4J8XA

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xA00
5BS7A 3AZKB 4KHAB 1BH8A 3REIA 2FJ7A 3UTAD 2CV5B 2HIOB 3KXBD 1TAFB 5KDMB 3AFAC 3B6FC 1JFIB 3KWQA 2PYOD 3B0DC 3W99D 1BFMA 1P3BC 1HQ3D 2F8NH 1BH9A 3WKJB 3B0BA 5B2JA 1ID3A 4NE3A 2NQBA 4CAYB 1M1AD 1P3PA 3O62A 5CPKC 1P3AA 5AY8B 5B32A 3MNNB 4YS3B 5AVCB 1TZYC 2AROB 3NQJA 5C3IC 3REID 5GT3B 2FJ7D 4H9PB 4AWLC 4CSRA 3LZ1A 1KX4B 5B0ZC 5B0YA 1KU5A 4J8XA 3KWQD 1P3FA 1Q9CA 1M1AB 4QLCA 3AZJA 3WAAC 1B67A 1KX5B 5FUGB 3W97A 3AZKC 3X1VA 2CWEA 1ID3D 5B24B 2NQBD 1R4VA 5GSUA 2CV5C 2HIOC 1P3PD 3O62D 3RELA 3UT9B 5B32D 1P3MB 4WU8A 1AOIC 4ZUXA 3VH6T 3REKB 1BH9B 3WKJC 4DRAA 5B2JB 3LZ1D 5CPIB 5AV6B 2L5AA 3MGRA 3LJAB 5B0YD 4J8XD 1H3OB 4H9NA 1P3FD 4DRBA 1P3PB 1P3GA 5E5AA 3O62B 2NZDA 1P3AB 1P3KA 1P3IA 4QLCD 3AZJD 3AZNB 5AY8C 1EQZB 3MNNC 4XUJA 3X1VD 4YS3C 5AVCC 3W97D 5BT1C 2AROC 4J8UA 1U35A 5GT3C 4LD9B 2BYMA 5GSUD 5AV8A 1N1JA 1P3LB 5CPJA 5F99A 3RELD 3X1SA 5AVBB 1KX4C 5B33A 3AYWA 4WU8D 3R45A 1M1AC 3AV1B 4H9SA 4ZUXD 3UTBB 1KX5C 3X1VB 5BS7C 4KGCD 3V9RB 3AZGB 3MGRD 3WA9A 5B24C 5B2IB 3AZEB 5BNVB 4H9RB 5E5AD 5BNXA 5B32G 2NZDD 1P3KD 3UT9C 2BYKA 4XUJD 4JJNB 4J8UD 1P3MC 1U35D 4J8WA 5AV8D 3REKC 5CPJD 3TU4B 1F66A 3LELA 4WU9A 5F99D 5B2JC 5CPIC 5AV6C 3AN2A 4Z2MH 3LJAC 5B33D 4NE6A 3AYWD 1P34A 3MGSA 3WTPC 1P3GB 1P3PC 5E5AB 3O62C 1P3KB 1P3AC 5GT0B 1P3IB 1KX3D 3AZNC 4WV4B 1F1EA 1EQZC 4HGAB 5AV9A 3AZMC 5B40B 3WA9D 3KUYC 4LD9C 5G49B 1P3LC 4J8VA 3X1SB 5AVBC 3AV1C 3UTBC 4J8WD 5B31B 4UUZA 1F66D 4WU9D 3LELD 4Z5TB 5CP6A 3AN2D 3AZGC 3AZIA 3WA9B 3MVDA 1P34D 5B2IC 3MGSD 3AZEC 5JA4B 3W96B 3B0CW 5BNXB 3C1CA 1S32A 3B6GA 2BYKB 4X23C 5JRGA 3AZHB 4JJNC 5BO0B 5AV9D 1P3OB 3AV2B 3TU4C 4J8VD 2F8NG 4H9OA 3MGSB 3UTAB 3MGQA 1P3GC 5E5AC 1P3KC 3KXBB 1P3IC 5GT0C 5GXQA 5DNMA 2PYOB 5CP6D 3WTPE 5AV9B 4HGAC 5DNNA 3AZID 5B40C 3MVDD 2RVQC 3W99B 3NQUB 1HQ3B 3C1CD 1S32D 3AZLA 3X1SC 3B6GD 1M19A 3REHA 5JRGD 4WNNB 3MGPA 4R8PA 1M18A 4UUZB 5B31C 4Z5TC 3A6NA 4ZBJB 1BH8B 3REIB 2FJ7B 3MGQD 3X1UA 3W96C 5B1LA 3C1CB 5GXQD 5DNMD 3KWQB 3AZHC 3LZ0A 3C1BA 5DNND 2IO5B 1P3OC 3AV2C 2YFWA 4YM6A 5B1MA 3AZLD 1M19D 4KGCA 1ID3B 3REHD 2NQBB 4E45A 3MGSC 3UTAC 3MGPD 4R8PD 3KXBC 1M18D 5DNMB 5B32B 3VH5W 2PYOC 3A6ND 3W99C 3NQJB 2HUEB 1HQ3C 3X1UD 4CSRB 5B1LD 3AZLB 3LZ1B 1M19B 2F8NK 5B0YB 4J8XB 1P3FB 3LZ0D 3C1BD 2F8NA 1M18B 4QLCB 3AZJB 1KX3A 5B1MD 4YM6D 3W97B 4ZBJC 3REIC 5CPKA 2FJ7C 5GSUB 3C1CC 4G92B 3RELB 1TZYA 3AZFA 3KWQC 3LZ0B 4WU8B 2IO5C 3W98A 4ZUXB 3B6FD 5B0ZA 2YFWB 1ULYA 4Z66A 4KGCB 3MGRB 1ID3C 2NQBC 4H9NB 3WAAA 2F8ND 4Z2MG 3AZKA 2NZDB 4KHAA 5DNMC 5B32C 4XUJB 2CV5A 4J8UB 2HIOA 2HUEC 1U35B 5CPKD 2BYMB 5AV8B 5KDMA 1N1JB 4KUDA 5CPJB 1JFIA 3AZLC 5F99B 3LZ1C 1M19C 1TZYD 1AOIA 5B33B 5B0YC 4J8XC 3AYWB 3AZFD 1P3FC 3WKJA 3R45B 4NFTA 3W98D 1M18C 4QLCC 3AZJC 1KX3B 5B0ZD 4XZQA 3X1TA 3X1VC 4Z66D 3W97C 4CAYA 5AY8A 5GSUC 3WAAD 3MNNA 4G92C 4YS3A 5AVCA 3RELC 3AZKD 2AROA 3AZFB 5GT3A 4H9PA 2CV5D 2HIOD 4WU8C 3W98B 4ZUXC 4G91B 2YFVA 4J8WB 1KX4A 4KUDD 1F66B 3LELB 4WU9B 4Z66B 4KGCC 3AN2B 3MGRC 1AOID 1P34B 3WKJD 1KX5A 5FUGA 2NZDC 5B24A 4XZQD 3X1TD 4XUJC 4J8UC 1U35C 3UT9A 5AY8D 5AV8C 4KUDB 5CPJC 3MNND 3VH6W 1HTAA 4J8VB 4YS3D 5AVCD 5F99C 5BT1D 1B6WA 2AROD 1P3MA 3KSYA 1AOIB 5GT3D 5B33C 3AYWC 3REKA 1ZLAA 5CPIA 4H9SC 5AV6A 3REJA 1KX4D 1KX3C 4XZQB 3LJAA 3X1TB 1H3OA 5CP6B 3WTPA 5B31G 3AZIB 3WA9C 3MVDB 3VH5A 3AZNA 1EQZA 1KX5D 1S32B 3B6GB 3AZMA 5B24D 3KUYA 3AZFC 5JRGB 4LD9A 3B0CT 5AV5A 1P3LA 3W98C 5AVBA 2YFVB 4G91C 3UT9D 4J8WC 1F66C 3LELC 4WU9C 4Z66C 1P3MD 3AN2C 4WZSB 3AV1A 4H9OB 1P34C 3UTBA 3REKD 1ZLAD 3MGQB 5B2JD 5CPID 3V9RA 5AV6D 3REJD 5GXQB 3AZGA 3LJAD 5B2IA 3AZEA 3WTPD 5BNVA 5AV9C 5DNNB 4H9RA 1P3AD 1A7WA 4X23A 3AZND 3AFAA 4KUDC 1EQZD 3B6FA 4J8VC 4JJNA 3AZMD 2JSSA 3KUYD 3REHB 1P3BA 4LD9D 1ZLAB 5AV5D 3TU4A 3MGPB 1P3LD 4R8PB 5AVBD 3REJB 4XZQC 3X1TC 3WTPB 4H9QA 5CP6C 1WWSA 5CHLB 3A6NB 3AZIC 3AV1D 3MVDC 3UTBD 5GT0A 3X1UB 5B1LB 1S32C 3B6GC 3AZGD 3AZMB 5B40A 3KUYB 5B2ID 5JRGC 4EO5B 5G49A 3AZED 5AV5B 3C1BB 4X23D 3AFAD 5B1MB 4YM6B 4JJND 1P3BD 5B31A 3MGQC 3TU4D 4Z5TA 5GXQC 2LY8A 5JA4A 3W96A 5DNNC 1P3GD 1P3ID 5GT0D 4X23B 1TAFA 3VH5T 3AFAB 3B6FB 3AZHA 3B0DB 5BO0A 5B40D 2RVQD 1P3BB 3REHC 1ZLAC 1P3OA 3AV2A 3MGPC 2F8NB 4R8PC 3X1SD 3REJC 3UTAA 4H9QB 4E44A 3A6NC 3KXBA 5CPKB 5B31D 3X1UC 5B1LC 4Z5TD 2PYOA 1TZYB 3W99A 5C3IB 3VH6A 4AWLB 3NQUA 1HQ3A 4EO5C 5AV5C 3LZ0C 3C1BC 3W96D 1WWIA 4M6BA 5B0ZB 5B1MC 4WNNA 4YM6C 3AZHD 4NE5A 1M1AA 1P3OD 3AV2D 3WAAB
