5FUGB

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
b'ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2016-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugB00
3WKJC 4G92B 2HIOA 4LD9A 2BYKB 3AZLA 1P3KA 5B2JB 5B0ZC 1P3FB 1U35A 1M19B 3MNND 3AV2A 2NZDD 3X1TB 4G92C 3X1VA 4YM6D 5AV8B 5B2JC 5KDMA 4Z66D 5B0YB 1P3IC 4X23D 4WU8D 5DNMB 1ID3D 1KX3B 3WKJD 4H9QA 4DRBA 5GT3A 3WTPA 5B0ZD 3AV1A 3TU4B 4XZQC 5CPJA 4YS3A 3B0DB 5G49A 3AZJC 3LELB 3AZNB 3MGQC 1P3ID 1P34C 4H9RA 3MGSC 1P3OC 2F8NB 5B40C 4YM6A 4KUDA 5GXQC 5AV9C 4JJNC 5B24A 2IO5B 4KHAB 4M6BA 5BO0B 3MGPD 1S32D 5AVCC 2YFWB 4XZQD 5CP6A 5CPKD 5AVBD 3A6NB 1ZLAB 4WU9A 3W99C 3UTBA 4Z5TA 1KU5A 1BH8A 4H9NB 5DNNC 4J8XC 3AZKB 1P34D 1P3OD 5B40D 2BYKA 5GXQD 5B2JA 4ZUXB 5AV9D 1P3FA 4KGCC 5B1LB 1P3IA 5B31C 1R4VA 5AVCD 3C1BB 3AZED 3X1SC 4J8VB 2CV5B 1M1AB 3AZFB 1AOIC 3W99D 5GSUB 4QLCC 3WA9B 4XZQA 5DNMA 4G91C 5DNND 3LZ0B 4J8XD 1KX3A 3WAAB 3VH6W 3KXBB 3KWQC 1KX5C 3AZJA 4KGCD 4J8WC 3MGQA 3AFAB 3MVDB 3LZ0C 3MGSA 3AZHC 5B40A 3X1SD 3KUYB 4XUJB 1P3GB 2FJ7C 4JJNA 1AOID 3LELA 5B2IB 5AV6B 4QLCD 1TZYB 3UTAB 2F8NA 5CPIB 2HIOC 1P3GC 4LD9C 3AZLC 4KHAA 3KWQD 1P3KC 5BO0A 3MGRB 1U35C 2YFWA 1HTAA 3AZHD 4H9SC 3X1VC 3UT9B 3W96B 3AN2B 5B32B 2FJ7D 3MGRC 1P3PB 3AZGD 5B31A 4H9NA 5BNXB 3AZKA 5B33B 2HIOD 4ZUXA 1AOIA 3AZIB 4LD9D 3AZLD 5GT3C 5B1LA 4QLCA 1P3KD 4NE5A 1U35D 3C1BA 2HUEB 5CPJC 4YS3C 3REIB 3AV2D 3AZMB 3WTPE 3KWQA 1P3LB 3X1VD 1KX5A 5GSUA 3REKC 4J8WA 3AZHA 3LZ0A 3WAAA 1KX4C 4NE3A 4KUDC 5BNVB 1TAFB 4H9PA 5AV5B 3B6FC 5E5AC 5GT3D 3AFAA 3MVDA 3AV1D 5CP6C 3KUYA 5CPJD 4YS3D 4XUJA 1P3GA 2CWEA 5C3IB 2NZDB 4HGAC 3LZ1C 4WU9C 3UTBC 1EQZB 5AV6A 4Z5TC 3REKD 1TZYA 4H9OB 2F8NH 3UTAA 4Z66B 5CPIA 4E45A 4H9SA 4WU8B 4X23B 4KUDD 3MGRA 4EO5B 1P3FC 1F66B 1M19C 5B24D 3NQUA 3X1TC 3O62B 5CP6D 3W96A 4WZSB 3UT9A 1BFMA 5AV8C 3RELB 4R8PB 4WU9D 5B0YC 5BNXA 3UTBD 1M18B 1H3OB 4Z5TD 3REJB 1ULYA 5DNMC 5B33A 5GT0B 1KX3C 3W97B 2AROB 3LJAB 3AZIA 3REKA 3REHB 5B2JD 1P3FD 3TU4C 1BH9A 3VH6T 3REIA 1KX4A 3B0DC 3R45B 3B6FA 5AV8D 5E5AA 5CPKB 5AVBB 3LELC 3AZNC 3C1CB 3VH5A 5DNMD 4E44A 1KX3D 1TAFA 3LZ1A 5AV5A 2IO5C 3AZJD 3AYWB 3MGQD 1P3AB 3MGSD 1ZLAC 5JRGB 3A6NC 4UUZB 5F99B 3AZEB 3X1UB 1EQZA 1M19A 4JJND 4H9OA 2RVQC 3LELD 3X1TA 2NQBB 3AZKC 2F8ND 5JRGC 1B6WA 2F8NK 5AV8A 4ZUXC 1F66A 5B0YA 5B1LC 2PYOB 3C1BC 4J8VC 2CV5C 1M1AC 1WWSA 3RELA 3AZFC 2JSSA 2LY8A 2F8NG 5GSUC 3TU4A 1H3OA 3REJA 1P3BB 2PYOC 3WA9C 2RVQD 5B31D 1P3MB 5GT0A 3WAAC 3AZKD 4AWLB 3W97A 2AROA 5BS7C 3LJAA 3KXBC 4ZUXD 3AZNA 1F1EA 5B1LD 3AFAC 3MVDC 3R45A 3C1BD 3KUYC 4AWLC 5FUGB 1M1AD 4XUJC 5B31G 1HQ3B 5AY8B 1KX5D 5B2IC 3C1CA 5AV6C 5GSUD 1TZYC 4J8WD 3WA9D 3UTAC 5CPIC 3LZ0D 3AZGB 3A6NA 1ZLAA 3WAAD 1JFIB 4CAYB 3KSYA 3W98B 3B6GB 3AYWA 4NE6A 1P3AA 3AFAD 3MVDD 4J8UB 5JRGA 3KUYD 5F99A 3W96C 4XUJD 3UT9C 3AN2C 1P3GD 5B32C 3AV2B 1P3PC 3B6GC 4Z2MH 5B1MB 5B2ID 2NQBA 5AV6D 1TZYD 4J8VA 2CV5A 1M1AA 3UTAD 5B33C 5CPID 3B0CW 3AZFA 3AZIC 4ZBJB 3MGRD 2PYOA 3WA9A 2HUEC 3REIC 5BS7A 3AZMC 3WTPB 3KXBA 2YFVB 1P3LC 3W96D 3UT9D 1P3BA 4ZBJC 3VH5W 5B33D 3MNNB 5AV5C 3AZID 5B2IA 4YM6B 5B24B 3REID 1KX4D 5C3IC 2NZDC 1HQ3A 1ID3B 5AY8A 1P3LD 3WKJB 1EQZC 3B6FD 5E5AD 4Z66C 5B0ZB 4X23C 4WU8C 3AN2A 1BH8B 5B32A 4CAYA 3LZ1D 4EO5C 1P3PA 1F66C 3B6GA 5AV5D 3W98A 4J8UA 3O62C 1P3IB 3RELC 1Q9CA 4R8PC 5B1MA 1M18C 2L5AA 1EQZD 3REJC 1M19D 4NFTA 1WWIA 5GT0C 3X1TD 3MGPB 3AZMA 1S32B 3W97C 2AROC 3LJAC 4XZQB 1P3LA 3REHC 3NQJB 1F66D 5B0YD 3MGPC 1S32C 3AZJB 5BNVA 2YFVA 3O62D 3MGQB 4Z2MG 1P34B 3MGSB 1P3OB 5BT1C 3RELD 5AVBC 5B40B 4R8PD 5CPKC 4CSRB 3C1CC 1M18D 5GXQB 5AV9B 3REJD 3TU4D 4DRAA 4JJNB 3MNNA 5GT0D 2NZDA 5AVCB 3W97D 2AROD 3LJAD 3REHD 3AZND 3AYWC 4Z66A 3W99B 1P3AC 4WU8A 4X23A 1ID3A 5F99C 5DNNB 3AZEC 4J8XB 3WKJA 3X1UC 5BT1D 3C1CD 2NQBC 5B0ZA 3O62A 4KGCB 1ZLAD 5JA4B 5B31B 3A6ND 3X1SB 4R8PA 5CHLB 1M18A 3B0CT 1AOIB 3AYWD 1N1JB 1P3AD 4QLCB 5JRGD 4G91B 5F99D 3REHA 3X1UD 1P3BC 3KWQB 1P3MC 3MGPA 2NQBD 1KX5B 1S32A 4J8VD 2CV5D 1B67A 4J8WB 3AZHB 3AZFD 5CPKA 3NQJA 5AVBA 3B0BA 3VH5T 2BYMB 2PYOD 2FJ7B 4H9PB 3V9RB 1P34A 1P3OA 3KXBD 1HQ3C 4WNNB 5AY8C 4CSRA 2HIOB 5AV9A 5GXQA 1P3BD 4LD9B 3AZLB 1P3KB 1P3MD 3AZGC 4UUZA 1U35B 5AVCA 3AZEA 3X1UA 3W98C 3X1VB 3W99A 4J8UC 5KDMB 5DNNA 4J8XA 3NQUB 3AV2C 1HQ3D 5B1MC 5AY8D 1A7WA 4H9QB 4KGCA 5GT3B 5JA4A 3AV1B 3X1SA 5CPJB 3AN2D 4YS3B 5B32D 1P3PD 3W98D 3B6GD 1P3MA 1N1JA 3REKB 4J8UD 5G49B 3WTPC 3AV1C 1BH9B 4H9RB 1KX4B 3VH6A 4KUDB 5B1MD 5B32G 3B6FB 5FUGA 5E5AB 3MNNC 3AZMD 5CP6B 2BYMA 4YM6C 2FJ7A 4HGAB 4WV4B 3LZ1B 4WU9B 3AZGA 5B24C 3V9RA 3UTBB 4Z5TB 3WTPD 1ID3C 1JFIA 4WNNA
