5FUGB

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2016-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugB00
2NQBB 1P3LB 5BNVB 3MNNC 4JJNC 4KUDB 3AZHC 1P3OB 1P3LA 3LJAD 4ZUXB 5BNVA 5GT0B 4KUDA 4Z5TC 3AV1D 1KX3D 4QLCC 3REJB 1ZLAD 3AZMA 3VH6T 4ZUXA 1M1AC 1Q9CA 3O62C 3REJA 1KX4D 5CP6D 3X1SC 1S32C 1P3ID 3REIA 4J8VD 2NQBC 1P3LC 4KUDC 3X1UC 1P3OC 3C1CB 2CV5D 3B6FA 4Z2MG 5BNXA 4ZUXC 3C1BB 5GT0C 3TU4B 3R45B 3VH5A 1M19D 1JFIB 2JSSA 4KGCD 3B0DB 3AZLD 5AVBC 5KDMA 5CPID 3WTPE 2RVQC 3R45A 4NFTA 1JFIA 3KWQB 3AZKB 3B6GB 3LZ1B 3KWQA 5B0YB 1KX5D 3AZKA 4Z66A 4WU9D 5GT3B 5B0YA 3C1CC 3UTAA 3VH5T 3C1BC 3TU4C 2BYMB 1H3OB 3MGSB 5B1LB 1P3FA 3WAAB 3W99B 5B2ID 5DNMD 5B24B 5B1MB 1H3OA 3B0CT 3KWQC 3LELB 3AZKC 5B24A 1P3GC 2F8NA 3B6GC 3LZ1C 5CPJD 2AROB 5JRGC 5B0YC 5F99A 1P3MA 5BO0B 5GT3C 5B31C 5BO0A 3AZMD 3REHB 3REKC 3MGSC 5B1LC 3WAAC 3W99C 3UT9D 5B1MC 3LELC 3LJAB 5JA4B 3AV1B 1KX3B 3REID 1ZLAB 2AROC 3KXBD 1KX3A 1KX4B 5CP6B 3KUYD 3B6FD 4CAYB 2F8NG 5CP6A 4H9SA 1F66D 1P3IB 4CAYA 4J8VB 3REHC 2CV5B 5AV5A 1WWSA 3LJAC 3MVDA 1M19B 2CV5A 3AV1C 4KGCB 1ZLAC 2LY8A 3AZLB 5CPIB 4Z66D 3AN2D 1KX4C 5CP6C 4H9SC 2YFVB 4DRBA 3UTAD 4J8UA 3X1VB 3AZND 1P3IC 2YFVA 5B32D 3W97D 1KX5B 3X1VA 4J8VC 3VH6W 1P3FD 4J8XA 4WU9B 4EO5B 2CV5C 4YM6D 2NZDA 4WU9A 5BS7C 1M19C 2F8ND 4KGCC 4XUJA 5F99D 3AZLC 5CPIC 4AWLB 1P3MD 5B2IB 3WA9A 5DNMB 1AOID 5B2IA 2BYKB 5GSUD 1KX5C 2BYKA 1TZYD 3WKJA 1KU5A 5CHLB 4EO5C 3MGRD 2PYOA 3AZFA 3AZMB 4AWLC 4M6BA 5B2IC 3UT9B 5DNMC 3X1TD 1A7WA 5DNNA 1P34D 3UT9A 3REIB 5CPJC 1U35A 5B2JA 3KXBB 3KUYB 3B6FB 5AV5D 3KXBA 3AZJB 5BNXB 3B0CW 3UTBD 3KUYA 3MVDD 3AV2D 1F66B 3AZJA 3AZMC 5KDMB 1F66A 5B40D 2HUEB 3REJC 1R4VA 5AV9D 4H9OB 4J8UD 3NQJB 1P3KD 3REIC 4E44A 5C3IB 4H9OA 3KXBC 3X1VD 3NQJA 3MGPA 3V9RB 4Z66B 3AN2B 4J8XD 3KUYC 3UTAB 3B6FC 2NZDD 3V9RA 3AN2A 1P3BD 3AZNB 1F66C 5B32B 3W97B 4XUJD 4WZSB 3AZNA 5B32A 1ULYA 3W97A 1P3FB 3WA9D 2HUEC 2IO5B 3B0DC 4YM6B 1M18A 3KSYA 2F8NB 4YM6A 5F99B 5C3IC 3W98D 3A6NA 1P3MB 3WTPB 4Z66C 3AZID 3WKJD 2PYOD 3UTAC 1AOIB 3WTPA 4X23A 5GSUB 3AZNC 3AZFD 5B32C 1ID3A 3W97C 4H9QB 1AOIA 4J8WD 5AV6D 5GSUA 1TZYB 1P3FC 3B0BA 4H9QA 2IO5C 5DNND 3MGRB 1B67A 1TZYA 4WNNB 5B24C 3MGRA 4WNNA 4YS3A 1U35D 5B2JD 5B32G 5F99C 1P3MC 3X1TB 1S32D 4H9PB 1P34B 1AOIC 3X1TA 5GSUC 4XZQD 4H9PA 3AZJD 1P34A 1EQZD 1TZYC 1HQ3A 3X1UD 5AV5B 3MGRC 3UTBB 3MVDB 3AV2B 1BH9B 3UTBA 4G92B 5B40B 3AV2A 1BH9A 3MGPD 1KX3C 4DRAA 3X1TC 1HTAA 5AV9B 5B40A 5GXQD 1P34C 4J8UB 1P3KB 5AV9A 5AVCD 1P3KA 2HIOA 2YFWA 4J8XB 5B33A 3W96D 1F1EA 5AV5C 2NZDB 3UTBC 1P3BB 1M18D 3MVDC 4XUJB 1P3BA 4LD9D 3A6ND 4G92C 5B40C 3WA9B 5AV9C 5BT1D 3WTPD 3AZEA 4X23D 4J8UC 1P3GD 1P3KC 2FJ7A 1ID3D 5JRGD 3W98B 5CPKA 3NQUA 1P3AA 3X1VC 4J8XC 3AZIB 3WKJB 3W98A 2PYOB 5B0ZA 3MGQD 2NZDC 1P3BC 3AZIA 4WU9C 3AZFB 5E5AD 1WWIA 4XUJC 4YS3D 5AV6B 4J8WB 3REKD 3WA9C 5DNNB 4J8WA 5AV6A 3AYWD 4JJNA 1BH8A 1U35B 5B2JB 4Z5TA 3VH6A 3VH5W 1TAFB 4QLCA 1HQ3D 3AZIC 3WKJC 1S32B 2PYOC 1TAFA 3O62A 3AFAD 3X1SA 4XZQB 4CSRA 3AZFC 1S32A 1EQZB 4J8WC 5AV6C 4XZQA 4HGAB 3X1UB 5DNNC 1EQZA 2NQBA 3LZ0D 3UT9C 4NE3A 3X1UA 4NE6A 1P3OA 1U35C 4Z2MH 5B2JC 5AVBB 5GT0A 2HIOD 3MGPB 5B33D 5AVBA 5GXQB 4E45A 4KHAB 4XZQC 5AVCB 3RELD 3AZJC 5GXQA 4H9NB 1EQZC 4KHAA 5AVCA 4HGAC 3W96B 4ZBJB 4H9NA 5AV8D 3W96A 1M18B 3AZED 4WU8D 3C1CA 2FJ7D 5CPKD 5AY8D 3A6NB 3C1BA 1P3AD 3TU4A 4LD9B 3MGPC 4R8PD 4LD9A 5B0ZD 1P3PD 5GXQC 3AN2C 4X23B 1P3GB 4H9RB 1ID3B 5AVCC 5JRGB 2F8NK 4UUZB 3AZGD 1P3GA 3B6GA 4H9RA 3LZ1A 3W96C 5JRGA 5B31B 4UUZA 4ZBJC 3MGQB 3MNND 1M18C 4JJND 5GT3A 5G49B 5B31A 3AZHD 4NE5A 5E5AB 4YM6C 3MGQA 1N1JB 4YS3B 3REKB 4LD9C 3A6NC 5G49A 4Z5TD 5E5AA 4QLCD 1N1JA 2BYMA 3REKA 3MGSA 5B1LA 3AYWB 5BT1C 1M1AD 3WAAA 3W99A 3WTPC 3O62D 4X23C 3X1SD 5B1MA 3LELA 3AYWA 1ID3C 2CWEA 1HQ3B 2AROA 3MGQC 2NQBD 1P3LD 3AFAB 4KUDD 1P3OD 5E5AC 4YS3C 3AFAA 4ZUXD 5GT0D 2F8NH 3REJD 5AVBD 3REHA 2RVQD 3AYWC 4G91B 5B31G 3LZ0B 3LJAA 5JA4A 3LZ0A 2L5AA 2HIOB 3AV1A 2YFWB 1HQ3C 5B33B 1ZLAA 1KX4A 3AFAC 3C1CD 3RELB 4WV4B 1B6WA 5FUGB 3C1BD 3TU4D 3AV2C 1P3IA 3RELA 1BFMA 4J8VA 5FUGA 5AV8B 4G91C 3AZEB 3LZ0C 4WU8B 2FJ7B 3KWQD 5AV8A 5CPKB 3NQUB 5AY8B 3AZKD 1P3AB 4WU8A 5BS7A 1M19A 3B6GD 2HIOC 4KGCA 3LZ1D 4R8PB 5B33C 5B0YD 3AZLA 5AY8A 5CPIA 5B0ZB 1P3PB 4R8PA 5GT3D 5B31D 3RELC 1P3PA 3AZGB 1KX5A 3MGSD 5B1LD 3AZGA 3WAAD 5AV8C 3W99D 3MNNB 4JJNB 3AZEC 3AZHB 1BH8B 4WU8C 5B24D 5B1MD 2FJ7C 3LELD 3MNNA 5AY8C 5CPKC 4Z5TB 3AZHA 1P3AC 4QLCB 2AROD 4R8PC 3W98C 1M1AB 5B0ZC 1P3PC 3O62B 5DNMA 3X1SB 4CSRB 1M1AA 5CPJB 3AZGC 5CPJA 3REHD
