 2F8NG 3VH6T 5AVBC 3MGSD 3X1TD 1S32A 3X1SD 5B33B 4ZUXC 4WU8B 5AV8D 2BYKA 3KUYD 3B0DC 4YS3A 2YFWA 1M18A 1S32D 1M1AC 1EQZC 3A1KA 5JA4A 3RELB 3MGRB 4YS3D 4UUZB 1P3MB 5DNNB 3B6GA 3EPJA 5BNVB 1TAFA 3VH5T 3REKA 2Y2PA 4H9PA 3B6GD 4KUDA 5AV5C 5B1LC 4EO5C 3EG5B 5B32G 3REKD 4KUDD 1T3UA 3AV1A 3X1SB 4Z5TA 5BS7A 3KUYB 4J8WC 5GT0C 3AV1D 3WKJA 3AV2A 4Z5TD 3X1UA 5AVBB 4Z2MG 5B40C 5G49A 4J8VA 1KX3A 3NQUB 4YS3B 4ZUXB 3UTBC 3WKJD 3AV2D 3X1UD 3B0DB 4UPKA 5JA4B 1KX3D 3WA9A 4WV4B 1A7WA 5CPJC 1EQZB 1JFIA 4H9OA 2Y2GA 1TAFB 5B0ZC 4WJ3C 5AVCA 5GSUA 5B1MA 5BO0A 3AZNA 4QLCC 3MGPA 5JRGA 5B31A 4KGCC 4CAYA 3WAAC 3W99C 5B1LB 5GSUD 1R4VA 5AV5B 3C1CA 1W2EA 3MGPD 4J8XC 4WNNA 4WU9C 4H9QB 2G5HC 5JRGD 5B31D 1F66C 3MNNC 4Z5TB 5B2JC 3A6NA 2CV5C 3C1CD 3KWQC 3WAAD 4Z66C 3UTAC 3WKJB 4J8WB 3AZKC 5GT0B 1F66D 3AZGC 5B40B 1P3LA 4XUJC 3LZ0A 1P3IC 2F8NH 4H9SA 5DNMC 3AYWC 1P3LD 3AZMA 3AZFC 2Y2JA 3W96C 5E5AA 3NQJA 4JJNA 1P3ID 5AV9A 3AZMD 5B0ZB 3AZIA 1BH9A 5E5AD 1WWSA 4DRAA 4JJND 2HUEC 5AV9D 3AZJC 2Y2IA 4QLCB 3MGQC 3AZID 3H0RC 4KGCB 1P3BC 3WAAB 5BT1D 3O62C 4J8XB 4KHAA 4WU9B 1F66B 2PYOC 3MNNB 3REJA 3AZEC 3UT9C 2CV5B 2NZDA 3TU4A 3MGQD 3KWQB 2XD5A 3AFAA 4Z66B 3UTAB 3V9RA 3REJD 3AZHC 2CWEA 2RVQC 3TU4D 1M19A 3LJAA 1F1EA 3AFAD 3AN2C 2ZY3A 4XUJB 5CP6A 1P3IB 4Z2MH 1M19D 1ID3D 3LJAD 3W98C 5DNMB 3AZHD 3B6FA 5CP6D 3MGSC 3X1TC 4AWLC 3AZFB 3X1SC 4YM6A 3W96B 1ZLAC 4H9RA 5AV8C 3R45B 1ULYA 3B6FD 1S32C 4XZQA 4YM6D 2HUEB 3AZJB 4YS3C 1HQ3A 5AY8A 3MGQB 1M18C 1ZLAD 3MVDA 1P3BB 1P3FA 3O62B 4H9NB 1HQ3D 5AY8D 2IO5C 2PYOB 3WTPE 3B6GC 3MVDD 3AZEB 1P3FD 3UT9B 2J8PA 1M18D 5CHLB 5B0YA 3REKC 1ID3B 5F99A 4KUDC 1TZYA 4G91C 4HGAC 3AZHB 4NE6A 5CP6B 3C1BA 1BFMA 2F8NA 3AN2B 5F99D 1WWIA 3C1BD 3W98B 3AV1C 4Z5TC 1P3OA 2F8ND 3MGSB 3X1TB 4AWLB 3A1IA 5BS7C 1ZLAB 5AV8B 3WKJC 3AV2C 1M1AA 1AOIA 3X1UC 1U35A 3VH6A 4J8VC 1S32B 1KX3C 1AOID 2BYKB 3W97A 2YFWB 1M18B 2YFVA 3AZLA 1KX5A 4J8VD 3W97D 2Y2QA 5B32A 2IO5B 3REHA 3B6GB 3AZLD 5AVCC 5GSUC 5F99B 3KFUG 3WA9D 3AZNC 3REKB 5B32D 3MGPC 3VH5A 4LD9A 4H9PB 5JRGC 5B31C 4G91B 2JE5A 3REHD 4HGAB 3H0MC 4KUDB 4R8PA 3REIA 3C1CC 1P3KA 2G5IC 2BYMA 5AVCD 4LD9D 5GT3A 5B1MD 3AZND 4R8PD 3REID 2FJ7A 2NQBA 1P3KD 3AV1B 4E44A 5GXQA 3UTBA 2ZY2A 1AOIB 2NQBD 5CPKA 1P34A 1KX4A 3AV2B 1P3LC 3X1UB 3A6ND 5G49B 5GXQD 3LZ0C 3KXBA 4J8VB 1KX3B 4H9SC 5CPKD 1P34D 1KX4D 3X1VA 3WTPA 3AZMC 2ZY5A 4X23A 3LZ1A 3WA9B 1B6WA 5KDMA 5E5AC 1JFIB 4H9OB 3LZ0D 4JJNC 3X1VD 5AV9C 1P3PA 3WTPD 5CPIA 2DQNC 2BG1A 4X23D 3LZ1D 5BNXA 4DQYB 5B2IA 3AZIC 2Y2LA
chains in the Genus database with same CATH topology
5AVCB 4NE5A 5GSUB 5BT1C 3H0LC 1H3OA 5B1MB 5BO0B 5B24A 3AZNB 2VQRA 3MGPB 3REIB 1P3PD 5JRGB 2HIOA 5B31B 5B2ID 3AL0C 3LELA 4CAYB 4G92C 3B0CW 3C1CB 5AV6A 4WNNB 1PZRA 4J8UA 3REJC 3LELD 3A6NB 2NZDC 3TU4C 5AV6D 3AFAC 1P3AA 4ZBJC 4J8UD 1BH8A 1M19C 1ID3C 1N1JA 3KSYA 3LJAC 1P3GA 1P3LB 2NZDD 5CP6C 3LZ0B 1P3AD 4CSRA 3WTPB 2AROA 1P3GD 3AZMB 3B6FC 2Y2HA 4YM6C 5B33A 5E5AB 5BNXB 4WU8A 3NQJB 4JJNB 2F8NK 5AV9B 3AZIB 2ZY4A 4XZQC 5B33D 1BH9B 3RELA 3MGRA 1HQ3C 2JSSA 5AY8C 4UUZA 1P3MA 3FDDA 5DNNA 3MVDC 2FFFB 1P3FC 4M6BA 4G92B 5BNVA 3RELD 5C3IB 3MGRD 4XZQD 4KHAB 1P3MD 5DNND 3REJB 2NZDB 3TU4B 5B0YC 3AFAB 5F99C 1TZYC 4ZBJB 3V9RB 1M19B 3VH6W 3LJAB 3C1BC 2UWXA 5B0YD 2XD1A 2W8SA 3KUYA 1TZYD 1P3OC 3B6FB 5AVBA 3NQUA 4YM6B 4ZUXA 4H9RB 1HTAA 4NE3A 1AOIC 1U35C 5AVBD 3VH5W 4XZQB 1P3OD 4ZUXD 1EQZA 1HQ3B 3W97C 5AY8B 1M1AD 3AZLC 3MVDB 1KX5C 1U35D 1P3FB 1EQZD 3WA9C 5B32C 3REHC 5AV5A 5B1LA 5B0YB 1KX5D 4LD9C 4H9QA 1TZYB 5B1MC 4R8PC 5AV5D 3REIC 