chains in the Genus database with same CATH superfamily
5BS7A 3AZKB 4KHAB 1BH8A 3REIA 2FJ7A 3UTAD 2CV5B 2HIOB 3KXBD 1TAFB 5KDMB 3AFAC 3B6FC 1JFIB 3KWQA 2PYOD 3B0DC 3W99D 1BFMA 1P3BC 1HQ3D 2F8NH 1BH9A 3WKJB 3B0BA 5B2JA 1ID3A 4NE3A 2NQBA 4CAYB 1M1AD 1P3PA 3O62A 5CPKC 1P3AA 5AY8B 5B32A 3MNNB 4YS3B 5AVCB 1TZYC 2AROB 3NQJA 5C3IC 3REID 5GT3B 2FJ7D 4H9PB 4AWLC 2Y2JA 4CSRA 3LZ1A 1KX4B 2DQNC 5B0ZC 5B0YA 1KU5A 4J8XA 3KWQD 1P3FA 1Q9CA 1M1AB 4QLCA 3AZJA 3WAAC 1B67A 1KX5B 5FUGB 3W97A 3AZKC 3X1VA 2CWEA 1ID3D 5B24B 2NQBD 1R4VA 5GSUA 2CV5C 2HIOC 1P3PD 3O62D 3RELA 3UT9B 5B32D 2DF4C 1P3MB 4WU8A 2JCHA 1AOIC 4ZUXA 3VH6T 3REKB 1BH9B 3WKJC 4DRAA 2UWXA 5B2JB 3LZ1D 5CPIB 2ZY2A 5AV6B 2L5AA 3MGRA 3LJAB 2VQRA 5B0YD 4J8XD 1H3OB 4H9NA 1P3FD 4DRBA 1P3PB 1P3GA 2Y2OA 5E5AA 3O62B 2NZDA 1P3AB 1P3KA 1P3IA 4QLCD 3AZJD 3AZNB 5AY8C 1EQZB 3MNNC 4XUJA 3X1VD 4YS3C 5AVCC 3W97D 1Z2CB 2AROC 5BT1C 4J8UA 1U35A 5GT3C 4LD9B 2BYMA 5GSUD 5AV8A 1N1JA 1P3LB 5CPJA 5F99A 3RELD 3X1SA 5AVBB 1KX4C 5B33A 3AYWA 4WU8D 1PZRA 3R45A 1M1AC 3AV1B 4H9SA 4ZUXD 3UTBB 1KX5C 3X1VB 5BS7C 4KGCD 3V9RB 3AZGB 3IP4C 3MGRD 3WA9A 5B24C 5B2IB 3AZEB 5BNVB 4H9RB 5E5AD 5BNXA 5B32G 2NZDD 1P3KD 3UT9C 2BYKA 4XUJD 4JJNB 4J8UD 1P3MC 1U35D 4J8WA 5AV8D 3REKC 5CPJD 3TU4B 1F66A 3LELA 4WU9A 5F99D 5B2JC 5CPIC 5AV6C 3AN2A 4Z2MH 3LJAC 5B33D 4NE6A 3EPLA 3AYWD 1P34A 3MGSA 3WTPC 1P3GB 1P3PC 5E5AB 3O62C 1P3KB 1P3AC 5GT0B 1P3IB 1KX3D 3AZNC 4WV4B 1F1EA 1EQZC 4HGAB 5AV9A 3AZMC 5B40B 3WA9D 3KUYC 4LD9C 5G49B 1P3LC 4J8VA 3X1SB 5AVBC 3AV1C 3UTBC 4J8WD 2RIQA 5B31B 4UUZA 1F66D 4WU9D 3LELD 4Z5TB 5CP6A 2ZY5A 3AN2D 3AZGC 3AZIA 3WA9B 3MVDA 1P34D 5B2IC 3MGSD 3AZEC 5JA4B 3W96B 3B0CW 5BNXB 3C1CA 1S32A 3B6GA 2BYKB 4X23C 5JRGA 3AZHB 4JJNC 5BO0B 5AV9D 2Y2LA 1P3OB 3AV2B 3TU4C 4J8VD 2F8NG 4H9OA 3MGSB 3UTAB 3MGQA 1P3GC 5E5AC 3FDDA 1P3KC 3KXBB 4UPKA 5GT0C 5GXQA 3EPJA 1P3IC 5DNMA 2PYOB 5CP6D 3WTPE 5AV9B 4HGAC 5DNNA 3AZID 5B40C 3MVDD 2RVQC 3W99B 3AL0C 3NQUB 1HQ3B 2W8SA 3C1CD 1S32D 3AZLA 3X1SC 3B6GD 1M19A 3F6TA 3REHA 5JRGD 4WNNB 3MGPA 4R8PA 1M18A 4UUZB 5B31C 2F2AC 4Z5TC 3A6NA 4ZBJB 1BH8B 3REIB 2FJ7B 3MGQD 3X1UA 3W96C 5B1LA 3C1CB 2Y2PA 5GXQD 5DNMD 3KWQB 3AZHC 3LZ0A 3C1BA 5DNND 2IO5B 1P3OC 3AV2C 2YFWA 5B1MA 4YM6A 3AZLD 1M19D 4KGCA 1ID3B 3REHD 2NQBB 4E45A 3MGSC 3UTAC 3MGPD 4R8PD 3KXBC 1M18D 5DNMB 5B32B 3VH5W 2PYOC 3A6ND 3W99C 3NQJB 2HUEB 1HQ3C 3X1UD 4CSRB 5B1LD 3AZLB 3LZ1B 1M19B 2F8NK 5B0YB 4J8XB 1P3FB 3LZ0D 3C1BD 2F8NA 1M18B 4QLCB 3AZJB 1KX3A 5B1MD 4YM6D 3W97B 4ZBJC 3REIC 2Y2QA 5CPKA 2FJ7C 5GSUB 2Y2IA 3C1CC 4G92B 3RELB 1TZYA 3AZFA 3KWQC 3LZ0B 4WU8B 2IO5C 3W98A 4ZUXB 3B6FD 5B0ZA 2YFWB 1ULYA 4Z66A 4KGCB 3MGRB 1ID3C 2NQBC 3H0MC 4DQYB 2XD5A 4H9NB 3WAAA 2F8ND 4Z2MG 3AZKA 2NZDB 4KHAA 5DNMC 5B32C 4XUJB 2CV5A 4J8UB 2HIOA 2HUEC 1U35B 5CPKD 2BYMB 5AV8B 5KDMA 1N1JB 4KUDA 5CPJB 1JFIA 3AZLC 5F99B 3LZ1C 1M19C 1TZYD 1AOIA 5B33B 5B0YC 4J8XC 3AYWB 3AZFD 1P3FC 2G5HC 2ZY3A 3WKJA 3R45B 4NFTA 3W98D 1M18C 4QLCC 3AZJC 1KX3B 5B0ZD 4XZQA 3X1TA 3X1VC 4Z66D 3W97C 4CAYA 3H0LC 5AY8A 5GSUC 3WAAD 3MNNA 4G92C 4YS3A 5AVCA 3RELC 3P5JB 3AZKD 2AROA 3AZFB 5GT3A 4H9PA 2CV5D 2HIOD 4WU8C 3W98B 2ZM5A 4ZUXC 4G91B 2YFVA 4J8WB 1KX4A 4KUDD 1F66B 3LELB 4WU9B 4Z66B 4KGCC 3AN2B 3MGRC 1AOID 1P34B 3WKJD 1KX5A 2FFFB 5FUGA 2NZDC 5B24A 4XZQD 3X1TD 4XUJC 4J8UC 1U35C 3UT9A 5AY8D 5AV8C 4KUDB 5CPJC 2ZY4A 3MNND 3VH6W 1HTAA 4J8VB 4YS3D 5AVCD 5F99C 5BT1D 1B6WA 2AROD 1P3MA 3KSYA 1AOIB 5GT3D 5B33C 3AYWC 3REKA 1ZLAA 2Y2GA 5CPIA 4H9SC 5AV6A 3REJA 1KX4D 1KX3C 4XZQB 3LJAA 3X1TB 1H3OA 5CP6B 3WTPA 5B31G 3AZIB 3WA9C 3MVDB 3VH5A 3AZNA 1EQZA 1KX5D 1S32B 2BG1A 3B6GB 3AZMA 5B24D 3KUYA 3AZFC 5JRGB 4LD9A 3B0CT 5AV5A 1P3LA 3W98C 5AVBA 2YFVB 4G91C 3UT9D 4J8WC 1F66C 3LELC 4WU9C 4Z66C 1P3MD 3AN2C 4WZSB 3AV1A 4H9OB 1P34C 3UTBA 3REKD 1ZLAD 3MGQB 2Y2MA 2Y2NA 5B2JD 5CPID 3V9RA 5AV6D 3REJD 5GXQB 3AZGA 3LJAD 5B2IA 3AZEA 3WTPD 5BNVA 5AV9C 5DNNB 4H9RA 1P3AD 1A7WA 4X23A 3AZND 3AFAA 4KUDC 1EQZD 3A1KA 3B6FA 4J8VC 4JJNA 2Y2KA 3AZMD 2JSSA 3KUYD 3REHB 1P3BA 4LD9D 1ZLAB 5AV5D 3TU4A 3MGPB 1P3LD 4R8PB 5AVBD 3REJB 4XZQC 3X1TC 3WTPB 4H9QA 2XD1A 1WWSA 5CHLB 5CP6C 3A6NB 3AZIC 3AV1D 3MVDC 3UTBD 5GT0A 1T3UA 3H0RC 3X1UB 5B1LB 1S32C 3B6GC 3AZGD 3AZMB 5B40A 3KUYB 3EPKA 5B2ID 5JRGC 4EO5B 5G49A 3AZED 5AV5B 3C1BB 4X23D 3AFAD 5B1MB 4YM6B 4JJND 3EG5B 1P3BD 5B31A 3MGQC 3TU4D 2G5IC 4Z5TA 5GXQC 1W2EA 2LY8A 5JA4A 3W96A 5DNNC 1P3GD 3EPHA 2JE5A 1P3ID 5GT0D 4X23B 1TAFA 3VH5T 3AFAB 3B6FB 3AZHA 3A1IA 3B0DB 5BO0A 5B40D 2RVQD 1P3BB 3REHC 1ZLAC 1P3OA 3AV2A 3MGPC 2F8NB 4R8PC 3X1SD 3REJC 2Y2HA 3UTAA 4H9QB 4E44A 3A6NC 3KXBA 5CPKB 5B31D 3X1UC 5B1LC 3KFUG 4Z5TD 2PYOA 1TZYB 3W99A 5C3IB 3VH6A 4AWLB 3NQUA 1HQ3A 4EO5C 5AV5C 3LZ0C 4WJ3C 3C1BC 3W96D 1WWIA 4M6BA 5B0ZB 5B1MC 4WNNA 4YM6C 3AZHD 4NE5A 1M1AA 2J8PA 1P3OD 3AV2D 3WAAB
