4J8XA

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xA00
5JRGD 2NQBB 4J8WD 1KX5D 5B33A 3X1TD 3RELA 5B24D 2RVQD 4DRAA 5GT3A 3A6NA 1P34C 1N1JB 4AWLC 3MGQD 1ZLAA 1HTAA 5AV5C 5F99B 4J8VB 3AZFD 4YM6B 3WKJD 5GXQC 5AV6A 3REHC 3KXBC 4YS3B 3B0BA 5B1MB 3TU4C 1P3MA 3UTBA 2NQBA 1ID3D 5B40D 5AVBD 4LD9D 3AZLB 1N1JA 5C3IC 4J8VA 4WU9B 4YM6A 3X1SB 3UTAD 4YS3A 1WWSA 5B1MA 1TZYC 3W97B 3RELD 3C1BD 5GT3D 3AZNB 3VH5W 3LZ0D 3AZLA 5GSUB 3B0CT 4WU9A 5AV6D 5AVCB 4J8UB 3X1SA 4J8WC 3LZ1A 3AZKC 4ZUXC 3UTBD 3AZHC 3AYWC 3W97A 3AV1D 4E45A 4EO5B 5CPJA 5B1LD 2HIOC 5GSUA 2AROB 5AVCA 2IO5B 4YS3D 1M19D 1JFIB 1U35C 3MGSC 3WTPB 4Z5TD 3MVDB 4XUJB 5GT0C 3KWQC 3AZEC 4CSRB 5AV9A 1P3LC 1S32A 1P3OC 3UT9C 4WU9D 4KUDB 4E44A 3LZ1D 3LELA 5BS7A 3AZJB 1JFIA 3WTPA 3MVDA 3LZ0C 1WWIA 4XUJA 3W97D 4CSRA 3WAAA 5CPJD 2L5AA 1M18C 1HQ3A 4R8PA 2JSSA 5AV8A 5AVCD 5AV5B 3O62A 1TAFB 1A7WA 3REHB 3AZJA 5B1LC 5B2IB 3LJAC 5AV9D 3AZGC 5KDMB 4XZQC 1S32D 1Q9CA 4Z5TC 1KX4C 2LY8A 3LELD 5AV5A 1TAFA 5GXQA 3REHA 4Z2MH 5B0YD 3MGPB 3WAAD 4H9QB 5KDMA 1HQ3D 4R8PD 1P3PC 5AV8D 5CPIB 3WA9D 5B2JC 3O62D 3AV2C 1R4VA 2NZDB 4G91C 4QLCD 5JRGB 5DNNC 4J8WB 3X1TB 4J8XC 3AZKB 4ZUXB 3MGQB 4H9QA 5G49A 1P3AC 3AZMD 1P34D 3WKJB 3B6GC 5CPIA 4HGAB 2HIOB 3REKC 5B31C 2NZDA 5GXQD 3REHD 5JRGA 3KXBD 5B40B 4J8WA 3X1TA 3TU4D 3AZKA 4ZUXA 4H9PB 3W96C 3B0DB 3MGQA 1P3OB 4NE6A 3UTAB 2HIOA 3UT9B 3AZIC 1AOID 2FJ7C 3RELB 5B40A 3AFAC 3C1BB 1B67A 5GT3B 4H9PA 1TZYD 3LZ0B 3R45B 5GT0A 4H9SA 5AV6B 1P3OA 5BNXB 1KU5A 1F1EA 3UT9A 3UTBB 4UUZB 3AZKD 3AV1B 3KSYA 4ZUXD 3C1BA 3AZMC 3AZHD 2PYOD 4DRBA 5B1LB 3AYWD 3VH6A 3LZ0A 3R45A 4XZQB 1M1AC 2HIOD 1M18A 5BNXA 3W99D 1M19B 4Z5TB 4UUZA 3AV1A 3MGSD 1U35D 3REJC 5B1LA 5GT0D 3KWQD 3AZED 3AZGA 1P3LD 4XZQA 1AOIC 1P3OD 3LZ1B 5E5AC 3UT9D 1M19A 4Z5TA 1KX4A 1P3KC 4G91B 5CPJB 2F8ND 1M18D 2F8NG 2CV5C 1F66C 3AN2C 3VH6W 1BFMA 5AV9B 1S32B 3LJAD 3REID 3AZGD 3W99C 4XZQD 3B0CW 4X23C 3LELB 1EQZC 3B6GA 1KX4D 4G92C 5B0YB 4Z66C 3WAAB 2FJ7B 1HQ3B 4R8PB 3MNND 5AV8B 3WA9B 2HUEC 3O62B 3X1VC 1P3PD 3MGRC 4QLCB 5B2JD 3AV2D 4WZSB 5B0YA 2FJ7A 5DNND 4J8XD 3AFAA 3AZMB 1P34B 4AWLB 3WA9A 1P3AD 1P3BC 3B6GD 5GXQB 4QLCA 1M1AB 5FUGB 3KXBB 3KUYC 3REKD 5B31D 3TU4B 3REIC 5B31G 3AZMA 1P34A 4ZBJC 5B33C 3W96D 1ZLAC 5C3IB 1AOIB 3W98C 3X1UC 1M1AA 3AZID 5E5AB 5FUGA 3KXBA 4KHAB 3MNNC 5B0ZC 3TU4A 2FJ7D 5G49B 1TZYB 1P3KB 1P3MC 3AFAD 1BH9B 2NQBC 1AOIA 5F99C 4J8VC 3V9RB 4YM6C 5E5AA 2BYKB 4KHAA 3AN2B 3AZHB 1P3GD 1TZYA 3AYWB 1P3KA 1BH9A 4JJNC 3W99B 3WTPE 1M1AD 3V9RA 1U35B 2BYKA 3MGSB 3X1SC 3AN2A 1P3ID 4G92B 5DNMC 3AZHA 4KGCD 3AYWA 5GT0B 3KWQB 3AZEB 4NFTA 3REJD 1P3LB 4WU8C 3AZNC 3W99A 5GSUC 4X23A 5E5AD 3MGRB 1U35A 3MGSA 4J8UC 5AY8C 1P3KD 2F8NB 3KWQA 3AZEA 1P3LA 5CP6C 1M18B 4EO5C 5JA4B 4CAYB 1H3OB 1P3GC 1P3FC 3NQUB 3X1VA 2AROC 2CV5D 1P3BB 3MGRA 1F66D 3AN2D 2IO5C 3LJAB 1KX3C 3WTPC 3MVDC 3REIB 3AZGB 2F8NA 4XUJC 2F8NK 3C1CC 5CPKC 1P3IC 4H9NB 5JA4A 1KX4B 4CAYA 1H3OA 4X23D 4KGCC 3NQUA 1P3BA 1EQZD 3X1UB 4KUDC 3KUYA 3MNNB 3LJAA 4Z66D 2F8NH 3REIA 1P3PB 1BH8A 4H9NA 5B2JB 3X1VD 3AV2B 3MGRD 3W98A 5DNNB 3X1UA 4J8XB 3MNNA 5B0ZA 5B2IC 1P3AB 1P3PA 3B6GB 5BT1C 5B2JA 4JJNB 3REKB 3VH5T 5B31B 3AV2A 1P3BD 3B6FC 5F99A 5DNNA 3KUYD 4J8XA 5DNMB 3W96B 3MGPC 1P3AA 3VH6T 5B33D 4WU8B 3A6ND 1ZLAD 3AZIB 5B32C 5CPIC 4JJNA 3REKA 4H9OB 5B31A 3W98D 3X1UD 2PYOC 2NZDC 3AFAB 5B0ZD 5JRGC 1KX5C 5DNMA 5AY8B 3X1TC 5B24C 3W96A 2RVQC 1P3MD 2NQBD 3MGQC 5CP6B 3AZFC 4WU8A 3WKJC 3AZIA 3AZNA 4HGAC 4H9OA 5F99D 4J8VD 1P3GB 4YM6D 1P3FB 1ID3C 4J8UA 5B40C 5B1MD 1KX3B 5AY8A 5AVBC 4LD9C 3B0DC 3C1CB 5CP6A 5CPKB 4JJND 4H9SC 3AZLD 1P3IB 3UTAC 1P3GA 1P3FA 4KGCB 2AROA 3X1SD 3REJB 2BYMB 5DNMD 3RELC 3C1BC 5GT3C 3A6NC 1KX3A 4WU8D 3C1CA 3AZND 5CPKA 5AV6C 4NE3A 1P3IA 5GSUD 4KGCA 3UTBC 4J8UD 3REJA 2BYMA 4KUDA 5AY8D 3AV1C 4H9RB 2YFWB 4M6BA 4WNNB 5CP6D 2CV5B 1F66B 4YS3C 1P3FD 1M19C 5B1MC 2AROD 3B6FB 1KX3D 3WTPD 3MVDD 4H9RA 3AZLC 4XUJD 2YFWA 5B2IA 3C1CD 2YFVB 4WNNA 4X23B 4WU9C 5CPKD 1B6WA 2CV5A 1EQZB 1F66A 5BNVB 3LZ1C 5B32B 4Z66B 3B6FA 2PYOB 3W97C 4KUDD 4NE5A 3AZJD 5CPJC 5BO0B 1KX5B 2HUEB 5B24B 3X1VB 2YFVA 3MGPA 4WV4B 5AVCC 4Z2MG 3AZFB 1EQZA 5BNVA 3NQJB 5B32A 4Z66A 5AV5D 2PYOA 5AV9C 1S32C 1ID3B 2CWEA 5BO0A 5B2ID 1KX5A 5B24A 5AVBB 4LD9B 5BT1D 3LELC 3AZFA 5BS7C 3KUYB 3WKJA 1ULYA 3NQJA 3B6FD 5B0YC 3WAAC 5CHLB 4ZBJB 1BH8B 5B33B 1ID3A 1HQ3C 4R8PC 3A6NB 1ZLAB 3MGPD 5AV8C 3WA9C 5AVBA 4LD9A 3W98B 3O62C 5B32D 5CPID 4QLCC 3AZJC 5B0ZB 3VH5A 3UTAA 5B32G 2NZDD 1P3MB