chains in the Genus database with same CATH superfamily
2NQBB 1P3LB 3EPKA 5BNVB 3MNNC 4JJNC 4KUDB 3AZHC 1P3OB 1P3LA 3LJAD 4ZUXB 2ZM5A 5BNVA 5GT0B 4KUDA 4Z5TC 3AV1D 1KX3D 4QLCC 3REJB 1ZLAD 3AZMA 3VH6T 4ZUXA 2G5HC 1M1AC 1Q9CA 2VQRA 3O62C 3REJA 1KX4D 5CP6D 3X1SC 1S32C 1P3ID 3REIA 4J8VD 2NQBC 1P3LC 4KUDC 3X1UC 1P3OC 3C1CB 2CV5D 2UWXA 1Z2CB 3B6FA 4Z2MG 2Y2NA 5BNXA 4ZUXC 3C1BB 5GT0C 3TU4B 3R45B 3VH5A 1M19D 1JFIB 2JSSA 4KGCD 3H0LC 3B0DB 3AZLD 5AVBC 5KDMA 5CPID 3WTPE 2RVQC 3R45A 4NFTA 1JFIA 3KWQB 3AZKB 3B6GB 3LZ1B 3KWQA 5B0YB 1KX5D 3H0MC 3AZKA 4Z66A 4WU9D 5GT3B 5B0YA 3C1CC 3UTAA 4DQYB 3VH5T 3C1BC 3TU4C 3EPHA 2BYMB 1H3OB 3MGSB 5B1LB 1P3FA 3WAAB 3W99B 5B2ID 5DNMD 5B24B 5B1MB 1H3OA 3B0CT 3KWQC 3LELB 3AZKC 5B24A 1P3GC 2F8NA 3B6GC 2W8SA 3LZ1C 5CPJD 2AROB 5JRGC 5B0YC 5F99A 1P3MA 5BO0B 5GT3C 5B31C 5BO0A 2Y2GA 3AZMD 3REHB 3REKC 3MGSC 5B1LC 3WAAC 3W99C 3UT9D 5B1MC 3LELC 2Y2JA 3LJAB 5JA4B 3AV1B 1KX3B 3REID 1ZLAB 2AROC 2Y2OA 3KXBD 1KX3A 1KX4B 5CP6B 3KUYD 3B6FD 2DQNC 4CAYB 2F8NG 5CP6A 4H9SA 1F66D 1P3IB 4CAYA 4J8VB 3REHC 3P5JB 2CV5B 5AV5A 1WWSA 3EG5B 3LJAC 3MVDA 1M19B 2CV5A 3AV1C 4KGCB 1ZLAC 2LY8A 3AZLB 5CPIB 2XD1A 4Z66D 3AN2D 1KX4C 5CP6C 4H9SC 2YFVB 4DRBA 3UTAD 2G5IC 4J8UA 3X1VB 3AZND 1P3IC 2YFVA 5B32D 3W97D 1KX5B 3X1VA 4J8VC 3VH6W 1P3FD 4J8XA 4WU9B 1PZRA 4EO5B 2CV5C 4YM6D 2NZDA 4WU9A 5BS7C 1M19C 2F8ND 4KGCC 4XUJA 5F99D 3AZLC 5CPIC 4AWLB 1P3MD 5B2IB 3WA9A 5DNMB 2JE5A 1AOID 5B2IA 2BYKB 5GSUD 1KX5C 2BYKA 1TZYD 3WKJA 1KU5A 5CHLB 4EO5C 3MGRD 2PYOA 3AZFA 3AZMB 2F2AC 4AWLC 4M6BA 5B2IC 3UT9B 5DNMC 3X1TD 1A7WA 5DNNA 1P34D 3UT9A 3REIB 5CPJC 1U35A 5B2JA 3KXBB 3KUYB 3B6FB 5AV5D 3KXBA 3AZJB 5BNXB 3B0CW 3UTBD 3KUYA 3MVDD 3AV2D 1F66B 3AZJA 3AZMC 5KDMB 1F66A 5B40D 2HUEB 3REJC 1R4VA 5AV9D 4H9OB 4J8UD 3NQJB 1P3KD 3REIC 4E44A 5C3IB 4H9OA 3KXBC 3X1VD 3NQJA 3MGPA 3V9RB 4Z66B 3AN2B 4J8XD 3KUYC 3UTAB 3B6FC 2NZDD 3V9RA 3AN2A 1P3BD 3AZNB 1F66C 5B32B 3W97B 4XUJD 2ZY4A 4WZSB 3AZNA 5B32A 1ULYA 3W97A 1P3FB 3WA9D 2HUEC 2IO5B 3B0DC 4YM6B 1M18A 3KSYA 2F8NB 3H0RC 4YM6A 2Y2IA 5F99B 5C3IC 3W98D 3A6NA 1P3MB 3WTPB 4Z66C 3AZID 3WKJD 2PYOD 3UTAC 1AOIB 2Y2HA 3WTPA 4X23A 5GSUB 3AZNC 3AZFD 5B32C 1ID3A 3W97C 4H9QB 1AOIA 4J8WD 5AV6D 5GSUA 1TZYB 1P3FC 3B0BA 4H9QA 2IO5C 5DNND 3MGRB 1B67A 1TZYA 4WNNB 5B24C 3MGRA 4WNNA 4YS3A 1U35D 5B2JD 5B32G 5F99C 1P3MC 3X1TB 4UPKA 1S32D 4H9PB 1P34B 1AOIC 3X1TA 5GSUC 4XZQD 3A1IA 4H9PA 3AZJD 1P34A 1EQZD 1TZYC 1HQ3A 3X1UD 5AV5B 3MGRC 3UTBB 3MVDB 3AV2B 1BH9B 3EPJA 3UTBA 4G92B 5B40B 3AV2A 1BH9A 3MGPD 1KX3C 4DRAA 2XD5A 3X1TC 1HTAA 5AV9B 5B40A 5GXQD 1P34C 4J8UB 1P3KB 5AV9A 5AVCD 1P3KA 2HIOA 2YFWA 4J8XB 5B33A 3W96D 1F1EA 5AV5C 2NZDB 3UTBC 1P3BB 1M18D 3MVDC 4XUJB 1P3BA 4LD9D 3A6ND 4G92C 5B40C 2Y2PA 3WA9B 2Y2LA 5AV9C 5BT1D 3WTPD 3AZEA 4X23D 4J8UC 2DF4C 1P3GD 1P3KC 2FJ7A 1ID3D 5JRGD 3W98B 5CPKA 3NQUA 1P3AA 3X1VC 4J8XC 3AZIB 3WKJB 3W98A 2PYOB 5B0ZA 3MGQD 2NZDC 2Y2KA 1P3BC 3AZIA 4WU9C 3AZFB 5E5AD 1WWIA 4XUJC 4YS3D 5AV6B 4J8WB 3REKD 3WA9C 5DNNB 4J8WA 5AV6A 3AYWD 4JJNA 1BH8A 2FFFB 1U35B 5B2JB 4Z5TA 3VH6A 3VH5W 1TAFB 4QLCA 1HQ3D 2J8PA 3AZIC 3WKJC 1S32B 2PYOC 1TAFA 3O62A 3AFAD 3X1SA 4XZQB 4CSRA 3AZFC 1S32A 1EQZB 4J8WC 5AV6C 4XZQA 4HGAB 3X1UB 5DNNC 1EQZA 2NQBA 3LZ0D 3UT9C 4NE3A 3X1UA 4NE6A 1P3OA 1U35C 4Z2MH 5B2JC 5AVBB 5GT0A 2HIOD 3MGPB 5B33D 5AVBA 5GXQB 4E45A 4KHAB 4XZQC 5AVCB 3RELD 3AZJC 5GXQA 4H9NB 1EQZC 4KHAA 5AVCA 4HGAC 3W96B 4ZBJB 4H9NA 5AV8D 3W96A 1M18B 3AZED 4WU8D 3C1CA 2FJ7D 5CPKD 5AY8D 2BG1A 1T3UA 3A6NB 3C1BA 3TU4A 1P3AD 4LD9B 3MGPC 2Y2QA 4R8PD 4LD9A 5B0ZD 1P3PD 5GXQC 3AN2C 4X23B 1P3GB 3A1KA 4H9RB 1ID3B 5AVCC 5JRGB 3EPLA 2F8NK 4UUZB 3AZGD 1P3GA 3B6GA 4H9RA 3LZ1A 3W96C 5JRGA 5B31B 4UUZA 4ZBJC 3MGQB 3MNND 1M18C 4JJND 5GT3A 5G49B 5B31A 3AZHD 4NE5A 3AL0C 5E5AB 4YM6C 3MGQA 1N1JB 4YS3B 3REKB 2ZY3A 3A6NC 4LD9C 5G49A 4Z5TD 5E5AA 4QLCD 1N1JA 2BYMA 3REKA 3MGSA 5B1LA 3AYWB 5BT1C 1M1AD 3WAAA 3W99A 3WTPC 3O62D 4X23C 3X1SD 5B1MA 2JCHA 3LELA 2ZY2A 3AYWA 1ID3C 2CWEA 1HQ3B 2AROA 4WJ3C 3MGQC 2NQBD 1P3LD 3AFAB 2Y2MA 4KUDD 1P3OD 5E5AC 2RIQA 4YS3C 3AFAA 4ZUXD 5GT0D 2F8NH 3REJD 5AVBD 3REHA 2RVQD 3AYWC 4G91B 5B31G 3LZ0B 3LJAA 5JA4A 3LZ0A 2L5AA 3IP4C 2HIOB 3AV1A 2YFWB 1HQ3C 5B33B 1ZLAA 1KX4A 3AFAC 3C1CD 3RELB 4WV4B 1B6WA 5FUGB 3C1BD 3TU4D 3AV2C 1P3IA 3RELA 1BFMA 4J8VA 5FUGA 2ZY5A 5AV8B 4G91C 3AZEB 3LZ0C 4WU8B 2FJ7B 3KWQD 5AV8A 5CPKB 3NQUB 5AY8B 3AZKD 1P3AB 4WU8A 5BS7A 1M19A 3B6GD 2HIOC 4KGCA 3LZ1D 3FDDA 4R8PB 5B0YD 5B33C 3AZLA 5AY8A 5CPIA 5B0ZB 1W2EA 1P3PB 4R8PA 5GT3D 5B31D 3RELC 1P3PA 3AZGB 1KX5A 3MGSD 5B1LD 3AZGA 3WAAD 5AV8C 3W99D 3MNNB 4JJNB 3AZEC 3AZHB 1BH8B 4WU8C 5B24D 5B1MD 2FJ7C 3LELD 3KFUG 3MNNA 5AY8C 5CPKC 4Z5TB 3AZHA 1P3AC 4QLCB 2AROD 4R8PC 3W98C 1M1AB 5B0ZC 1P3PC 3O62B 5DNMA 3X1SB 4CSRB 1M1AA 3F6TA 5CPJB 3AZGC 5CPJA 3REHD