chains in the Genus database with same CATH topology
5BS7A 3AZKB 4KHAB 1BH8A 3REIA 2FJ7A 3UTAD 2CV5B 2HIOB 3KXBD 1TAFB 5KDMB 3AFAC 3B6FC 1JFIB 3KWQA 2PYOD 3B0DC 3W99D 1BFMA 1P3BC 1HQ3D 2F8NH 1BH9A 3WKJB 3B0BA 5B2JA 1ID3A 4NE3A 2NQBA 4CAYB 1M1AD 1P3PA 3O62A 5CPKC 1P3AA 5AY8B 5B32A 3MNNB 4YS3B 5AVCB 1TZYC 2AROB 3NQJA 5C3IC 3REID 5GT3B 2FJ7D 4H9PB 4AWLC 2Y2JA 4CSRA 3LZ1A 1KX4B 2DQNC 5B0ZC 5B0YA 1KU5A 4J8XA 3KWQD 1P3FA 1Q9CA 1M1AB 4QLCA 3AZJA 3WAAC 1B67A 1KX5B 5FUGB 3W97A 3AZKC 3X1VA 2CWEA 1ID3D 5B24B 2NQBD 1R4VA 5GSUA 2CV5C 2HIOC 1P3PD 3O62D 3RELA 3UT9B 5B32D 2DF4C 1P3MB 4WU8A 2JCHA 1AOIC 4ZUXA 3VH6T 3REKB 1BH9B 3WKJC 4DRAA 2UWXA 5B2JB 3LZ1D 5CPIB 2ZY2A 5AV6B 2L5AA 3MGRA 3LJAB 2VQRA 5B0YD 4J8XD 1H3OB 4H9NA 1P3FD 4DRBA 1P3PB 1P3GA 2Y2OA 5E5AA 3O62B 2NZDA 1P3AB 1P3KA 1P3IA 4QLCD 3AZJD 3AZNB 5AY8C 1EQZB 3MNNC 4XUJA 3X1VD 4YS3C 5AVCC 3W97D 1Z2CB 2AROC 5BT1C 4J8UA 1U35A 5GT3C 4LD9B 2BYMA 5GSUD 5AV8A 1N1JA 1P3LB 5CPJA 5F99A 3RELD 3X1SA 5AVBB 1KX4C 5B33A 3AYWA 4WU8D 1PZRA 3R45A 1M1AC 3AV1B 4H9SA 4ZUXD 3UTBB 1KX5C 3X1VB 5BS7C 4KGCD 3V9RB 3AZGB 3IP4C 3MGRD 3WA9A 5B24C 5B2IB 3AZEB 5BNVB 4H9RB 5E5AD 5BNXA 5B32G 2NZDD 1P3KD 3UT9C 2BYKA 4XUJD 4JJNB 4J8UD 1P3MC 1U35D 4J8WA 5AV8D 3REKC 5CPJD 3TU4B 1F66A 3LELA 4WU9A 5F99D 5B2JC 5CPIC 5AV6C 3AN2A 4Z2MH 3LJAC 5B33D 4NE6A 3EPLA 3AYWD 1P34A 3MGSA 3WTPC 1P3GB 1P3PC 5E5AB 3O62C 1P3KB 1P3AC 5GT0B 1P3IB 1KX3D 3AZNC 4WV4B 1F1EA 1EQZC 4HGAB 5AV9A 3AZMC 5B40B 3WA9D 3KUYC 4LD9C 5G49B 1P3LC 4J8VA 3X1SB 5AVBC 3AV1C 3UTBC 4J8WD 2RIQA 5B31B 4UUZA 1F66D 4WU9D 3LELD 4Z5TB 5CP6A 2ZY5A 3AN2D 3AZGC 3AZIA 3WA9B 3MVDA 1P34D 5B2IC 3MGSD 3AZEC 5JA4B 3W96B 3B0CW 5BNXB 3C1CA 1S32A 3B6GA 2BYKB 4X23C 5JRGA 3AZHB 4JJNC 5BO0B 5AV9D 2Y2LA 1P3OB 3AV2B 3TU4C 4J8VD 2F8NG 4H9OA 3MGSB 3UTAB 3MGQA 1P3GC 5E5AC 3FDDA 1P3KC 3KXBB 4UPKA 5GT0C 5GXQA 3EPJA 1P3IC 5DNMA 2PYOB 5CP6D 3WTPE 5AV9B 4HGAC 5DNNA 3AZID 5B40C 3MVDD 2RVQC 3W99B 3AL0C 3NQUB 1HQ3B 2W8SA 3C1CD 1S32D 3AZLA 3X1SC 3B6GD 1M19A 3F6TA 3REHA 5JRGD 4WNNB 3MGPA 4R8PA 1M18A 4UUZB 5B31C 2F2AC 4Z5TC 3A6NA 4ZBJB 1BH8B 3REIB 2FJ7B 3MGQD 3X1UA 3W96C 5B1LA 3C1CB 2Y2PA 5GXQD 5DNMD 3KWQB 3AZHC 3LZ0A 3C1BA 5DNND 2IO5B 1P3OC 3AV2C 2YFWA 5B1MA 4YM6A 3AZLD 1M19D 4KGCA 1ID3B 3REHD 2NQBB 4E45A 3MGSC 3UTAC 3MGPD 4R8PD 3KXBC 1M18D 5DNMB 5B32B 3VH5W 2PYOC 3A6ND 3W99C 3NQJB 2HUEB 1HQ3C 3X1UD 4CSRB 5B1LD 3AZLB 3LZ1B 1M19B 2F8NK 5B0YB 4J8XB 1P3FB 3LZ0D 3C1BD 2F8NA 1M18B 4QLCB 3AZJB 1KX3A 5B1MD 4YM6D 3W97B 4ZBJC 3REIC 2Y2QA 5CPKA 2FJ7C 5GSUB 2Y2IA 3C1CC 4G92B 3RELB 1TZYA 3AZFA 3KWQC 3LZ0B 4WU8B 2IO5C 3W98A 4ZUXB 3B6FD 5B0ZA 2YFWB 1ULYA 4Z66A 4KGCB 3MGRB 1ID3C 2NQBC 3H0MC 4DQYB 2XD5A 4H9NB 3WAAA 2F8ND 4Z2MG 3AZKA 2NZDB 4KHAA 5DNMC 5B32C 4XUJB 2CV5A 4J8UB 2HIOA 2HUEC 1U35B 5CPKD 2BYMB 5AV8B 5KDMA 1N1JB 4KUDA 5CPJB 1JFIA 3AZLC 5F99B 3LZ1C 1M19C 1TZYD 1AOIA 5B33B 5B0YC 4J8XC 3AYWB 3AZFD 1P3FC 2G5HC 2ZY3A 3WKJA 3R45B 4NFTA 3W98D 1M18C 4QLCC 3AZJC 1KX3B 5B0ZD 4XZQA 3X1TA 3X1VC 4Z66D 3W97C 4CAYA 3H0LC 5AY8A 5GSUC 3WAAD 3MNNA 4G92C 4YS3A 5AVCA 3RELC 3P5JB 3AZKD 2AROA 3AZFB 5GT3A 4H9PA 2CV5D 2HIOD 4WU8C 3W98B 2ZM5A 4ZUXC 4G91B 2YFVA 4J8WB 1KX4A 4KUDD 1F66B 3LELB 4WU9B 4Z66B 4KGCC 3AN2B 3MGRC 1AOID 1P34B 3WKJD 1KX5A 2FFFB 5FUGA 2NZDC 5B24A 4XZQD 3X1TD 4XUJC 4J8UC 1U35C 3UT9A 5AY8D 5AV8C 4KUDB 5CPJC 2ZY4A 3MNND 3VH6W 1HTAA 4J8VB 4YS3D 5AVCD 5F99C 5BT1D 1B6WA 2AROD 1P3MA 3KSYA 1AOIB 5GT3D 5B33C 3AYWC 3REKA 1ZLAA 2Y2GA 5CPIA 4H9SC 5AV6A 3REJA 1KX4D 1KX3C 4XZQB 3LJAA 3X1TB 1H3OA 5CP6B 3WTPA 5B31G 3AZIB 3WA9C 3MVDB 3VH5A 3AZNA 1EQZA 1KX5D 1S32B 2BG1A 3B6GB 3AZMA 5B24D 3KUYA 3AZFC 5JRGB 4LD9A 3B0CT 5AV5A 1P3LA 3W98C 5AVBA 2YFVB 4G91C 3UT9D 4J8WC 1F66C 3LELC 4WU9C 4Z66C 1P3MD 3AN2C 4WZSB 3AV1A 4H9OB 1P34C 3UTBA 3REKD 1ZLAD 3MGQB 2Y2MA 2Y2NA 5B2JD 5CPID 3V9RA 5AV6D 3REJD 5GXQB 3AZGA 3LJAD 5B2IA 3AZEA 3WTPD 5BNVA 5AV9C 5DNNB 