chains in the Genus database with same CATH superfamily
3WKJC 4G92B 2HIOA 4LD9A 2BYKB 3AZLA 1P3KA 5B2JB 5B0ZC 1P3FB 1U35A 1M19B 3MNND 3AV2A 2NZDD 3X1TB 4G92C 3X1VA 4YM6D 5AV8B 5B2JC 5KDMA 4Z66D 5B0YB 1P3IC 4X23D 4WU8D 5DNMB 1ID3D 1KX3B 3WKJD 4H9QA 4DRBA 5GT3A 3WTPA 5B0ZD 3AV1A 3TU4B 4XZQC 5CPJA 4YS3A 3B0DB 5G49A 3AZJC 3LELB 3AZNB 3MGQC 1P3ID 1P34C 4H9RA 3MGSC 1P3OC 2F8NB 5B40C 3A1IA 4YM6A 4KUDA 5GXQC 5AV9C 4JJNC 5B24A 2IO5B 4KHAB 4M6BA 5BO0B 3MGPD 1S32D 5AVCC 2YFWB 4XZQD 5CP6A 5CPKD 5AVBD 3A6NB 1ZLAB 4WU9A 3W99C 3UTBA 4Z5TA 1KU5A 2UWXA 1BH8A 4H9NB 5DNNC 4J8XC 3AZKB 1P34D 1P3OD 5B40D 2BYKA 5GXQD 5B2JA 4ZUXB 5AV9D 1P3FA 4KGCC 3FDDA 5B1LB 1P3IA 5B31C 1R4VA 5AVCD 3C1BB 3AZED 3X1SC 4J8VB 2CV5B 1M1AB 3AZFB 1AOIC 3W99D 5GSUB 4QLCC 3WA9B 4XZQA 5DNMA 4G91C 2J8PA 5DNND 3LZ0B 4J8XD 1KX3A 3WAAB 3VH6W 3KXBB 3KWQC 1KX5C 3AZJA 4KGCD 4J8WC 3MGQA 3AFAB 3MVDB 3LZ0C 3A1KA 3MGSA 5B40A 3X1SD 3AZHC 3KUYB 4XUJB 1P3GB 2FJ7C 4JJNA 1AOID 3LELA 5B2IB 5AV6B 4QLCD 1TZYB 3UTAB 2F8NA 5CPIB 2HIOC 1P3GC 4LD9C 3AZLC 4KHAA 3KWQD 1P3KC 5BO0A 3MGRB 2BG1A 1U35C 2YFWA 1HTAA 3AZHD 4H9SC 3X1VC 3UT9B 3W96B 3AN2B 5B32B 2FJ7D 3MGRC 1P3PB 3AZGD 5B31A 4H9NA 5BNXB 3AZKA 5B33B 2HIOD 4ZUXA 1AOIA 3AZIB 4LD9D 3AZLD 5GT3C 5B1LA 4QLCA 1P3KD 4NE5A 1U35D 3C1BA 2HUEB 5CPJC 3KFUG 4YS3C 3REIB 3AV2D 3AZMB 3WTPE 3KWQA 1P3LB 3X1VD 1KX5A 5GSUA 3REKC 4J8WA 3AZHA 3LZ0A 3WAAA 1KX4C 4NE3A 4KUDC 5BNVB 1TAFB 4H9PA 3EPLA 5AV5B 3B6FC 5E5AC 5GT3D 3AFAA 3MVDA 3AV1D 3H0MC 5CP6C 3KUYA 5CPJD 4YS3D 4XUJA 1P3GA 2CWEA 5C3IB 2NZDB 4HGAC 3LZ1C 4WU9C 3UTBC 1EQZB 5AV6A 4Z5TC 3REKD 1TZYA 4H9OB 2F8NH 3UTAA 4Z66B 5CPIA 4E45A 4H9SA 4WU8B 4X23B 4KUDD 3MGRA 4EO5B 1P3FC 1F66B 1M19C 3IP4C 5B24D 3NQUA 3X1TC 2ZY2A 3EPHA 3O62B 5CP6D 3W96A 4WZSB 3UT9A 1BFMA 5AV8C 3RELB 2Y2QA 4R8PB 4WU9D 5B0YC 5BNXA 3UTBD 1M18B 1H3OB 4Z5TD 3REJB 1ULYA 5DNMC 5B33A 4DQYB 5GT0B 1KX3C 3W97B 2AROB 3LJAB 3AZIA 4UPKA 3REKA 3REHB 5B2JD 1P3FD 3TU4C 1BH9A 3VH6T 3REIA 1KX4A 3B0DC 3R45B 3B6FA 5AV8D 5E5AA 5CPKB 5AVBB 3LELC 3AZNC 3C1CB 3VH5A 5DNMD 4E44A 1KX3D 1TAFA 3LZ1A 5AV5A 2IO5C 3AZJD 3AYWB 3MGQD 1P3AB 3MGSD 1ZLAC 5JRGB 3A6NC 3AL0C 4UUZB 3H0LC 5F99B 3AZEB 3X1UB 1EQZA 1M19A 4JJND 4H9OA 2RVQC 2VQRA 3LELD 3X1TA 2NQBB 2DQNC 3AZKC 2F8ND 5JRGC 1B6WA 2F8NK 5AV8A 4ZUXC 1F66A 5B0YA 5B1LC 2PYOB 3C1BC 4J8VC 2CV5C 1M1AC 1WWSA 3RELA 3AZFC 2JSSA 2LY8A 2F8NG 5GSUC 3TU4A 1H3OA 3REJA 1P3BB 2PYOC 3WA9C 2RVQD 2Y2LA 5B31D 1P3MB 5GT0A 2XD5A 3WAAC 3AZKD 4AWLB 3W97A 2AROA 3P5JB 5BS7C 3LJAA 3KXBC 2JE5A 2RIQA 4ZUXD 3AZNA 1F1EA 5B1LD 3AFAC 3MVDC 3R45A 3C1BD 3EG5B 3KUYC 4AWLC 5FUGB 1M1AD 4XUJC 5B31G 1HQ3B 5AY8B 1KX5D 5B2IC 3C1CA 5AV6C 5GSUD 1TZYC 4J8WD 3WA9D 3UTAC 5CPIC 3LZ0D 3AZGB 3A6NA 1ZLAA 3WAAD 1JFIB 4CAYB 3KSYA 2G5IC 3W98B 3B6GB 3AYWA 4NE6A 1P3AA 3AFAD 3MVDD 4J8UB 5JRGA 1PZRA 3KUYD 5F99A 3W96C 4XUJD 3UT9C 3AN2C 1P3GD 5B32C 3AV2B 1P3PC 3B6GC 4Z2MH 5B1MB 5B2ID 2NQBA 5AV6D 1TZYD 4J8VA 2CV5A 1M1AA 3UTAD 5B33C 5CPID 3B0CW 3AZFA 3AZIC 4ZBJB 3MGRD 2PYOA 3WA9A 2HUEC 3REIC 5BS7A 3AZMC 2ZY5A 3WTPB 3KXBA 2YFVB 2ZM5A 1P3LC 3W96D 3UT9D 1P3BA 4ZBJC 3VH5W 5B33D 3MNNB 2ZY4A 5AV5C 3AZID 5B2IA 4YM6B 5B24B 3REID 1KX4D 5C3IC 2NZDC 1HQ3A 1ID3B 5AY8A 1P3LD 3WKJB 1EQZC 3B6FD 5E5AD 4Z66C 5B0ZB 4X23C 4WU8C 3AN2A 1BH8B 5B32A 4CAYA 3LZ1D 4EO5C 1P3PA 1F66C 3B6GA 2Y2MA 5AV5D 3W98A 2Y2IA 4J8UA 3O62C 1P3IB 3RELC 1Q9CA 4R8PC 5B1MA 1M18C 2L5AA 1EQZD 3REJC 1M19D 4NFTA 1WWIA 5GT0C 3X1TD 3MGPB 3AZMA 1S32B 3W97C 2AROC 3LJAC 4XZQB 1P3LA 2Y2PA 3REHC 3NQJB 1F66D 5B0YD 2F2AC 3MGPC 1S32C 3AZJB 5BNVA 2YFVA 3O62D 3MGQB 4Z2MG 1P34B 3MGSB 1P3OB 5BT1C 3RELD 5AVBC 5B40B 4R8PD 5CPKC 4CSRB 3C1CC 1M18D 5GXQB 2XD1A 5AV9B 3REJD 3TU4D 4DRAA 4JJNB 3MNNA 5GT0D 2NZDA 5AVCB 3W97D 2AROD 3LJAD 3REHD 3AZND 3AYWC 4Z66A 3W99B 1P3AC 4WU8A 4X23A 1ID3A 5F99C 5DNNB 3AZEC 4J8XB 3WKJA 3X1UC 5BT1D 3C1CD 2W8SA 2NQBC 5B0ZA 3O62A 4KGCB 1ZLAD 5JA4B 5B31B 3A6ND 3X1SB 4R8PA 5CHLB 1M18A 3B0CT 1AOIB 3AYWD 1N1JB 1P3AD 4QLCB 3EPJA 2JCHA 5JRGD 4G91B 5F99D 3REHA 3X1UD 1P3BC 3KWQB 1P3MC 3MGPA 2NQBD 1KX5B 1S32A 2Y2KA 2Y2OA 4J8VD 2CV5D 1B67A 4J8WB 2Y2GA 3AZHB 3AZFD 3EPKA 3F6TA 3NQJA 5AVBA 5CPKA 3B0BA 3VH5T 2BYMB 2PYOD 2FJ7B 4H9PB 2ZY3A 3V9RB 1P34A 1P3OA 3KXBD 1HQ3C 4WNNB 5AY8C 4CSRA 2HIOB 5AV9A 5GXQA 1P3BD 4LD9B 3AZLB 1P3KB 1P3MD 3AZGC 4UUZA 1U35B 2G5HC 5AVCA 3AZEA 3X1UA 3W98C 3X1VB 3W99A 4J8UC 5KDMB 5DNNA 4J8XA 3NQUB 3AV2C 1HQ3D 5B1MC 5AY8D 1A7WA 4H9QB 4KGCA 5GT3B 5JA4A 3AV1B 3X1SA 2FFFB 5CPJB 3AN2D 4YS3B 5B32D 2Y2HA 1P3PD 3W98D 3B6GD 1P3MA 1N1JA 3REKB 4J8UD 5G49B 3WTPC 3AV1C 1BH9B 4H9RB 3H0RC 1KX4B 3VH6A 2Y2JA 4KUDB 2DF4C 5B1MD 1W2EA 5B32G 2Y2NA 3B6FB 5FUGA 5E5AB 3MNNC 3AZMD 1Z2CB 5CP6B 2BYMA 4WJ3C 4YM6C 1T3UA 2FJ7A 4HGAB 4WV4B 3LZ1B 4WU9B 3AZGA 5B24C 3V9RA 3UTBB 4Z5TB 3WTPD 1ID3C 1JFIA 4WNNA