chains in the Genus database with same CATH topology
2NQBB 1P3LB 3EPKA 5BNVB 3MNNC 4JJNC 4KUDB 3AZHC 1P3OB 1P3LA 3LJAD 4ZUXB 2ZM5A 5BNVA 5GT0B 4KUDA 4Z5TC 3AV1D 1KX3D 4QLCC 3REJB 1ZLAD 3AZMA 3VH6T 4ZUXA 2G5HC 1M1AC 1Q9CA 2VQRA 3O62C 3REJA 1KX4D 5CP6D 3X1SC 1S32C 1P3ID 3REIA 4J8VD 2NQBC 1P3LC 4KUDC 3X1UC 1P3OC 3C1CB 2CV5D 2UWXA 1Z2CB 3B6FA 4Z2MG 2Y2NA 5BNXA 4ZUXC 3C1BB 5GT0C 3TU4B 3R45B 3VH5A 1M19D 1JFIB 2JSSA 4KGCD 3H0LC 3B0DB 3AZLD 5AVBC 5KDMA 5CPID 3WTPE 2RVQC 3R45A 4NFTA 1JFIA 3KWQB 3AZKB 3B6GB 3LZ1B 3KWQA 5B0YB 1KX5D 3H0MC 3AZKA 4Z66A 4WU9D 5GT3B 5B0YA 3C1CC 3UTAA 4DQYB 3VH5T 3C1BC 3TU4C 3EPHA 2BYMB 1H3OB 3MGSB 5B1LB 1P3FA 3WAAB 3W99B 5B2ID 5DNMD 5B24B 5B1MB 1H3OA 3B0CT 3KWQC 3LELB 3AZKC 5B24A 1P3GC 2F8NA 3B6GC 2W8SA 3LZ1C 5CPJD 2AROB 5JRGC 5B0YC 5F99A 1P3MA 5BO0B 5GT3C 5B31C 5BO0A 2Y2GA 3AZMD 3REHB 3REKC 3MGSC 5B1LC 3WAAC 3W99C 3UT9D 5B1MC 3LELC 2Y2JA 3LJAB 5JA4B 3AV1B 1KX3B 3REID 1ZLAB 2AROC 2Y2OA 3KXBD 1KX3A 1KX4B 5CP6B 3KUYD 3B6FD 2DQNC 4CAYB 2F8NG 5CP6A 4H9SA 1F66D 1P3IB 4CAYA 4J8VB 3REHC 3P5JB 2CV5B 5AV5A 1WWSA 3EG5B 3LJAC 3MVDA 1M19B 2CV5A 3AV1C 4KGCB 1ZLAC 2LY8A 3AZLB 5CPIB 2XD1A 4Z66D 3AN2D 1KX4C 5CP6C 4H9SC 2YFVB 4DRBA 3UTAD 2G5IC 4J8UA 3X1VB 3AZND 1P3IC 2YFVA 5B32D 3W97D 1KX5B 3X1VA 4J8VC 3VH6W 1P3FD 4J8XA 4WU9B 1PZRA 4EO5B 2CV5C 4YM6D 2NZDA 4WU9A 5BS7C 1M19C 2F8ND 4KGCC 4XUJA 5F99D 3AZLC 5CPIC 4AWLB 1P3MD 5B2IB 3WA9A 5DNMB 2JE5A 1AOID 5B2IA 2BYKB 5GSUD 1KX5C 2BYKA 1TZYD 3WKJA 1KU5A 5CHLB 4EO5C 3MGRD 2PYOA 3AZFA 3AZMB 2F2AC 4AWLC 4M6BA 5B2IC 3UT9B 5DNMC 3X1TD 1A7WA 5DNNA 1P34D 3UT9A 3REIB 5CPJC 1U35A 5B2JA 3KXBB 3KUYB 3B6FB 5AV5D 3KXBA 3AZJB 5BNXB 3B0CW 3UTBD 3KUYA 3MVDD 3AV2D 1F66B 3AZJA 3AZMC 5KDMB 1F66A 5B40D 2HUEB 3REJC 1R4VA 5AV9D 4H9OB 4J8UD 3NQJB 1P3KD 3REIC 4E44A 5C3IB 4H9OA 3KXBC 3X1VD 3NQJA 3MGPA 3V9RB 4Z66B 3AN2B 4J8XD 3KUYC 3UTAB 3B6FC 2NZDD 3V9RA 3AN2A 1P3BD 3AZNB 1F66C 5B32B 3W97B 4XUJD 2ZY4A 4WZSB 3AZNA 5B32A 1ULYA 3W97A 1P3FB 3WA9D 2HUEC 2IO5B 3B0DC 4YM6B 1M18A 3KSYA 2F8NB 3H0RC 4YM6A 2Y2IA 5F99B 5C3IC 3W98D 3A6NA 1P3MB 3WTPB 4Z66C 3AZID 3WKJD 2PYOD 3UTAC 1AOIB 2Y2HA 3WTPA 4X23A 5GSUB 3AZNC 3AZFD 5B32C 1ID3A 3W97C 4H9QB 1AOIA 4J8WD 5AV6D 5GSUA 1TZYB 1P3FC 3B0BA 4H9QA 2IO5C 5DNND 3MGRB 1B67A 1TZYA 4WNNB 5B24C 3MGRA 4WNNA 4YS3A 1U35D 5B2JD 5B32G 5F99C 1P3MC 3X1TB 4UPKA 1S32D 4H9PB 1P34B 1AOIC 3X1TA 5GSUC 4XZQD 3A1IA 4H9PA 3AZJD 1P34A 1EQZD 1TZYC 1HQ3A 3X1UD 5AV5B 3MGRC 3UTBB 3MVDB 3AV2B 1BH9B 3EPJA 3UTBA 4G92B 5B40B 3AV2A 1BH9A 3MGPD 1KX3C 4DRAA 2XD5A 3X1TC 1HTAA 5AV9B 5B40A 5GXQD 1P34C 4J8UB 1P3KB 5AV9A 5AVCD 1P3KA 2HIOA 2YFWA 4J8XB 5B33A 3W96D 1F1EA 5AV5C 2NZDB 3UTBC 1P3BB 1M18D 3MVDC 4XUJB 1P3BA 4LD9D 3A6ND 4G92C 5B40C 2Y2PA 3WA9B 2Y2LA 5AV9C 5BT1D 3WTPD 3AZEA 4X23D 4J8UC 2DF4C 1P3GD 1P3KC 2FJ7A 1ID3D 5JRGD 3W98B 5CPKA 3NQUA 1P3AA 3X1VC 4J8XC 3AZIB 3WKJB 3W98A 2PYOB 5B0ZA 3MGQD 2NZDC 2Y2KA 1P3BC 3AZIA 4WU9C 3AZFB 5E5AD 1WWIA 4XUJC 4YS3D 5AV6B 4J8WB 3REKD 3WA9C 5DNNB 4J8WA 5AV6A 3AYWD 4JJNA 1BH8A 2FFFB 1U35B 5B2JB 4Z5TA 3VH6A 3VH5W 1TAFB 4QLCA 1HQ3D 2J8PA 3AZIC 3WKJC 1S32B 2PYOC 1TAFA 3O62A 3AFAD 3X1SA 4XZQB 4CSRA 3AZFC 1S32A 1EQZB 4J8WC 5AV6C 4XZQA 4HGAB 3X1UB 5DNNC 1EQZA 2NQBA 3LZ0D 3UT9C 4NE3A 3X1UA 4NE6A 1P3OA 1U35C 4Z2MH 5B2JC 5AVBB 5GT0A 2HIOD 3MGPB 5B33D 5AVBA 5GXQB 4E45A 4KHAB 4XZQC 5AVCB 3RELD 3AZJC 5GXQA 4H9NB 1EQZC 4KHAA 5AVCA 4HGAC 3W96B 4ZBJB 4H9NA 5AV8D 3W96A 1M18B 3AZED 4WU8D 3C1CA 2FJ7D 5CPKD 5AY8D 2BG1A 1T3UA 3A6NB 3C1BA 3TU4A 1P3AD 4LD9B 3MGPC 2Y2QA 4R8PD 4LD9A 5B0ZD 1P3PD 5GXQC 3AN2C 4X23B 1P3GB 3A1KA 4H9RB 1ID3B 5AVCC 5JRGB 3EPLA 2F8NK 4UUZB 3AZGD 1P3GA 3B6GA 4H9RA 3LZ1A 3W96C 5JRGA 5B31B 4UUZA 4ZBJC 3MGQB 3MNND 1M18C 4JJND 5GT3A 5G49B 5B31A 3AZHD 4NE5A 3AL0C 5E5AB 4YM6C 3MGQA 1N1JB 4YS3B 3REKB 2ZY3A 3A6NC 4LD9C 5G49A 4Z5TD 5E5AA 4QLCD 1N1JA 2BYMA 