chains in the Genus database with same CATH superfamily
5JRGD 2NQBB 4J8WD 1KX5D 5B33A 3X1TD 3RELA 5B24D 2RVQD 4DRAA 5GT3A 3A6NA 1P34C 1N1JB 4AWLC 3MGQD 1ZLAA 1HTAA 5AV5C 5F99B 4J8VB 3AZFD 4YM6B 3WKJD 5GXQC 5AV6A 3REHC 3KXBC 4YS3B 3B0BA 5B1MB 3TU4C 1P3MA 3UTBA 2NQBA 1ID3D 5B40D 4DQYB 5AVBD 4LD9D 3AZLB 1N1JA 5C3IC 4J8VA 4WU9B 4YM6A 3X1SB 3UTAD 4YS3A 1WWSA 5B1MA 1TZYC 3W97B 3RELD 3C1BD 5GT3D 3AZNB 3VH5W 3LZ0D 3AZLA 3EG5B 5GSUB 3B0CT 4WU9A 5AV6D 5AVCB 4J8UB 3X1SA 4J8WC 3LZ1A 3AZKC 4ZUXC 3UTBD 3AZHC 3AYWC 3W97A 3AV1D 4E45A 4EO5B 5CPJA 5B1LD 3H0MC 2HIOC 5GSUA 2AROB 5AVCA 2IO5B 4YS3D 1M19D 1JFIB 1U35C 3MGSC 3WTPB 4Z5TD 3MVDB 4XUJB 2Y2IA 5GT0C 3KWQC 3AZEC 4CSRB 5AV9A 2Y2GA 1P3LC 1S32A 1P3OC 2Y2LA 2Y2JA 3UT9C 4WU9D 4KUDB 4E44A 3LZ1D 3LELA 5BS7A 3AZJB 1JFIA 2VQRA 3WTPA 3MVDA 3LZ0C 1WWIA 4XUJA 3W97D 4CSRA 3WAAA 5CPJD 2L5AA 1M18C 1HQ3A 4R8PA 2JSSA 5AV8A 5AVCD 2Y2KA 5AV5B 3O62A 1TAFB 1A7WA 2DF4C 3REHB 3AZJA 3KFUG 5B1LC 5B2IB 3LJAC 5AV9D 3AZGC 5KDMB 4XZQC 1S32D 1Q9CA 2XD1A 4Z5TC 1KX4C 2LY8A 3LELD 5AV5A 1TAFA 5GXQA 3REHA 4Z2MH 5B0YD 3MGPB 3WAAD 4H9QB 5KDMA 2ZY2A 2DQNC 1HQ3D 4R8PD 1P3PC 5AV8D 5CPIB 3WA9D 5B2JC 3O62D 2Y2OA 3AV2C 1R4VA 2NZDB 4G91C 4QLCD 5JRGB 5DNNC 4J8WB 3X1TB 4J8XC 3AZKB 4ZUXB 3MGQB 4H9QA 5G49A 1P3AC 3AZMD 1P34D 3WKJB 3B6GC 5CPIA 4HGAB 2HIOB 3REKC 5B31C 2NZDA 5GXQD 3REHD 5JRGA 3KXBD 5B40B 4J8WA 3X1TA 3TU4D 3AZKA 4ZUXA 4H9PB 3W96C 3B0DB 3MGQA 1P3OB 4NE6A 3UTAB 2HIOA 3UT9B 3AZIC 1AOID 2FJ7C 3RELB 5B40A 3AFAC 3C1BB 1B67A 5GT3B 4H9PA 1TZYD 3LZ0B 2ZM5A 3R45B 5GT0A 4H9SA 5AV6B 1P3OA 5BNXB 1KU5A 1F1EA 3UT9A 3UTBB 2G5HC 4UUZB 3AZKD 3AV1B 3KSYA 4ZUXD 3C1BA 3AZMC 3AZHD 2PYOD 4DRBA 2FFFB 5B1LB 3AYWD 3VH6A 3LZ0A 3R45A 3EPJA 4XZQB 1M1AC 2HIOD 1M18A 5BNXA 3W99D 1M19B 4Z5TB 4UUZA 3AV1A 3MGSD 1U35D 3REJC 5B1LA 5GT0D 3KWQD 3AZED 3AZGA 1P3LD 4XZQA 1AOIC 1P3OD 3LZ1B 5E5AC 3UT9D 1M19A 4Z5TA 1KX4A 1P3KC 4G91B 3A1IA 5CPJB 4WJ3C 2F8ND 1M18D 2F8NG 2CV5C 1F66C 3AN2C 3VH6W 1BFMA 5AV9B 1S32B 3LJAD 3REID 3AZGD 3W99C 4XZQD 3B0CW 3EPLA 3H0RC 4X23C 3LELB 1EQZC 3B6GA 1KX4D 4G92C 5B0YB 4Z66C 3WAAB 2FJ7B 1HQ3B 4R8PB 3MNND 5AV8B 3WA9B 2HUEC 3O62B 3X1VC 1P3PD 3MGRC 4QLCB 5B2JD 3AV2D 3FDDA 4WZSB 5B0YA 2FJ7A 5DNND 4J8XD 3AFAA 3AZMB 1P34B 4AWLB 3WA9A 1P3AD 2ZY4A 1P3BC 3B6GD 5GXQB 4QLCA 1M1AB 5FUGB 3KXBB 3KUYC 3REKD 5B31D 3TU4B 3REIC 5B31G 3AZMA 1P34A 4ZBJC 5B33C 3W96D 1ZLAC 5C3IB 1AOIB 3W98C 3X1UC 1M1AA 3AZID 5E5AB 5FUGA 3KXBA 4KHAB 3MNNC 5B0ZC 3TU4A 2FJ7D 5G49B 1TZYB 1P3KB 1P3MC 3AFAD 2JE5A 1BH9B 2NQBC 2XD5A 1AOIA 5F99C 4J8VC 3V9RB 4YM6C 5E5AA 2BYKB 4KHAA 3AN2B 3AZHB 1P3GD 2Y2MA 1TZYA 3AYWB 1P3KA 1BH9A 4JJNC 3W99B 3WTPE 1M1AD 2W8SA 3V9RA 1Z2CB 1U35B 2BYKA 3MGSB 3P5JB 3AN2A 3X1SC 4G92B 5DNMC 3AZHA 1P3ID 4KGCD 3AYWA 5GT0B 3KWQB 3AZEB 4NFTA 3REJD 1P3LB 4WU8C 3AZNC 3W99A 5GSUC 4X23A 5E5AD 3MGRB 1T3UA 1U35A 3MGSA 4J8UC 5AY8C 1P3KD 2F8NB 3KWQA 3AZEA 1P3LA 5CP6C 1M18B 4EO5C 5JA4B 4CAYB 1H3OB 3EPKA 1P3GC 1P3FC 3NQUB 3X1VA 2AROC 2CV5D 1P3BB 3MGRA 1F66D 3AN2D 2IO5C 3LJAB 1KX3C 3WTPC 3MVDC 3REIB 3AZGB 2F8NA 4XUJC 2F8NK 1W2EA 3C1CC 5CPKC 2G5IC 1P3IC 4H9NB 5JA4A 1KX4B 4CAYA 1H3OA 4X23D 4KGCC 3NQUA 4UPKA 1P3BA 1EQZD 3X1UB 4KUDC 3KUYA 3MNNB 3LJAA 4Z66D 2F8NH 3REIA 1P3PB 2JCHA 1BH8A 4H9NA 5B2JB 3X1VD 3AV2B 3MGRD 3W98A 5DNNB 3X1UA 4J8XB 2Y2PA 3MNNA 5B0ZA 5B2IC 1P3AB 1P3PA 3B6GB 5BT1C 5B2JA 4JJNB 3REKB 3VH5T 5B31B 3AV2A 1P3BD 2Y2NA 3B6FC 5F99A 5DNNA 3KUYD 4J8XA 5DNMB 3W96B 3MGPC 1P3AA 3VH6T 5B33D 4WU8B 3A6ND 1ZLAD 3AZIB 5B32C 5CPIC 4JJNA 3REKA 4H9OB 2BG1A 5B31A 3W98D 2F2AC 3X1UD 2PYOC 2NZDC 3AFAB 5B0ZD 5JRGC 1KX5C 5DNMA 5AY8B 3X1TC 5B24C 3W96A 2RVQC 1P3MD 2NQBD 3MGQC 5CP6B 3AZFC 4WU8A 3WKJC 3AL0C 3AZIA 3AZNA 4HGAC 4H9OA 5F99D 4J8VD 1P3GB 4YM6D 1P3FB 1ID3C 4J8UA 5B40C 5B1MD 1KX3B 5AY8A 5AVBC 4LD9C 3B0DC 3C1CB 5CP6A 5CPKB 4JJND 4H9SC 1PZRA 3AZLD 1P3IB 3UTAC 1P3GA 1P3FA 4KGCB 2AROA 3X1SD 3REJB 2BYMB 5DNMD 3RELC 3C1BC 5GT3C 3A6NC 1KX3A 3F6TA 4WU8D 3C1CA 3AZND 5CPKA 5AV6C 4NE3A 1P3IA 2J8PA 5GSUD 4KGCA 3UTBC 4J8UD 3REJA 2BYMA 4KUDA 5AY8D 3AV1C 4H9RB 2YFWB 4M6BA 4WNNB 5CP6D 2CV5B 1F66B 4YS3C 1P3FD 1M19C 5B1MC 2AROD 2ZY5A 2RIQA 3B6FB 2Y2QA 1KX3D 3WTPD 3MVDD 4H9RA 3AZLC 4XUJD 2YFWA 5B2IA 3C1CD 2YFVB 4WNNA 4X23B 4WU9C 5CPKD 1B6WA 2CV5A 1EQZB 1F66A 5BNVB 3LZ1C 5B32B 4Z66B 3B6FA 2PYOB 3W97C 4KUDD 3A1KA 2Y2HA 4NE5A 3H0LC 2UWXA 3AZJD 5CPJC 5BO0B 1KX5B 2HUEB 5B24B 3X1VB 2YFVA 2ZY3A 4WV4B 3MGPA 5AVCC 4Z2MG 3AZFB 1EQZA 5BNVA 3NQJB 5B32A 4Z66A 5AV5D 2PYOA 5AV9C 1S32C 3IP4C 1ID3B 2CWEA 5BO0A 5B2ID 1KX5A 5B24A 5AVBB 4LD9B 5BT1D 3LELC 3AZFA 5BS7C 3KUYB 3WKJA 1ULYA 3NQJA 3B6FD 5B0YC 3WAAC 5B33B 5CHLB 1BH8B 4ZBJB 1ID3A 1HQ3C 4R8PC 3A6NB 1ZLAB 3MGPD 3EPHA 5AV8C 3WA9C 5AVBA 4LD9A 3W98B 3O62C 5B32D 5CPID 4QLCC 3AZJC 5B0ZB 3VH5A 3UTAA 5B32G 2NZDD 1P3MB