chains in the Genus database with same CATH topology
3WKJC 4G92B 2HIOA 4LD9A 2BYKB 3AZLA 1P3KA 5B2JB 5B0ZC 1P3FB 1U35A 1M19B 3MNND 3AV2A 2NZDD 3X1TB 4G92C 3X1VA 4YM6D 5AV8B 5B2JC 5KDMA 4Z66D 5B0YB 1P3IC 4X23D 4WU8D 5DNMB 1ID3D 1KX3B 3WKJD 4H9QA 4DRBA 5GT3A 3WTPA 5B0ZD 3AV1A 3TU4B 4XZQC 5CPJA 4YS3A 3B0DB 5G49A 3AZJC 3LELB 3AZNB 3MGQC 1P3ID 1P34C 4H9RA 3MGSC 1P3OC 2F8NB 5B40C 3A1IA 4YM6A 4KUDA 5GXQC 5AV9C 4JJNC 5B24A 2IO5B 4KHAB 4M6BA 5BO0B 3MGPD 1S32D 5AVCC 2YFWB 4XZQD 5CP6A 5CPKD 5AVBD 3A6NB 1ZLAB 4WU9A 3W99C 3UTBA 4Z5TA 1KU5A 2UWXA 1BH8A 4H9NB 5DNNC 4J8XC 3AZKB 1P34D 1P3OD 5B40D 2BYKA 5GXQD 5B2JA 4ZUXB 5AV9D 1P3FA 4KGCC 3FDDA 5B1LB 1P3IA 5B31C 1R4VA 5AVCD 3C1BB 3AZED 3X1SC 4J8VB 2CV5B 1M1AB 3AZFB 1AOIC 3W99D 5GSUB 4QLCC 3WA9B 4XZQA 5DNMA 4G91C 2J8PA 5DNND 3LZ0B 4J8XD 1KX3A 3WAAB 3VH6W 3KXBB 3KWQC 1KX5C 3AZJA 4KGCD 4J8WC 3MGQA 3AFAB 3MVDB 3LZ0C 3A1KA 3MGSA 5B40A 3X1SD 3AZHC 3KUYB 4XUJB 1P3GB 2FJ7C 4JJNA 1AOID 3LELA 5B2IB 5AV6B 4QLCD 1TZYB 3UTAB 2F8NA 5CPIB 2HIOC 1P3GC 4LD9C 3AZLC 4KHAA 3KWQD 1P3KC 5BO0A 3MGRB 2BG1A 1U35C 2YFWA 1HTAA 3AZHD 4H9SC 3X1VC 3UT9B 3W96B 3AN2B 5B32B 2FJ7D 3MGRC 1P3PB 3AZGD 5B31A 4H9NA 5BNXB 3AZKA 5B33B 2HIOD 4ZUXA 1AOIA 3AZIB 4LD9D 3AZLD 5GT3C 5B1LA 4QLCA 1P3KD 4NE5A 1U35D 3C1BA 2HUEB 5CPJC 3KFUG 4YS3C 3REIB 3AV2D 3AZMB 3WTPE 3KWQA 1P3LB 3X1VD 1KX5A 5GSUA 3REKC 4J8WA 3AZHA 3LZ0A 3WAAA 1KX4C 4NE3A 4KUDC 5BNVB 1TAFB 4H9PA 3EPLA 5AV5B 3B6FC 5E5AC 5GT3D 3AFAA 3MVDA 3AV1D 3H0MC 5CP6C 3KUYA 5CPJD 4YS3D 4XUJA 1P3GA 2CWEA 5C3IB 2NZDB 4HGAC 3LZ1C 4WU9C 3UTBC 1EQZB 5AV6A 4Z5TC 3REKD 1TZYA 4H9OB 2F8NH 3UTAA 4Z66B 5CPIA 4E45A 4H9SA 4WU8B 4X23B 4KUDD 3MGRA 4EO5B 1P3FC 1F66B 1M19C 3IP4C 5B24D 3NQUA 3X1TC 2ZY2A 3EPHA 3O62B 5CP6D 3W96A 4WZSB 3UT9A 1BFMA 5AV8C 3RELB 2Y2QA 4R8PB 4WU9D 5B0YC 5BNXA 3UTBD 1M18B 1H3OB 4Z5TD 3REJB 1ULYA 5DNMC 5B33A 4DQYB 5GT0B 1KX3C 3W97B 2AROB 3LJAB 3AZIA 4UPKA 3REKA 3REHB 5B2JD 1P3FD 3TU4C 1BH9A 3VH6T 3REIA 1KX4A 3B0DC 3R45B 3B6FA 5AV8D 5E5AA 5CPKB 5AVBB 3LELC 3AZNC 3C1CB 3VH5A 5DNMD 4E44A 1KX3D 1TAFA 3LZ1A 5AV5A 2IO5C 3AZJD 3AYWB 3MGQD 1P3AB 3MGSD 1ZLAC 5JRGB 3A6NC 3AL0C 4UUZB 3H0LC 5F99B 3AZEB 3X1UB 1EQZA 1M19A 4JJND 4H9OA 2RVQC 2VQRA 3LELD 3X1TA 2NQBB 2DQNC 3AZKC 2F8ND 5JRGC 1B6WA 2F8NK 5AV8A 4ZUXC 1F66A 5B0YA 5B1LC 2PYOB 3C1BC 4J8VC 2CV5C 1M1AC 1WWSA 3RELA 3AZFC 2JSSA 2LY8A 2F8NG 5GSUC 3TU4A 1H3OA 3REJA 1P3BB 2PYOC 3WA9C 2RVQD 2Y2LA 5B31D 1P3MB 5GT0A 2XD5A 3WAAC 3AZKD 4AWLB 3W97A 2AROA 3P5JB 5BS7C 3LJAA 3KXBC 2JE5A 2RIQA 4ZUXD 3AZNA 1F1EA 5B1LD 3AFAC 3MVDC 3R45A 3C1BD 3EG5B 3KUYC 4AWLC 5FUGB 1M1AD 4XUJC 5B31G 1HQ3B 5AY8B 1KX5D 5B2IC 3C1CA 5AV6C 5GSUD 1TZYC 4J8WD 3WA9D 3UTAC 5CPIC 3LZ0D 3AZGB 3A6NA 1ZLAA 3WAAD 1JFIB 4CAYB 3KSYA 2G5IC 3W98B 3B6GB 3AYWA 4NE6A 1P3AA 3AFAD 3MVDD 4J8UB 5JRGA 1PZRA 3KUYD 5F99A 3W96C 4XUJD 3UT9C 3AN2C 1P3GD 5B32C 3AV2B 1P3PC 3B6GC 4Z2MH 5B1MB 5B2ID 2NQBA 5AV6D 1TZYD 4J8VA 2CV5A 1M1AA 3UTAD 5B33C 5CPID 3B0CW 3AZFA 3AZIC 4ZBJB 3MGRD 2PYOA 3WA9A 2HUEC 3REIC 5BS7A 3AZMC 2ZY5A 3WTPB 3KXBA 2YFVB 2ZM5A 1P3LC 3W96D 3UT9D 1P3BA 4ZBJC 3VH5W 5B33D 3MNNB 2ZY4A 5AV5C 3AZID 5B2IA 4YM6B 5B24B 3REID 1KX4D 5C3IC 2NZDC 1HQ3A 1ID3B 5AY8A 1P3LD 3WKJB 1EQZC 3B6FD 5E5AD 4Z66C 5B0ZB 4X23C 4WU8C 3AN2A 1BH8B 5B32A 4CAYA 3LZ1D 4EO5C 1P3PA 1F66C 3B6GA 2Y2MA 5AV5D 3W98A 2Y2IA 4J8UA 3O62C 1P3IB 3RELC 1Q9CA 4R8PC 5B1MA 1M18C 2L5AA 1EQZD 3REJC 1M19D 4NFTA 1WWIA 5GT0C 3X1TD 3MGPB 3AZMA 1S32B 3W97C 2AROC 3LJAC 4XZQB 1P3LA 2Y2PA 3REHC 3NQJB 1F66D 5B0YD 2F2AC 3MGPC 1S32C 3AZJB 5BNVA 2YFVA 3O62D 3MGQB 4Z2MG 1P34B 3MGSB 1P3OB 5BT1C 3RELD 5AVBC 5B40B 4R8PD 5CPKC 4CSRB 3C1CC 1M18D 5GXQB 2XD1A 5AV9B 3REJD 3TU4D 4DRAA 4JJNB 3MNNA 5GT0D 2NZDA 5AVCB 3W97D 2AROD 3LJAD 3REHD 3AZND 3AYWC 4Z66A 3W99B 1P3AC 4WU8A 4X23A 1ID3A 5F99C 5DNNB 3AZEC 