3REKA 3MGSA 5B1LA 3AYWB 5BT1C 1M1AD 3WAAA 3W99A 3WTPC 3O62D 4X23C 3X1SD 5B1MA 2JCHA 3LELA 2ZY2A 3AYWA 1ID3C 2CWEA 1HQ3B 2AROA 4WJ3C 3MGQC 2NQBD 1P3LD 3AFAB 2Y2MA 4KUDD 1P3OD 5E5AC 2RIQA 4YS3C 3AFAA 4ZUXD 5GT0D 2F8NH 3REJD 5AVBD 3REHA 2RVQD 3AYWC 4G91B 5B31G 3LZ0B 3LJAA 5JA4A 3LZ0A 2L5AA 3IP4C 2HIOB 3AV1A 2YFWB 1HQ3C 5B33B 1ZLAA 1KX4A 3AFAC 3C1CD 3RELB 4WV4B 1B6WA 5FUGB 3C1BD 3TU4D 3AV2C 1P3IA 3RELA 1BFMA 4J8VA 5FUGA 2ZY5A 5AV8B 4G91C 3AZEB 3LZ0C 4WU8B 2FJ7B 3KWQD 5AV8A 5CPKB 3NQUB 5AY8B 3AZKD 1P3AB 4WU8A 5BS7A 1M19A 3B6GD 2HIOC 4KGCA 3LZ1D 3FDDA 4R8PB 5B0YD 5B33C 3AZLA 5AY8A 5CPIA 5B0ZB 1W2EA 1P3PB 4R8PA 5GT3D 5B31D 3RELC 1P3PA 3AZGB 1KX5A 3MGSD 5B1LD 3AZGA 3WAAD 5AV8C 3W99D 3MNNB 4JJNB 3AZEC 3AZHB 1BH8B 4WU8C 5B24D 5B1MD 2FJ7C 3LELD 3KFUG 3MNNA 5AY8C 5CPKC 4Z5TB 3AZHA 1P3AC 4QLCB 2AROD 4R8PC 3W98C 1M1AB 5B0ZC 1P3PC 3O62B 5DNMA 3X1SB 4CSRB 1M1AA 3F6TA 5CPJB 3AZGC 5CPJA 3REHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB B;  1P3L B;  5BNV B;  3MNN C;  4JJN C;  4KUD B;  3AZH C;  1P3O B;  1P3L A;  3LJA D;  4ZUX B;  5BNV A;  5GT0 B;  4KUD A;  4Z5T C;  3AV1 D;  1KX3 D;  4QLC C;  3REJ B;  1ZLA D;  3AZM A;  3VH6 T;  4ZUX A;  1M1A C;  1Q9C A;  3O62 C;  3REJ A;  1KX4 D;  5CP6 D;  3X1S C;  1S32 C;  1P3I D;  3REI A;  4J8V D;  2NQB C;  1P3L C;  4KUD C;  3X1U C;  1P3O C;  3C1C B;  2CV5 D;  3B6F A;  4Z2M G;  5BNX A;  4ZUX C;  3C1B B;  5GT0 C;  3TU4 B;  3R45 B;  3VH5 A;  1M19 D;  1JFI B;  2JSS A;  4KGC D;  3B0D B;  3AZL D;  5AVB C;  5KDM A;  5CPI D;  3WTP E;  2RVQ C;  3R45 A;  4NFT A;  1JFI A;  3KWQ B;  3AZK B;  3B6G B;  3LZ1 B;  3KWQ A;  5B0Y B;  1KX5 D;  3AZK A;  4Z66 A;  4WU9 D;  5GT3 B;  5B0Y A;  3C1C C;  3UTA A;  3VH5 T;  3C1B C;  3TU4 C;  2BYM B;  1H3O B;  3MGS B;  5B1L B;  1P3F A;  3WAA B;  3W99 B;  5B2I D;  5DNM D;  5B24 B;  5B1M B;  1H3O A;  3B0C T;  3KWQ C;  3LEL B;  3AZK C;  5B24 A;  1P3G C;  2F8N A;  3B6G C;  3LZ1 C;  5CPJ D;  2ARO B;  5JRG C;  5B0Y C;  5F99 A;  1P3M A;  5BO0 B;  5GT3 C;  5B31 C;  5BO0 A;  3AZM D;  3REH B;  3REK C;  3MGS C;  5B1L C;  3WAA C;  3W99 C;  3UT9 D;  5B1M C;  3LEL C;  3LJA B;  5JA4 B;  3AV1 B;  1KX3 B;  3REI D;  1ZLA B;  2ARO C;  3KXB D;  1KX3 A;  1KX4 B;  5CP6 B;  3KUY D;  3B6F D;  4CAY B;  2F8N G;  5CP6 A;  4H9S A;  1F66 D;  1P3I B;  4CAY A;  4J8V B;  3REH C;  2CV5 B;  5AV5 A;  1WWS A;  3LJA C;  3MVD A;  1M19 B;  2CV5 A;  3AV1 C;  4KGC B;  1ZLA C;  2LY8 A;  3AZL B;  5CPI B;  4Z66 D;  3AN2 D;  1KX4 C;  5CP6 C;  4H9S C;  2YFV B;  4DRB A;  3UTA D;  4J8U A;  3X1V B;  3AZN D;  1P3I C;  2YFV A;  5B32 D;  3W97 D;  1KX5 B;  3X1V A;  4J8V C;  3VH6 W;  1P3F D;  4J8X A;  4WU9 B;  4EO5 B;  2CV5 C;  4YM6 D;  2NZD A;  4WU9 A;  5BS7 C;  1M19 C;  2F8N D;  4KGC C;  4XUJ A;  5F99 D;  3AZL C;  5CPI C;  4AWL B;  1P3M D;  5B2I B;  3WA9 A;  5DNM B;  1AOI D;  5B2I A;  2BYK B;  5GSU D;  1KX5 C;  2BYK A;  1TZY D;  3WKJ A;  1KU5 A;  5CHL B;  4EO5 C;  3MGR D;  2PYO A;  3AZF A;  3AZM B;  4AWL C;  4M6B A;  5B2I C;  3UT9 B;  5DNM C;  3X1T D;  1A7W A;  5DNN A;  1P34 D;  3UT9 A;  3REI B;  5CPJ C;  1U35 A;  5B2J A;  3KXB B;  3KUY B;  3B6F B;  5AV5 D;  3KXB A;  3AZJ B;  5BNX B;  3B0C W;  3UTB D;  3KUY A;  3MVD D;  3AV2 D;  1F66 B;  3AZJ A;  3AZM C;  5KDM B;  1F66 A;  5B40 D;  2HUE B;  3REJ C;  1R4V A;  5AV9 D;  4H9O B;  4J8U D;  3NQJ B;  1P3K D;  3REI C;  4E44 A;  5C3I B;  4H9O A;  3KXB C;  3X1V D;  3NQJ A;  3MGP A;  3V9R B;  4Z66 B;  3AN2 B;  4J8X D;  3KUY C;  3UTA B;  3B6F C;  2NZD D;  3V9R A;  3AN2 A;  1P3B D;  3AZN B;  1F66 C;  5B32 B;  3W97 B;  4XUJ D;  4WZS B;  3AZN A;  5B32 A;  1ULY A;  3W97 A;  1P3F B;  3WA9 D;  2HUE C;  2IO5 B;  3B0D C;  4YM6 B;  1M18 A;  3KSY A;  2F8N B;  4YM6 A;  5F99 B;  5C3I C;  3W98 D;  3A6N A;  1P3M B;  3WTP B;  4Z66 C;  3AZI D;  3WKJ D;  2PYO D;  3UTA C;  1AOI B;  3WTP A;  4X23 A;  5GSU B;  3AZN C;  3AZF D;  5B32 C;  1ID3 A;  3W97 C;  4H9Q B;  1AOI A;  4J8W D;  5AV6 D;  5GSU A;  1TZY B;  1P3F C;  3B0B A;  4H9Q A;  2IO5 C;  5DNN D;  3MGR B;  1B67 A;  1TZY A;  4WNN B;  5B24 C;  3MGR A;  4WNN A;  4YS3 A;  1U35 D;  5B2J D;  5B32 G;  5F99 C;  1P3M C;  3X1T B;  1S32 D;  4H9P B;  1P34 B;  1AOI C;  3X1T A;  5GSU C;  4XZQ D;  4H9P A;  3AZJ D;  1P34 A;  1EQZ D;  1TZY C;  1HQ3 A;  3X1U D;  5AV5 B;  3MGR C;  3UTB B;  3MVD B;  3AV2 B;  1BH9 B;  3UTB A;  4G92 B;  5B40 B;  