5FUGB

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 90
sequence length 90
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2016-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugB00
3AZNB 4J8VA 3AYWC 4LD9D 3UTBC 4WV4B 1U35D 2YFVB 5GT0A 5DNND 4J8VB 3MGPA 3MGRA 5GXQD 5B0YD 5GT0B 3WTPD 1KX3A 4H9NA 5CP6D 4Z2MH 3MGPB 3MGRB 1P3MA 3KXBA 5B2JC 2JSSA 3UT9C 1KX3B 3MGQC 4H9NB 5AVCA 3AZGD 4NE5A 3AV2C 4H9SA 1P3AA 1P3MB 4J8UD 1AOID 3KXBB 2CV5C 3VH6A 3UTBA 5B32D 3REJD 4NE6A 5AVCB 5AVBC 3LZ0C 4HGAB 4ZUXA 4AWLC 1P3AB 4XZQD 3W99B 4YM6D 4UUZA 3VH5T 3UTBB 5B40D 1P3OD 4JJNC 4ZUXB 1P34C 1BH8A 1KX5C 5AV5D 1TZYC 5AV6B 5B2JA 3AZKC 4NFTA 3UT9A 1BH8B 3MGQA 3RELD 3AV2A 1P3BC 5B31D 3B6FD 5JRGC 5B2JB 2CV5A 4EO5C 1WWSA 4H9QB 3UT9B 3MGQB 5AVBA 3LZ0A 3AV2B 1M18D 2NQBD 3REIB 2CV5B 3REJC 3MGSD 2BYMB 5AVBB 3LZ0B 5GT3A 4JJNA 4AWLB 4ZBJB 1P34A 1KX5A 1HQ3C 4QLCC 1TZYA 5GT3B 4JJNB 3AZKA 4R8PC 3AZFC 3REKD 3LJAC 1P34B 3WAAC 5AV8D 3LELC 1KX5B 3X1UC 1P3BA 1TZYB 1H3OA 2NZDD 5JRGA 3AZKB 3MNNC 3B0CW 4KGCC 3O62C 4J8XD 1JFIA 1P3BB 1B6WA 5KDMA 1H3OB 5JRGB 4EO5B 3AFAA 5CPID 4WU8C 1JFIB 1F66D 3TU4D 3AZHD 3REHC 5CPJC 3MGSC 1HQ3A 4QLCA 4Z66C 3AZJD 3AFAB 1B67A 3B0CT 3C1BD 3AZFA 3LJAA 3WAAA 3LELA 1HQ3B 3X1UA 4QLCB 1P3PC 3MNNA 3AZFB 3A6NC 5GSUD 1EQZC 2HUEC 3LJAB 4KGCA 3O62A 3UTAC 3WAAB 3LELB 3X1UB 4H9PA 2F8NA 3W96D 1P3IC 3B6GC 3MNNB 1P3FD 5AVCD 4KGCB 3O62B 2HIOD 4WU8A 4H9PB 3W99D 3X1SC 5CPKD 2F8NB 3REHA 5CPJA 4X23C 1P3LD 4Z66A 4ZUXD 1F66C 4WU8B 1ZLAC 1M1AC 3REHB 5CPJB 1ID3D 4Z66B 5AV6D 1M19C 3C1CC 3AZID 1P3PA 3WA9C 1P3KC 5B24D 5JA4A 1S32D 3A6NA 5B1MD 1EQZA 3UTAA 3AV1C 4Z5TD 4WNNA 5AY8C 1P3IA 2FJ7D 5JA4B 3B6GA 3A6NB 5B1LC 1EQZB 5B33C 3REID 1KX4D 2AROD 3X1SA 4WNNB 1P3IB 3B6GB 3X1TC 3VH5W 3WKJC 3LZ1C 4WU9D 3MVDD 5DNMD 3W98D 3X1SB 1ZLAA 1M1AA 1P3GC 3KSYA 1M19A 3C1CA 4J8WC 3AYWA 3WA9A 5BNVA 1P3KA 4DRAA 2RVQD 1ZLAB 1M1AB 4YS3D 3AZED 5B32G 3AV1A 4LD9C 3C1CB 3AYWB 3WA9B 5AY8A 5BNVB 1P3KB 5B0ZD 5B1LA 1U35C 5B33A 2LY8A 3AV1B 5DNNC 4UUZB 5AY8B 5F99D 3AZMD 3AN2D 5GXQC 3X1TA 5B1LB 5B0YC 3W97D 3LZ1A 5B33B 3WKJA 3WTPC 3X1VD 3B0DC 5CP6C 3KUYD 5B2ID 1P3GA 3X1TB 3WKJB 3LZ1B 4J8WA 4XUJD 5B31G 3AZGC 2YFWA 