5B1LD 1P3KC 3C1BB 3EPKA 5FUGA 2F8NB 5GT3C 5B31G 2FJ7C 2NQBC 2Y2MA 4J8WA 5GT0A 4DRBA 1P3OB 5B40A 3A6NC 5GXQC 4J8WD 5GT3D 5GT0D 5CPKC 1P34C 1KX4C 1M1AB 2DF4C 5B40D 1U35B 2FJ7D 3KXBC 3F6TA 2LY8A 5CPJA 2RIQA 3UTBD 3X1VC 3WTPC 3W97B 2ZM5A 4X23C 3LZ1C 2Y2KA 1Z2CB 2YFVB 5B0ZA 3AZLB 1KX5B 5CPJD 3KXBD 1P3PC 2JCHA 5CPIC 4QLCA 5B32B 4EO5B 5B2IC 3REHB 5B0ZD 4KGCA 2L5AA 3W99A 3WAAA 5B24C 4QLCD 4J8XA 4LD9B 4WU9A 2HIOC 1F66A 5FUGB 4KGCD 3MNNA 3LELC 5CPID 5B2JA 3W99D 4R8PB 2CV5A 1P3KB 1B67A 2BYMB 5AV6C 3KWQA 4J8XD 5GT3B 4WU9D 4Z66A 3UTAA 4J8UC 5C3IC 5B24D 3MNND 5B2JD 2FJ7B 2NQBB 2CV5D 3AZKA 2HIOD 3KWQD 3AZGA 3B0CT 4Z66D 5GXQB 4XUJA 3UTBB 3UTAD 1P3AC 1P3IA 3P5JB 3AZKD 1KU5A 2Y2NA 5CPKB 1P34B 1P3GC 3AZGD 1KX4B 5DNMA 3AYWA 5CPJB 4XUJD 4E45A 3KXBB 3AZFA 2AROC 3W96A 3X1VB 5DNMD 3AYWD 3R45A 4X23B 3LZ1B 3EPLA 5KDMB 2F2AC 3AZFD 5B33C 4WU8C 3W96D 3B0BA 1P3PB 3AZJA 2AROD 5CPIB 3W99B 5B2IB 3MGQA 1P3BA 1H3OB 3RELC 2Y2OA 5B24B 3O62A 3MGRC 3AZJD 4H9NA 5B2JB 1P3MC 4WU8D 2HIOB 5DNNC 2PYOA 3LELB 4NFTA 3AZEA 1P3BD 3UT9A 3O62D 5AV6B 3AZKB 1ID3A 4WZSB 4J8UB 3AZGB 2PYOD 3AZED 3AZHA 3UT9D 3AN2A 1P3AB 3AYWB 1BH8B 2RVQD 1N1JB 3W98A 1P3GB 3AN2D 3EPHA 3MGSA 1Q9CA 3X1TA 4CSRB 2AROB 3X1SA 3KUYC 3W98D 1ZLAA 5AV8A 3IP4C 2F8NG 3VH6T 5AVBC 3MGSD 3X1TD 1S32A 3X1SD 5B33B 4ZUXC 4WU8B 5AV8D 2BYKA 3KUYD 3B0DC 4YS3A 2YFWA 1M18A 1S32D 1M1AC 1EQZC 3A1KA 5JA4A 3RELB 3MGRB 4YS3D 4UUZB 1P3MB 5DNNB 3B6GA 3EPJA 5BNVB 1TAFA 3VH5T 3REKA 2Y2PA 4H9PA 3B6GD 4KUDA 5AV5C 5B1LC 4EO5C 3EG5B 5B32G 3REKD 4KUDD 1T3UA 3AV1A 3X1SB 4Z5TA 5BS7A 3KUYB 4J8WC 5GT0C 3AV1D 3WKJA 3AV2A 4Z5TD 3X1UA 5AVBB 4Z2MG 5B40C 5G49A 4J8VA 1KX3A 3NQUB 4YS3B 4ZUXB 3UTBC 3WKJD 3AV2D 3X1UD 3B0DB 4UPKA 5JA4B 1KX3D 3WA9A 4WV4B 1A7WA 5CPJC 1EQZB 1JFIA 4H9OA 2Y2GA 1TAFB 5B0ZC 4WJ3C 5AVCA 5GSUA 5B1MA 5BO0A 3AZNA 4QLCC 3MGPA 5JRGA 5B31A 4KGCC 4CAYA 3WAAC 3W99C 5B1LB 5GSUD 1R4VA 5AV5B 3C1CA 1W2EA 3MGPD 4J8XC 4WNNA 4WU9C 4H9QB 2G5HC 5JRGD 5B31D 1F66C 3MNNC 4Z5TB 5B2JC 3A6NA 2CV5C 3C1CD 3KWQC 3WAAD 4Z66C 3UTAC 3WKJB 4J8WB 3AZKC 5GT0B 1F66D 3AZGC 5B40B 1P3LA 4XUJC 3LZ0A 1P3IC 2F8NH 4H9SA 5DNMC 3AYWC 1P3LD 3AZMA 3AZFC 2Y2JA 3W96C 5E5AA 3NQJA 4JJNA 1P3ID 5AV9A 3AZMD 5B0ZB 3AZIA 1BH9A 5E5AD 1WWSA 4DRAA 4JJND 2HUEC 5AV9D 3AZJC 2Y2IA 4QLCB 3MGQC 3AZID 3H0RC 4KGCB 1P3BC 3WAAB 5BT1D 3O62C 4J8XB 4KHAA 4WU9B 1F66B 2PYOC 3MNNB 3REJA 3AZEC 3UT9C 2CV5B 2NZDA 3TU4A 3MGQD 3KWQB 2XD5A 3AFAA 4Z66B 3UTAB 3V9RA 3REJD 3AZHC 2CWEA 2RVQC 3TU4D 1M19A 3LJAA 1F1EA 3AFAD 3AN2C 2ZY3A 4XUJB 5CP6A 1P3IB 4Z2MH 1M19D 1ID3D 3LJAD 3W98C 5DNMB 3AZHD 3B6FA 5CP6D 3MGSC 3X1TC 4AWLC 3AZFB 3X1SC 4YM6A 3W96B 1ZLAC 4H9RA 5AV8C 3R45B 1ULYA 3B6FD 1S32C 4XZQA 4YM6D 2HUEB 3AZJB 4YS3C 1HQ3A 5AY8A 3MGQB 1M18C 1ZLAD 3MVDA 1P3BB 1P3FA 3O62B 4H9NB 1HQ3D 5AY8D 2IO5C 2PYOB 3WTPE 3B6GC 3MVDD 3AZEB 1P3FD 3UT9B 2J8PA 1M18D 5CHLB 5B0YA 3REKC 1ID3B 5F99A 4KUDC 1TZYA 4G91C 4HGAC 3AZHB 4NE6A 5CP6B 3C1BA 1BFMA 2F8NA 3AN2B 5F99D 1WWIA 3C1BD 3W98B 3AV1C 4Z5TC 1P3OA 2F8ND 3MGSB 3X1TB 4AWLB 3A1IA 5BS7C 1ZLAB 5AV8B 3WKJC 3AV2C 1M1AA 1AOIA 3X1UC 1U35A 3VH6A 4J8VC 1S32B 1KX3C 1AOID 2BYKB 3W97A 2YFWB 1M18B 2YFVA 3AZLA 1KX5A 4J8VD 3W97D 2Y2QA 5B32A 2IO5B 3REHA 3B6GB 3AZLD 5AVCC 5GSUC 5F99B 3KFUG 3WA9D 3AZNC 3REKB 5B32D 3MGPC 3VH5A 4LD9A 4H9PB 5JRGC 5B31C 4G91B 2JE5A 3REHD 4HGAB 3H0MC 4KUDB 4R8PA 3REIA 3C1CC 1P3KA 2G5IC 2BYMA 5AVCD 4LD9D 5GT3A 5B1MD 3AZND 4R8PD 3REID 2FJ7A 2NQBA 1P3KD 3AV1B 4E44A 5GXQA 3UTBA 2ZY2A 1AOIB 2NQBD 5CPKA 1P34A 1KX4A 3AV2B 1P3LC 3X1UB 3A6ND 5G49B 5GXQD 