chains in the Genus database with same CATH topology
5JRGD 2NQBB 4J8WD 1KX5D 5B33A 3X1TD 3RELA 5B24D 2RVQD 4DRAA 5GT3A 3A6NA 1P34C 1N1JB 4AWLC 3MGQD 1ZLAA 1HTAA 5AV5C 5F99B 4J8VB 3AZFD 4YM6B 3WKJD 5GXQC 5AV6A 3REHC 3KXBC 4YS3B 3B0BA 5B1MB 3TU4C 1P3MA 3UTBA 2NQBA 1ID3D 5B40D 4DQYB 5AVBD 4LD9D 3AZLB 1N1JA 5C3IC 4J8VA 4WU9B 4YM6A 3X1SB 3UTAD 4YS3A 1WWSA 5B1MA 1TZYC 3W97B 3RELD 3C1BD 5GT3D 3AZNB 3VH5W 3LZ0D 3AZLA 3EG5B 5GSUB 3B0CT 4WU9A 5AV6D 5AVCB 4J8UB 3X1SA 4J8WC 3LZ1A 3AZKC 4ZUXC 3UTBD 3AZHC 3AYWC 3W97A 3AV1D 4E45A 4EO5B 5CPJA 5B1LD 3H0MC 2HIOC 5GSUA 2AROB 5AVCA 2IO5B 4YS3D 1M19D 1JFIB 1U35C 3MGSC 3WTPB 4Z5TD 3MVDB 4XUJB 2Y2IA 5GT0C 3KWQC 3AZEC 4CSRB 5AV9A 2Y2GA 1P3LC 1S32A 1P3OC 2Y2LA 2Y2JA 3UT9C 4WU9D 4KUDB 4E44A 3LZ1D 3LELA 5BS7A 3AZJB 1JFIA 2VQRA 3WTPA 3MVDA 3LZ0C 1WWIA 4XUJA 3W97D 4CSRA 3WAAA 5CPJD 2L5AA 1M18C 1HQ3A 4R8PA 2JSSA 5AV8A 5AVCD 2Y2KA 5AV5B 3O62A 1TAFB 1A7WA 2DF4C 3REHB 3AZJA 3KFUG 5B1LC 5B2IB 3LJAC 5AV9D 3AZGC 5KDMB 4XZQC 1S32D 1Q9CA 2XD1A 4Z5TC 1KX4C 2LY8A 3LELD 5AV5A 1TAFA 5GXQA 3REHA 4Z2MH 5B0YD 3MGPB 3WAAD 4H9QB 5KDMA 2ZY2A 2DQNC 1HQ3D 4R8PD 1P3PC 5AV8D 5CPIB 3WA9D 5B2JC 3O62D 2Y2OA 3AV2C 1R4VA 2NZDB 4G91C 4QLCD 5JRGB 5DNNC 4J8WB 3X1TB 4J8XC 3AZKB 4ZUXB 3MGQB 4H9QA 5G49A 1P3AC 3AZMD 1P34D 3WKJB 3B6GC 5CPIA 4HGAB 2HIOB 3REKC 5B31C 2NZDA 5GXQD 3REHD 5JRGA 3KXBD 5B40B 4J8WA 3X1TA 3TU4D 3AZKA 4ZUXA 4H9PB 3W96C 3B0DB 3MGQA 1P3OB 4NE6A 3UTAB 2HIOA 3UT9B 3AZIC 1AOID 2FJ7C 3RELB 5B40A 3AFAC 3C1BB 1B67A 5GT3B 4H9PA 1TZYD 3LZ0B 2ZM5A 3R45B 5GT0A 4H9SA 5AV6B 1P3OA 5BNXB 1KU5A 1F1EA 3UT9A 3UTBB 2G5HC 4UUZB 3AZKD 3AV1B 3KSYA 4ZUXD 3C1BA 3AZMC 3AZHD 2PYOD 4DRBA 2FFFB 5B1LB 3AYWD 3VH6A 3LZ0A 3R45A 3EPJA 4XZQB 1M1AC 2HIOD 1M18A 5BNXA 3W99D 1M19B 4Z5TB 4UUZA 3AV1A 3MGSD 1U35D 3REJC 5B1LA 5GT0D 3KWQD 3AZED 3AZGA 1P3LD 4XZQA 1AOIC 1P3OD 3LZ1B 5E5AC 3UT9D 1M19A 4Z5TA 1KX4A 1P3KC 4G91B 3A1IA 5CPJB 4WJ3C 2F8ND 1M18D 2F8NG 2CV5C 1F66C 3AN2C 3VH6W 1BFMA 5AV9B 1S32B 3LJAD 3REID 3AZGD 3W99C 4XZQD 3B0CW 3EPLA 3H0RC 4X23C 3LELB 1EQZC 3B6GA 1KX4D 4G92C 5B0YB 4Z66C 3WAAB 2FJ7B 1HQ3B 4R8PB 3MNND 5AV8B 3WA9B 2HUEC 3O62B 3X1VC 1P3PD 3MGRC 4QLCB 5B2JD 3AV2D 3FDDA 4WZSB 5B0YA 2FJ7A 5DNND 4J8XD 3AFAA 3AZMB 1P34B 4AWLB 3WA9A 1P3AD 2ZY4A 1P3BC 3B6GD 5GXQB 4QLCA 1M1AB 5FUGB 3KXBB 3KUYC 3REKD 5B31D 3TU4B 3REIC 5B31G 3AZMA 1P34A 4ZBJC 5B33C 3W96D 1ZLAC 5C3IB 1AOIB 3W98C 3X1UC 1M1AA 3AZID 5E5AB 5FUGA 3KXBA 4KHAB 3MNNC 5B0ZC 3TU4A 2FJ7D 5G49B 1TZYB 1P3KB 1P3MC 3AFAD 2JE5A 1BH9B 2NQBC 2XD5A 1AOIA 5F99C 4J8VC 3V9RB 4YM6C 5E5AA 2BYKB 4KHAA 3AN2B 3AZHB 1P3GD 2Y2MA 1TZYA 3AYWB 1P3KA 1BH9A 4JJNC 3W99B 3WTPE 1M1AD 2W8SA 3V9RA 1Z2CB 1U35B 2BYKA 3MGSB 3P5JB 3AN2A 3X1SC 4G92B 5DNMC 3AZHA 1P3ID 4KGCD 3AYWA 5GT0B 3KWQB 3AZEB 4NFTA 3REJD 1P3LB 4WU8C 3AZNC 3W99A 5GSUC 4X23A 5E5AD 3MGRB 1T3UA 1U35A 3MGSA 4J8UC 5AY8C 1P3KD 2F8NB 3KWQA 3AZEA 1P3LA 5CP6C 1M18B 4EO5C 5JA4B 4CAYB 1H3OB 3EPKA 1P3GC 1P3FC 3NQUB 3X1VA 2AROC 2CV5D 1P3BB 3MGRA 1F66D 3AN2D 2IO5C 3LJAB 1KX3C 3WTPC 3MVDC 3REIB 3AZGB 2F8NA 4XUJC 2F8NK 1W2EA 3C1CC 5CPKC 2G5IC 1P3IC 4H9NB 5JA4A 1KX4B 4CAYA 1H3OA 4X23D 4KGCC 3NQUA 4UPKA 1P3BA 1EQZD 3X1UB 4KUDC 3KUYA 3MNNB 3LJAA 4Z66D 2F8NH 3REIA 1P3PB 2JCHA 1BH8A 4H9NA 5B2JB 3X1VD 3AV2B 3MGRD 3W98A 5DNNB 3X1UA 4J8XB 2Y2PA 3MNNA 5B0ZA 5B2IC 1P3AB 1P3PA 3B6GB 5BT1C 5B2JA 4JJNB 3REKB 3VH5T 5B31B 3AV2A 1P3BD 2Y2NA 3B6FC 5F99A 5DNNA 3KUYD 4J8XA 5DNMB 3W96B 3MGPC 1P3AA 3VH6T 5B33D 4WU8B 3A6ND 1ZLAD 3AZIB 5B32C 5CPIC 4JJNA 3REKA 4H9OB 2BG1A 5B31A 3W98D 2F2AC 3X1UD 2PYOC 2NZDC 3AFAB 5B0ZD 5JRGC 1KX5C 5DNMA 5AY8B 3X1TC 5B24C 3W96A 2RVQC 1P3MD 2NQBD 3MGQC 5CP6B 3AZFC 4WU8A 3WKJC 3AL0C 3AZIA 3AZNA 4HGAC 4H9OA 5F99D 4J8VD 1P3GB 4YM6D 1P3FB 1ID3C 4J8UA 5B40C 5B1MD 1KX3B 5AY8A 5AVBC 4LD9C 3B0DC 3C1CB 5CP6A 5CPKB 4JJND 4H9SC 1PZRA 3AZLD 1P3IB 3UTAC 1P3GA 1P3FA 4KGCB 2AROA 3X1SD 3REJB 