4J8XB 3WKJA 3X1UC 5BT1D 3C1CD 2W8SA 2NQBC 5B0ZA 3O62A 4KGCB 1ZLAD 5JA4B 5B31B 3A6ND 3X1SB 4R8PA 5CHLB 1M18A 3B0CT 1AOIB 3AYWD 1N1JB 1P3AD 4QLCB 3EPJA 2JCHA 5JRGD 4G91B 5F99D 3REHA 3X1UD 1P3BC 3KWQB 1P3MC 3MGPA 2NQBD 1KX5B 1S32A 2Y2KA 2Y2OA 4J8VD 2CV5D 1B67A 4J8WB 2Y2GA 3AZHB 3AZFD 3EPKA 3F6TA 3NQJA 5AVBA 5CPKA 3B0BA 3VH5T 2BYMB 2PYOD 2FJ7B 4H9PB 2ZY3A 3V9RB 1P34A 1P3OA 3KXBD 1HQ3C 4WNNB 5AY8C 4CSRA 2HIOB 5AV9A 5GXQA 1P3BD 4LD9B 3AZLB 1P3KB 1P3MD 3AZGC 4UUZA 1U35B 2G5HC 5AVCA 3AZEA 3X1UA 3W98C 3X1VB 3W99A 4J8UC 5KDMB 5DNNA 4J8XA 3NQUB 3AV2C 1HQ3D 5B1MC 5AY8D 1A7WA 4H9QB 4KGCA 5GT3B 5JA4A 3AV1B 3X1SA 2FFFB 5CPJB 3AN2D 4YS3B 5B32D 2Y2HA 1P3PD 3W98D 3B6GD 1P3MA 1N1JA 3REKB 4J8UD 5G49B 3WTPC 3AV1C 1BH9B 4H9RB 3H0RC 1KX4B 3VH6A 2Y2JA 4KUDB 2DF4C 5B1MD 1W2EA 5B32G 2Y2NA 3B6FB 5FUGA 5E5AB 3MNNC 3AZMD 1Z2CB 5CP6B 2BYMA 4WJ3C 4YM6C 1T3UA 2FJ7A 4HGAB 4WV4B 3LZ1B 4WU9B 3AZGA 5B24C 3V9RA 3UTBB 4Z5TB 3WTPD 1ID3C 1JFIA 4WNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ C;  4G92 B;  2HIO A;  4LD9 A;  2BYK B;  3AZL A;  1P3K A;  5B2J B;  5B0Z C;  1P3F B;  1U35 A;  1M19 B;  3MNN D;  3AV2 A;  2NZD D;  3X1T B;  4G92 C;  3X1V A;  4YM6 D;  5AV8 B;  5B2J C;  5KDM A;  4Z66 D;  5B0Y B;  1P3I C;  4X23 D;  4WU8 D;  5DNM B;  1ID3 D;  1KX3 B;  3WKJ D;  4H9Q A;  4DRB A;  5GT3 A;  3WTP A;  5B0Z D;  3AV1 A;  3TU4 B;  4XZQ C;  5CPJ A;  4YS3 A;  3B0D B;  5G49 A;  3AZJ C;  3LEL B;  3AZN B;  3MGQ C;  1P3I D;  1P34 C;  4H9R A;  3MGS C;  1P3O C;  2F8N B;  5B40 C;  4YM6 A;  4KUD A;  5GXQ C;  5AV9 C;  4JJN C;  5B24 A;  2IO5 B;  4KHA B;  4M6B A;  5BO0 B;  3MGP D;  1S32 D;  5AVC C;  2YFW B;  4XZQ D;  5CP6 A;  5CPK D;  5AVB D;  3A6N B;  1ZLA B;  4WU9 A;  3W99 C;  3UTB A;  4Z5T A;  1KU5 A;  1BH8 A;  4H9N B;  5DNN C;  4J8X C;  3AZK B;  1P34 D;  1P3O D;  5B40 D;  2BYK A;  5GXQ D;  5B2J A;  4ZUX B;  5AV9 D;  1P3F A;  4KGC C;  5B1L B;  1P3I A;  5B31 C;  1R4V A;  5AVC D;  3C1B B;  3AZE D;  3X1S C;  4J8V B;  2CV5 B;  1M1A B;  3AZF B;  1AOI C;  3W99 D;  5GSU B;  4QLC C;  3WA9 B;  4XZQ A;  5DNM A;  4G91 C;  5DNN D;  3LZ0 B;  4J8X D;  1KX3 A;  3WAA B;  3VH6 W;  3KXB B;  3KWQ C;  1KX5 C;  3AZJ A;  4KGC D;  4J8W C;  3MGQ A;  3AFA B;  3MVD B;  3LZ0 C;  3MGS A;  3AZH C;  5B40 A;  3X1S D;  3KUY B;  4XUJ B;  1P3G B;  2FJ7 C;  4JJN A;  1AOI D;  3LEL A;  5B2I B;  5AV6 B;  4QLC D;  1TZY B;  3UTA B;  2F8N A;  5CPI B;  2HIO C;  1P3G C;  4LD9 C;  3AZL C;  4KHA A;  3KWQ D;  1P3K C;  5BO0 A;  3MGR B;  1U35 C;  2YFW A;  1HTA A;  3AZH D;  4H9S C;  3X1V C;  3UT9 B;  3W96 B;  3AN2 B;  5B32 B;  2FJ7 D;  3MGR C;  1P3P B;  3AZG D;  5B31 A;  4H9N A;  5BNX B;  3AZK A;  5B33 B;  2HIO D;  4ZUX A;  1AOI A;  3AZI B;  4LD9 D;  3AZL D;  5GT3 C;  5B1L A;  4QLC A;  1P3K D;  4NE5 A;  1U35 D;  3C1B A;  2HUE B;  5CPJ C;  4YS3 C;  3REI B;  3AV2 D;  3AZM B;  3WTP E;  3KWQ A;  1P3L B;  3X1V D;  1KX5 A;  5GSU A;  3REK C;  4J8W A;  3AZH A;  3LZ0 A;  3WAA A;  1KX4 C;  4NE3 A;  4KUD C;  5BNV B;  1TAF B;  4H9P A;  5AV5 B;  3B6F C;  5E5A C;  5GT3 D;  3AFA A;  3MVD A;  3AV1 D;  5CP6 C;  3KUY A;  5CPJ D;  4YS3 D;  4XUJ A;  1P3G A;  2CWE A;  5C3I B;  2NZD B;  4HGA C;  3LZ1 C;  4WU9 C;  3UTB C;  1EQZ B;  5AV6 A;  4Z5T C;  3REK D;  1TZY A;  4H9O B;  2F8N H;  3UTA A;  4Z66 B;  5CPI A;  4E45 A;  4H9S A;  4WU8 B;  4X23 B;  4KUD D;  3MGR A;  4EO5 B;  1P3F C;  1F66 B;  1M19 C;  5B24 D;  3NQU A;  3X1T C;  3O62 B;  5CP6 D;  3W96 A;  4WZS B;  3UT9 A;  1BFM A;  5AV8 C;  3REL B;  4R8P B;  4WU9 D;  5B0Y C;  5BNX A;  3UTB D;  1M18 B;  1H3O B;  4Z5T D;  3REJ B;  1ULY A;  5DNM C;  5B33 A;  5GT0 B;  1KX3 C;  3W97 B;  2ARO B;  3LJA B;  3AZI A;  3REK A;  3REH B;  5B2J D;  1P3F D;  3TU4 C;  1BH9 A;  3VH6 T;  3REI A;  1KX4 A;  3B0D C;  3R45 B;  3B6F A;  5AV8 D;  5E5A A;  5CPK B;  5AVB B;  3LEL C;  3AZN C;  3C1C B;  3VH5 A;  5DNM D;  4E44 A;  1KX3 D;  1TAF A;  3LZ1 A;  5AV5 A;  2IO5 C;  3AZJ D;  3AYW B;  3MGQ D;  1P3A B;  3MGS D;  1ZLA C;  5JRG B;  3A6N C;  4UUZ B;  5F99 B;  3AZE B;  3X1U B;  1EQZ A;  1M19 A;  4JJN D;  4H9O A;  2RVQ C;  3LEL D;  3X1T A;  2NQB B;  3AZK C;  2F8N D;  5JRG C;  1B6W A;  2F8N K;  5AV8 A;  4ZUX C;  1F66 A;  5B0Y A;  5B1L C;  2PYO B;  3C1B C;  4J8V C;  2CV5 C;  1M1A C;  1WWS A;  3REL A;  3AZF C;  2JSS A;  2LY8 A;  2F8N G;  5GSU C;  3TU4 A;  1H3O A;  3REJ A;  1P3B B;  2PYO C;  3WA9 C;  