5BO0A 2F8NG 4J8UC 1P3GB 1AOIC 1N1JA 4KUDD 3KWQD 4LD9A 4J8WB 5B32C 5AV9D 2YFWB 5BO0B 1U35A 1N1JB 4XZQC 5DNNA 4YM6C 2PYOD 4LD9B 5B40C 1P3OC 5GXQA 2IO5C 5B0YA 3WTPA 5C3IC 3AZLD 5DNNB 5CP6A 4H9OA 5AV5C 4NE3A 5GXQB 4E44A 5BNXA 5B0YB 3WTPB 3B0DB 4H9OB 5CP6B 3RELC 3AZGA 5E5AD 5B31C 4J8UA 1AOIA 1BH9A 3B6FC 3AZND 4G92C 5BNXB 5B32A 3REJA 3AZGB 1M18C 2NQBC 4J8UB 1AOIB 5KDMB 1BH9B 3VH6W 4XZQA 5BT1D 4J8VD 4YM6A 5CHLB 5B40A 5B32B 3REJB 1P3OA 4R8PA 5GT0D 4XZQB 4YM6B 3MGPD 5AV5A 5B40B 3MGRD 1P3OB 3VH5A 2IO5B 3REKC 4R8PB 1KX3D 4WZSB 5C3IB 5AV8C 3VH6T 3RELA 5AV5B 1P3MD 5B31A 3B6FA 3KXBD 2NZDC 4J8XC 3RELB 1M18A 1P3AD 2NQBA 5B31B 3B6FB 3UTBD 3MGSA 5CPIC 1M18B 2NQBB 3TU4C 3AZHC 3AZJC 3MGSB 1A7WA 3C1BC 3REKA 4Z2MG 1WWIA 5BS7C 5AV8A 1HTAA 2NZDA 5B2JD 1P3PB 4CSRA 3REKB 5GSUC 3UT9D 3MGQD 4M6BA 2HUEB 4J8XA 5AV8B 3AV2D 1P3MC 3UTAB 3W96C 2NZDB 3NQUA 2CV5D 4CSRB 1P3FC 4X23A 5AVCC 4J8XB 5AVBD 3LZ0D 2HIOC 5CPIA 1F66A 3TU4A 3W99C 3AZHA 5CPKC 3NQUB 1P3LC 4X23B 3AZJA 4ZUXC 1TAFA 2CWEA 5GT3D 4JJND 5CPIB 1F66B 3C1BA 3TU4B 3AZHB 5BS7A 1P34D 3V9RA 1ID3C 1KX5D 1TZYD 5AV6C 3AZJB 1TAFB 1M19B 3AZIC 4G91C 3AZKD 5B24C 3C1BB 1S32C 5B1MC 5GSUA 3V9RB 4Z5TC 1P3BD 3W96A 5JRGD 2FJ7C 1P3FA 5GSUB 3REIC 2HIOA 4E45A 4DRBA 1KX4C 2AROC 3W99A 5CPKA 3W96B 2F8NK 1P3FB 1P3LA 3AFAD 2HIOB 4ZBJC 4WU9C 3MVDC 4KHAA 3R45A 5DNMC 3W98C 5CPKB 4H9RA 1ID3A 1P3LB 1ULYA 1HQ3D 4QLCD 1R4VA 5AV6A 5GT3C 3AZIA 5B24A 4R8PD 3AZFD 4KHAB 3R45B 1S32A 2RVQC 5B1MA 3LJAD 4YS3C 4H9RB 3AZEC 1ID3B 3WAAD 3LELD 3X1UD 4Z5TA 3AZIB 4G91B 5B24B 4H9QA 3MNND 5B0ZC 1S32B 2FJ7A 5B1MB 4KGCD 3O62D 3REIA 1U35B 4Z5TB 1KX4A 2AROA 2F8ND 5F99C 3AZMC 2FJ7B 3AN2C 2BYMA 3W97C 3X1VC 4WU8D 4WU9A 3MVDA 1KX4B 5DNMA 3KUYC 2AROB 5B2IC 3W98A 3REHD 5FUGA 5CPJD 4Z66D 3AFAC 4XUJC 4WU9B 3MVDB 5DNMB 3W98B 4CAYA 5FUGB 4YS3A 4KUDC 3AZEA 3WTPE 2F8NH 3KWQC 1P3PD 5AV9C 2BYKA 5B0ZA 3A6ND 4CAYB 1EQZD 4YS3B 3UTAD 3AZEB 2PYOC 1P3ID 3B6GD 5F99A 3AZMA 2BYKB 5B0ZB 3AN2A 3W97A 3X1VA 3AZLC 3KUYA 3X1SD 5B2IA 5F99B 3AZMB 4X23D 3AN2B 3W97B 1KU5A 3X1VB 4XUJA 3KUYB 5E5AC 1ZLAD 5B2IB 1M1AD 4KUDA 1BFMA 3AZNC 1M19D 3KWQA 4G92B 2L5AA 3C1CD 3AYWD 1F1EA 4XUJB 1P3KD 5AV9A 3WA9D 4KUDB 5BT1C 3AV1D 4J8VC 3KWQB 2PYOA 5AY8D 5AV9B 5B1LD 5B33D 5GT0C 3AZLA 3NQJA 2PYOB 3MGPC 3MGRC 5G49A 3X1TD 3WKJD 3LZ1D 1KX3C 3AZLB 3B0BA 3NQJB 5E5AA 5G49B 1P3GD 3KXBC 3AZNA 4J8WD 4HGAC 4H9SC 5E5AB 1P3AC 2YFVA 1Q9CA