4H9RA 1P3AD 1A7WA 4X23A 3AZND 3AFAA 4KUDC 1EQZD 3A1KA 3B6FA 4J8VC 4JJNA 2Y2KA 3AZMD 2JSSA 3KUYD 3REHB 1P3BA 4LD9D 1ZLAB 5AV5D 3TU4A 3MGPB 1P3LD 4R8PB 5AVBD 3REJB 4XZQC 3X1TC 3WTPB 4H9QA 2XD1A 1WWSA 5CHLB 5CP6C 3A6NB 3AZIC 3AV1D 3MVDC 3UTBD 5GT0A 1T3UA 3H0RC 3X1UB 5B1LB 1S32C 3B6GC 3AZGD 3AZMB 5B40A 3KUYB 3EPKA 5B2ID 5JRGC 4EO5B 5G49A 3AZED 5AV5B 3C1BB 4X23D 3AFAD 5B1MB 4YM6B 4JJND 3EG5B 1P3BD 5B31A 3MGQC 3TU4D 2G5IC 4Z5TA 5GXQC 1W2EA 2LY8A 5JA4A 3W96A 5DNNC 1P3GD 3EPHA 2JE5A 1P3ID 5GT0D 4X23B 1TAFA 3VH5T 3AFAB 3B6FB 3AZHA 3A1IA 3B0DB 5BO0A 5B40D 2RVQD 1P3BB 3REHC 1ZLAC 1P3OA 3AV2A 3MGPC 2F8NB 4R8PC 3X1SD 3REJC 2Y2HA 3UTAA 4H9QB 4E44A 3A6NC 3KXBA 5CPKB 5B31D 3X1UC 5B1LC 3KFUG 4Z5TD 2PYOA 1TZYB 3W99A 5C3IB 3VH6A 4AWLB 3NQUA 1HQ3A 4EO5C 5AV5C 3LZ0C 4WJ3C 3C1BC 3W96D 1WWIA 4M6BA 5B0ZB 5B1MC 4WNNA 4YM6C 3AZHD 4NE5A 1M1AA 2J8PA 1P3OD 3AV2D 3WAAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS7 A;  3AZK B;  4KHA B;  1BH8 A;  3REI A;  2FJ7 A;  3UTA D;  2CV5 B;  2HIO B;  3KXB D;  1TAF B;  5KDM B;  3AFA C;  3B6F C;  1JFI B;  3KWQ A;  2PYO D;  3B0D C;  3W99 D;  1BFM A;  1P3B C;  1HQ3 D;  2F8N H;  1BH9 A;  3WKJ B;  3B0B A;  5B2J A;  1ID3 A;  4NE3 A;  2NQB A;  4CAY B;  1M1A D;  1P3P A;  3O62 A;  5CPK C;  1P3A A;  5AY8 B;  5B32 A;  3MNN B;  4YS3 B;  5AVC B;  1TZY C;  2ARO B;  3NQJ A;  5C3I C;  3REI D;  5GT3 B;  2FJ7 D;  4H9P B;  4AWL C;  4CSR A;  3LZ1 A;  1KX4 B;  5B0Z C;  5B0Y A;  1KU5 A;  4J8X A;  3KWQ D;  1P3F A;  1Q9C A;  1M1A B;  4QLC A;  3AZJ A;  3WAA C;  1B67 A;  1KX5 B;  5FUG B;  3W97 A;  3AZK C;  3X1V A;  2CWE A;  1ID3 D;  5B24 B;  2NQB D;  1R4V A;  5GSU A;  2CV5 C;  2HIO C;  1P3P D;  3O62 D;  3REL A;  3UT9 B;  5B32 D;  1P3M B;  4WU8 A;  1AOI C;  4ZUX A;  3VH6 T;  3REK B;  1BH9 B;  3WKJ C;  4DRA A;  5B2J B;  3LZ1 D;  5CPI B;  5AV6 B;  2L5A A;  3MGR A;  3LJA B;  5B0Y D;  4J8X D;  1H3O B;  4H9N A;  1P3F D;  4DRB A;  1P3P B;  1P3G A;  5E5A A;  3O62 B;  2NZD A;  1P3A B;  1P3K A;  1P3I A;  4QLC D;  3AZJ D;  3AZN B;  5AY8 C;  1EQZ B;  3MNN C;  4XUJ A;  3X1V D;  4YS3 C;  5AVC C;  3W97 D;  5BT1 C;  2ARO C;  4J8U A;  1U35 A;  5GT3 C;  4LD9 B;  2BYM A;  5GSU D;  5AV8 A;  1N1J A;  1P3L B;  5CPJ A;  5F99 A;  3REL D;  3X1S A;  5AVB B;  1KX4 C;  5B33 A;  3AYW A;  4WU8 D;  3R45 A;  1M1A C;  3AV1 B;  4H9S A;  4ZUX D;  3UTB B;  1KX5 C;  3X1V B;  5BS7 C;  4KGC D;  3V9R B;  3AZG B;  3MGR D;  3WA9 A;  5B24 C;  5B2I B;  3AZE B;  5BNV B;  4H9R B;  5E5A D;  5BNX A;  5B32 G;  2NZD D;  1P3K D;  3UT9 C;  2BYK A;  4XUJ D;  4JJN B;  4J8U D;  1P3M C;  1U35 D;  4J8W A;  5AV8 D;  3REK C;  5CPJ D;  3TU4 B;  1F66 A;  3LEL A;  4WU9 A;  5F99 D;  5B2J C;  5CPI C;  5AV6 C;  3AN2 A;  4Z2M H;  3LJA C;  5B33 D;  4NE6 A;  3AYW D;  1P34 A;  3MGS A;  3WTP C;  1P3G B;  1P3P C;  5E5A B;  3O62 C;  1P3K B;  1P3A C;  5GT0 B;  1P3I B;  1KX3 D;  3AZN C;  4WV4 B;  1F1E A;  1EQZ C;  4HGA B;  5AV9 A;  3AZM C;  5B40 B;  3WA9 D;  3KUY C;  4LD9 C;  5G49 B;  1P3L C;  4J8V A;  3X1S B;  5AVB C;  3AV1 C;  3UTB C;  4J8W D;  5B31 B;  4UUZ A;  1F66 D;  4WU9 D;  3LEL D;  4Z5T B;  5CP6 A;  3AN2 D;  3AZG C;  3AZI A;  3WA9 B;  3MVD A;  1P34 D;  5B2I C;  3MGS D;  3AZE C;  5JA4 B;  3W96 B;  3B0C W;  5BNX B;  3C1C A;  1S32 A;  3B6G A;  2BYK B;  4X23 C;  5JRG A;  3AZH B;  4JJN C;  5BO0 B;  5AV9 D;  1P3O B;  3AV2 B;  3TU4 C;  4J8V D;  2F8N G;  4H9O A;  3MGS B;  3UTA B;  3MGQ A;  1P3G C;  5E5A C;  1P3K C;  3KXB B;  1P3I C;  5GT0 C;  5GXQ A;  5DNM A;  2PYO B;  5CP6 D;  3WTP E;  5AV9 B;  4HGA C;  5DNN A;  3AZI D;  5B40 C;  3MVD D;  2RVQ C;  3W99 B;  3NQU B;  1HQ3 B;  3C1C D;  1S32 D;  3AZL A;  3X1S C;  3B6G D;  1M19 A;  3REH A;  5JRG D;  4WNN B;  3MGP A;  4R8P A;  1M18 A;  4UUZ B;  5B31 C;  4Z5T C;  3A6N A;  4ZBJ B;  1BH8 B;  3REI B;  2FJ7 B;  3MGQ D;  3X1U A;  3W96 C;  5B1L A;  3C1C B;  5GXQ D;  5DNM D;  3KWQ B;  3AZH C;  3LZ0 A;  3C1B A;  5DNN D;  2IO5 B;  1P3O C;  3AV2 C;  2YFW A;  4YM6 A;  5B1M A;  3AZL D;  1M19 D;  4KGC A;  1ID3 B;  3REH D;  2NQB B;  4E45 A;  3MGS C;  3UTA C;  3MGP D;  4R8P D;  3KXB C;  1M18 D;  5DNM B;  5B32 B;  3VH5 W;  2PYO C;  3A6N D;  3W99 C;  3NQJ B;  2HUE B;  1HQ3 C;  3X1U D;  4CSR B;  5B1L D;  3AZL B;  3LZ1 B;  1M19 B;  2F8N K;  5B0Y B;  4J8X B;  1P3F B;  3LZ0 D;  3C1B D;  2F8N A;  1M18 B;  4QLC B;  3AZJ B;  1KX3 A;  5B1M D;  4YM6 D;  3W97 B;  4ZBJ C;  3REI C;  5CPK A;  2FJ7 C;  5GSU B;  3C1C C;  4G92 B;  3REL B;  1TZY A;  3AZF A;  3KWQ C;  3LZ0 B;  4WU8 B;  2IO5 C;  3W98 A;  4ZUX B;  3B6F D;  5B0Z A;  2YFW B;  1ULY A;  4Z66 A;  4KGC B;  3MGR B;  1ID3 C;  2NQB C;  4H9N B;  3WAA A;  2F8N D;  4Z2M G;  3AZK A;  2NZD B;  4KHA A;  5DNM C;  5B32 C;  4XUJ B;  2CV5 A;  4J8U B;  2HIO A;  2HUE C;  1U35 B;  5CPK D;  2BYM B;  5AV8 B;  5KDM A;  1N1J B;  4KUD A;  5CPJ B;  1JFI A;  3AZL C;  5F99 B;  3LZ1 C;  1M19 C;  1TZY D;  1AOI A;  5B33 B;  5B0Y C;  4J8X C;  3AYW B;  3AZF D;  1P3F C;  3WKJ A;  3R45 B;  4NFT A;  3W98 D;  1M18 C;  4QLC C;  3AZJ C;  1KX3 B;  5B0Z D;  4XZQ A;  3X1T A;  3X1V C;  4Z66 D;  3W97 C;  4CAY A;  5AY8 A;  5GSU C;  3WAA D;  3MNN A;  4G92 C;  4YS3 A;  5AVC A;  3REL C;  3AZK D;  2ARO A;  3AZF B;  5GT3 A;  4H9P A;  2CV5 D;  2HIO D;  4WU8 C;  3W98 B;  4ZUX C;  4G91 B;  2YFV A;  4J8W B;  1KX4 A;  4KUD D;  1F66 B;  3LEL B;  4WU9 B;  4Z66 B;  4KGC C;  3AN2 B;  3MGR C;  1AOI D;  1P34 B;  3WKJ D;  1KX5 A;  5FUG A;  2NZD C;  5B24 A;  4XZQ D;  3X1T D;  4XUJ C;  4J8U C;  1U35 C;  3UT9 A;  5AY8 D;  5AV8 C;  4KUD B;  5CPJ C;  3MNN D;  3VH6 W;  1HTA A;  4J8V B;  4YS3 D;  5AVC D;  5F99 C;  5BT1 D;  1B6W A;  2ARO D;  1P3M A;  3KSY A;  1AOI B;  5GT3 D;  5B33 C;  3AYW C;  3REK A;  1ZLA A;  5CPI A;  4H9S C;  5AV6 A;  3REJ A;  1KX4 D;  1KX3 C;  4XZQ B;  3LJA A;  3X1T B;  1H3O A;  5CP6 B;  3WTP A;  5B31 G;  3AZI B;  3WA9 C;  3MVD B;  3VH5 A;  3AZN A;  1EQZ A;  1KX5 D;  1S32 B;  3B6G B;  3AZM A;  5B24 D;  3KUY A;  3AZF C;  5JRG B;  4LD9 A;  3B0C T;  5AV5 A;  1P3L A;  3W98 C;  5AVB A;  2YFV B;  4G91 C;  3UT9 D;  4J8W C;  1F66 C;  3LEL C;  4WU9 C;  4Z66 C;  1P3M D;  3AN2 C;  4WZS B;  3AV1 A;  4H9O B;  1P34 C;  3UTB A;  3REK D;  1ZLA D;  3MGQ B;  5B2J D;  5CPI D;  3V9R A;  5AV6 D;  3REJ D;  5GXQ B;  3AZG A;  3LJA D;  5B2I A;  3AZE A;  3WTP D;  5BNV A;  5AV9 C;  5DNN B;  4H9R A;  1P3A D;  1A7W A;  4X23 A;  3AZN D;  3AFA A;  4KUD C;  1EQZ D;  3B6F A;  4J8V C;  4JJN A;  3AZM D;  2JSS A;  3KUY D;  3REH B;  1P3B A;  4LD9 D;  1ZLA B;  5AV5 D;  3TU4 A;  3MGP B;  1P3L D;  4R8P B;  5AVB D;  3REJ B;  4XZQ C;  3X1T C;  3WTP B;  4H9Q A;  5CP6 C;  1WWS A;  5CHL B;  3A6N B;  3AZI C;  3AV1 D;  3MVD C;  3UTB D;  5GT0 A;  3X1U B;  5B1L B;  1S32 C;  3B6G C;  3AZG D;  3AZM B;  5B40 A;  3KUY B;  5B2I D;  5JRG C;  4EO5 B;  5G49 A;  3AZE D;  5AV5 B;  3C1B B;  4X23 D;  3AFA D;  5B1M B;  4YM6 B;  4JJN D;  1P3B D;  5B31 A;  3MGQ C;  3TU4 D;  4Z5T A;  5GXQ C;  2LY8 A;  5JA4 A;  3W96 A;  5DNN C;  1P3G D;  1P3I D;  5GT0 D;  4X23 B;  1TAF A;  3VH5 T;  3AFA B;  3B6F B;  3AZH A;  3B0D B;  5BO0 A;  5B40 D;  2RVQ D;  1P3B B;  3REH C;  1ZLA C;  1P3O A;  3AV2 A;  3MGP C;  2F8N B;  4R8P C;  3X1S D;  3REJ C;  3UTA A;  4H9Q B;  4E44 A;  3A6N C;  3KXB A;  5CPK B;  5B31 D;  3X1U C;  5B1L C;  4Z5T D;  2PYO A;  1TZY B;  3W99 A;  5C3I B;  3VH6 A;  4AWL B;  3NQU A;  1HQ3 A;  4EO5 C;  5AV5 C;  3LZ0 C;  3C1B C;  3W96 D;  1WWI A;  4M6B A;  5B0Z B;  5B1M C;  4WNN A;  4YM6 C;  3AZH D;  4NE5 A;  1M1A A;  1P3O D;  3AV2 D;  3WAA B; 
#chains in the Genus database with same CATH topology
 5BS7 A;  3AZK B;  4KHA B;  1BH8 A;  3REI A;  2FJ7 A;  3UTA D;  2CV5 B;  2HIO B;  3KXB D;  1TAF B;  5KDM B;  3AFA C;  3B6F C;  1JFI B;  3KWQ A;  2PYO D;  3B0D C;  3W99 D;  1BFM A;  1P3B C;  1HQ3 D;  2F8N H;  1BH9 A;  3WKJ B;  3B0B A;  5B2J A;  1ID3 A;  4NE3 A;  2NQB A;  4CAY B;  1M1A D;  1P3P A;  3O62 A;  5CPK C;  1P3A A;  5AY8 B;  5B32 A;  3MNN B;  4YS3 B;  5AVC B;  1TZY C;  2ARO B;  3NQJ A;  5C3I C;  3REI D;  5GT3 B;  2FJ7 D;  4H9P B;  4AWL C;  2Y2J A;  4CSR A;  3LZ1 A;  1KX4 B;  2DQN C;  5B0Z C;  5B0Y A;  1KU5 A;  4J8X A;  3KWQ D;  1P3F A;  1Q9C A;  1M1A B;  4QLC A;  3AZJ A;  3WAA C;  1B67 A;  1KX5 B;  5FUG B;  3W97 A;  3AZK C;  3X1V A;  2CWE A;  1ID3 D;  5B24 B;  2NQB D;  1R4V A;  5GSU A;  2CV5 C;  2HIO C;  1P3P D;  3O62 D;  3REL A;  3UT9 B;  5B32 D;  2DF4 C;  1P3M B;  4WU8 A;  2JCH A;  1AOI C;  4ZUX A;  3VH6 T;  3REK B;  1BH9 B;  3WKJ C;  4DRA A;  2UWX A;  5B2J B;  3LZ1 D;  5CPI B;  2ZY2 A;  5AV6 B;  2L5A A;  3MGR A;  3LJA B;  2VQR A;  5B0Y D;  4J8X D;  1H3O B;  4H9N A;  1P3F D;  4DRB A;  1P3P B;  1P3G A;  2Y2O A;  5E5A A;  3O62 B;  2NZD A;  1P3A B;  1P3K A;  1P3I A;  4QLC D;  3AZJ D;  3AZN B;  