3LZ0C 3KXBA 4J8VB 1KX3B 4H9SC 5CPKD 1P34D 1KX4D 3X1VA 3WTPA 3AZMC 2ZY5A 4X23A 3LZ1A 3WA9B 1B6WA 5KDMA 5E5AC 1JFIB 4H9OB 3LZ0D 4JJNC 3X1VD 5AV9C 1P3PA 3WTPD 5CPIA 2DQNC 2BG1A 4X23D 3LZ1D 5BNXA 4DQYB 5B2IA 3AZIC 2Y2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC B;  4NE5 A;  5GSU B;  5BT1 C;  1H3O A;  5B1M B;  5BO0 B;  5B24 A;  3AZN B;  1P3P D;  3MGP B;  3REI B;  5JRG B;  2HIO A;  5B31 B;  5B2I D;  3LEL A;  4CAY B;  4G92 C;  3B0C W;  3C1C B;  5AV6 A;  4WNN B;  4J8U A;  3REJ C;  3LEL D;  3A6N B;  2NZD C;  3TU4 C;  5AV6 D;  3AFA C;  1P3A A;  4ZBJ C;  4J8U D;  1BH8 A;  1M19 C;  1ID3 C;  1N1J A;  3KSY A;  3LJA C;  1P3G A;  1P3L B;  2NZD D;  5CP6 C;  3LZ0 B;  1P3A D;  4CSR A;  3WTP B;  2ARO A;  1P3G D;  3AZM B;  3B6F C;  4YM6 C;  5B33 A;  5E5A B;  4WU8 A;  5BNX B;  3NQJ B;  4JJN B;  2F8N K;  5AV9 B;  3AZI B;  4XZQ C;  5B33 D;  1BH9 B;  3REL A;  3MGR A;  1HQ3 C;  2JSS A;  5AY8 C;  4UUZ A;  1P3M A;  5DNN A;  3MVD C;  1P3F C;  4M6B A;  4G92 B;  5BNV A;  3REL D;  5C3I B;  3MGR D;  4XZQ D;  4KHA B;  1P3M D;  5DNN D;  3REJ B;  2NZD B;  3TU4 B;  5B0Y C;  3AFA B;  5F99 C;  1TZY C;  4ZBJ B;  3V9R B;  1M19 B;  3VH6 W;  3LJA B;  3C1B C;  5B0Y D;  3KUY A;  1TZY D;  1P3O C;  3B6F B;  5AVB A;  3NQU A;  4YM6 B;  4ZUX A;  4H9R B;  1HTA A;  4NE3 A;  1AOI C;  1U35 C;  5AVB D;  3VH5 W;  4XZQ B;  1P3O D;  4ZUX D;  1EQZ A;  1HQ3 B;  3W97 C;  5AY8 B;  1M1A D;  3AZL C;  3MVD B;  1KX5 C;  1U35 D;  1P3F B;  1EQZ D;  3WA9 C;  5B32 C;  3REH C;  5AV5 A;  5B1L A;  5B0Y B;  1KX5 D;  4LD9 C;  4H9Q A;  1TZY B;  5B1M C;  4R8P C;  5AV5 D;  3REI C;  5B1L D;  1P3K C;  3C1B B;  5FUG A;  2F8N B;  5GT3 C;  5B31 G;  2FJ7 C;  2NQB C;  4J8W A;  5GT0 A;  4DRB A;  1P3O B;  5B40 A;  3A6N C;  5GXQ C;  4J8W D;  5GT3 D;  5GT0 D;  5CPK C;  1P34 C;  1KX4 C;  1M1A B;  1U35 B;  5B40 D;  2FJ7 D;  3KXB C;  2LY8 A;  5CPJ A;  3UTB D;  3X1V C;  3WTP C;  3W97 B;  4X23 C;  3LZ1 C;  2YFV B;  5B0Z A;  3AZL B;  1KX5 B;  5CPJ D;  3KXB D;  1P3P C;  5CPI C;  5B32 B;  4QLC A;  4EO5 B;  5B2I C;  3REH B;  5B0Z D;  4KGC A;  2L5A A;  3W99 A;  3WAA A;  5B24 C;  4QLC D;  4J8X A;  4LD9 B;  4WU9 A;  2HIO C;  1F66 A;  5FUG B;  4KGC D;  3MNN A;  3LEL C;  5CPI D;  5B2J A;  3W99 D;  4R8P B;  2CV5 A;  1P3K B;  1B67 A;  2BYM B;  5AV6 C;  3KWQ A;  4J8X D;  5GT3 B;  4WU9 D;  4Z66 A;  3UTA A;  4J8U C;  5C3I C;  5B24 D;  3MNN D;  5B2J D;  2FJ7 B;  2NQB B;  2CV5 D;  3AZK A;  2HIO D;  3KWQ D;  3AZG A;  3B0C T;  4Z66 D;  5GXQ B;  4XUJ A;  3UTB B;  3UTA D;  1P3A C;  1P3I A;  3AZK D;  1KU5 A;  5CPK B;  1P34 B;  1KX4 B;  1P3G C;  3AZG D;  5DNM A;  3AYW A;  5CPJ B;  4XUJ D;  4E45 A;  3KXB B;  3AZF A;  2ARO C;  3W96 A;  3X1V B;  5DNM D;  3AYW D;  3R45 A;  4X23 B;  3LZ1 B;  5KDM B;  3AZF D;  5B33 C;  4WU8 C;  3W96 D;  3B0B A;  1P3P B;  3AZJ A;  2ARO D;  5CPI B;  3W99 B;  5B2I B;  3MGQ A;  1P3B A;  1H3O B;  3REL C;  5B24 B;  3O62 A;  3MGR C;  3AZJ D;  4H9N A;  5B2J B;  1P3M C;  4WU8 D;  2HIO B;  5DNN C;  2PYO A;  3LEL B;  4NFT A;  3AZE A;  1P3B D;  3UT9 A;  3O62 D;  5AV6 B;  3AZK B;  1ID3 A;  4WZS B;  4J8U B;  3AZG B;  2PYO D;  3AZE D;  3AZH A;  3UT9 D;  3AN2 A;  1P3A B;  3AYW B;  1BH8 B;  2RVQ D;  1N1J B;  3W98 A;  1P3G B;  3AN2 D;  3MGS A;  1Q9C A;  3X1T A;  4CSR B;  2ARO B;  3X1S A;  3KUY C;  3W98 D;  1ZLA A;  5AV8 A;  2F8N G;  3VH6 T;  5AVB C;  3MGS D;  3X1T D;  1S32 A;  3X1S D;  5B33 B;  4ZUX C;  4WU8 B;  5AV8 D;  2BYK A;  3KUY D;  3B0D C;  4YS3 A;  2YFW A;  1M18 A;  1S32 D;  1M1A C;  1EQZ C;  5JA4 A;  3REL B;  3MGR B;  4YS3 D;  4UUZ B;  1P3M B;  5DNN B;  3B6G A;  5BNV B;  1TAF A;  3VH5 T;  3REK A;  4H9P A;  3B6G D;  4KUD A;  5AV5 C;  5B1L C;  4EO5 C;  5B32 G;  3REK D;  4KUD D;  3AV1 A;  3X1S B;  4Z5T A;  5BS7 A;  3KUY B;  4J8W C;  5GT0 C;  3AV1 D;  3WKJ A;  3AV2 A;  4Z5T D;  3X1U A;  5AVB B;  4Z2M G;  5B40 C;  5G49 A;  4J8V A;  1KX3 A;  3NQU B;  4YS3 B;  4ZUX B;  3UTB C;  3WKJ D;  3AV2 D;  3X1U D;  3B0D B;  5JA4 B;  1KX3 D;  3WA9 A;  4WV4 B;  1A7W A;  5CPJ C;  1EQZ B;  1JFI A;  4H9O A;  1TAF B;  5B0Z C;  5AVC A;  5GSU A;  5B1M A;  5BO0 A;  3AZN A;  4QLC C;  3MGP A;  5JRG A;  5B31 A;  4KGC C;  5AV5 B;  3WAA C;  3W99 C;  5B1L B;  4CAY A;  1R4V A;  5GSU D;  3C1C A;  4J8X C;  3MGP D;  4WNN A;  4WU9 C;  4H9Q B;  5JRG D;  5B31 D;  1F66 C;  3MNN C;  4Z5T B;  5B2J C;  3A6N A;  2CV5 C;  3C1C D;  3KWQ C;  3WAA D;  4Z66 C;  3UTA C;  3WKJ B;  4J8W B;  3AZK C;  5GT0 B;  1F66 D;  3AZG C;  5B40 B;  1P3L A;  4XUJ C;  3LZ0 A;  1P3I C;  2F8N H;  4H9S A;  5DNM C;  3AYW C;  1P3L D;  3AZM A;  3AZF C;  3W96 C;  5E5A A;  3NQJ A;  4JJN A;  1P3I D;  5AV9 A;  3AZM D;  5B0Z B;  3AZI A;  1BH9 A;  5E5A D;  1WWS A;  4DRA A;  4JJN D;  2HUE C;  5AV9 D;  3AZJ C;  4QLC B;  3MGQ C;  3AZI D;  4KGC B;  1P3B C;  3WAA B;  5BT1 D;  3O62 C;  4J8X B;  4KHA A;  4WU9 B;  1F66 B;  2PYO C;  3MNN B;  3REJ A;  3AZE C;  3UT9 C;  2CV5 B;  2NZD A;  3TU4 A;  3MGQ D;  3KWQ B;  3AFA A;  4Z66 B;  3UTA B;  3V9R A;  3REJ D;  3AZH C;  2CWE A;  2RVQ C;  3TU4 D;  1M19 A;  3LJA A;  1F1E A;  3AFA D;  3AN2 C;  4XUJ B;  5CP6 A;  1P3I B;  4Z2M H;  1M19 D;  1ID3 D;  3LJA D;  3W98 C;  5DNM B;  3AZH D;  3B6F A;  5CP6 D;  3MGS C;  3X1T C;  4AWL C;  3AZF B;  3X1S C;  4YM6 A;  3W96 B;  1ZLA C;  4H9R A;  5AV8 C;  3R45 B;  1ULY A;  3B6F D;  1S32 C;  4XZQ A;  4YM6 D;  2HUE B;  3AZJ B;  4YS3 C;  1HQ3 A;  5AY8 A;  3MGQ B;  1M18 C;  1ZLA D;  3MVD A;  1P3B B;  1P3F A;  3O62 B;  4H9N B;  1HQ3 D;  5AY8 D;  2IO5 C;  2PYO B;  3WTP E;  3B6G C;  3MVD D;  3AZE B;  1P3F D;  3UT9 B;  1M18 D;  5CHL B;  5B0Y A;  3REK C;  1ID3 B;  5F99 A;  4KUD C;  1TZY A;  4G91 C;  4HGA C;  3AZH B;  4NE6 A;  5CP6 B;  3C1B A;  1BFM A;  2F8N A;  3AN2 B;  5F99 D;  1WWI A;  3C1B D;  3W98 B;  3AV1 C;  4Z5T C;  1P3O A;  2F8N D;  3MGS B;  3X1T B;  4AWL B;  5BS7 C;  1ZLA B;  5AV8 B;  3WKJ C;  3AV2 C;  1M1A A;  1AOI A;  3X1U C;  1U35 A;  3VH6 A;  4J8V C;  1S32 B;  1KX3 C;  1AOI D;  2BYK B;  3W97 A;  2YFW B;  1M18 B;  2YFV A;  3AZL A;  1KX5 A;  4J8V D;  3W97 D;  5B32 A;  2IO5 B;  3REH A;  3B6G B;  3AZL D;  5AVC C;  5GSU C;  5F99 B;  3WA9 D;  3AZN C;  3REK B;  5B32 D;  3MGP C;  3VH5 A;  4LD9 A;  4H9P B;  5JRG C;  5B31 C;  4G91 B;  3REH D;  4KUD B;  4HGA B;  4R8P A;  3REI A;  3C1C C;  1P3K A;  2BYM A;  5AVC D;  4LD9 D;  5GT3 A;  5B1M D;  3AZN D;  4R8P D;  3REI D;  2FJ7 A;  2NQB A;  1P3K D;  3AV1 B;  4E44 A;  5GXQ A;  3UTB A;  1AOI B;  2NQB D;  5CPK A;  1P34 A;  1KX4 A;  3AV2 B;  1P3L C;  3X1U B;  3A6N D;  5G49 B;  5GXQ D;  3LZ0 C;  3KXB A;  4J8V B;  1KX3 B;  4H9S C;  5CPK D;  1P34 D;  1KX4 D;  3X1V A;  3WTP A;  3AZM C;  4X23 A;  3LZ1 A;  3WA9 B;  1B6W A;  5KDM A;  5E5A C;  1JFI B;  4H9O B;  3LZ0 D;  4JJN C;  3X1V D;  5AV9 C;  1P3P A;  3WTP D;  5CPI A;  4X23 D;  3LZ1 D;  5BNX A;  5B2I A;  3AZI C; 
#chains in the Genus database with same CATH topology