2BYMB 5DNMD 3RELC 3C1BC 5GT3C 3A6NC 1KX3A 3F6TA 4WU8D 3C1CA 3AZND 5CPKA 5AV6C 4NE3A 1P3IA 2J8PA 5GSUD 4KGCA 3UTBC 4J8UD 3REJA 2BYMA 4KUDA 5AY8D 3AV1C 4H9RB 2YFWB 4M6BA 4WNNB 5CP6D 2CV5B 1F66B 4YS3C 1P3FD 1M19C 5B1MC 2AROD 2ZY5A 2RIQA 3B6FB 2Y2QA 1KX3D 3WTPD 3MVDD 4H9RA 3AZLC 4XUJD 2YFWA 5B2IA 3C1CD 2YFVB 4WNNA 4X23B 4WU9C 5CPKD 1B6WA 2CV5A 1EQZB 1F66A 5BNVB 3LZ1C 5B32B 4Z66B 3B6FA 2PYOB 3W97C 4KUDD 3A1KA 2Y2HA 4NE5A 3H0LC 2UWXA 3AZJD 5CPJC 5BO0B 1KX5B 2HUEB 5B24B 3X1VB 2YFVA 2ZY3A 4WV4B 3MGPA 5AVCC 4Z2MG 3AZFB 1EQZA 5BNVA 3NQJB 5B32A 4Z66A 5AV5D 2PYOA 5AV9C 1S32C 3IP4C 1ID3B 2CWEA 5BO0A 5B2ID 1KX5A 5B24A 5AVBB 4LD9B 5BT1D 3LELC 3AZFA 5BS7C 3KUYB 3WKJA 1ULYA 3NQJA 3B6FD 5B0YC 3WAAC 5B33B 5CHLB 1BH8B 4ZBJB 1ID3A 1HQ3C 4R8PC 3A6NB 1ZLAB 3MGPD 3EPHA 5AV8C 3WA9C 5AVBA 4LD9A 3W98B 3O62C 5B32D 5CPID 4QLCC 3AZJC 5B0ZB 3VH5A 3UTAA 5B32G 2NZDD 1P3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG D;  2NQB B;  4J8W D;  1KX5 D;  5B33 A;  3X1T D;  3REL A;  5B24 D;  2RVQ D;  4DRA A;  5GT3 A;  3A6N A;  1P34 C;  1N1J B;  4AWL C;  3MGQ D;  1ZLA A;  1HTA A;  5AV5 C;  5F99 B;  4J8V B;  3AZF D;  4YM6 B;  3WKJ D;  5GXQ C;  5AV6 A;  3REH C;  3KXB C;  4YS3 B;  3B0B A;  5B1M B;  3TU4 C;  1P3M A;  3UTB A;  2NQB A;  1ID3 D;  5B40 D;  5AVB D;  4LD9 D;  3AZL B;  1N1J A;  5C3I C;  4J8V A;  4WU9 B;  4YM6 A;  3X1S B;  3UTA D;  4YS3 A;  1WWS A;  5B1M A;  1TZY C;  3W97 B;  3REL D;  3C1B D;  5GT3 D;  3AZN B;  3VH5 W;  3LZ0 D;  3AZL A;  5GSU B;  3B0C T;  4WU9 A;  5AV6 D;  5AVC B;  4J8U B;  3X1S A;  4J8W C;  3LZ1 A;  3AZK C;  4ZUX C;  3UTB D;  3AZH C;  3AYW C;  3W97 A;  3AV1 D;  4E45 A;  4EO5 B;  5CPJ A;  5B1L D;  2HIO C;  5GSU A;  2ARO B;  5AVC A;  2IO5 B;  4YS3 D;  1M19 D;  1JFI B;  1U35 C;  3MGS C;  3WTP B;  4Z5T D;  3MVD B;  4XUJ B;  5GT0 C;  3KWQ C;  3AZE C;  4CSR B;  5AV9 A;  1P3L C;  1S32 A;  1P3O C;  3UT9 C;  4WU9 D;  4KUD B;  4E44 A;  3LZ1 D;  3LEL A;  5BS7 A;  3AZJ B;  1JFI A;  3WTP A;  3MVD A;  3LZ0 C;  1WWI A;  4XUJ A;  3W97 D;  4CSR A;  3WAA A;  5CPJ D;  2L5A A;  1M18 C;  1HQ3 A;  4R8P A;  2JSS A;  5AV8 A;  5AVC D;  5AV5 B;  3O62 A;  1TAF B;  1A7W A;  3REH B;  3AZJ A;  5B1L C;  5B2I B;  3LJA C;  5AV9 D;  3AZG C;  5KDM B;  4XZQ C;  1S32 D;  1Q9C A;  4Z5T C;  1KX4 C;  2LY8 A;  3LEL D;  5AV5 A;  1TAF A;  5GXQ A;  3REH A;  4Z2M H;  5B0Y D;  3MGP B;  3WAA D;  4H9Q B;  5KDM A;  1HQ3 D;  4R8P D;  1P3P C;  5AV8 D;  5CPI B;  3WA9 D;  5B2J C;  3O62 D;  3AV2 C;  1R4V A;  2NZD B;  4G91 C;  4QLC D;  5JRG B;  5DNN C;  4J8W B;  3X1T B;  4J8X C;  3AZK B;  4ZUX B;  3MGQ B;  4H9Q A;  5G49 A;  1P3A C;  3AZM D;  1P34 D;  3WKJ B;  3B6G C;  5CPI A;  4HGA B;  2HIO B;  3REK C;  5B31 C;  2NZD A;  5GXQ D;  3REH D;  5JRG A;  3KXB D;  5B40 B;  4J8W A;  3X1T A;  3TU4 D;  3AZK A;  4ZUX A;  4H9P B;  3W96 C;  3B0D B;  3MGQ A;  1P3O B;  4NE6 A;  3UTA B;  2HIO A;  3UT9 B;  3AZI C;  1AOI D;  2FJ7 C;  3REL B;  5B40 A;  3AFA C;  3C1B B;  1B67 A;  5GT3 B;  4H9P A;  1TZY D;  3LZ0 B;  3R45 B;  5GT0 A;  4H9S A;  5AV6 B;  1P3O A;  5BNX B;  1KU5 A;  1F1E A;  3UT9 A;  3UTB B;  4UUZ B;  3AZK D;  3AV1 B;  3KSY A;  4ZUX D;  3C1B A;  3AZM C;  3AZH D;  2PYO D;  4DRB A;  5B1L B;  3AYW D;  3VH6 A;  3LZ0 A;  3R45 A;  4XZQ B;  1M1A C;  2HIO D;  1M18 A;  5BNX A;  3W99 D;  1M19 B;  4Z5T B;  4UUZ A;  3AV1 A;  3MGS D;  1U35 D;  3REJ C;  5B1L A;  5GT0 D;  3KWQ D;  3AZE D;  3AZG A;  1P3L D;  4XZQ A;  1AOI C;  1P3O D;  3LZ1 B;  5E5A C;  3UT9 D;  1M19 A;  4Z5T A;  1KX4 A;  1P3K C;  4G91 B;  5CPJ B;  2F8N D;  1M18 D;  2F8N G;  2CV5 C;  1F66 C;  3AN2 C;  3VH6 W;  1BFM A;  5AV9 B;  1S32 B;  3LJA D;  3REI D;  3AZG D;  3W99 C;  4XZQ D;  3B0C W;  4X23 C;  3LEL B;  1EQZ C;  3B6G A;  1KX4 D;  4G92 C;  5B0Y B;  4Z66 C;  3WAA B;  2FJ7 B;  1HQ3 B;  4R8P B;  3MNN D;  5AV8 B;  3WA9 B;  2HUE C;  3O62 B;  3X1V C;  1P3P D;  3MGR C;  4QLC B;  5B2J D;  3AV2 D;  4WZS B;  5B0Y A;  2FJ7 A;  5DNN D;  4J8X D;  3AFA A;  3AZM B;  1P34 B;  4AWL B;  3WA9 A;  1P3A D;  1P3B C;  3B6G D;  5GXQ B;  4QLC A;  1M1A B;  5FUG B;  3KXB B;  3KUY C;  3REK D;  5B31 D;  3TU4 B;  3REI C;  5B31 G;  3AZM A;  1P34 A;  4ZBJ C;  5B33 C;  3W96 D;  1ZLA C;  5C3I B;  1AOI B;  3W98 C;  3X1U C;  1M1A A;  3AZI D;  5E5A B;  5FUG A;  3KXB A;  4KHA B;  3MNN C;  5B0Z C;  3TU4 A;  2FJ7 D;  5G49 B;  1TZY B;  1P3K B;  1P3M