2RVQ D;  5B31 D;  1P3M B;  5GT0 A;  3WAA C;  3AZK D;  4AWL B;  3W97 A;  2ARO A;  5BS7 C;  3LJA A;  3KXB C;  4ZUX D;  3AZN A;  1F1E A;  5B1L D;  3AFA C;  3MVD C;  3R45 A;  3C1B D;  3KUY C;  4AWL C;  5FUG B;  1M1A D;  4XUJ C;  5B31 G;  1HQ3 B;  5AY8 B;  1KX5 D;  5B2I C;  3C1C A;  5AV6 C;  5GSU D;  1TZY C;  4J8W D;  3WA9 D;  3UTA C;  5CPI C;  3LZ0 D;  3AZG B;  3A6N A;  1ZLA A;  3WAA D;  1JFI B;  4CAY B;  3KSY A;  3W98 B;  3B6G B;  3AYW A;  4NE6 A;  1P3A A;  3AFA D;  3MVD D;  4J8U B;  5JRG A;  3KUY D;  5F99 A;  3W96 C;  4XUJ D;  3UT9 C;  3AN2 C;  1P3G D;  5B32 C;  3AV2 B;  1P3P C;  3B6G C;  4Z2M H;  5B1M B;  5B2I D;  2NQB A;  5AV6 D;  1TZY D;  4J8V A;  2CV5 A;  1M1A A;  3UTA D;  5B33 C;  5CPI D;  3B0C W;  3AZF A;  3AZI C;  4ZBJ B;  3MGR D;  2PYO A;  3WA9 A;  2HUE C;  3REI C;  5BS7 A;  3AZM C;  3WTP B;  3KXB A;  2YFV B;  1P3L C;  3W96 D;  3UT9 D;  1P3B A;  4ZBJ C;  3VH5 W;  5B33 D;  3MNN B;  5AV5 C;  3AZI D;  5B2I A;  4YM6 B;  5B24 B;  3REI D;  1KX4 D;  5C3I C;  2NZD C;  1HQ3 A;  1ID3 B;  5AY8 A;  1P3L D;  3WKJ B;  1EQZ C;  3B6F D;  5E5A D;  4Z66 C;  5B0Z B;  4X23 C;  4WU8 C;  3AN2 A;  1BH8 B;  5B32 A;  4CAY A;  3LZ1 D;  4EO5 C;  1P3P A;  1F66 C;  3B6G A;  5AV5 D;  3W98 A;  4J8U A;  3O62 C;  1P3I B;  3REL C;  1Q9C A;  4R8P C;  5B1M A;  1M18 C;  2L5A A;  1EQZ D;  3REJ C;  1M19 D;  4NFT A;  1WWI A;  5GT0 C;  3X1T D;  3MGP B;  3AZM A;  1S32 B;  3W97 C;  2ARO C;  3LJA C;  4XZQ B;  1P3L A;  3REH C;  3NQJ B;  1F66 D;  5B0Y D;  3MGP C;  1S32 C;  3AZJ B;  5BNV A;  2YFV A;  3O62 D;  3MGQ B;  4Z2M G;  1P34 B;  3MGS B;  1P3O B;  5BT1 C;  3REL D;  5AVB C;  5B40 B;  4R8P D;  5CPK C;  4CSR B;  3C1C C;  1M18 D;  5GXQ B;  5AV9 B;  3REJ D;  3TU4 D;  4DRA A;  4JJN B;  3MNN A;  5GT0 D;  2NZD A;  5AVC B;  3W97 D;  2ARO D;  3LJA D;  3REH D;  3AZN D;  3AYW C;  4Z66 A;  3W99 B;  1P3A C;  4WU8 A;  4X23 A;  1ID3 A;  5F99 C;  5DNN B;  3AZE C;  4J8X B;  3WKJ A;  3X1U C;  5BT1 D;  3C1C D;  2NQB C;  5B0Z A;  3O62 A;  4KGC B;  1ZLA D;  5JA4 B;  5B31 B;  3A6N D;  3X1S B;  4R8P A;  5CHL B;  1M18 A;  3B0C T;  1AOI B;  3AYW D;  1N1J B;  1P3A D;  4QLC B;  5JRG D;  4G91 B;  5F99 D;  3REH A;  3X1U D;  1P3B C;  3KWQ B;  1P3M C;  3MGP A;  2NQB D;  1KX5 B;  1S32 A;  4J8V D;  2CV5 D;  1B67 A;  4J8W B;  3AZH B;  3AZF D;  5CPK A;  3NQJ A;  5AVB A;  3B0B A;  3VH5 T;  2BYM B;  2PYO D;  2FJ7 B;  4H9P B;  3V9R B;  1P34 A;  1P3O A;  3KXB D;  1HQ3 C;  4WNN B;  5AY8 C;  4CSR A;  2HIO B;  5AV9 A;  5GXQ A;  1P3B D;  4LD9 B;  3AZL B;  1P3K B;  1P3M D;  3AZG C;  4UUZ A;  1U35 B;  5AVC A;  3AZE A;  3X1U A;  3W98 C;  3X1V B;  3W99 A;  4J8U C;  5KDM B;  5DNN A;  4J8X A;  3NQU B;  3AV2 C;  1HQ3 D;  5B1M C;  5AY8 D;  1A7W A;  4H9Q B;  4KGC A;  5GT3 B;  5JA4 A;  3AV1 B;  3X1S A;  5CPJ B;  3AN2 D;  4YS3 B;  5B32 D;  1P3P D;  3W98 D;  3B6G D;  1P3M A;  1N1J A;  3REK B;  4J8U D;  5G49 B;  3WTP C;  3AV1 C;  1BH9 B;  4H9R B;  1KX4 B;  3VH6 A;  4KUD B;  5B1M D;  5B32 G;  3B6F B;  5FUG A;  5E5A B;  3MNN C;  3AZM D;  5CP6 B;  2BYM A;  4YM6 C;  2FJ7 A;  4HGA B;  4WV4 B;  3LZ1 B;  4WU9 B;  3AZG A;  5B24 C;  3V9R A;  3UTB B;  4Z5T B;  3WTP D;  1ID3 C;  1JFI A;  4WNN A; 
#chains in the Genus database with same CATH topology
 3WKJ C;  4G92 B;  2HIO A;  4LD9 A;  2BYK B;  3AZL A;  1P3K A;  5B2J B;  5B0Z C;  1P3F B;  1U35 A;  1M19 B;  3MNN D;  3AV2 A;  2NZD D;  3X1T B;  4G92 C;  3X1V A;  4YM6 D;  5AV8 B;  5B2J C;  5KDM A;  4Z66 D;  5B0Y B;  1P3I C;  4X23 D;  4WU8 D;  5DNM B;  1ID3 D;  1KX3 B;  3WKJ D;  4H9Q A;  4DRB A;  5GT3 A;  3WTP A;  5B0Z D;  3AV1 A;  3TU4 B;  4XZQ C;  5CPJ A;  4YS3 A;  3B0D B;  5G49 A;  3AZJ C;  3LEL B;  3AZN B;  3MGQ C;  1P3I D;  1P34 C;  4H9R A;  3MGS C;  1P3O C;  2F8N B;  5B40 C;  3A1I A;  4YM6 A;  4KUD A;  5GXQ C;  5AV9 C;  4JJN C;  5B24 A;  2IO5 B;  4KHA B;  4M6B A;  5BO0 B;  3MGP D;  1S32 D;  5AVC C;  2YFW B;  4XZQ D;  5CP6 A;  5CPK D;  5AVB D;  3A6N B;  1ZLA B;  4WU9 A;  3W99 C;  3UTB A;  4Z5T A;  1KU5 A;  2UWX A;  1BH8 A;  4H9N B;  5DNN C;  4J8X C;  3AZK B;  1P34 D;  1P3O D;  5B40 D;  2BYK A;  5GXQ D;  5B2J A;  4ZUX B;  5AV9 D;  1P3F A;  4KGC C;  3FDD A;  5B1L B;  1P3I A;  5B31 C;  1R4V A;  5AVC D;  3C1B B;  3AZE D;  3X1S C;  4J8V B;  2CV5 B;  1M1A B;  3AZF B;  1AOI C;  3W99 D;  5GSU B;  4QLC C;  3WA9 B;  4XZQ A;  5DNM A;  4G91 C;  2J8P A;  5DNN D;  