5AY8 C;  1EQZ B;  3MNN C;  4XUJ A;  3X1V D;  4YS3 C;  5AVC C;  3W97 D;  1Z2C B;  2ARO C;  5BT1 C;  4J8U A;  1U35 A;  5GT3 C;  4LD9 B;  2BYM A;  5GSU D;  5AV8 A;  1N1J A;  1P3L B;  5CPJ A;  5F99 A;  3REL D;  3X1S A;  5AVB B;  1KX4 C;  5B33 A;  3AYW A;  4WU8 D;  1PZR A;  3R45 A;  1M1A C;  3AV1 B;  4H9S A;  4ZUX D;  3UTB B;  1KX5 C;  3X1V B;  5BS7 C;  4KGC D;  3V9R B;  3AZG B;  3IP4 C;  3MGR D;  3WA9 A;  5B24 C;  5B2I B;  3AZE B;  5BNV B;  4H9R B;  5E5A D;  5BNX A;  5B32 G;  2NZD D;  1P3K D;  3UT9 C;  2BYK A;  4XUJ D;  4JJN B;  4J8U D;  1P3M C;  1U35 D;  4J8W A;  5AV8 D;  3REK C;  5CPJ D;  3TU4 B;  1F66 A;  3LEL A;  4WU9 A;  5F99 D;  5B2J C;  5CPI C;  5AV6 C;  3AN2 A;  4Z2M H;  3LJA C;  5B33 D;  4NE6 A;  3EPL A;  3AYW D;  1P34 A;  3MGS A;  3WTP C;  1P3G B;  1P3P C;  5E5A B;  3O62 C;  1P3K B;  1P3A C;  5GT0 B;  1P3I B;  1KX3 D;  3AZN C;  4WV4 B;  1F1E A;  1EQZ C;  4HGA B;  5AV9 A;  3AZM C;  5B40 B;  3WA9 D;  3KUY C;  4LD9 C;  5G49 B;  1P3L C;  4J8V A;  3X1S B;  5AVB C;  3AV1 C;  3UTB C;  4J8W D;  2RIQ A;  5B31 B;  4UUZ A;  1F66 D;  4WU9 D;  3LEL D;  4Z5T B;  5CP6 A;  2ZY5 A;  3AN2 D;  3AZG C;  3AZI A;  3WA9 B;  3MVD A;  1P34 D;  5B2I C;  3MGS D;  3AZE C;  5JA4 B;  3W96 B;  3B0C W;  5BNX B;  3C1C A;  1S32 A;  3B6G A;  2BYK B;  4X23 C;  5JRG A;  3AZH B;  4JJN C;  5BO0 B;  5AV9 D;  2Y2L A;  1P3O B;  3AV2 B;  3TU4 C;  4J8V D;  2F8N G;  4H9O A;  3MGS B;  3UTA B;  3MGQ A;  1P3G C;  5E5A C;  3FDD A;  1P3K C;  3KXB B;  4UPK A;  5GT0 C;  5GXQ A;  3EPJ A;  1P3I C;  5DNM A;  2PYO B;  5CP6 D;  3WTP E;  5AV9 B;  4HGA C;  5DNN A;  3AZI D;  5B40 C;  3MVD D;  2RVQ C;  3W99 B;  3AL0 C;  3NQU B;  1HQ3 B;  2W8S A;  3C1C D;  1S32 D;  3AZL A;  3X1S C;  3B6G D;  1M19 A;  3F6T A;  3REH A;  5JRG D;  4WNN B;  3MGP A;  4R8P A;  1M18 A;  4UUZ B;  5B31 C;  2F2A C;  4Z5T C;  3A6N A;  4ZBJ B;  1BH8 B;  3REI B;  2FJ7 B;  3MGQ D;  3X1U A;  3W96 C;  5B1L A;  3C1C B;  2Y2P A;  5GXQ D;  5DNM D;  3KWQ B;  3AZH C;  3LZ0 A;  3C1B A;  5DNN D;  2IO5 B;  1P3O C;  3AV2 C;  2YFW A;  5B1M A;  4YM6 A;  3AZL D;  1M19 D;  4KGC A;  1ID3 B;  3REH D;  2NQB B;  4E45 A;  3MGS C;  3UTA C;  3MGP D;  4R8P D;  3KXB C;  1M18 D;  5DNM B;  5B32 B;  3VH5 W;  2PYO C;  3A6N D;  3W99 C;  3NQJ B;  2HUE B;  1HQ3 C;  3X1U D;  4CSR B;  5B1L D;  3AZL B;  3LZ1 B;  1M19 B;  2F8N K;  5B0Y B;  4J8X B;  1P3F B;  3LZ0 D;  3C1B D;  2F8N A;  1M18 B;  4QLC B;  3AZJ B;  1KX3 A;  5B1M D;  4YM6 D;  3W97 B;  4ZBJ C;  3REI C;  2Y2Q A;  5CPK A;  2FJ7 C;  5GSU B;  2Y2I A;  3C1C C;  4G92 B;  3REL B;  1TZY A;  3AZF A;  3KWQ C;  3LZ0 B;  4WU8 B;  2IO5 C;  3W98 A;  4ZUX B;  3B6F D;  5B0Z A;  2YFW B;  1ULY A;  4Z66 A;  4KGC B;  3MGR B;  1ID3 C;  2NQB C;  3H0M C;  4DQY B;  2XD5 A;  4H9N B;  3WAA A;  2F8N D;  4Z2M G;  3AZK A;  2NZD B;  4KHA A;  5DNM C;  5B32 C;  4XUJ B;  2CV5 A;  4J8U B;  2HIO A;  2HUE C;  1U35 B;  5CPK D;  2BYM B;  5AV8 B;  5KDM A;  1N1J B;  4KUD A;  5CPJ B;  1JFI A;  3AZL C;  5F99 B;  3LZ1 C;  1M19 C;  1TZY D;  1AOI A;  5B33 B;  5B0Y C;  4J8X C;  3AYW B;  3AZF D;  1P3F C;  2G5H C;  2ZY3 A;  3WKJ A;  3R45 B;  4NFT A;  3W98 D;  1M18 C;  4QLC C;  3AZJ C;  1KX3 B;  5B0Z D;  4XZQ A;  3X1T A;  3X1V C;  4Z66 D;  3W97 C;  4CAY A;  3H0L C;  5AY8 A;  5GSU C;  3WAA D;  3MNN A;  4G92 C;  4YS3 A;  5AVC A;  3REL C;  3P5J B;  3AZK D;  2ARO A;  3AZF B;  5GT3 A;  4H9P A;  2CV5 D;  2HIO D;  4WU8 C;  3W98 B;  2ZM5 A;  4ZUX C;  4G91 B;  2YFV A;  4J8W B;  1KX4 A;  4KUD D;  1F66 B;  3LEL B;  4WU9 B;  4Z66 B;  4KGC C;  3AN2 B;  3MGR C;  1AOI D;  1P34 B;  3WKJ D;  1KX5 A;  2FFF B;  5FUG A;  2NZD C;  5B24 A;  4XZQ D;  3X1T D;  4XUJ C;  4J8U C;  1U35 C;  3UT9 A;  5AY8 D;  5AV8 C;  4KUD B;  5CPJ C;  2ZY4 A;  3MNN D;  3VH6 W;  1HTA A;  4J8V B;  4YS3 D;  5AVC D;  5F99 C;  5BT1 D;  1B6W A;  2ARO D;  1P3M A;  3KSY A;  1AOI B;  5GT3 D;  5B33 C;  3AYW C;  3REK A;  1ZLA A;  2Y2G A;  5CPI A;  4H9S C;  5AV6 A;  3REJ A;  1KX4 D;  1KX3 C;  4XZQ B;  3LJA A;  3X1T B;  1H3O A;  5CP6 B;  3WTP A;  5B31 G;  3AZI B;  3WA9 C;  3MVD B;  3VH5 A;  3AZN A;  1EQZ A;  1KX5 D;  1S32 B;  2BG1 A;  3B6G B;  3AZM A;  5B24 D;  3KUY A;  3AZF C;  5JRG B;  4LD9 A;  3B0C T;  5AV5 A;  1P3L A;  3W98 C;  5AVB A;  2YFV B;  4G91 C;  3UT9 D;  4J8W C;  1F66 C;  3LEL C;  4WU9 C;  4Z66 C;  1P3M D;  3AN2 C;  4WZS B;  3AV1 A;  4H9O