C;  3AFA D;  1BH9 B;  2NQB C;  1AOI A;  5F99 C;  4J8V C;  3V9R B;  4YM6 C;  5E5A A;  2BYK B;  4KHA A;  3AN2 B;  3AZH B;  1P3G D;  1TZY A;  3AYW B;  1P3K A;  1BH9 A;  4JJN C;  3W99 B;  3WTP E;  1M1A D;  3V9R A;  1U35 B;  2BYK A;  3MGS B;  3X1S C;  3AN2 A;  1P3I D;  4G92 B;  5DNM C;  3AZH A;  4KGC D;  3AYW A;  5GT0 B;  3KWQ B;  3AZE B;  4NFT A;  3REJ D;  1P3L B;  4WU8 C;  3AZN C;  3W99 A;  5GSU C;  4X23 A;  5E5A D;  3MGR B;  1U35 A;  3MGS A;  4J8U C;  5AY8 C;  1P3K D;  2F8N B;  3KWQ A;  3AZE A;  1P3L A;  5CP6 C;  1M18 B;  4EO5 C;  5JA4 B;  4CAY B;  1H3O B;  1P3G C;  1P3F C;  3NQU B;  3X1V A;  2ARO C;  2CV5 D;  1P3B B;  3MGR A;  1F66 D;  3AN2 D;  2IO5 C;  3LJA B;  1KX3 C;  3WTP C;  3MVD C;  3REI B;  3AZG B;  2F8N A;  4XUJ C;  2F8N K;  3C1C C;  5CPK C;  1P3I C;  4H9N B;  5JA4 A;  1KX4 B;  4CAY A;  1H3O A;  4X23 D;  4KGC C;  3NQU A;  1P3B A;  1EQZ D;  3X1U B;  4KUD C;  3KUY A;  3MNN B;  3LJA A;  4Z66 D;  2F8N H;  3REI A;  1P3P B;  1BH8 A;  4H9N A;  5B2J B;  3X1V D;  3AV2 B;  3MGR D;  3W98 A;  5DNN B;  3X1U A;  4J8X B;  3MNN A;  5B0Z A;  5B2I C;  1P3A B;  1P3P A;  3B6G B;  5BT1 C;  5B2J A;  4JJN B;  3REK B;  3VH5 T;  5B31 B;  3AV2 A;  1P3B D;  3B6F C;  5F99 A;  5DNN A;  3KUY D;  4J8X A;  5DNM B;  3W96 B;  3MGP C;  1P3A A;  3VH6 T;  5B33 D;  4WU8 B;  3A6N D;  1ZLA D;  3AZI B;  5B32 C;  5CPI C;  4JJN A;  3REK A;  4H9O B;  5B31 A;  3W98 D;  3X1U D;  2PYO C;  2NZD C;  3AFA B;  5B0Z D;  5JRG C;  1KX5 C;  5DNM A;  5AY8 B;  3X1T C;  5B24 C;  3W96 A;  2RVQ C;  1P3M D;  2NQB D;  3MGQ C;  5CP6 B;  3AZF C;  4WU8 A;  3WKJ C;  3AZI A;  3AZN A;  4HGA C;  4H9O A;  5F99 D;  4J8V D;  1P3G B;  4YM6 D;  1P3F B;  1ID3 C;  4J8U A;  5B40 C;  5B1M D;  1KX3 B;  5AY8 A;  5AVB C;  4LD9 C;  3B0D C;  3C1C B;  5CP6 A;  5CPK B;  4JJN D;  4H9S C;  3AZL D;  1P3I B;  3UTA C;  1P3G A;  1P3F A;  4KGC B;  2ARO A;  3X1S D;  3REJ B;  2BYM B;  5DNM D;  3REL C;  3C1B C;  5GT3 C;  3A6N C;  1KX3 A;  4WU8 D;  3C1C A;  3AZN D;  5CPK A;  5AV6 C;  4NE3 A;  1P3I A;  5GSU D;  4KGC A;  3UTB C;  4J8U D;  3REJ A;  2BYM A;  4KUD A;  5AY8 D;  3AV1 C;  4H9R B;  2YFW B;  4M6B A;  4WNN B;  5CP6 D;  2CV5 B;  1F66 B;  4YS3 C;  1P3F D;  1M19 C;  5B1M C;  2ARO D;  3B6F B;  1KX3 D;  3WTP D;  3MVD D;  4H9R A;  3AZL C;  4XUJ D;  2YFW A;  5B2I A;  3C1C D;  2YFV B;  4WNN A;  4X23 B;  4WU9 C;  5CPK D;  1B6W A;  2CV5 A;  1EQZ B;  1F66 A;  5BNV B;  3LZ1 C;  5B32 B;  4Z66 B;  3B6F A;  2PYO B;  3W97 C;  4KUD D;  4NE5 A;  3AZJ D;  5CPJ C;  5BO0 B;  1KX5 B;  2HUE B;  5B24 B;  3X1V B;  2YFV A;  3MGP A;  4WV4 B;  5AVC C;  4Z2M G;  3AZF B;  1EQZ A;  5BNV A;  3NQJ B;  5B32 A;  4Z66 A;  5AV5 D;  2PYO A;  5AV9 C;  1S32 C;  1ID3 B;  2CWE A;  5BO0 A;  5B2I D;  1KX5 A;  5B24 A;  5AVB B;  4LD9 B;  5BT1 D;  3LEL C;  3AZF A;  5BS7 C;  3KUY B;  3WKJ A;  1ULY A;  3NQJ A;  3B6F D;  5B0Y C;  3WAA C;  5CHL B;  4ZBJ B;  1BH8 B;  5B33 B;  1ID3 A;  1HQ3 C;  4R8P C;  3A6N B;  1ZLA B;  3MGP D;  5AV8 C;  3WA9 C;  5AVB A;  4LD9 A;  3W98 B;  3O62 C;  5B32 D;  5CPI D;  4QLC C;  3AZJ C;  5B0Z B;  3VH5 A;  3UTA A;  5B32 G;  2NZD D;  1P3M B; 
#chains in the Genus database with same CATH topology
 5JRG D;  2NQB B;  4J8W D;  1KX5 D;  5B33 A;  3X1T D;  3REL A;  5B24 D;  2RVQ D;  4DRA A;  5GT3 A;  3A6N A;  1P34 C;  1N1J B;  4AWL C;  3MGQ D;  1ZLA A;  1HTA A;  5AV5 C;  5F99 B;  4J8V B;  3AZF D;  4YM6 B;  3WKJ D;  5GXQ C;  5AV6 A;  3REH C;  3KXB C;  4YS3 B;  3B0B A;  5B1M B;  3TU4 C;  1P3M A;  3UTB A;  2NQB A;  1ID3 D;  5B40 D;  4DQY B;  5AVB D;  4LD9 D;  3AZL B;  1N1J A;  5C3I C;  4J8V A;  4WU9 B;  4YM6 A;  3X1S B;  3UTA D;  4YS3 A;  1WWS A;  5B1M A;  1TZY C;  3W97 B;  3REL D;  3C1B D;  5GT3 D;  3AZN B;  3VH5 W;  3LZ0 D;  3AZL A;  3EG5 B;  5GSU B;  3B0C T;  4WU9 A;  5AV6 D;  5AVC B;  4J8U B;  3X1S A;  4J8W C;  3LZ1 A;  3AZK C;  4ZUX C;  3UTB D;  3AZH C;  3AYW C;  3W97 A;  3AV1 D;  4E45 A;  4EO5 B;  5CPJ A;  5B1L D;  3H0M C;  2HIO C;  5GSU A;  2ARO B;  5AVC A;  2IO5 B;  4YS3 D;  1M19 D;  1JFI B;  1U35 C;  3MGS C;  3WTP B;  4Z5T D;  3MVD B;  4XUJ B;  2Y2I A;  5GT0 C;  3KWQ C;  3AZE C;  4CSR B;  5AV9 A;  2Y2G A;  1P3L C;  1S32 A;  1P3O C;  2Y2L A;  2Y2J A;  3UT9 C;  4WU9 D;  4KUD B;  4E44 A;  3LZ1 D;  3LEL A;  5BS7 A;  3AZJ B;  1JFI A;  2VQR A;  3WTP A;  3MVD A;  3LZ0 C;  1WWI A;  4XUJ A;  3W97 D;  