3AV2 A;  1BH9 A;  3MGP D;  1KX3 C;  4DRA A;  3X1T C;  1HTA A;  5AV9 B;  5B40 A;  5GXQ D;  1P34 C;  4J8U B;  1P3K B;  5AV9 A;  5AVC D;  1P3K A;  2HIO A;  2YFW A;  4J8X B;  5B33 A;  3W96 D;  1F1E A;  5AV5 C;  2NZD B;  3UTB C;  1P3B B;  1M18 D;  3MVD C;  4XUJ B;  1P3B A;  4LD9 D;  3A6N D;  4G92 C;  5B40 C;  3WA9 B;  5AV9 C;  5BT1 D;  3WTP D;  3AZE A;  4X23 D;  4J8U C;  1P3G D;  1P3K C;  2FJ7 A;  1ID3 D;  5JRG D;  3W98 B;  5CPK A;  3NQU A;  1P3A A;  3X1V C;  4J8X C;  3AZI B;  3WKJ B;  3W98 A;  2PYO B;  5B0Z A;  3MGQ D;  2NZD C;  1P3B C;  3AZI A;  4WU9 C;  3AZF B;  5E5A D;  1WWI A;  4XUJ C;  4YS3 D;  5AV6 B;  4J8W B;  3REK D;  3WA9 C;  5DNN B;  4J8W A;  5AV6 A;  3AYW D;  4JJN A;  1BH8 A;  1U35 B;  5B2J B;  4Z5T A;  3VH6 A;  3VH5 W;  1TAF B;  4QLC A;  1HQ3 D;  3AZI C;  3WKJ C;  1S32 B;  2PYO C;  1TAF A;  3O62 A;  3AFA D;  3X1S A;  4XZQ B;  4CSR A;  3AZF C;  1S32 A;  1EQZ B;  4J8W C;  5AV6 C;  4XZQ A;  4HGA B;  3X1U B;  5DNN C;  1EQZ A;  2NQB A;  3LZ0 D;  3UT9 C;  4NE3 A;  3X1U A;  4NE6 A;  1P3O A;  1U35 C;  4Z2M H;  5B2J C;  5AVB B;  5GT0 A;  2HIO D;  3MGP B;  5B33 D;  5AVB A;  5GXQ B;  4E45 A;  4KHA B;  4XZQ C;  5AVC B;  3REL D;  3AZJ C;  5GXQ A;  4H9N B;  1EQZ C;  4KHA A;  5AVC A;  4HGA C;  3W96 B;  4ZBJ B;  4H9N A;  5AV8 D;  3W96 A;  1M18 B;  3AZE D;  4WU8 D;  3C1C A;  2FJ7 D;  5CPK D;  5AY8 D;  3A6N B;  3C1B A;  1P3A D;  3TU4 A;  4LD9 B;  3MGP C;  4R8P D;  4LD9 A;  5B0Z D;  1P3P D;  5GXQ C;  3AN2 C;  4X23 B;  1P3G B;  4H9R B;  1ID3 B;  5AVC C;  5JRG B;  2F8N K;  4UUZ B;  3AZG D;  1P3G A;  3B6G A;  4H9R A;  3LZ1 A;  3W96 C;  5JRG A;  5B31 B;  4UUZ A;  4ZBJ C;  3MGQ B;  3MNN D;  1M18 C;  4JJN D;  5GT3 A;  5G49 B;  5B31 A;  3AZH D;  4NE5 A;  5E5A B;  4YM6 C;  3MGQ A;  1N1J B;  4YS3 B;  3REK B;  4LD9 C;  3A6N C;  5G49 A;  4Z5T D;  5E5A A;  4QLC D;  1N1J A;  2BYM A;  3REK A;  3MGS A;  5B1L A;  3AYW B;  5BT1 C;  1M1A D;  3WAA A;  3W99 A;  3WTP C;  3O62 D;  4X23 C;  3X1S D;  5B1M A;  3LEL A;  3AYW A;  1ID3 C;  2CWE A;  1HQ3 B;  2ARO A;  3MGQ C;  2NQB D;  1P3L D;  3AFA B;  4KUD D;  1P3O D;  5E5A C;  4YS3 C;  3AFA A;  4ZUX D;  5GT0 D;  2F8N H;  3REJ D;  5AVB D;  3REH A;  2RVQ D;  3AYW C;  4G91 B;  5B31 G;  3LZ0 B;  3LJA A;  5JA4 A;  3LZ0 A;  2L5A A;  2HIO B;  3AV1 A;  2YFW B;  1HQ3 C;  5B33 B;  1ZLA A;  1KX4 A;  3AFA C;  3C1C D;  3REL B;  4WV4 B;  1B6W A;  5FUG B;  3C1B D;  3TU4 D;  3AV2 C;  1P3I A;  3REL A;  1BFM A;  4J8V A;  5FUG A;  5AV8 B;  4G91 C;  3AZE B;  3LZ0 C;  4WU8 B;  2FJ7 B;  3KWQ D;  5AV8 A;  5CPK B;  3NQU B;  5AY8 B;  3AZK D;  1P3A B;  4WU8 A;  5BS7 A;  1M19 A;  3B6G D;  2HIO C;  4KGC A;  3LZ1 D;  4R8P B;  5B33 C;  5B0Y D;  3AZL A;  5AY8 A;  5CPI A;  5B0Z B;  1P3P B;  4R8P A;  5GT3 D;  5B31 D;  3REL C;  1P3P A;  3AZG B;  1KX5 A;  3MGS D;  5B1L D;  3AZG A;  3WAA D;  5AV8 C;  3W99 D;  3MNN B;  4JJN B;  3AZE C;  3AZH B;  1BH8 B;  4WU8 C;  5B24 D;  5B1M D;  2FJ7 C;  3LEL D;  3MNN A;  5AY8 C;  5CPK C;  4Z5T B;  3AZH A;  1P3A C;  4QLC B;  2ARO D;  4R8P C;  3W98 C;  1M1A B;  5B0Z C;  1P3P C;  3O62 B;  5DNM A;  3X1S B;  4CSR B;  1M1A A;  5CPJ B;  3AZG C;  5CPJ A;  3REH D; 
#chains in the Genus database with same CATH topology
 2NQB B;  1P3L B;  3EPK A;  5BNV B;  3MNN C;  4JJN C;  4KUD B;  3AZH C;  1P3O B;  1P3L A;  3LJA D;  4ZUX B;  2ZM5 A;  5BNV A;  5GT0 B;  4KUD A;  4Z5T C;  3AV1 D;  1KX3 D;  4QLC C;  3REJ B;  1ZLA D;  3AZM A;  3VH6 T;  4ZUX A;  2G5H C;  1M1A C;  1Q9C A;  2VQR A;  3O62 C;  3REJ A;  1KX4 D;  5CP6 D;  3X1S C;  1S32 C;  1P3I D;  3REI A;  4J8V D;  2NQB C;  1P3L C;  4KUD C;  3X1U C;  1P3O C;  3C1C B;  2CV5 D;  2UWX A;  1Z2C B;  3B6F A;  4Z2M G;  2Y2N A;  5BNX A;  4ZUX C;  3C1B B;  5GT0 C;  3TU4 B;  3R45 B;  3VH5 A;  1M19 D;  1JFI B;  2JSS A;  4KGC D;  3H0L C;  3B0D B;  3AZL D;  5AVB C;  5KDM A;  5CPI D;  3WTP E;  2RVQ C;  3R45 A;  4NFT A;  1JFI A;  3KWQ B;  3AZK B;  3B6G B;  3LZ1 B;  3KWQ A;  5B0Y B;  1KX5 D;  3H0M C;  3AZK A;  4Z66 A;  4WU9 D;  5GT3 B;  5B0Y A;  3C1C C;  3UTA A;  4DQY B;  3VH5 T;  3C1B C;  3TU4 C;  3EPH A;  2BYM B;  1H3O B;  3MGS B;  5B1L B;  1P3F A;  3WAA B;  3W99 B;  5B2I D;  5DNM D;  5B24 B;  5B1M B;  1H3O A;  3B0C T;  3KWQ C;  3LEL B;  3AZK C;  5B24 A;  1P3G C;  2F8N A;  3B6G C;  2W8S A;  3LZ1 C;  5CPJ D;  2ARO B;  5JRG C;  5B0Y C;  5F99 A;  1P3M A;  5BO0 B;  5GT3 