B;  1P34 C;  3UTB A;  3REK D;  1ZLA D;  3MGQ B;  2Y2M A;  2Y2N A;  5B2J D;  5CPI D;  3V9R A;  5AV6 D;  3REJ D;  5GXQ B;  3AZG A;  3LJA D;  5B2I A;  3AZE A;  3WTP D;  5BNV A;  5AV9 C;  5DNN B;  4H9R A;  1P3A D;  1A7W A;  4X23 A;  3AZN D;  3AFA A;  4KUD C;  1EQZ D;  3A1K A;  3B6F A;  4J8V C;  4JJN A;  2Y2K A;  3AZM D;  2JSS A;  3KUY D;  3REH B;  1P3B A;  4LD9 D;  1ZLA B;  5AV5 D;  3TU4 A;  3MGP B;  1P3L D;  4R8P B;  5AVB D;  3REJ B;  4XZQ C;  3X1T C;  3WTP B;  4H9Q A;  2XD1 A;  1WWS A;  5CHL B;  5CP6 C;  3A6N B;  3AZI C;  3AV1 D;  3MVD C;  3UTB D;  5GT0 A;  1T3U A;  3H0R C;  3X1U B;  5B1L B;  1S32 C;  3B6G C;  3AZG D;  3AZM B;  5B40 A;  3KUY B;  3EPK A;  5B2I D;  5JRG C;  4EO5 B;  5G49 A;  3AZE D;  5AV5 B;  3C1B B;  4X23 D;  3AFA D;  5B1M B;  4YM6 B;  4JJN D;  3EG5 B;  1P3B D;  5B31 A;  3MGQ C;  3TU4 D;  2G5I C;  4Z5T A;  5GXQ C;  1W2E A;  2LY8 A;  5JA4 A;  3W96 A;  5DNN C;  1P3G D;  3EPH A;  2JE5 A;  1P3I D;  5GT0 D;  4X23 B;  1TAF A;  3VH5 T;  3AFA B;  3B6F B;  3AZH A;  3A1I A;  3B0D B;  5BO0 A;  5B40 D;  2RVQ D;  1P3B B;  3REH C;  1ZLA C;  1P3O A;  3AV2 A;  3MGP C;  2F8N B;  4R8P C;  3X1S D;  3REJ C;  2Y2H A;  3UTA A;  4H9Q B;  4E44 A;  3A6N C;  3KXB A;  5CPK B;  5B31 D;  3X1U C;  5B1L C;  3KFU G;  4Z5T D;  2PYO A;  1TZY B;  3W99 A;  5C3I B;  3VH6 A;  4AWL B;  3NQU A;  1HQ3 A;  4EO5 C;  5AV5 C;  3LZ0 C;  4WJ3 C;  3C1B C;  3W96 D;  1WWI A;  4M6B A;  5B0Z B;  5B1M C;  4WNN A;  4YM6 C;  3AZH D;  4NE5 A;  1M1A A;  2J8P A;  1P3O D;  3AV2 D;  3WAA B; 
#chains in the Genus database with same CATH homology
 5BS7 A;  3AZK B;  4KHA B;  1BH8 A;  3REI A;  2FJ7 A;  3UTA D;  2CV5 B;  2HIO B;  3KXB D;  1TAF B;  5KDM B;  3AFA C;  3B6F C;  1JFI B;  3KWQ A;  2PYO D;  3B0D C;  3W99 D;  1BFM A;  1P3B C;  1HQ3 D;  2F8N H;  1BH9 A;  3WKJ B;  3B0B A;  5B2J A;  1ID3 A;  4NE3 A;  2NQB A;  4CAY B;  1M1A D;  1P3P A;  3O62 A;  5CPK C;  1P3A A;  5AY8 B;  5B32 A;  3MNN B;  4YS3 B;  5AVC B;  1TZY C;  2ARO B;  3NQJ A;  5C3I C;  3REI D;  5GT3 B;  2FJ7 D;  4H9P B;  4AWL C;  2Y2J A;  4CSR A;  3LZ1 A;  1KX4 B;  2DQN C;  5B0Z C;  5B0Y A;  1KU5 A;  4J8X A;  3KWQ D;  1P3F A;  1Q9C A;  1M1A B;  4QLC A;  3AZJ A;  3WAA C;  1B67 A;  1KX5 B;  5FUG B;  3W97 A;  3AZK C;  3X1V A;  2CWE A;  1ID3 D;  5B24 B;  2NQB D;  1R4V A;  5GSU A;  2CV5 C;  2HIO C;  1P3P D;  3O62 D;  3REL A;  3UT9 B;  5B32 D;  2DF4 C;  1P3M B;  4WU8 A;  2JCH A;  1AOI C;  4ZUX A;  3VH6 T;  3REK B;  1BH9 B;  3WKJ C;  4DRA A;  2UWX A;  5B2J B;  3LZ1 D;  5CPI B;  2ZY2 A;  5AV6 B;  2L5A A;  3MGR A;  3LJA B;  2VQR A;  5B0Y D;  4J8X D;  1H3O B;  4H9N A;  1P3F D;  4DRB A;  1P3P B;  1P3G A;  2Y2O A;  5E5A A;  3O62 B;  2NZD A;  1P3A B;  1P3K A;  1P3I A;  4QLC D;  3AZJ D;  3AZN B;  5AY8 C;  1EQZ B;  3MNN C;  4XUJ A;  3X1V D;  4YS3 C;  5AVC C;  3W97 D;  1Z2C B;  2ARO C;  5BT1 C;  4J8U A;  1U35 A;  5GT3 C;  4LD9 B;  2BYM A;  5GSU D;  5AV8 A;  1N1J A;  1P3L B;  5CPJ A;  5F99 A;  3REL D;  3X1S A;  5AVB B;  1KX4 C;  5B33 A;  3AYW A;  4WU8 D;  1PZR A;  3R45 A;  1M1A C;  3AV1 B;  4H9S A;  4ZUX D;  3UTB B;  1KX5 C;  3X1V B;  5BS7 C;  4KGC D;  3V9R B;  3AZG B;  3IP4 C;  3MGR D;  3WA9 A;  5B24 C;  5B2I B;  3AZE B;  5BNV B;  4H9R B;  5E5A D;  5BNX A;  5B32 G;  2NZD D;  1P3K D;  3UT9 C;  2BYK A;  4XUJ D;  4JJN B;  4J8U D;  1P3M C;  1U35 D;  4J8W A;  5AV8 D;  3REK C;  5CPJ D;  3TU4 B;  1F66 A;  3LEL A;  4WU9 A;  5F99 D;  5B2J C;  5CPI C;  5AV6 C;  3AN2 A;  4Z2M H;  3LJA C;  5B33 D;  4NE6 A;  3EPL A;  3AYW D;  1P34 A;  3MGS A;  3WTP C;  1P3G B;  1P3P C;  5E5A B;  3O62 C;  1P3K B;  1P3A C;  5GT0 B;  1P3I B;  1KX3 D;  3AZN C;  4WV4 B;  1F1E A;  1EQZ C;  4HGA B;  5AV9 A;  3AZM C;  5B40 B;  3WA9 D;  3KUY C;  4LD9 C;  5G49 B;  1P3L C;  4J8V A;  3X1S B;  5AVB C;  3AV1 C;  3UTB C;  4J8W D;  2RIQ A;  5B31 B;  4UUZ A;  1F66 D;  4WU9 D;  3LEL D;  4Z5T B;  5CP6 A;  2ZY5 A;  3AN2 D;  3AZG C;  3AZI A;  3WA9 B;  3MVD A;  1P34 D;  5B2I C;  3MGS D;  3AZE C;  5JA4 B;  3W96 B;  3B0C W;  5BNX B;  3C1C A;  1S32 A;  3B6G A;  2BYK B;  4X23 C;  5JRG A;  3AZH B;  4JJN C;  5BO0 B;  5AV9 D;  2Y2L A;  1P3O B;  3AV2 B;  3TU4 C;  4J8V D;  2F8N G;  4H9O A;  3MGS B;  3UTA B;  3MGQ A;  1P3G C;  5E5A C;  3FDD A;  1P3K C;  3KXB B;  4UPK A;  5GT0 C;  5GXQ A;  3EPJ A;  1P3I C;  5DNM A;  2PYO B;  5CP6 D;  3WTP E;  5AV9 B;  