3LZ0 B;  4J8X D;  1KX3 A;  3WAA B;  3VH6 W;  3KXB B;  3KWQ C;  1KX5 C;  3AZJ A;  4KGC D;  4J8W C;  3MGQ A;  3AFA B;  3MVD B;  3LZ0 C;  3A1K A;  3MGS A;  5B40 A;  3X1S D;  3AZH C;  3KUY B;  4XUJ B;  1P3G B;  2FJ7 C;  4JJN A;  1AOI D;  3LEL A;  5B2I B;  5AV6 B;  4QLC D;  1TZY B;  3UTA B;  2F8N A;  5CPI B;  2HIO C;  1P3G C;  4LD9 C;  3AZL C;  4KHA A;  3KWQ D;  1P3K C;  5BO0 A;  3MGR B;  2BG1 A;  1U35 C;  2YFW A;  1HTA A;  3AZH D;  4H9S C;  3X1V C;  3UT9 B;  3W96 B;  3AN2 B;  5B32 B;  2FJ7 D;  3MGR C;  1P3P B;  3AZG D;  5B31 A;  4H9N A;  5BNX B;  3AZK A;  5B33 B;  2HIO D;  4ZUX A;  1AOI A;  3AZI B;  4LD9 D;  3AZL D;  5GT3 C;  5B1L A;  4QLC A;  1P3K D;  4NE5 A;  1U35 D;  3C1B A;  2HUE B;  5CPJ C;  3KFU G;  4YS3 C;  3REI B;  3AV2 D;  3AZM B;  3WTP E;  3KWQ A;  1P3L B;  3X1V D;  1KX5 A;  5GSU A;  3REK C;  4J8W A;  3AZH A;  3LZ0 A;  3WAA A;  1KX4 C;  4NE3 A;  4KUD C;  5BNV B;  1TAF B;  4H9P A;  3EPL A;  5AV5 B;  3B6F C;  5E5A C;  5GT3 D;  3AFA A;  3MVD A;  3AV1 D;  3H0M C;  5CP6 C;  3KUY A;  5CPJ D;  4YS3 D;  4XUJ A;  1P3G A;  2CWE A;  5C3I B;  2NZD B;  4HGA C;  3LZ1 C;  4WU9 C;  3UTB C;  1EQZ B;  5AV6 A;  4Z5T C;  3REK D;  1TZY A;  4H9O B;  2F8N H;  3UTA A;  4Z66 B;  5CPI A;  4E45 A;  4H9S A;  4WU8 B;  4X23 B;  4KUD D;  3MGR A;  4EO5 B;  1P3F C;  1F66 B;  1M19 C;  3IP4 C;  5B24 D;  3NQU A;  3X1T C;  2ZY2 A;  3EPH A;  3O62 B;  5CP6 D;  3W96 A;  4WZS B;  3UT9 A;  1BFM A;  5AV8 C;  3REL B;  2Y2Q A;  4R8P B;  4WU9 D;  5B0Y C;  5BNX A;  3UTB D;  1M18 B;  1H3O B;  4Z5T D;  3REJ B;  1ULY A;  5DNM C;  5B33 A;  4DQY B;  5GT0 B;  1KX3 C;  3W97 B;  2ARO B;  3LJA B;  3AZI A;  4UPK A;  3REK A;  3REH B;  5B2J D;  1P3F D;  3TU4 C;  1BH9 A;  3VH6 T;  3REI A;  1KX4 A;  3B0D C;  3R45 B;  3B6F A;  5AV8 D;  5E5A A;  5CPK B;  5AVB B;  3LEL C;  3AZN C;  3C1C B;  3VH5 A;  5DNM D;  4E44 A;  1KX3 D;  1TAF A;  3LZ1 A;  5AV5 A;  2IO5 C;  3AZJ D;  3AYW B;  3MGQ D;  1P3A B;  3MGS D;  1ZLA C;  5JRG B;  3A6N C;  3AL0 C;  4UUZ B;  3H0L C;  5F99 B;  3AZE B;  3X1U B;  1EQZ A;  1M19 A;  4JJN D;  4H9O A;  2RVQ C;  2VQR A;  3LEL D;  3X1T A;  2NQB B;  2DQN C;  3AZK C;  2F8N D;  5JRG C;  1B6W A;  2F8N K;  5AV8 A;  4ZUX C;  1F66 A;  5B0Y A;  5B1L C;  2PYO B;  3C1B C;  4J8V C;  2CV5 C;  1M1A C;  1WWS A;  3REL A;  3AZF C;  2JSS A;  2LY8 A;  2F8N G;  5GSU C;  3TU4 A;  1H3O A;  3REJ A;  1P3B B;  2PYO C;  3WA9 C;  2RVQ D;  2Y2L A;  5B31 D;  1P3M B;  5GT0 A;  2XD5 A;  3WAA C;  3AZK D;  4AWL B;  3W97 A;  2ARO A;  3P5J B;  5BS7 C;  3LJA A;  3KXB C;  2JE5 A;  2RIQ A;  4ZUX D;  3AZN A;  1F1E A;  5B1L D;  3AFA C;  3MVD C;  3R45 A;  3C1B D;  3EG5 B;  3KUY C;  4AWL C;  5FUG B;  1M1A D;  4XUJ C;  5B31 G;  1HQ3 B;  5AY8 B;  1KX5 D;  5B2I C;  3C1C A;  5AV6 C;  5GSU D;  1TZY C;  4J8W D;  3WA9 D;  3UTA C;  5CPI C;  3LZ0 D;  3AZG B;  3A6N A;  1ZLA A;  3WAA D;  1JFI B;  4CAY B;  3KSY A;  2G5I C;  3W98 B;  3B6G B;  3AYW A;  4NE6 A;  1P3A A;  3AFA D;  3MVD D;  4J8U B;  5JRG A;  1PZR A;  3KUY D;  5F99 A;  3W96 C;  4XUJ D;  3UT9 C;  3AN2 C;  1P3G D;  5B32 C;  3AV2 B;  1P3P C;  3B6G C;  4Z2M H;  5B1M B;  5B2I D;  2NQB A;  5AV6 D;  1TZY D;  4J8V A;  2CV5 A;  1M1A A;  3UTA D;  5B33 C;  5CPI D;  3B0C W;  3AZF A;  3AZI C;  4ZBJ B;  3MGR D;  2PYO A;  3WA9 A;  2HUE C;  3REI C;  5BS7 A;  3AZM C;  2ZY5 A;  3WTP B;  3KXB A;  2YFV B;  2ZM5 A;  1P3L C;  3W96 D;  3UT9 D;  1P3B A;  4ZBJ C;  3VH5 W;  5B33 D;  3MNN B;  2ZY4 A;  5AV5 C;  3AZI D;  5B2I A;  4YM6 B;  5B24 B;  3REI D;  1KX4 D;  5C3I C;  2NZD C;  1HQ3 A;  1ID3 B;  5AY8 A;  1P3L D;  3WKJ B;  1EQZ C;  3B6F D;  5E5A D;  4Z66 C;  5B0Z B;  4X23 C;  4WU8 C;  3AN2 A;  1BH8 B;  5B32 A;  4CAY A;  3LZ1 D;  4EO5 C;  1P3P A;  1F66 C;  3B6G A;  2Y2M A;  5AV5 D;  3W98 A;  2Y2I A;  4J8U A;  3O62 C;  1P3I B;  3REL C;  1Q9C A;  4R8P C;  5B1M A;  1M18 C;  2L5A A;  1EQZ D;  3REJ C;  1M19 D;  4NFT A;  1WWI A;  5GT0 C;  3X1T D;  3MGP B;  3AZM A;  1S32 B;  3W97 C;  2ARO C;  3LJA C;  4XZQ B;  1P3L A;  2Y2P A;  3REH C;  3NQJ B;  1F66 D;  5B0Y D;  2F2A C;  3MGP C;  1S32 C;  3AZJ B;  5BNV A;  2YFV A;  3O62 D;  3MGQ B;  4Z2M G;  1P34 B;  3MGS B;  1P3O B;  5BT1 C;  3REL D;  5AVB C;  5B40 B;  4R8P D;  5CPK C;  4CSR B;  3C1C C;  1M18 D;  5GXQ B;  2XD1 A;  5AV9 B;  3REJ D;  3TU4 D;  4DRA A;  4JJN B;  3MNN A;  5GT0 D;  2NZD A;  5AVC B;  3W97 D;  2ARO D;  3LJA