C;  5B31 C;  5BO0 A;  2Y2G A;  3AZM D;  3REH B;  3REK C;  3MGS C;  5B1L C;  3WAA C;  3W99 C;  3UT9 D;  5B1M C;  3LEL C;  2Y2J A;  3LJA B;  5JA4 B;  3AV1 B;  1KX3 B;  3REI D;  1ZLA B;  2ARO C;  2Y2O A;  3KXB D;  1KX3 A;  1KX4 B;  5CP6 B;  3KUY D;  3B6F D;  2DQN C;  4CAY B;  2F8N G;  5CP6 A;  4H9S A;  1F66 D;  1P3I B;  4CAY A;  4J8V B;  3REH C;  3P5J B;  2CV5 B;  5AV5 A;  1WWS A;  3EG5 B;  3LJA C;  3MVD A;  1M19 B;  2CV5 A;  3AV1 C;  4KGC B;  1ZLA C;  2LY8 A;  3AZL B;  5CPI B;  2XD1 A;  4Z66 D;  3AN2 D;  1KX4 C;  5CP6 C;  4H9S C;  2YFV B;  4DRB A;  3UTA D;  2G5I C;  4J8U A;  3X1V B;  3AZN D;  1P3I C;  2YFV A;  5B32 D;  3W97 D;  1KX5 B;  3X1V A;  4J8V C;  3VH6 W;  1P3F D;  4J8X A;  4WU9 B;  1PZR A;  4EO5 B;  2CV5 C;  4YM6 D;  2NZD A;  4WU9 A;  5BS7 C;  1M19 C;  2F8N D;  4KGC C;  4XUJ A;  5F99 D;  3AZL C;  5CPI C;  4AWL B;  1P3M D;  5B2I B;  3WA9 A;  5DNM B;  2JE5 A;  1AOI D;  5B2I A;  2BYK B;  5GSU D;  1KX5 C;  2BYK A;  1TZY D;  3WKJ A;  1KU5 A;  5CHL B;  4EO5 C;  3MGR D;  2PYO A;  3AZF A;  3AZM B;  2F2A C;  4AWL C;  4M6B A;  5B2I C;  3UT9 B;  5DNM C;  3X1T D;  1A7W A;  5DNN A;  1P34 D;  3UT9 A;  3REI B;  5CPJ C;  1U35 A;  5B2J A;  3KXB B;  3KUY B;  3B6F B;  5AV5 D;  3KXB A;  3AZJ B;  5BNX B;  3B0C W;  3UTB D;  3KUY A;  3MVD D;  3AV2 D;  1F66 B;  3AZJ A;  3AZM C;  5KDM B;  1F66 A;  5B40 D;  2HUE B;  3REJ C;  1R4V A;  5AV9 D;  4H9O B;  4J8U D;  3NQJ B;  1P3K D;  3REI C;  4E44 A;  5C3I B;  4H9O A;  3KXB C;  3X1V D;  3NQJ A;  3MGP A;  3V9R B;  4Z66 B;  3AN2 B;  4J8X D;  3KUY C;  3UTA B;  3B6F C;  2NZD D;  3V9R A;  3AN2 A;  1P3B D;  3AZN B;  1F66 C;  5B32 B;  3W97 B;  4XUJ D;  2ZY4 A;  4WZS B;  3AZN A;  5B32 A;  1ULY A;  3W97 A;  1P3F B;  3WA9 D;  2HUE C;  2IO5 B;  3B0D C;  4YM6 B;  1M18 A;  3KSY A;  2F8N B;  3H0R C;  4YM6 A;  2Y2I A;  5F99 B;  5C3I C;  3W98 D;  3A6N A;  1P3M B;  3WTP B;  4Z66 C;  3AZI D;  3WKJ D;  2PYO D;  3UTA C;  1AOI B;  2Y2H A;  3WTP A;  4X23 A;  5GSU B;  3AZN C;  3AZF D;  5B32 C;  1ID3 A;  3W97 C;  4H9Q B;  1AOI A;  4J8W D;  5AV6 D;  5GSU A;  1TZY B;  1P3F C;  3B0B A;  4H9Q A;  2IO5 C;  5DNN D;  3MGR B;  1B67 A;  1TZY A;  4WNN B;  5B24 C;  3MGR A;  4WNN A;  4YS3 A;  1U35 D;  5B2J D;  5B32 G;  5F99 C;  1P3M C;  3X1T B;  4UPK A;  1S32 D;  4H9P B;  1P34 B;  1AOI C;  3X1T A;  5GSU C;  4XZQ D;  3A1I A;  4H9P A;  3AZJ D;  1P34 A;  1EQZ D;  1TZY C;  1HQ3 A;  3X1U D;  5AV5 B;  3MGR C;  3UTB B;  3MVD B;  3AV2 B;  1BH9 B;  3EPJ A;  3UTB A;  4G92 B;  5B40 B;  3AV2 A;  1BH9 A;  3MGP D;  1KX3 C;  4DRA A;  2XD5 A;  3X1T C;  1HTA A;  5AV9 B;  5B40 A;  5GXQ D;  1P34 C;  4J8U B;  1P3K B;  5AV9 A;  5AVC D;  1P3K A;  2HIO A;  2YFW A;  4J8X B;  5B33 A;  3W96 D;  1F1E A;  5AV5 C;  2NZD B;  3UTB C;  1P3B B;  1M18 D;  3MVD C;  4XUJ B;  1P3B A;  4LD9 D;  3A6N D;  4G92 C;  5B40 C;  2Y2P A;  3WA9 B;  2Y2L A;  5AV9 C;  5BT1 D;  3WTP D;  3AZE A;  4X23 D;  4J8U C;  2DF4 C;  1P3G D;  1P3K C;  2FJ7 A;  1ID3 D;  5JRG D;  3W98 B;  5CPK A;  3NQU A;  1P3A A;  3X1V C;  4J8X C;  3AZI B;  3WKJ B;  3W98 A;  2PYO B;  5B0Z A;  3MGQ D;  2NZD C;  2Y2K A;  1P3B C;  3AZI A;  4WU9 C;  3AZF B;  5E5A D;  1WWI A;  4XUJ C;  4YS3 D;  5AV6 B;  4J8W B;  3REK D;  3WA9 C;  5DNN B;  4J8W A;  5AV6 A;  3AYW D;  4JJN A;  1BH8 A;  2FFF B;  1U35 B;  5B2J B;  4Z5T A;  3VH6 A;  3VH5 W;  1TAF B;  4QLC A;  1HQ3 D;  2J8P A;  3AZI C;  3WKJ C;  1S32 B;  2PYO C;  1TAF A;  3O62 A;  3AFA D;  3X1S A;  4XZQ B;  4CSR A;  3AZF C;  1S32 A;  1EQZ B;  4J8W C;  5AV6 C;  4XZQ A;  4HGA B;  3X1U B;  5DNN C;  1EQZ A;  2NQB A;  3LZ0 D;  3UT9 C;  4NE3 A;  3X1U A;  4NE6 A;  1P3O A;  1U35 C;  4Z2M H;  5B2J C;  5AVB B;  5GT0 A;  2HIO D;  3MGP B;  5B33 D;  5AVB A;  5GXQ B;  4E45 A;  4KHA B;  4XZQ C;  5AVC B;  3REL D;  3AZJ C;  5GXQ A;  4H9N B;  1EQZ C;  4KHA A;  5AVC A;  4HGA C;  3W96 B;  4ZBJ B;  4H9N A;  5AV8 D;  3W96 A;  1M18 B;  3AZE D;  4WU8 D;  3C1C A;  2FJ7 D;  5CPK D;  5AY8 D;  2BG1 A;  1T3U A;  3A6N B;  3C1B A;  3TU4 A;  1P3A D;  4LD9 B;  3MGP C;  2Y2Q A;  4R8P D;  4LD9 A;  5B0Z D;  1P3P D;  5GXQ C;  3AN2 C;  4X23 B;  1P3G B;  3A1K A;  4H9R B;  1ID3 B;  5AVC C;  5JRG B;  3EPL A;  2F8N K;  4UUZ B;  3AZG D;  1P3G A;  3B6G A;  4H9R A;  3LZ1 A;  3W96 C;  5JRG A;  5B31 B;  4UUZ A;  4ZBJ C;  3MGQ B;  3MNN D;  1M18 C;  4JJN D;  5GT3 A;  5G49 B;  5B31 A;  3AZH D;  