 5AVC B;  4NE5 A;  5GSU B;  5BT1 C;  3H0L C;  1H3O A;  5B1M B;  5BO0 B;  5B24 A;  3AZN B;  2VQR A;  3MGP B;  3REI B;  1P3P D;  5JRG B;  2HIO A;  5B31 B;  5B2I D;  3AL0 C;  3LEL A;  4CAY B;  4G92 C;  3B0C W;  3C1C B;  5AV6 A;  4WNN B;  1PZR A;  4J8U A;  3REJ C;  3LEL D;  3A6N B;  2NZD C;  3TU4 C;  5AV6 D;  3AFA C;  1P3A A;  4ZBJ C;  4J8U D;  1BH8 A;  1M19 C;  1ID3 C;  1N1J A;  3KSY A;  3LJA C;  1P3G A;  1P3L B;  2NZD D;  5CP6 C;  3LZ0 B;  1P3A D;  4CSR A;  3WTP B;  2ARO A;  1P3G D;  3AZM B;  3B6F C;  2Y2H A;  4YM6 C;  5B33 A;  5E5A B;  5BNX B;  4WU8 A;  3NQJ B;  4JJN B;  2F8N K;  5AV9 B;  3AZI B;  2ZY4 A;  4XZQ C;  5B33 D;  1BH9 B;  3REL A;  3MGR A;  1HQ3 C;  2JSS A;  5AY8 C;  4UUZ A;  1P3M A;  3FDD A;  5DNN A;  3MVD C;  2FFF B;  1P3F C;  4M6B A;  4G92 B;  5BNV A;  3REL D;  5C3I B;  3MGR D;  4XZQ D;  4KHA B;  1P3M D;  5DNN D;  3REJ B;  2NZD B;  3TU4 B;  5B0Y C;  3AFA B;  5F99 C;  1TZY C;  4ZBJ B;  3V9R B;  1M19 B;  3VH6 W;  3LJA B;  3C1B C;  2UWX A;  5B0Y D;  2XD1 A;  2W8S A;  3KUY A;  1TZY D;  1P3O C;  3B6F B;  5AVB A;  3NQU A;  4YM6 B;  4ZUX A;  4H9R B;  1HTA A;  4NE3 A;  1AOI C;  1U35 C;  5AVB D;  3VH5 W;  4XZQ B;  1P3O D;  4ZUX D;  1EQZ A;  1HQ3 B;  3W97 C;  5AY8 B;  1M1A D;  3AZL C;  3MVD B;  1KX5 C;  1U35 D;  1P3F B;  1EQZ D;  3WA9 C;  5B32 C;  3REH C;  5AV5 A;  5B1L A;  5B0Y B;  1KX5 D;  4LD9 C;  4H9Q A;  1TZY B;  5B1M C;  4R8P C;  5AV5 D;  3REI C;  5B1L D;  1P3K C;  3C1B B;  3EPK A;  5FUG A;  2F8N B;  5GT3 C;  5B31 G;  2FJ7 C;  2NQB C;  2Y2M A;  4J8W A;  5GT0 A;  4DRB A;  1P3O B;  5B40 A;  3A6N C;  5GXQ C;  4J8W D;  5GT3 D;  5GT0 D;  5CPK C;  1P34 C;  1KX4 C;  1M1A B;  2DF4 C;  5B40 D;  1U35 B;  2FJ7 D;  3KXB C;  3F6T A;  2LY8 A;  5CPJ A;  2RIQ A;  3UTB D;  3X1V C;  3WTP C;  3W97 B;  2ZM5 A;  4X23 C;  3LZ1 C;  2Y2K A;  1Z2C B;  2YFV B;  5B0Z A;  3AZL B;  1KX5 B;  5CPJ D;  3KXB D;  1P3P C;  2JCH A;  5CPI C;  4QLC A;  5B32 B;  4EO5 B;  5B2I C;  3REH B;  5B0Z D;  4KGC A;  2L5A A;  3W99 A;  3WAA A;  5B24 C;  4QLC D;  4J8X A;  4LD9 B;  4WU9 A;  2HIO C;  1F66 A;  5FUG B;  4KGC D;  3MNN A;  3LEL C;  5CPI D;  5B2J A;  3W99 D;  4R8P B;  2CV5 A;  1P3K B;  1B67 A;  2BYM B;  5AV6 C;  3KWQ A;  4J8X D;  5GT3 B;  4WU9 D;  4Z66 A;  3UTA A;  4J8U C;  5C3I C;  5B24 D;  3MNN D;  5B2J D;  2FJ7 B;  2NQB B;  2CV5 D;  3AZK A;  2HIO D;  3KWQ D;  3AZG A;  3B0C T;  4Z66 D;  5GXQ B;  4XUJ A;  3UTB B;  3UTA D;  1P3A C;  1P3I A;  3P5J B;  3AZK D;  1KU5 A;  2Y2N A;  5CPK B;  1P34 B;  1P3G C;  3AZG D;  1KX4 B;  5DNM A;  3AYW A;  5CPJ B;  4XUJ D;  4E45 A;  3KXB B;  3AZF A;  2ARO C;  3W96 A;  3X1V B;  5DNM D;  3AYW D;  3R45 A;  4X23 B;  3LZ1 B;  3EPL A;  5KDM B;  2F2A C;  3AZF D;  5B33 C;  4WU8 C;  3W96 D;  3B0B A;  1P3P B;  3AZJ A;  2ARO D;  5CPI B;  3W99 B;  5B2I B;  3MGQ A;  1P3B A;  1H3O B;  3REL C;  2Y2O A;  5B24 B;  3O62 A;  3MGR C;  3AZJ D;  4H9N A;  5B2J B;  1P3M C;  4WU8 D;  2HIO B;  5DNN C;  2PYO A;  3LEL B;  4NFT A;  3AZE A;  1P3B D;  3UT9 A;  3O62 D;  5AV6 B;  3AZK B;  1ID3 A;  4WZS B;  4J8U B;  3AZG B;  2PYO D;  3AZE D;  3AZH A;  3UT9 D;  3AN2 A;  1P3A B;  3AYW B;  1BH8 B;  2RVQ D;  1N1J B;  3W98 A;  1P3G B;  3AN2 D;  3EPH A;  3MGS A;  1Q9C A;  3X1T A;  4CSR B;  2ARO B;  3X1S A;  3KUY C;  3W98 D;  1ZLA A;  5AV8 A;  3IP4 C;  2F8N G;  3VH6 T;  5AVB C;  3MGS D;  3X1T D;  1S32 A;  3X1S D;  5B33 B;  4ZUX C;  4WU8 B;  5AV8 D;  2BYK A;  3KUY D;  3B0D C;  4YS3 A;  2YFW A;  1M18 A;  1S32 D;  1M1A C;  1EQZ C;  3A1K A;  5JA4 A;  3REL B;  3MGR B;  4YS3 D;  4UUZ B;  1P3M B;  5DNN B;  3B6G A;  3EPJ A;  5BNV B;  1TAF A;  3VH5 T;  3REK A;  2Y2P A;  4H9P A;  3B6G D;  4KUD A;  5AV5 