4HGA C;  5DNN A;  3AZI D;  5B40 C;  3MVD D;  2RVQ C;  3W99 B;  3AL0 C;  3NQU B;  1HQ3 B;  2W8S A;  3C1C D;  1S32 D;  3AZL A;  3X1S C;  3B6G D;  1M19 A;  3F6T A;  3REH A;  5JRG D;  4WNN B;  3MGP A;  4R8P A;  1M18 A;  4UUZ B;  5B31 C;  2F2A C;  4Z5T C;  3A6N A;  4ZBJ B;  1BH8 B;  3REI B;  2FJ7 B;  3MGQ D;  3X1U A;  3W96 C;  5B1L A;  3C1C B;  2Y2P A;  5GXQ D;  5DNM D;  3KWQ B;  3AZH C;  3LZ0 A;  3C1B A;  5DNN D;  2IO5 B;  1P3O C;  3AV2 C;  2YFW A;  5B1M A;  4YM6 A;  3AZL D;  1M19 D;  4KGC A;  1ID3 B;  3REH D;  2NQB B;  4E45 A;  3MGS C;  3UTA C;  3MGP D;  4R8P D;  3KXB C;  1M18 D;  5DNM B;  5B32 B;  3VH5 W;  2PYO C;  3A6N D;  3W99 C;  3NQJ B;  2HUE B;  1HQ3 C;  3X1U D;  4CSR B;  5B1L D;  3AZL B;  3LZ1 B;  1M19 B;  2F8N K;  5B0Y B;  4J8X B;  1P3F B;  3LZ0 D;  3C1B D;  2F8N A;  1M18 B;  4QLC B;  3AZJ B;  1KX3 A;  5B1M D;  4YM6 D;  3W97 B;  4ZBJ C;  3REI C;  2Y2Q A;  5CPK A;  2FJ7 C;  5GSU B;  2Y2I A;  3C1C C;  4G92 B;  3REL B;  1TZY A;  3AZF A;  3KWQ C;  3LZ0 B;  4WU8 B;  2IO5 C;  3W98 A;  4ZUX B;  3B6F D;  5B0Z A;  2YFW B;  1ULY A;  4Z66 A;  4KGC B;  3MGR B;  1ID3 C;  2NQB C;  3H0M C;  4DQY B;  2XD5 A;  4H9N B;  3WAA A;  2F8N D;  4Z2M G;  3AZK A;  2NZD B;  4KHA A;  5DNM C;  5B32 C;  4XUJ B;  2CV5 A;  4J8U B;  2HIO A;  2HUE C;  1U35 B;  5CPK D;  2BYM B;  5AV8 B;  5KDM A;  1N1J B;  4KUD A;  5CPJ B;  1JFI A;  3AZL C;  5F99 B;  3LZ1 C;  1M19 C;  1TZY D;  1AOI A;  5B33 B;  5B0Y C;  4J8X C;  3AYW B;  3AZF D;  1P3F C;  2G5H C;  2ZY3 A;  3WKJ A;  3R45 B;  4NFT A;  3W98 D;  1M18 C;  4QLC C;  3AZJ C;  1KX3 B;  5B0Z D;  4XZQ A;  3X1T A;  3X1V C;  4Z66 D;  3W97 C;  4CAY A;  3H0L C;  5AY8 A;  5GSU C;  3WAA D;  3MNN A;  4G92 C;  4YS3 A;  5AVC A;  3REL C;  3P5J B;  3AZK D;  2ARO A;  3AZF B;  5GT3 A;  4H9P A;  2CV5 D;  2HIO D;  4WU8 C;  3W98 B;  2ZM5 A;  4ZUX C;  4G91 B;  2YFV A;  4J8W B;  1KX4 A;  4KUD D;  1F66 B;  3LEL B;  4WU9 B;  4Z66 B;  4KGC C;  3AN2 B;  3MGR C;  1AOI D;  1P34 B;  3WKJ D;  1KX5 A;  2FFF B;  5FUG A;  2NZD C;  5B24 A;  4XZQ D;  3X1T D;  4XUJ C;  4J8U C;  1U35 C;  3UT9 A;  5AY8 D;  5AV8 C;  4KUD B;  5CPJ C;  2ZY4 A;  3MNN D;  3VH6 W;  1HTA A;  4J8V B;  4YS3 D;  5AVC D;  5F99 C;  5BT1 D;  1B6W A;  2ARO D;  1P3M A;  3KSY A;  1AOI B;  5GT3 D;  5B33 C;  3AYW C;  3REK A;  1ZLA A;  2Y2G A;  5CPI A;  4H9S C;  5AV6 A;  3REJ A;  1KX4 D;  1KX3 C;  4XZQ B;  3LJA A;  3X1T B;  1H3O A;  5CP6 B;  3WTP A;  5B31 G;  3AZI B;  3WA9 C;  3MVD B;  3VH5 A;  3AZN A;  1EQZ A;  1KX5 D;  1S32 B;  2BG1 A;  3B6G B;  3AZM A;  5B24 D;  3KUY A;  3AZF C;  5JRG B;  4LD9 A;  3B0C T;  5AV5 A;  1P3L A;  3W98 C;  5AVB A;  2YFV B;  4G91 C;  3UT9 D;  4J8W C;  1F66 C;  3LEL C;  4WU9 C;  4Z66 C;  1P3M D;  3AN2 C;  4WZS B;  3AV1 A;  4H9O B;  1P34 C;  3UTB A;  3REK D;  1ZLA D;  3MGQ B;  2Y2M A;  2Y2N A;  5B2J D;  5CPI D;  3V9R A;  5AV6 D;  3REJ D;  5GXQ B;  3AZG A;  3LJA D;  5B2I A;  3AZE A;  3WTP D;  5BNV A;  5AV9 C;  5DNN B;  4H9R A;  1P3A D;  1A7W A;  4X23 A;  3AZN D;  3AFA A;  4KUD C;  1EQZ D;  3A1K A;  3B6F A;  4J8V C;  4JJN A;  2Y2K A;  3AZM D;  2JSS A;  3KUY D;  3REH B;  1P3B A;  4LD9 D;  1ZLA B;  5AV5 D;  3TU4 A;  3MGP B;  1P3L D;  4R8P B;  5AVB D;  3REJ B;  4XZQ C;  3X1T C;  3WTP B;  4H9Q A;  2XD1 A;  1WWS A;  5CHL B;  5CP6 C;  3A6N B;  3AZI C;  3AV1 D;  3MVD C;  3UTB D;  5GT0 A;  1T3U A;  3H0R C;  3X1U B;  5B1L B;  1S32 C;  3B6G C;  3AZG D;  3AZM B;  5B40 A;  3KUY B;  3EPK A;  5B2I D;  5JRG C;  4EO5 B;  5G49 A;  3AZE D;  5AV5 B;  3C1B B;  4X23 D;  3AFA D;  5B1M B;  4YM6 B;  4JJN D;  3EG5 B;  1P3B D;  5B31 A;  3MGQ C;  3TU4 D;  2G5I C;  4Z5T A;  5GXQ C;  1W2E A;  2LY8 A;  5JA4 A;  3W96 A;  5DNN C;  1P3G D;  3EPH A;  2JE5 A;  1P3I D;  5GT0 D;  4X23 B;  1TAF A;  3VH5 T;  3AFA B;  3B6F B;  3AZH A;  3A1I A;  3B0D B;  5BO0 A;  5B40 D;  2RVQ D;  1P3B B;  3REH C;  1ZLA C;  1P3O A;  3AV2 A;  3MGP C;  2F8N B;  4R8P C;  3X1S D;  3REJ C;  2Y2H A;  3UTA A;  4H9Q B;  4E44 A;  3A6N C;  3KXB A;  5CPK B;  5B31 D;  3X1U C;  5B1L C;  3KFU G;  4Z5T D;  2PYO A;  1TZY B;  3W99 A;  5C3I B;  3VH6 A;  4AWL B;  3NQU A;  1HQ3 A;  4EO5 C;  5AV5 C;  3LZ0 C;  4WJ3 C;  3C1B C;  3W96 D;  1WWI A;  4M6B A;  5B0Z B;  5B1M C;  4WNN A;  4YM6 C;  3AZH D;  4NE5 A;  1M1A A;  2J8P A;  1P3O D;  3AV2 D;  3WAA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...