4CSR A;  3WAA A;  5CPJ D;  2L5A A;  1M18 C;  1HQ3 A;  4R8P A;  2JSS A;  5AV8 A;  5AVC D;  2Y2K A;  5AV5 B;  3O62 A;  1TAF B;  1A7W A;  2DF4 C;  3REH B;  3AZJ A;  3KFU G;  5B1L C;  5B2I B;  3LJA C;  5AV9 D;  3AZG C;  5KDM B;  4XZQ C;  1S32 D;  1Q9C A;  2XD1 A;  4Z5T C;  1KX4 C;  2LY8 A;  3LEL D;  5AV5 A;  1TAF A;  5GXQ A;  3REH A;  4Z2M H;  5B0Y D;  3MGP B;  3WAA D;  4H9Q B;  5KDM A;  2ZY2 A;  2DQN C;  1HQ3 D;  4R8P D;  1P3P C;  5AV8 D;  5CPI B;  3WA9 D;  5B2J C;  3O62 D;  2Y2O A;  3AV2 C;  1R4V A;  2NZD B;  4G91 C;  4QLC D;  5JRG B;  5DNN C;  4J8W B;  3X1T B;  4J8X C;  3AZK B;  4ZUX B;  3MGQ B;  4H9Q A;  5G49 A;  1P3A C;  3AZM D;  1P34 D;  3WKJ B;  3B6G C;  5CPI A;  4HGA B;  2HIO B;  3REK C;  5B31 C;  2NZD A;  5GXQ D;  3REH D;  5JRG A;  3KXB D;  5B40 B;  4J8W A;  3X1T A;  3TU4 D;  3AZK A;  4ZUX A;  4H9P B;  3W96 C;  3B0D B;  3MGQ A;  1P3O B;  4NE6 A;  3UTA B;  2HIO A;  3UT9 B;  3AZI C;  1AOI D;  2FJ7 C;  3REL B;  5B40 A;  3AFA C;  3C1B B;  1B67 A;  5GT3 B;  4H9P A;  1TZY D;  3LZ0 B;  2ZM5 A;  3R45 B;  5GT0 A;  4H9S A;  5AV6 B;  1P3O A;  5BNX B;  1KU5 A;  1F1E A;  3UT9 A;  3UTB B;  2G5H C;  4UUZ B;  3AZK D;  3AV1 B;  3KSY A;  4ZUX D;  3C1B A;  3AZM C;  3AZH D;  2PYO D;  4DRB A;  2FFF B;  5B1L B;  3AYW D;  3VH6 A;  3LZ0 A;  3R45 A;  3EPJ A;  4XZQ B;  1M1A C;  2HIO D;  1M18 A;  5BNX A;  3W99 D;  1M19 B;  4Z5T B;  4UUZ A;  3AV1 A;  3MGS D;  1U35 D;  3REJ C;  5B1L A;  5GT0 D;  3KWQ D;  3AZE D;  3AZG A;  1P3L D;  4XZQ A;  1AOI C;  1P3O D;  3LZ1 B;  5E5A C;  3UT9 D;  1M19 A;  4Z5T A;  1KX4 A;  1P3K C;  4G91 B;  3A1I A;  5CPJ B;  4WJ3 C;  2F8N D;  1M18 D;  2F8N G;  2CV5 C;  1F66 C;  3AN2 C;  3VH6 W;  1BFM A;  5AV9 B;  1S32 B;  3LJA D;  3REI D;  3AZG D;  3W99 C;  4XZQ D;  3B0C W;  3EPL A;  3H0R C;  4X23 C;  3LEL B;  1EQZ C;  3B6G A;  1KX4 D;  4G92 C;  5B0Y B;  4Z66 C;  3WAA B;  2FJ7 B;  1HQ3 B;  4R8P B;  3MNN D;  5AV8 B;  3WA9 B;  2HUE C;  3O62 B;  3X1V C;  1P3P D;  3MGR C;  4QLC B;  5B2J D;  3AV2 D;  3FDD A;  4WZS B;  5B0Y A;  2FJ7 A;  5DNN D;  4J8X D;  3AFA A;  3AZM B;  1P34 B;  4AWL B;  3WA9 A;  1P3A D;  2ZY4 A;  1P3B C;  3B6G D;  5GXQ B;  4QLC A;  1M1A B;  5FUG B;  3KXB B;  3KUY C;  3REK D;  5B31 D;  3TU4 B;  3REI C;  5B31 G;  3AZM A;  1P34 A;  4ZBJ C;  5B33 C;  3W96 D;  1ZLA C;  5C3I B;  1AOI B;  3W98 C;  3X1U C;  1M1A A;  3AZI D;  5E5A B;  5FUG A;  3KXB A;  4KHA B;  3MNN C;  5B0Z C;  3TU4 A;  2FJ7 D;  5G49 B;  1TZY B;  1P3K B;  1P3M C;  3AFA D;  2JE5 A;  1BH9 B;  2NQB C;  2XD5 A;  1AOI A;  5F99 C;  4J8V C;  3V9R B;  4YM6 C;  5E5A A;  2BYK B;  4KHA A;  3AN2 B;  3AZH B;  1P3G D;  2Y2M A;  1TZY A;  3AYW B;  1P3K A;  1BH9 A;  4JJN C;  3W99 B;  3WTP E;  1M1A D;  2W8S A;  3V9R A;  1Z2C B;  1U35 B;  2BYK A;  3MGS B;  3P5J B;  3AN2 A;  3X1S C;  4G92 B;  5DNM C;  3AZH A;  1P3I D;  4KGC D;  3AYW A;  5GT0 B;  3KWQ B;  3AZE B;  4NFT A;  3REJ D;  1P3L B;  4WU8 C;  3AZN C;  3W99 A;  5GSU C;  4X23 A;  5E5A D;  3MGR B;  1T3U A;  1U35 A;  3MGS A;  4J8U C;  5AY8 C;  1P3K D;  2F8N B;  3KWQ A;  3AZE A;  1P3L A;  5CP6 C;  1M18 B;  4EO5 C;  5JA4 B;  4CAY B;  1H3O B;  3EPK A;  1P3G C;  1P3F C;  3NQU B;  3X1V A;  2ARO C;  2CV5 D;  1P3B B;  3MGR A;  1F66 D;  3AN2 D;  2IO5 C;  3LJA B;  1KX3 C;  3WTP C;  3MVD C;  3REI B;  3AZG B;  2F8N A;  4XUJ C;  2F8N K;  1W2E A;  3C1C C;  5CPK C;  2G5I C;  1P3I C;  4H9N B;  5JA4 A;  1KX4 B;  4CAY A;  1H3O A;  4X23 D;  4KGC C;  3NQU A;  4UPK A;  1P3B A;  1EQZ D;  3X1U B;  4KUD C;  3KUY A;  3MNN B;  3LJA A;  4Z66 D;  2F8N H;  3REI A;  1P3P B;  2JCH A;  1BH8 A;  4H9N A;  5B2J B;  3X1V D;  3AV2 B;  3MGR D;  3W98 A;  5DNN B;  3X1U A;  4J8X B;  2Y2P A;  3MNN A;  5B0Z A;  5B2I C;  1P3A B;  1P3P A;  3B6G B;  5BT1 C;  5B2J A;  4JJN B;  3REK B;  3VH5 T;  5B31 B;  3AV2 A;  1P3B D;  2Y2N A;  3B6F C;  5F99 A;  5DNN A;  3KUY D;  4J8X A;  5DNM B;  3W96 B;  3MGP C;  1P3A A;  3VH6 T;  5B33 D;  4WU8 B;  3A6N D;  1ZLA D;  3AZI B;  5B32 C;  5CPI C;  4JJN A;  3REK A;  4H9O B;  2BG1 A;  5B31 A;  3W98 D;  2F2A C;  3X1U D;  2PYO C;  2NZD C;  3AFA B;  5B0Z D;  5JRG C;  1KX5 C;  5DNM A;  5AY8 B;  3X1T C;  5B24 C;  3W96 A;  2RVQ C;  1P3M D;  2NQB D;  3MGQ C;  5CP6 B;  3AZF C;  4WU8 A;  3WKJ C;  3AL0 C;  3AZI A;  3AZN A;  4HGA C;  4H9O A;  5F99 D;  4J8V D;  1P3G B;  4YM6 D;  1P3F B;  1ID3 C;  4J8U A;  5B40 