C;  5B1L C;  4EO5 C;  3EG5 B;  5B32 G;  3REK D;  4KUD D;  1T3U A;  3AV1 A;  3X1S B;  4Z5T A;  5BS7 A;  3KUY B;  4J8W C;  5GT0 C;  3AV1 D;  3WKJ A;  3AV2 A;  4Z5T D;  3X1U A;  5AVB B;  4Z2M G;  5B40 C;  5G49 A;  4J8V A;  1KX3 A;  3NQU B;  4YS3 B;  4ZUX B;  3UTB C;  3WKJ D;  3AV2 D;  3X1U D;  3B0D B;  4UPK A;  5JA4 B;  1KX3 D;  3WA9 A;  4WV4 B;  1A7W A;  5CPJ C;  1EQZ B;  1JFI A;  4H9O A;  2Y2G A;  1TAF B;  5B0Z C;  4WJ3 C;  5AVC A;  5GSU A;  5B1M A;  5BO0 A;  3AZN A;  4QLC C;  3MGP A;  5JRG A;  5B31 A;  4KGC C;  4CAY A;  3WAA C;  3W99 C;  5B1L B;  5GSU D;  1R4V A;  5AV5 B;  3C1C A;  1W2E A;  3MGP D;  4J8X C;  4WNN A;  4WU9 C;  4H9Q B;  2G5H C;  5JRG D;  5B31 D;  1F66 C;  3MNN C;  4Z5T B;  5B2J C;  3A6N A;  2CV5 C;  3C1C D;  3KWQ C;  3WAA D;  4Z66 C;  3UTA C;  3WKJ B;  4J8W B;  3AZK C;  5GT0 B;  1F66 D;  3AZG C;  5B40 B;  1P3L A;  4XUJ C;  3LZ0 A;  1P3I C;  2F8N H;  4H9S A;  5DNM C;  3AYW C;  1P3L D;  3AZM A;  3AZF C;  2Y2J A;  3W96 C;  5E5A A;  3NQJ A;  4JJN A;  1P3I D;  5AV9 A;  3AZM D;  5B0Z B;  3AZI A;  1BH9 A;  5E5A D;  1WWS A;  4DRA A;  4JJN D;  2HUE C;  5AV9 D;  3AZJ C;  2Y2I A;  4QLC B;  3MGQ C;  3AZI D;  3H0R C;  4KGC B;  1P3B C;  3WAA B;  5BT1 D;  3O62 C;  4J8X B;  4KHA A;  4WU9 B;  1F66 B;  2PYO C;  3MNN B;  3REJ A;  3AZE C;  3UT9 C;  2CV5 B;  2NZD A;  3TU4 A;  3MGQ D;  3KWQ B;  2XD5 A;  3AFA A;  4Z66 B;  3UTA B;  3V9R A;  3REJ D;  3AZH C;  2CWE A;  2RVQ C;  3TU4 D;  1M19 A;  3LJA A;  1F1E A;  3AFA D;  3AN2 C;  2ZY3 A;  4XUJ B;  5CP6 A;  1P3I B;  4Z2M H;  1M19 D;  1ID3 D;  3LJA D;  3W98 C;  5DNM B;  3AZH D;  3B6F A;  5CP6 D;  3MGS C;  3X1T C;  4AWL C;  3AZF B;  3X1S C;  4YM6 A;  3W96 B;  1ZLA C;  4H9R A;  5AV8 C;  3R45 B;  1ULY A;  3B6F D;  1S32 C;  4XZQ A;  4YM6 D;  2HUE B;  3AZJ B;  4YS3 C;  1HQ3 A;  5AY8 A;  3MGQ B;  1M18 C;  1ZLA D;  3MVD A;  1P3B B;  1P3F A;  3O62 B;  4H9N B;  1HQ3 D;  5AY8 D;  2IO5 C;  2PYO B;  3WTP E;  3B6G C;  3MVD D;  3AZE B;  1P3F D;  3UT9 B;  2J8P A;  1M18 D;  5CHL B;  5B0Y A;  3REK C;  1ID3 B;  5F99 A;  4KUD C;  1TZY A;  4G91 C;  4HGA C;  3AZH B;  4NE6 A;  5CP6 B;  3C1B A;  1BFM A;  2F8N A;  3AN2 B;  5F99 D;  1WWI A;  3C1B D;  3W98 B;  3AV1 C;  4Z5T C;  1P3O A;  2F8N D;  3MGS B;  3X1T B;  4AWL B;  3A1I A;  5BS7 C;  1ZLA B;  5AV8 B;  3WKJ C;  3AV2 C;  1M1A A;  1AOI A;  3X1U C;  1U35 A;  3VH6 A;  4J8V C;  1S32 B;  1KX3 C;  1AOI D;  2BYK B;  3W97 A;  2YFW B;  1M18 B;  2YFV A;  3AZL A;  1KX5 A;  4J8V D;  3W97 D;  2Y2Q A;  5B32 A;  2IO5 B;  3REH A;  3B6G B;  3AZL D;  5AVC C;  5GSU C;  5F99 B;  3KFU G;  3WA9 D;  3AZN C;  3REK B;  5B32 D;  3MGP C;  3VH5 A;  4LD9 A;  4H9P B;  5JRG C;  5B31 C;  4G91 B;  2JE5 A;  3REH D;  4HGA B;  3H0M C;  4KUD B;  4R8P A;  3REI A;  3C1C C;  1P3K A;  2G5I C;  2BYM A;  5AVC D;  4LD9 D;  5GT3 A;  5B1M D;  3AZN D;  4R8P D;  3REI D;  2FJ7 A;  2NQB A;  1P3K D;  3AV1 B;  4E44 A;  5GXQ A;  3UTB A;  2ZY2 A;  1AOI B;  2NQB D;  5CPK A;  1P34 A;  1KX4 A;  3AV2 B;  1P3L C;  3X1U B;  3A6N D;  5G49 B;  5GXQ D;  3LZ0 C;  3KXB A;  4J8V B;  1KX3 B;  4H9S C;  5CPK D;  1P34 D;  1KX4 D;  3X1V A;  3WTP A;  3AZM C;  2ZY5 A;  4X23 A;  3LZ1 A;  3WA9 B;  1B6W A;  5KDM A;  5E5A C;  1JFI B;  4H9O B;  3LZ0 D;  4JJN C;  3X1V D;  5AV9 C;  1P3P A;  3WTP D;  5CPI A;  2DQN C;  2BG1 A;  4X23 D;  3LZ1 D;  5BNX A;  4DQY B;  5B2I A;  3AZI C;  2Y2L A; 
#chains in the Genus database with same CATH homology