D;  3REH D;  3AZN D;  3AYW C;  4Z66 A;  3W99 B;  1P3A C;  4WU8 A;  4X23 A;  1ID3 A;  5F99 C;  5DNN B;  3AZE C;  4J8X B;  3WKJ A;  3X1U C;  5BT1 D;  3C1C D;  2W8S A;  2NQB C;  5B0Z A;  3O62 A;  4KGC B;  1ZLA D;  5JA4 B;  5B31 B;  3A6N D;  3X1S B;  4R8P A;  5CHL B;  1M18 A;  3B0C T;  1AOI B;  3AYW D;  1N1J B;  1P3A D;  4QLC B;  3EPJ A;  2JCH A;  5JRG D;  4G91 B;  5F99 D;  3REH A;  3X1U D;  1P3B C;  3KWQ B;  1P3M C;  3MGP A;  2NQB D;  1KX5 B;  1S32 A;  2Y2K A;  2Y2O A;  4J8V D;  2CV5 D;  1B67 A;  4J8W B;  2Y2G A;  3AZH B;  3AZF D;  3EPK A;  3F6T A;  3NQJ A;  5AVB A;  5CPK A;  3B0B A;  3VH5 T;  2BYM B;  2PYO D;  2FJ7 B;  4H9P B;  2ZY3 A;  3V9R B;  1P34 A;  1P3O A;  3KXB D;  1HQ3 C;  4WNN B;  5AY8 C;  4CSR A;  2HIO B;  5AV9 A;  5GXQ A;  1P3B D;  4LD9 B;  3AZL B;  1P3K B;  1P3M D;  3AZG C;  4UUZ A;  1U35 B;  2G5H C;  5AVC A;  3AZE A;  3X1U A;  3W98 C;  3X1V B;  3W99 A;  4J8U C;  5KDM B;  5DNN A;  4J8X A;  3NQU B;  3AV2 C;  1HQ3 D;  5B1M C;  5AY8 D;  1A7W A;  4H9Q B;  4KGC A;  5GT3 B;  5JA4 A;  3AV1 B;  3X1S A;  2FFF B;  5CPJ B;  3AN2 D;  4YS3 B;  5B32 D;  2Y2H A;  1P3P D;  3W98 D;  3B6G D;  1P3M A;  1N1J A;  3REK B;  4J8U D;  5G49 B;  3WTP C;  3AV1 C;  1BH9 B;  4H9R B;  3H0R C;  1KX4 B;  3VH6 A;  2Y2J A;  4KUD B;  2DF4 C;  5B1M D;  1W2E A;  5B32 G;  2Y2N A;  3B6F B;  5FUG A;  5E5A B;  3MNN C;  3AZM D;  1Z2C B;  5CP6 B;  2BYM A;  4WJ3 C;  4YM6 C;  1T3U A;  2FJ7 A;  4HGA B;  4WV4 B;  3LZ1 B;  4WU9 B;  3AZG A;  5B24 C;  3V9R A;  3UTB B;  4Z5T B;  3WTP D;  1ID3 C;  1JFI A;  4WNN A; 
#chains in the Genus database with same CATH homology
 3WKJ C;  4G92 B;  2HIO A;  4LD9 A;  2BYK B;  3AZL A;  1P3K A;  5B2J B;  5B0Z C;  1P3F B;  1U35 A;  1M19 B;  3MNN D;  3AV2 A;  2NZD D;  3X1T B;  4G92 C;  3X1V A;  4YM6 D;  5AV8 B;  5B2J C;  5KDM A;  4Z66 D;  5B0Y B;  1P3I C;  4X23 D;  4WU8 D;  5DNM B;  1ID3 D;  1KX3 B;  3WKJ D;  4H9Q A;  4DRB A;  5GT3 A;  3WTP A;  5B0Z D;  3AV1 A;  3TU4 B;  4XZQ C;  5CPJ A;  4YS3 A;  3B0D B;  5G49 A;  3AZJ C;  3LEL B;  3AZN B;  3MGQ C;  1P3I D;  1P34 C;  4H9R A;  3MGS C;  1P3O C;  2F8N B;  5B40 C;  3A1I A;  4YM6 A;  4KUD A;  5GXQ C;  5AV9 C;  4JJN C;  5B24 A;  2IO5 B;  4KHA B;  4M6B A;  5BO0 B;  3MGP D;  1S32 D;  5AVC C;  2YFW B;  4XZQ D;  5CP6 A;  5CPK D;  5AVB D;  3A6N B;  1ZLA B;  4WU9 A;  3W99 C;  3UTB A;  4Z5T A;  1KU5 A;  2UWX A;  1BH8 A;  4H9N B;  5DNN C;  4J8X C;  3AZK B;  1P34 D;  1P3O D;  5B40 D;  2BYK A;  5GXQ D;  5B2J A;  4ZUX B;  5AV9 D;  1P3F A;  4KGC C;  3FDD A;  5B1L B;  1P3I A;  5B31 C;  1R4V A;  5AVC D;  3C1B B;  3AZE D;  3X1S C;  4J8V B;  2CV5 B;  1M1A B;  3AZF B;  1AOI C;  3W99 D;  5GSU B;  4QLC C;  3WA9 B;  4XZQ A;  5DNM A;  4G91 C;  2J8P A;  5DNN D;  3LZ0 B;  4J8X D;  1KX3 A;  3WAA B;  3VH6 W;  3KXB B;  3KWQ C;  1KX5 C;  3AZJ A;  4KGC D;  4J8W C;  3MGQ A;  3AFA B;  3MVD B;  3LZ0 C;  3A1K A;  3MGS A;  5B40 A;  3X1S D;  3AZH C;  3KUY B;  4XUJ B;  1P3G B;  2FJ7 C;  4JJN A;  1AOI D;  3LEL A;  5B2I B;  5AV6 B;  4QLC D;  1TZY B;  3UTA B;  2F8N A;  5CPI B;  2HIO C;  1P3G C;  4LD9 C;  3AZL C;  4KHA A;  3KWQ D;  1P3K C;  5BO0 A;  3MGR B;  2BG1 A;  1U35 C;  2YFW A;  1HTA A;  3AZH D;  4H9S C;  3X1V C;  3UT9 B;  3W96 B;  3AN2 B;  5B32 B;  2FJ7 D;  3MGR C;  1P3P B;  3AZG D;  5B31 A;  4H9N A;  5BNX B;  3AZK A;  5B33 B;  2HIO D;  4ZUX A;  1AOI A;  3AZI B;  4LD9 D;  3AZL D;  5GT3 C;  5B1L A;  4QLC A;  1P3K D;  4NE5 A;  1U35 D;  3C1B A;  2HUE B;  5CPJ C;  3KFU G;  4YS3 C;  3REI B;  3AV2 D;  3AZM B;  3WTP E;  3KWQ A;  1P3L B;  3X1V D;  1KX5 A;  5GSU A;  3REK C;  4J8W A;  3AZH A;  3LZ0 A;  3WAA A;  1KX4 C;  4NE3 A;  4KUD C;  5BNV B;  1TAF B;  4H9P A;  3EPL A;  5AV5 B;  3B6F C;  5E5A C;  5GT3 D;  3AFA A;  3MVD A;  3AV1 D;  3H0M C;  5CP6 C;  3KUY A;  5CPJ D;  4YS3 D;  4XUJ A;  1P3G A;  2CWE A;  5C3I B;  2NZD B;  4HGA C;  3LZ1 C;  4WU9 C;  3UTB C;  1EQZ B;  5AV6 A;  4Z5T C;  3REK D;  1TZY A;  4H9O B;  2F8N H;  3UTA A;  4Z66 B;  5CPI A;  4E45 A;  4H9S A;  4WU8 B;  4X23 B;  4KUD D;  3MGR A;  4EO5 B;  1P3F C;  1F66 B;  1M19 C;  3IP4 C;  5B24 D;  3NQU A;  3X1T C;  2ZY2 A;  3EPH A;  3O62 B;  5CP6 D;  3W96 A;  4WZS B;  3UT9 A;  1BFM A;  5AV8 C;  3REL B;  2Y2Q A;  4R8P B;  4WU9 D;  5B0Y C;  5BNX A;  3UTB D;  1M18 B;  1H3O B;  4Z5T D;  3REJ B;  1ULY A;  5DNM C;  5B33 A;  4DQY B;  5GT0 B;  1KX3 C;  3W97 