C;  5B1M D;  1KX3 B;  5AY8 A;  5AVB C;  4LD9 C;  3B0D C;  3C1C B;  5CP6 A;  5CPK B;  4JJN D;  4H9S C;  1PZR A;  3AZL D;  1P3I B;  3UTA C;  1P3G A;  1P3F A;  4KGC B;  2ARO A;  3X1S D;  3REJ B;  2BYM B;  5DNM D;  3REL C;  3C1B C;  5GT3 C;  3A6N C;  1KX3 A;  3F6T A;  4WU8 D;  3C1C A;  3AZN D;  5CPK A;  5AV6 C;  4NE3 A;  1P3I A;  2J8P A;  5GSU D;  4KGC A;  3UTB C;  4J8U D;  3REJ A;  2BYM A;  4KUD A;  5AY8 D;  3AV1 C;  4H9R B;  2YFW B;  4M6B A;  4WNN B;  5CP6 D;  2CV5 B;  1F66 B;  4YS3 C;  1P3F D;  1M19 C;  5B1M C;  2ARO D;  2ZY5 A;  2RIQ A;  3B6F B;  2Y2Q A;  1KX3 D;  3WTP D;  3MVD D;  4H9R A;  3AZL C;  4XUJ D;  2YFW A;  5B2I A;  3C1C D;  2YFV B;  4WNN A;  4X23 B;  4WU9 C;  5CPK D;  1B6W A;  2CV5 A;  1EQZ B;  1F66 A;  5BNV B;  3LZ1 C;  5B32 B;  4Z66 B;  3B6F A;  2PYO B;  3W97 C;  4KUD D;  3A1K A;  2Y2H A;  4NE5 A;  3H0L C;  2UWX A;  3AZJ D;  5CPJ C;  5BO0 B;  1KX5 B;  2HUE B;  5B24 B;  3X1V B;  2YFV A;  2ZY3 A;  4WV4 B;  3MGP A;  5AVC C;  4Z2M G;  3AZF B;  1EQZ A;  5BNV A;  3NQJ B;  5B32 A;  4Z66 A;  5AV5 D;  2PYO A;  5AV9 C;  1S32 C;  3IP4 C;  1ID3 B;  2CWE A;  5BO0 A;  5B2I D;  1KX5 A;  5B24 A;  5AVB B;  4LD9 B;  5BT1 D;  3LEL C;  3AZF A;  5BS7 C;  3KUY B;  3WKJ A;  1ULY A;  3NQJ A;  3B6F D;  5B0Y C;  3WAA C;  5B33 B;  5CHL B;  1BH8 B;  4ZBJ B;  1ID3 A;  1HQ3 C;  4R8P C;  3A6N B;  1ZLA B;  3MGP D;  3EPH A;  5AV8 C;  3WA9 C;  5AVB A;  4LD9 A;  3W98 B;  3O62 C;  5B32 D;  5CPI D;  4QLC C;  3AZJ C;  5B0Z B;  3VH5 A;  3UTA A;  5B32 G;  2NZD D;  1P3M B; 
#chains in the Genus database with same CATH homology
 5JRG D;  2NQB B;  4J8W D;  1KX5 D;  5B33 A;  3X1T D;  3REL A;  5B24 D;  2RVQ D;  4DRA A;  5GT3 A;  3A6N A;  1P34 C;  1N1J B;  4AWL C;  3MGQ D;  1ZLA A;  1HTA A;  5AV5 C;  5F99 B;  4J8V B;  3AZF D;  4YM6 B;  3WKJ D;  5GXQ C;  5AV6 A;  3REH C;  3KXB C;  4YS3 B;  3B0B A;  5B1M B;  3TU4 C;  1P3M A;  3UTB A;  2NQB A;  1ID3 D;  5B40 D;  4DQY B;  5AVB D;  4LD9 D;  3AZL B;  1N1J A;  5C3I C;  4J8V A;  4WU9 B;  4YM6 A;  3X1S B;  3UTA D;  4YS3 A;  1WWS A;  5B1M A;  1TZY C;  3W97 B;  3REL D;  3C1B D;  5GT3 D;  3AZN B;  3VH5 W;  3LZ0 D;  3AZL A;  3EG5 B;  5GSU B;  3B0C T;  4WU9 A;  5AV6 D;  5AVC B;  4J8U B;  3X1S A;  4J8W C;  3LZ1 A;  3AZK C;  4ZUX C;  3UTB D;  3AZH C;  3AYW C;  3W97 A;  3AV1 D;  4E45 A;  4EO5 B;  5CPJ A;  5B1L D;  3H0M C;  2HIO C;  5GSU A;  2ARO B;  5AVC A;  2IO5 B;  4YS3 D;  1M19 D;  1JFI B;  1U35 C;  3MGS C;  3WTP B;  4Z5T D;  3MVD B;  4XUJ B;  2Y2I A;  5GT0 C;  3KWQ C;  3AZE C;  4CSR B;  5AV9 A;  2Y2G A;  1P3L C;  1S32 A;  1P3O C;  2Y2L A;  2Y2J A;  3UT9 C;  4WU9 D;  4KUD B;  4E44 A;  3LZ1 D;  3LEL A;  5BS7 A;  3AZJ B;  1JFI A;  2VQR A;  3WTP A;  3MVD A;  3LZ0 C;  1WWI A;  4XUJ A;  3W97 D;  4CSR A;  3WAA A;  5CPJ D;  2L5A A;  1M18 C;  1HQ3 A;  4R8P A;  2JSS A;  5AV8 A;  5AVC D;  2Y2K A;  5AV5 B;  3O62 A;  1TAF B;  1A7W A;  2DF4 C;  3REH B;  3AZJ A;  3KFU G;  5B1L C;  5B2I B;  3LJA C;  5AV9 D;  3AZG C;  5KDM B;  4XZQ C;  1S32 D;  1Q9C A;  2XD1 A;  4Z5T C;  1KX4 C;  2LY8 A;  3LEL D;  5AV5 A;  1TAF A;  5GXQ A;  3REH A;  4Z2M H;  5B0Y D;  3MGP B;  3WAA D;  4H9Q B;  5KDM A;  2ZY2 A;  2DQN C;  1HQ3 D;  4R8P D;  1P3P C;  5AV8 D;  5CPI B;  3WA9 D;  5B2J C;  3O62 D;  2Y2O A;  3AV2 C;  1R4V A;  2NZD B;  4G91 C;  4QLC D;  5JRG B;  5DNN C;  4J8W B;  3X1T B;  4J8X C;  3AZK B;  4ZUX B;  3MGQ B;  4H9Q A;  5G49 A;  1P3A C;  3AZM D;  1P34 D;  3WKJ B;  3B6G C;  5CPI A;  4HGA B;  2HIO B;  3REK C;  5B31 C;  2NZD A;  5GXQ D;  3REH D;  5JRG A;  3KXB D;  5B40 B;  4J8W A;  3X1T A;  3TU4 D;  3AZK A;  4ZUX A;  4H9P B;  3W96 C;  3B0D B;  3MGQ A;  1P3O B;  4NE6 A;  3UTA B;  2HIO A;  3UT9 B;  3AZI C;  1AOI D;  2FJ7 C;  3REL B;  5B40 A;  3AFA C;  3C1B B;  1B67 A;  5GT3 B;  4H9P A;  1TZY D;  3LZ0 B;  2ZM5 A;  3R45 B;  5GT0 A;  4H9S A;  5AV6 B;  1P3O A;  5BNX B;  1KU5 A;  1F1E A;  3UT9 A;  3UTB B;  2G5H C;  4UUZ B;  3AZK D;  3AV1 B;  3KSY A;  4ZUX D;  3C1B A;  3AZM C;  3AZH D;  2PYO D;  4DRB A;  2FFF B;  5B1L B;  3AYW D;  3VH6 A;  3LZ0 A;  3R45 A;  3EPJ A;  4XZQ B;  1M1A C;  2HIO D;  1M18 A;  5BNX A;  3W99 D;  1M19 B;  4Z5T B;  4UUZ A;  3AV1 A;  3MGS D;  1U35 D;  3REJ C;  5B1L A;  5GT0 D;  3KWQ D;  3AZE D;  3AZG A;  1P3L D;  4XZQ A;  1AOI C;  1P3O D;  3LZ1 B;  5E5A C;  3UT9 D;  1M19 A;  4Z5T A;  1KX4 A;  1P3K C;  