 5AVC B;  4NE5 A;  5GSU B;  5BT1 C;  3H0L C;  1H3O A;  5B1M B;  5BO0 B;  5B24 A;  3AZN B;  2VQR A;  3MGP B;  3REI B;  1P3P D;  5JRG B;  2HIO A;  5B31 B;  5B2I D;  3AL0 C;  3LEL A;  4CAY B;  4G92 C;  3B0C W;  3C1C B;  5AV6 A;  4WNN B;  1PZR A;  4J8U A;  3REJ C;  3LEL D;  3A6N B;  2NZD C;  3TU4 C;  5AV6 D;  3AFA C;  1P3A A;  4ZBJ C;  4J8U D;  1BH8 A;  1M19 C;  1ID3 C;  1N1J A;  3KSY A;  3LJA C;  1P3G A;  1P3L B;  2NZD D;  5CP6 C;  3LZ0 B;  1P3A D;  4CSR A;  3WTP B;  2ARO A;  1P3G D;  3AZM B;  3B6F C;  2Y2H A;  4YM6 C;  5B33 A;  5E5A B;  5BNX B;  4WU8 A;  3NQJ B;  4JJN B;  2F8N K;  5AV9 B;  3AZI B;  2ZY4 A;  4XZQ C;  5B33 D;  1BH9 B;  3REL A;  3MGR A;  1HQ3 C;  2JSS A;  5AY8 C;  4UUZ A;  1P3M A;  3FDD A;  5DNN A;  3MVD C;  2FFF B;  1P3F C;  4M6B A;  4G92 B;  5BNV A;  3REL D;  5C3I B;  3MGR D;  4XZQ D;  4KHA B;  1P3M D;  5DNN D;  3REJ B;  2NZD B;  3TU4 B;  5B0Y C;  3AFA B;  5F99 C;  1TZY C;  4ZBJ B;  3V9R B;  1M19 B;  3VH6 W;  3LJA B;  3C1B C;  2UWX A;  5B0Y D;  2XD1 A;  2W8S A;  3KUY A;  1TZY D;  1P3O C;  3B6F B;  5AVB A;  3NQU A;  4YM6 B;  4ZUX A;  4H9R B;  1HTA A;  4NE3 A;  1AOI C;  1U35 C;  5AVB D;  3VH5 W;  4XZQ B;  1P3O D;  4ZUX D;  1EQZ A;  1HQ3 B;  3W97 C;  5AY8 B;  1M1A D;  3AZL C;  3MVD B;  1KX5 C;  1U35 D;  1P3F B;  1EQZ D;  3WA9 C;  5B32 C;  3REH C;  5AV5 A;  5B1L A;  5B0Y B;  1KX5 D;  4LD9 C;  4H9Q A;  1TZY B;  5B1M C;  4R8P C;  5AV5 D;  3REI C;  5B1L D;  1P3K C;  3C1B B;  3EPK A;  5FUG A;  2F8N B;  5GT3 C;  5B31 G;  2FJ7 C;  2NQB C;  2Y2M A;  4J8W A;  5GT0 A;  4DRB A;  1P3O B;  5B40 A;  3A6N C;  5GXQ C;  4J8W D;  5GT3 D;  5GT0 D;  5CPK C;  1P34 C;  1KX4 C;  1M1A B;  2DF4 C;  5B40 D;  1U35 B;  2FJ7 D;  3KXB C;  3F6T A;  2LY8 A;  5CPJ A;  2RIQ A;  3UTB D;  3X1V C;  3WTP C;  3W97 B;  2ZM5 A;  4X23 C;  3LZ1 C;  2Y2K A;  1Z2C B;  2YFV B;  5B0Z A;  3AZL B;  1KX5 B;  5CPJ D;  3KXB D;  1P3P C;  2JCH A;  5CPI C;  4QLC A;  5B32 B;  4EO5 B;  5B2I C;  3REH B;  5B0Z D;  4KGC A;  2L5A A;  3W99 A;  3WAA A;  5B24 C;  4QLC D;  4J8X A;  4LD9 B;  4WU9 A;  2HIO C;  1F66 A;  5FUG B;  4KGC D;  3MNN A;  3LEL C;  5CPI D;  5B2J A;  3W99 D;  4R8P B;  2CV5 A;  1P3K B;  1B67 A;  2BYM B;  5AV6 C;  3KWQ A;  4J8X D;  5GT3 B;  4WU9 D;  4Z66 A;  3UTA A;  4J8U C;  5C3I C;  5B24 D;  3MNN D;  5B2J D;  2FJ7 B;  2NQB B;  2CV5 D;  3AZK A;  2HIO D;  3KWQ D;  3AZG A;  3B0C T;  4Z66 D;  5GXQ B;  4XUJ A;  3UTB B;  3UTA D;  1P3A C;  1P3I A;  3P5J B;  3AZK D;  1KU5 A;  2Y2N A;  5CPK B;  1P34 B;  1P3G C;  3AZG D;  1KX4 B;  5DNM A;  3AYW A;  5CPJ B;  4XUJ D;  4E45 A;  3KXB B;  3AZF A;  2ARO C;  3W96 A;  3X1V B;  5DNM D;  3AYW D;  3R45 A;  4X23 B;  3LZ1 B;  3EPL A;  5KDM B;  2F2A C;  3AZF D;  5B33 C;  4WU8 C;  3W96 D;  3B0B A;  1P3P B;  3AZJ A;  2ARO D;  5CPI B;  3W99 B;  5B2I B;  3MGQ A;  1P3B A;  1H3O B;  3REL C;  2Y2O A;  5B24 B;  3O62 A;  3MGR C;  3AZJ D;  4H9N A;  5B2J B;  1P3M C;  4WU8 D;  2HIO B;  5DNN C;  2PYO A;  3LEL B;  4NFT A;  3AZE A;  1P3B D;  3UT9 A;  3O62 D;  5AV6 B;  3AZK B;  1ID3 A;  4WZS B;  4J8U B;  3AZG B;  2PYO D;  3AZE D;  3AZH A;  3UT9 D;  3AN2 A;  1P3A B;  3AYW B;  1BH8 B;  2RVQ D;  1N1J B;  3W98 A;  1P3G B;  3AN2 D;  3EPH A;  3MGS A;  1Q9C A;  3X1T A;  4CSR B;  2ARO B;  3X1S A;  3KUY C;  3W98 D;  1ZLA A;  5AV8 A;  3IP4 C;  2F8N G;  3VH6 T;  5AVB C;  3MGS D;  3X1T D;  1S32 A;  3X1S D;  5B33 B;  4ZUX C;  4WU8 B;  5AV8 D;  2BYK A;  3KUY D;  3B0D C;  4YS3 A;  2YFW A;  1M18 A;  1S32 D;  1M1A C;  1EQZ C;  3A1K A;  5JA4 A;  3REL B;  3MGR B;  4YS3 D;  4UUZ B;  1P3M B;  5DNN B;  3B6G A;  3EPJ A;  