4NE5 A;  3AL0 C;  5E5A B;  4YM6 C;  3MGQ A;  1N1J B;  4YS3 B;  3REK B;  2ZY3 A;  3A6N C;  4LD9 C;  5G49 A;  4Z5T D;  5E5A A;  4QLC D;  1N1J A;  2BYM A;  3REK A;  3MGS A;  5B1L A;  3AYW B;  5BT1 C;  1M1A D;  3WAA A;  3W99 A;  3WTP C;  3O62 D;  4X23 C;  3X1S D;  5B1M A;  2JCH A;  3LEL A;  2ZY2 A;  3AYW A;  1ID3 C;  2CWE A;  1HQ3 B;  2ARO A;  4WJ3 C;  3MGQ C;  2NQB D;  1P3L D;  3AFA B;  2Y2M A;  4KUD D;  1P3O D;  5E5A C;  2RIQ A;  4YS3 C;  3AFA A;  4ZUX D;  5GT0 D;  2F8N H;  3REJ D;  5AVB D;  3REH A;  2RVQ D;  3AYW C;  4G91 B;  5B31 G;  3LZ0 B;  3LJA A;  5JA4 A;  3LZ0 A;  2L5A A;  3IP4 C;  2HIO B;  3AV1 A;  2YFW B;  1HQ3 C;  5B33 B;  1ZLA A;  1KX4 A;  3AFA C;  3C1C D;  3REL B;  4WV4 B;  1B6W A;  5FUG B;  3C1B D;  3TU4 D;  3AV2 C;  1P3I A;  3REL A;  1BFM A;  4J8V A;  5FUG A;  2ZY5 A;  5AV8 B;  4G91 C;  3AZE B;  3LZ0 C;  4WU8 B;  2FJ7 B;  3KWQ D;  5AV8 A;  5CPK B;  3NQU B;  5AY8 B;  3AZK D;  1P3A B;  4WU8 A;  5BS7 A;  1M19 A;  3B6G D;  2HIO C;  4KGC A;  3LZ1 D;  3FDD A;  4R8P B;  5B0Y D;  5B33 C;  3AZL A;  5AY8 A;  5CPI A;  5B0Z B;  1W2E A;  1P3P B;  4R8P A;  5GT3 D;  5B31 D;  3REL C;  1P3P A;  3AZG B;  1KX5 A;  3MGS D;  5B1L D;  3AZG A;  3WAA D;  5AV8 C;  3W99 D;  3MNN B;  4JJN B;  3AZE C;  3AZH B;  1BH8 B;  4WU8 C;  5B24 D;  5B1M D;  2FJ7 C;  3LEL D;  3KFU G;  3MNN A;  5AY8 C;  5CPK C;  4Z5T B;  3AZH A;  1P3A C;  4QLC B;  2ARO D;  4R8P C;  3W98 C;  1M1A B;  5B0Z C;  1P3P C;  3O62 B;  5DNM A;  3X1S B;  4CSR B;  1M1A A;  3F6T A;  5CPJ B;  3AZG C;  5CPJ A;  3REH D; 
#chains in the Genus database with same CATH homology
 2NQB B;  1P3L B;  3EPK A;  5BNV B;  3MNN C;  4JJN C;  4KUD B;  3AZH C;  1P3O B;  1P3L A;  3LJA D;  4ZUX B;  2ZM5 A;  5BNV A;  5GT0 B;  4KUD A;  4Z5T C;  3AV1 D;  1KX3 D;  4QLC C;  3REJ B;  1ZLA D;  3AZM A;  3VH6 T;  4ZUX A;  2G5H C;  1M1A C;  1Q9C A;  2VQR A;  3O62 C;  3REJ A;  1KX4 D;  5CP6 D;  3X1S C;  1S32 C;  1P3I D;  3REI A;  4J8V D;  2NQB C;  1P3L C;  4KUD C;  3X1U C;  1P3O C;  3C1C B;  2CV5 D;  2UWX A;  1Z2C B;  3B6F A;  4Z2M G;  2Y2N A;  5BNX A;  4ZUX C;  3C1B B;  5GT0 C;  3TU4 B;  3R45 B;  3VH5 A;  1M19 D;  1JFI B;  2JSS A;  4KGC D;  3H0L C;  3B0D B;  3AZL D;  5AVB C;  5KDM A;  5CPI D;  3WTP E;  2RVQ C;  3R45 A;  4NFT A;  1JFI A;  3KWQ B;  3AZK B;  3B6G B;  3LZ1 B;  3KWQ A;  5B0Y B;  1KX5 D;  3H0M C;  3AZK A;  4Z66 A;  4WU9 D;  5GT3 B;  5B0Y A;  3C1C C;  3UTA A;  4DQY B;  3VH5 T;  3C1B C;  3TU4 C;  3EPH A;  2BYM B;  1H3O B;  3MGS B;  5B1L B;  1P3F A;  3WAA B;  3W99 B;  5B2I D;  5DNM D;  5B24 B;  5B1M B;  1H3O A;  3B0C T;  3KWQ C;  3LEL B;  3AZK C;  5B24 A;  1P3G C;  2F8N A;  3B6G C;  2W8S A;  3LZ1 C;  5CPJ D;  2ARO B;  5JRG C;  5B0Y C;  5F99 A;  1P3M A;  5BO0 B;  5GT3 C;  5B31 C;  5BO0 A;  2Y2G A;  3AZM D;  3REH B;  3REK C;  3MGS C;  5B1L C;  3WAA C;  3W99 C;  3UT9 D;  5B1M C;  3LEL C;  2Y2J A;  3LJA B;  5JA4 B;  3AV1 B;  1KX3 B;  3REI D;  1ZLA B;  2ARO C;  2Y2O A;  3KXB D;  1KX3 A;  1KX4 B;  5CP6 B;  3KUY D;  3B6F D;  2DQN C;  4CAY B;  2F8N G;  5CP6 A;  4H9S A;  1F66 D;  1P3I B;  4CAY A;  4J8V B;  3REH C;  3P5J B;  2CV5 B;  5AV5 A;  1WWS A;  3EG5 B;  3LJA C;  3MVD A;  1M19 B;  2CV5 A;  3AV1 C;  4KGC B;  1ZLA C;  2LY8 A;  3AZL B;  5CPI B;  2XD1 A;  4Z66 D;  3AN2 D;  1KX4 C;  5CP6 C;  4H9S C;  2YFV B;  4DRB A;  3UTA D;  2G5I C;  4J8U A;  3X1V B;  3AZN D;  1P3I C;  2YFV A;  5B32 D;  3W97 D;  1KX5 B;  3X1V A;  4J8V C;  3VH6 W;  1P3F D;  4J8X A;  4WU9 B;  1PZR A;  4EO5 B;  2CV5 C;  4YM6 D;  2NZD A;  4WU9 A;  5BS7 C;  1M19 C;  2F8N D;  4KGC C;  4XUJ A;  5F99 D;  3AZL C;  5CPI C;  4AWL B;  1P3M D;  5B2I B;  3WA9 A;  5DNM B;  2JE5 A;  1AOI D;  5B2I A;  2BYK B;  5GSU D;  1KX5 C;  2BYK A;  1TZY D;  3WKJ A;  1KU5 A;  5CHL B;  4EO5 C;  3MGR D;  2PYO A;  3AZF A;  3AZM B;  2F2A C;  4AWL C;  4M6B A;  5B2I C;  3UT9 B;  5DNM C;  3X1T D;  1A7W A;  5DNN A;  1P34 D;  3UT9 A;  3REI B;  5CPJ C;  1U35 A;  5B2J A;  3KXB B;  3KUY B;  3B6F B;  5AV5 D;  3KXB A;  3AZJ B;  5BNX B;  3B0C W;  3UTB D;  3KUY A;  3MVD D;  3AV2 D;  1F66 B;  3AZJ A;  3AZM C;  5KDM B;  1F66 A;  5B40 D;  2HUE B;  3REJ C;  1R4V A;  5AV9 D;  4H9O B;  4J8U D;  3NQJ B;  1P3K D;  3REI C;  4E44 A;  5C3I B;  4H9O A;  3KXB C;  3X1V D;  3NQJ A;  3MGP A;  3V9R B;  4Z66 B;  3AN2 B;  4J8X D;  3KUY C;  3UTA B;  3B6F C;  2NZD D;  3V9R A;  