B;  2ARO B;  3LJA B;  3AZI A;  4UPK A;  3REK A;  3REH B;  5B2J D;  1P3F D;  3TU4 C;  1BH9 A;  3VH6 T;  3REI A;  1KX4 A;  3B0D C;  3R45 B;  3B6F A;  5AV8 D;  5E5A A;  5CPK B;  5AVB B;  3LEL C;  3AZN C;  3C1C B;  3VH5 A;  5DNM D;  4E44 A;  1KX3 D;  1TAF A;  3LZ1 A;  5AV5 A;  2IO5 C;  3AZJ D;  3AYW B;  3MGQ D;  1P3A B;  3MGS D;  1ZLA C;  5JRG B;  3A6N C;  3AL0 C;  4UUZ B;  3H0L C;  5F99 B;  3AZE B;  3X1U B;  1EQZ A;  1M19 A;  4JJN D;  4H9O A;  2RVQ C;  2VQR A;  3LEL D;  3X1T A;  2NQB B;  2DQN C;  3AZK C;  2F8N D;  5JRG C;  1B6W A;  2F8N K;  5AV8 A;  4ZUX C;  1F66 A;  5B0Y A;  5B1L C;  2PYO B;  3C1B C;  4J8V C;  2CV5 C;  1M1A C;  1WWS A;  3REL A;  3AZF C;  2JSS A;  2LY8 A;  2F8N G;  5GSU C;  3TU4 A;  1H3O A;  3REJ A;  1P3B B;  2PYO C;  3WA9 C;  2RVQ D;  2Y2L A;  5B31 D;  1P3M B;  5GT0 A;  2XD5 A;  3WAA C;  3AZK D;  4AWL B;  3W97 A;  2ARO A;  3P5J B;  5BS7 C;  3LJA A;  3KXB C;  2JE5 A;  2RIQ A;  4ZUX D;  3AZN A;  1F1E A;  5B1L D;  3AFA C;  3MVD C;  3R45 A;  3C1B D;  3EG5 B;  3KUY C;  4AWL C;  5FUG B;  1M1A D;  4XUJ C;  5B31 G;  1HQ3 B;  5AY8 B;  1KX5 D;  5B2I C;  3C1C A;  5AV6 C;  5GSU D;  1TZY C;  4J8W D;  3WA9 D;  3UTA C;  5CPI C;  3LZ0 D;  3AZG B;  3A6N A;  1ZLA A;  3WAA D;  1JFI B;  4CAY B;  3KSY A;  2G5I C;  3W98 B;  3B6G B;  3AYW A;  4NE6 A;  1P3A A;  3AFA D;  3MVD D;  4J8U B;  5JRG A;  1PZR A;  3KUY D;  5F99 A;  3W96 C;  4XUJ D;  3UT9 C;  3AN2 C;  1P3G D;  5B32 C;  3AV2 B;  1P3P C;  3B6G C;  4Z2M H;  5B1M B;  5B2I D;  2NQB A;  5AV6 D;  1TZY D;  4J8V A;  2CV5 A;  1M1A A;  3UTA D;  5B33 C;  5CPI D;  3B0C W;  3AZF A;  3AZI C;  4ZBJ B;  3MGR D;  2PYO A;  3WA9 A;  2HUE C;  3REI C;  5BS7 A;  3AZM C;  2ZY5 A;  3WTP B;  3KXB A;  2YFV B;  2ZM5 A;  1P3L C;  3W96 D;  3UT9 D;  1P3B A;  4ZBJ C;  3VH5 W;  5B33 D;  3MNN B;  2ZY4 A;  5AV5 C;  3AZI D;  5B2I A;  4YM6 B;  5B24 B;  3REI D;  1KX4 D;  5C3I C;  2NZD C;  1HQ3 A;  1ID3 B;  5AY8 A;  1P3L D;  3WKJ B;  1EQZ C;  3B6F D;  5E5A D;  4Z66 C;  5B0Z B;  4X23 C;  4WU8 C;  3AN2 A;  1BH8 B;  5B32 A;  4CAY A;  3LZ1 D;  4EO5 C;  1P3P A;  1F66 C;  3B6G A;  2Y2M A;  5AV5 D;  3W98 A;  2Y2I A;  4J8U A;  3O62 C;  1P3I B;  3REL C;  1Q9C A;  4R8P C;  5B1M A;  1M18 C;  2L5A A;  1EQZ D;  3REJ C;  1M19 D;  4NFT A;  1WWI A;  5GT0 C;  3X1T D;  3MGP B;  3AZM A;  1S32 B;  3W97 C;  2ARO C;  3LJA C;  4XZQ B;  1P3L A;  2Y2P A;  3REH C;  3NQJ B;  1F66 D;  5B0Y D;  2F2A C;  3MGP C;  1S32 C;  3AZJ B;  5BNV A;  2YFV A;  3O62 D;  3MGQ B;  4Z2M G;  1P34 B;  3MGS B;  1P3O B;  5BT1 C;  3REL D;  5AVB C;  5B40 B;  4R8P D;  5CPK C;  4CSR B;  3C1C C;  1M18 D;  5GXQ B;  2XD1 A;  5AV9 B;  3REJ D;  3TU4 D;  4DRA A;  4JJN B;  3MNN A;  5GT0 D;  2NZD A;  5AVC B;  3W97 D;  2ARO D;  3LJA D;  3REH D;  3AZN D;  3AYW C;  4Z66 A;  3W99 B;  1P3A C;  4WU8 A;  4X23 A;  1ID3 A;  5F99 C;  5DNN B;  3AZE C;  4J8X B;  3WKJ A;  3X1U C;  5BT1 D;  3C1C D;  2W8S A;  2NQB C;  5B0Z A;  3O62 A;  4KGC B;  1ZLA D;  5JA4 B;  5B31 B;  3A6N D;  3X1S B;  4R8P A;  5CHL B;  1M18 A;  3B0C T;  1AOI B;  3AYW D;  1N1J B;  1P3A D;  4QLC B;  3EPJ A;  2JCH A;  5JRG D;  4G91 B;  5F99 D;  3REH A;  3X1U D;  1P3B C;  3KWQ B;  1P3M C;  3MGP A;  2NQB D;  1KX5 B;  1S32 A;  2Y2K A;  2Y2O A;  4J8V D;  2CV5 D;  1B67 A;  4J8W B;  2Y2G A;  3AZH B;  3AZF D;  3EPK A;  3F6T A;  3NQJ A;  5AVB A;  5CPK A;  3B0B A;  3VH5 T;  2BYM B;  2PYO D;  2FJ7 B;  4H9P B;  2ZY3 A;  3V9R B;  1P34 A;  1P3O A;  3KXB D;  1HQ3 C;  4WNN B;  5AY8 C;  4CSR A;  2HIO B;  5AV9 A;  5GXQ A;  1P3B D;  4LD9 B;  3AZL B;  1P3K B;  1P3M D;  3AZG C;  4UUZ A;  1U35 B;  2G5H C;  5AVC A;  3AZE A;  3X1U A;  3W98 C;  3X1V B;  3W99 A;  4J8U C;  5KDM B;  5DNN A;  4J8X A;  3NQU B;  3AV2 C;  1HQ3 D;  5B1M C;  5AY8 D;  1A7W A;  4H9Q B;  4KGC A;  5GT3 B;  5JA4 A;  3AV1 B;  3X1S A;  2FFF B;  5CPJ B;  3AN2 D;  4YS3 B;  5B32 D;  2Y2H A;  1P3P D;  3W98 D;  3B6G D;  1P3M A;  1N1J A;  3REK B;  4J8U D;  5G49 B;  3WTP C;  3AV1 C;  1BH9 B;  4H9R B;  3H0R C;  1KX4 B;  3VH6 A;  2Y2J A;  4KUD B;  2DF4 C;  5B1M D;  1W2E A;  5B32 G;  2Y2N A;  3B6F B;  5FUG A;  5E5A B;  3MNN C;  3AZM D;  1Z2C B;  5CP6 B;  2BYM A;  4WJ3 C;  4YM6 C;  1T3U A;  2FJ7 A;  4HGA B;  4WV4 B;  3LZ1 B;  4WU9 B;  3AZG A;  5B24 C;  3V9R A;  3UTB B;  4Z5T B;  3WTP D;  1ID3 C;  1JFI A;  4WNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...