5BNV B;  1TAF A;  3VH5 T;  3REK A;  2Y2P A;  4H9P A;  3B6G D;  4KUD A;  5AV5 C;  5B1L C;  4EO5 C;  3EG5 B;  5B32 G;  3REK D;  4KUD D;  1T3U A;  3AV1 A;  3X1S B;  4Z5T A;  5BS7 A;  3KUY B;  4J8W C;  5GT0 C;  3AV1 D;  3WKJ A;  3AV2 A;  4Z5T D;  3X1U A;  5AVB B;  4Z2M G;  5B40 C;  5G49 A;  4J8V A;  1KX3 A;  3NQU B;  4YS3 B;  4ZUX B;  3UTB C;  3WKJ D;  3AV2 D;  3X1U D;  3B0D B;  4UPK A;  5JA4 B;  1KX3 D;  3WA9 A;  4WV4 B;  1A7W A;  5CPJ C;  1EQZ B;  1JFI A;  4H9O A;  2Y2G A;  1TAF B;  5B0Z C;  4WJ3 C;  5AVC A;  5GSU A;  5B1M A;  5BO0 A;  3AZN A;  4QLC C;  3MGP A;  5JRG A;  5B31 A;  4KGC C;  4CAY A;  3WAA C;  3W99 C;  5B1L B;  5GSU D;  1R4V A;  5AV5 B;  3C1C A;  1W2E A;  3MGP D;  4J8X C;  4WNN A;  4WU9 C;  4H9Q B;  2G5H C;  5JRG D;  5B31 D;  1F66 C;  3MNN C;  4Z5T B;  5B2J C;  3A6N A;  2CV5 C;  3C1C D;  3KWQ C;  3WAA D;  4Z66 C;  3UTA C;  3WKJ B;  4J8W B;  3AZK C;  5GT0 B;  1F66 D;  3AZG C;  5B40 B;  1P3L A;  4XUJ C;  3LZ0 A;  1P3I C;  2F8N H;  4H9S A;  5DNM C;  3AYW C;  1P3L D;  3AZM A;  3AZF C;  2Y2J A;  3W96 C;  5E5A A;  3NQJ A;  4JJN A;  1P3I D;  5AV9 A;  3AZM D;  5B0Z B;  3AZI A;  1BH9 A;  5E5A D;  1WWS A;  4DRA A;  4JJN D;  2HUE C;  5AV9 D;  3AZJ C;  2Y2I A;  4QLC B;  3MGQ C;  3AZI D;  3H0R C;  4KGC B;  1P3B C;  3WAA B;  5BT1 D;  3O62 C;  4J8X B;  4KHA A;  4WU9 B;  1F66 B;  2PYO C;  3MNN B;  3REJ A;  3AZE C;  3UT9 C;  2CV5 B;  2NZD A;  3TU4 A;  3MGQ D;  3KWQ B;  2XD5 A;  3AFA A;  4Z66 B;  3UTA B;  3V9R A;  3REJ D;  3AZH C;  2CWE A;  2RVQ C;  3TU4 D;  1M19 A;  3LJA A;  1F1E A;  3AFA D;  3AN2 C;  2ZY3 A;  4XUJ B;  5CP6 A;  1P3I B;  4Z2M H;  1M19 D;  1ID3 D;  3LJA D;  3W98 C;  5DNM B;  3AZH D;  3B6F A;  5CP6 D;  3MGS C;  3X1T C;  4AWL C;  3AZF B;  3X1S C;  4YM6 A;  3W96 B;  1ZLA C;  4H9R A;  5AV8 C;  3R45 B;  1ULY A;  3B6F D;  1S32 C;  4XZQ A;  4YM6 D;  2HUE B;  3AZJ B;  4YS3 C;  1HQ3 A;  5AY8 A;  3MGQ B;  1M18 C;  1ZLA D;  3MVD A;  1P3B B;  1P3F A;  3O62 B;  4H9N B;  1HQ3 D;  5AY8 D;  2IO5 C;  2PYO B;  3WTP E;  3B6G C;  3MVD D;  3AZE B;  1P3F D;  3UT9 B;  2J8P A;  1M18 D;  5CHL B;  5B0Y A;  3REK C;  1ID3 B;  5F99 A;  4KUD C;  1TZY A;  4G91 C;  4HGA C;  3AZH B;  4NE6 A;  5CP6 B;  3C1B A;  1BFM A;  2F8N A;  3AN2 B;  5F99 D;  1WWI A;  3C1B D;  3W98 B;  3AV1 C;  4Z5T C;  1P3O A;  2F8N D;  3MGS B;  3X1T B;  4AWL B;  3A1I A;  5BS7 C;  1ZLA B;  5AV8 B;  3WKJ C;  3AV2 C;  1M1A A;  1AOI A;  3X1U C;  1U35 A;  3VH6 A;  4J8V C;  1S32 B;  1KX3 C;  1AOI D;  2BYK B;  3W97 A;  2YFW B;  1M18 B;  2YFV A;  3AZL A;  1KX5 A;  4J8V D;  3W97 D;  2Y2Q A;  5B32 A;  2IO5 B;  3REH A;  3B6G B;  3AZL D;  5AVC C;  5GSU C;  5F99 B;  3KFU G;  3WA9 D;  3AZN C;  3REK B;  5B32 D;  3MGP C;  3VH5 A;  4LD9 A;  4H9P B;  5JRG C;  5B31 C;  4G91 B;  2JE5 A;  3REH D;  4HGA B;  3H0M C;  4KUD B;  4R8P A;  3REI A;  3C1C C;  1P3K A;  2G5I C;  2BYM A;  5AVC D;  4LD9 D;  5GT3 A;  5B1M D;  3AZN D;  4R8P D;  3REI D;  2FJ7 A;  2NQB A;  1P3K D;  3AV1 B;  4E44 A;  5GXQ A;  3UTB A;  2ZY2 A;  1AOI B;  2NQB D;  5CPK A;  1P34 A;  1KX4 A;  3AV2 B;  1P3L C;  3X1U B;  3A6N D;  5G49 B;  5GXQ D;  3LZ0 C;  3KXB A;  4J8V B;  1KX3 B;  4H9S C;  5CPK D;  1P34 D;  1KX4 D;  3X1V A;  3WTP A;  3AZM C;  2ZY5 A;  4X23 A;  3LZ1 A;  3WA9 B;  1B6W A;  5KDM A;  5E5A C;  1JFI B;  4H9O B;  3LZ0 D;  4JJN C;  3X1V D;  5AV9 C;  1P3P A;  3WTP D;  5CPI A;  2DQN C;  2BG1 A;  4X23 D;  3LZ1 D;  5BNX A;  4DQY B;  5B2I A;  3AZI C;  2Y2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...