3AN2 A;  1P3B D;  3AZN B;  1F66 C;  5B32 B;  3W97 B;  4XUJ D;  2ZY4 A;  4WZS B;  3AZN A;  5B32 A;  1ULY A;  3W97 A;  1P3F B;  3WA9 D;  2HUE C;  2IO5 B;  3B0D C;  4YM6 B;  1M18 A;  3KSY A;  2F8N B;  3H0R C;  4YM6 A;  2Y2I A;  5F99 B;  5C3I C;  3W98 D;  3A6N A;  1P3M B;  3WTP B;  4Z66 C;  3AZI D;  3WKJ D;  2PYO D;  3UTA C;  1AOI B;  2Y2H A;  3WTP A;  4X23 A;  5GSU B;  3AZN C;  3AZF D;  5B32 C;  1ID3 A;  3W97 C;  4H9Q B;  1AOI A;  4J8W D;  5AV6 D;  5GSU A;  1TZY B;  1P3F C;  3B0B A;  4H9Q A;  2IO5 C;  5DNN D;  3MGR B;  1B67 A;  1TZY A;  4WNN B;  5B24 C;  3MGR A;  4WNN A;  4YS3 A;  1U35 D;  5B2J D;  5B32 G;  5F99 C;  1P3M C;  3X1T B;  4UPK A;  1S32 D;  4H9P B;  1P34 B;  1AOI C;  3X1T A;  5GSU C;  4XZQ D;  3A1I A;  4H9P A;  3AZJ D;  1P34 A;  1EQZ D;  1TZY C;  1HQ3 A;  3X1U D;  5AV5 B;  3MGR C;  3UTB B;  3MVD B;  3AV2 B;  1BH9 B;  3EPJ A;  3UTB A;  4G92 B;  5B40 B;  3AV2 A;  1BH9 A;  3MGP D;  1KX3 C;  4DRA A;  2XD5 A;  3X1T C;  1HTA A;  5AV9 B;  5B40 A;  5GXQ D;  1P34 C;  4J8U B;  1P3K B;  5AV9 A;  5AVC D;  1P3K A;  2HIO A;  2YFW A;  4J8X B;  5B33 A;  3W96 D;  1F1E A;  5AV5 C;  2NZD B;  3UTB C;  1P3B B;  1M18 D;  3MVD C;  4XUJ B;  1P3B A;  4LD9 D;  3A6N D;  4G92 C;  5B40 C;  2Y2P A;  3WA9 B;  2Y2L A;  5AV9 C;  5BT1 D;  3WTP D;  3AZE A;  4X23 D;  4J8U C;  2DF4 C;  1P3G D;  1P3K C;  2FJ7 A;  1ID3 D;  5JRG D;  3W98 B;  5CPK A;  3NQU A;  1P3A A;  3X1V C;  4J8X C;  3AZI B;  3WKJ B;  3W98 A;  2PYO B;  5B0Z A;  3MGQ D;  2NZD C;  2Y2K A;  1P3B C;  3AZI A;  4WU9 C;  3AZF B;  5E5A D;  1WWI A;  4XUJ C;  4YS3 D;  5AV6 B;  4J8W B;  3REK D;  3WA9 C;  5DNN B;  4J8W A;  5AV6 A;  3AYW D;  4JJN A;  1BH8 A;  2FFF B;  1U35 B;  5B2J B;  4Z5T A;  3VH6 A;  3VH5 W;  1TAF B;  4QLC A;  1HQ3 D;  2J8P A;  3AZI C;  3WKJ C;  1S32 B;  2PYO C;  1TAF A;  3O62 A;  3AFA D;  3X1S A;  4XZQ B;  4CSR A;  3AZF C;  1S32 A;  1EQZ B;  4J8W C;  5AV6 C;  4XZQ A;  4HGA B;  3X1U B;  5DNN C;  1EQZ A;  2NQB A;  3LZ0 D;  3UT9 C;  4NE3 A;  3X1U A;  4NE6 A;  1P3O A;  1U35 C;  4Z2M H;  5B2J C;  5AVB B;  5GT0 A;  2HIO D;  3MGP B;  5B33 D;  5AVB A;  5GXQ B;  4E45 A;  4KHA B;  4XZQ C;  5AVC B;  3REL D;  3AZJ C;  5GXQ A;  4H9N B;  1EQZ C;  4KHA A;  5AVC A;  4HGA C;  3W96 B;  4ZBJ B;  4H9N A;  5AV8 D;  3W96 A;  1M18 B;  3AZE D;  4WU8 D;  3C1C A;  2FJ7 D;  5CPK D;  5AY8 D;  2BG1 A;  1T3U A;  3A6N B;  3C1B A;  3TU4 A;  1P3A D;  4LD9 B;  3MGP C;  2Y2Q A;  4R8P D;  4LD9 A;  5B0Z D;  1P3P D;  5GXQ C;  3AN2 C;  4X23 B;  1P3G B;  3A1K A;  4H9R B;  1ID3 B;  5AVC C;  5JRG B;  3EPL A;  2F8N K;  4UUZ B;  3AZG D;  1P3G A;  3B6G A;  4H9R A;  3LZ1 A;  3W96 C;  5JRG A;  5B31 B;  4UUZ A;  4ZBJ C;  3MGQ B;  3MNN D;  1M18 C;  4JJN D;  5GT3 A;  5G49 B;  5B31 A;  3AZH D;  4NE5 A;  3AL0 C;  5E5A B;  4YM6 C;  3MGQ A;  1N1J B;  4YS3 B;  3REK B;  2ZY3 A;  3A6N C;  4LD9 C;  5G49 A;  4Z5T D;  5E5A A;  4QLC D;  1N1J A;  2BYM A;  3REK A;  3MGS A;  5B1L A;  3AYW B;  5BT1 C;  1M1A D;  3WAA A;  3W99 A;  3WTP C;  3O62 D;  4X23 C;  3X1S D;  5B1M A;  2JCH A;  3LEL A;  2ZY2 A;  3AYW A;  1ID3 C;  2CWE A;  1HQ3 B;  2ARO A;  4WJ3 C;  3MGQ C;  2NQB D;  1P3L D;  3AFA B;  2Y2M A;  4KUD D;  1P3O D;  5E5A C;  2RIQ A;  4YS3 C;  3AFA A;  4ZUX D;  5GT0 D;  2F8N H;  3REJ D;  5AVB D;  3REH A;  2RVQ D;  3AYW C;  4G91 B;  5B31 G;  3LZ0 B;  3LJA A;  5JA4 A;  3LZ0 A;  2L5A A;  3IP4 C;  2HIO B;  3AV1 A;  2YFW B;  1HQ3 C;  5B33 B;  1ZLA A;  1KX4 A;  3AFA C;  3C1C D;  3REL B;  4WV4 B;  1B6W A;  5FUG B;  3C1B D;  3TU4 D;  3AV2 C;  1P3I A;  3REL A;  1BFM A;  4J8V A;  5FUG A;  2ZY5 A;  5AV8 B;  4G91 C;  3AZE B;  3LZ0 C;  4WU8 B;  2FJ7 B;  3KWQ D;  5AV8 A;  5CPK B;  3NQU B;  5AY8 B;  3AZK D;  1P3A B;  4WU8 A;  5BS7 A;  1M19 A;  3B6G D;  2HIO C;  4KGC A;  3LZ1 D;  3FDD A;  4R8P B;  5B0Y D;  5B33 C;  3AZL A;  5AY8 A;  5CPI A;  5B0Z B;  1W2E A;  1P3P B;  4R8P A;  5GT3 D;  5B31 D;  3REL C;  1P3P A;  3AZG B;  1KX5 A;  3MGS D;  5B1L D;  3AZG A;  3WAA D;  5AV8 C;  3W99 D;  3MNN B;  4JJN B;  3AZE C;  3AZH B;  1BH8 B;  4WU8 C;  5B24 D;  5B1M D;  2FJ7 C;  3LEL D;  3KFU G;  3MNN A;  5AY8 C;  5CPK C;  4Z5T B;  3AZH A;  1P3A C;  4QLC B;  2ARO D;  4R8P C;  3W98 C;  1M1A B;  5B0Z C;  1P3P C;  3O62 B;  5DNM A;  3X1S B;  4CSR B;  1M1A A;  3F6T A;  5CPJ B;  3AZG C;  5CPJ A;  3REH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...