4G91 B;  3A1I A;  5CPJ B;  4WJ3 C;  2F8N D;  1M18 D;  2F8N G;  2CV5 C;  1F66 C;  3AN2 C;  3VH6 W;  1BFM A;  5AV9 B;  1S32 B;  3LJA D;  3REI D;  3AZG D;  3W99 C;  4XZQ D;  3B0C W;  3EPL A;  3H0R C;  4X23 C;  3LEL B;  1EQZ C;  3B6G A;  1KX4 D;  4G92 C;  5B0Y B;  4Z66 C;  3WAA B;  2FJ7 B;  1HQ3 B;  4R8P B;  3MNN D;  5AV8 B;  3WA9 B;  2HUE C;  3O62 B;  3X1V C;  1P3P D;  3MGR C;  4QLC B;  5B2J D;  3AV2 D;  3FDD A;  4WZS B;  5B0Y A;  2FJ7 A;  5DNN D;  4J8X D;  3AFA A;  3AZM B;  1P34 B;  4AWL B;  3WA9 A;  1P3A D;  2ZY4 A;  1P3B C;  3B6G D;  5GXQ B;  4QLC A;  1M1A B;  5FUG B;  3KXB B;  3KUY C;  3REK D;  5B31 D;  3TU4 B;  3REI C;  5B31 G;  3AZM A;  1P34 A;  4ZBJ C;  5B33 C;  3W96 D;  1ZLA C;  5C3I B;  1AOI B;  3W98 C;  3X1U C;  1M1A A;  3AZI D;  5E5A B;  5FUG A;  3KXB A;  4KHA B;  3MNN C;  5B0Z C;  3TU4 A;  2FJ7 D;  5G49 B;  1TZY B;  1P3K B;  1P3M C;  3AFA D;  2JE5 A;  1BH9 B;  2NQB C;  2XD5 A;  1AOI A;  5F99 C;  4J8V C;  3V9R B;  4YM6 C;  5E5A A;  2BYK B;  4KHA A;  3AN2 B;  3AZH B;  1P3G D;  2Y2M A;  1TZY A;  3AYW B;  1P3K A;  1BH9 A;  4JJN C;  3W99 B;  3WTP E;  1M1A D;  2W8S A;  3V9R A;  1Z2C B;  1U35 B;  2BYK A;  3MGS B;  3P5J B;  3AN2 A;  3X1S C;  4G92 B;  5DNM C;  3AZH A;  1P3I D;  4KGC D;  3AYW A;  5GT0 B;  3KWQ B;  3AZE B;  4NFT A;  3REJ D;  1P3L B;  4WU8 C;  3AZN C;  3W99 A;  5GSU C;  4X23 A;  5E5A D;  3MGR B;  1T3U A;  1U35 A;  3MGS A;  4J8U C;  5AY8 C;  1P3K D;  2F8N B;  3KWQ A;  3AZE A;  1P3L A;  5CP6 C;  1M18 B;  4EO5 C;  5JA4 B;  4CAY B;  1H3O B;  3EPK A;  1P3G C;  1P3F C;  3NQU B;  3X1V A;  2ARO C;  2CV5 D;  1P3B B;  3MGR A;  1F66 D;  3AN2 D;  2IO5 C;  3LJA B;  1KX3 C;  3WTP C;  3MVD C;  3REI B;  3AZG B;  2F8N A;  4XUJ C;  2F8N K;  1W2E A;  3C1C C;  5CPK C;  2G5I C;  1P3I C;  4H9N B;  5JA4 A;  1KX4 B;  4CAY A;  1H3O A;  4X23 D;  4KGC C;  3NQU A;  4UPK A;  1P3B A;  1EQZ D;  3X1U B;  4KUD C;  3KUY A;  3MNN B;  3LJA A;  4Z66 D;  2F8N H;  3REI A;  1P3P B;  2JCH A;  1BH8 A;  4H9N A;  5B2J B;  3X1V D;  3AV2 B;  3MGR D;  3W98 A;  5DNN B;  3X1U A;  4J8X B;  2Y2P A;  3MNN A;  5B0Z A;  5B2I C;  1P3A B;  1P3P A;  3B6G B;  5BT1 C;  5B2J A;  4JJN B;  3REK B;  3VH5 T;  5B31 B;  3AV2 A;  1P3B D;  2Y2N A;  3B6F C;  5F99 A;  5DNN A;  3KUY D;  4J8X A;  5DNM B;  3W96 B;  3MGP C;  1P3A A;  3VH6 T;  5B33 D;  4WU8 B;  3A6N D;  1ZLA D;  3AZI B;  5B32 C;  5CPI C;  4JJN A;  3REK A;  4H9O B;  2BG1 A;  5B31 A;  3W98 D;  2F2A C;  3X1U D;  2PYO C;  2NZD C;  3AFA B;  5B0Z D;  5JRG C;  1KX5 C;  5DNM A;  5AY8 B;  3X1T C;  5B24 C;  3W96 A;  2RVQ C;  1P3M D;  2NQB D;  3MGQ C;  5CP6 B;  3AZF C;  4WU8 A;  3WKJ C;  3AL0 C;  3AZI A;  3AZN A;  4HGA C;  4H9O A;  5F99 D;  4J8V D;  1P3G B;  4YM6 D;  1P3F B;  1ID3 C;  4J8U A;  5B40 C;  5B1M D;  1KX3 B;  5AY8 A;  5AVB C;  4LD9 C;  3B0D C;  3C1C B;  5CP6 A;  5CPK B;  4JJN D;  4H9S C;  1PZR A;  3AZL D;  1P3I B;  3UTA C;  1P3G A;  1P3F A;  4KGC B;  2ARO A;  3X1S D;  3REJ B;  2BYM B;  5DNM D;  3REL C;  3C1B C;  5GT3 C;  3A6N C;  1KX3 A;  3F6T A;  4WU8 D;  3C1C A;  3AZN D;  5CPK A;  5AV6 C;  4NE3 A;  1P3I A;  2J8P A;  5GSU D;  4KGC A;  3UTB C;  4J8U D;  3REJ A;  2BYM A;  4KUD A;  5AY8 D;  3AV1 C;  4H9R B;  2YFW B;  4M6B A;  4WNN B;  5CP6 D;  2CV5 B;  1F66 B;  4YS3 C;  1P3F D;  1M19 C;  5B1M C;  2ARO D;  2ZY5 A;  2RIQ A;  3B6F B;  2Y2Q A;  1KX3 D;  3WTP D;  3MVD D;  4H9R A;  3AZL C;  4XUJ D;  2YFW A;  5B2I A;  3C1C D;  2YFV B;  4WNN A;  4X23 B;  4WU9 C;  5CPK D;  1B6W A;  2CV5 A;  1EQZ B;  1F66 A;  5BNV B;  3LZ1 C;  5B32 B;  4Z66 B;  3B6F A;  2PYO B;  3W97 C;  4KUD D;  3A1K A;  2Y2H A;  4NE5 A;  3H0L C;  2UWX A;  3AZJ D;  5CPJ C;  5BO0 B;  1KX5 B;  2HUE B;  5B24 B;  3X1V B;  2YFV A;  2ZY3 A;  4WV4 B;  3MGP A;  5AVC C;  4Z2M G;  3AZF B;  1EQZ A;  5BNV A;  3NQJ B;  5B32 A;  4Z66 A;  5AV5 D;  2PYO A;  5AV9 C;  1S32 C;  3IP4 C;  1ID3 B;  2CWE A;  5BO0 A;  5B2I D;  1KX5 A;  5B24 A;  5AVB B;  4LD9 B;  5BT1 D;  3LEL C;  3AZF A;  5BS7 C;  3KUY B;  3WKJ A;  1ULY A;  3NQJ A;  3B6F D;  5B0Y C;  3WAA C;  5B33 B;  5CHL B;  1BH8 B;  4ZBJ B;  1ID3 A;  1HQ3 C;  4R8P C;  3A6N B;  1ZLA B;  3MGP D;  3EPH A;  5AV8 C;  3WA9 C;  5AVB A;  4LD9 A;  3W98 B;  3O62 C;  5B32 D;  5CPI D;  4QLC C;  3AZJ C;  5B0Z B;  3VH5 A;  3UTA A;  5B32 G;  2NZD D;  1P3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...