chains in the Genus database with same CATH superfamily
3AZNB 4J8VA 3AYWC 4LD9D 3UTBC 4WV4B 1U35D 2YFVB 5GT0A 5DNND 4J8VB 3MGPA 2DF4C 3MGRA 3EPJA 5GXQD 5B0YD 5GT0B 3WTPD 1KX3A 4H9NA 5CP6D 4Z2MH 3MGPB 3MGRB 1P3MA 3KXBA 2Y2JA 5B2JC 2JSSA 3UT9C 1KX3B 2DQNC 4H9NB 3MGQC 5AVCA 3AZGD 4NE5A 3AV2C 4H9SA 1P3AA 1P3MB 4J8UD 1AOID 3KXBB 2CV5C 3VH6A 3UTBA 5B32D 3REJD 4NE6A 5AVCB 5AVBC 3LZ0C 4HGAB 4ZUXA 4AWLC 1P3AB 4XZQD 3W99B 4YM6D 4UUZA 3VH5T 3UTBB 5B40D 2Y2LA 1P3OD 4JJNC 4ZUXB 3KFUG 1P34C 1BH8A 2Y2PA 1KX5C 5AV5D 1TZYC 5AV6B 5B2JA 3AZKC 4NFTA 3UT9A 1BH8B 3MGQA 3RELD 3AV2A 1P3BC 5B31D 3B6FD 5JRGC 5B2JB 2CV5A 4EO5C 1WWSA 4H9QB 3UT9B 3MGQB 5AVBA 3LZ0A 3AV2B 1M18D 2NQBD 3REIB 2CV5B 3REJC 3MGSD 2BYMB 5AVBB 3LZ0B 5GT3A 4JJNA 4AWLB 2J8PA 4ZBJB 1P34A 1KX5A 1HQ3C 4QLCC 1TZYA 5GT3B 3H0MC 4JJNB 3AZKA 4R8PC 3AZFC 3REKD 3A1IA 3LJAC 1P34B 3WAAC 5AV8D 3LELC 1KX5B 3X1UC 1P3BA 1TZYB 1H3OA 2NZDD 5JRGA 3AZKB 3MNNC 3B0CW 4KGCC 3O62C 4J8XD 2Y2HA 1JFIA 1P3BB 1B6WA 5KDMA 1H3OB 5JRGB 4EO5B 2ZM5A 3AFAA 5CPID 4WU8C 1JFIB 1F66D 3TU4D 3AZHD 3REHC 5CPJC 3AL0C 3MGSC 1HQ3A 4QLCA 4Z66C 3AZJD 3AFAB 1B67A 3B0CT 3C1BD 3AZFA 3LJAA 1T3UA 3WAAA 3LELA 1HQ3B 3X1UA 4QLCB 1P3PC 3MNNA 3AZFB 3A6NC 5GSUD 1EQZC 2HUEC 3LJAB 4KGCA 3O62A 3UTAC 3WAAB 3LELB 3X1UB 4H9PA 2F8NA 3W96D 1P3IC 3B6GC 3MNNB 1P3FD 1W2EA 5AVCD 4KGCB 3O62B 2HIOD 4WU8A 4H9PB 3W99D 3X1SC 5CPKD 2F8NB 3REHA 1Z2CB 5CPJA 2BG1A 4X23C 1P3LD 4Z66A 4ZUXD 1F66C 4WU8B 1ZLAC 1M1AC 3REHB 5CPJB 1ID3D 4Z66B 5AV6D 1M19C 3C1CC 3AZID 1P3PA 3WA9C 1P3KC 3H0RC 5B24D 5JA4A 1S32D 3A6NA 5B1MD 1EQZA 3UTAA 3AV1C 4Z5TD 4WNNA 5AY8C 1P3IA 2FJ7D 5JA4B 3B6GA 2XD1A 3A6NB 5B1LC 1EQZB 5B33C 3EPKA 3REID 1KX4D 2AROD 3X1SA 4WNNB 1P3IB 3B6GB 3X1TC 3VH5W 3WKJC 3LZ1C 4WU9D 3MVDD 5DNMD 4DQYB 3W98D 3X1SB 1ZLAA 1M1AA 1P3GC 3KSYA 1M19A 3C1CA 4J8WC 3AYWA 3WA9A 5BNVA 1P3KA 4DRAA 2RVQD 1ZLAB 1M1AB 4YS3D 3AZED 5B32G 3AV1A 4LD9C 2Y2QA 3C1CB 3AYWB 3WA9B 5AY8A 5BNVB 1P3KB 5B0ZD 5B1LA 1U35C 5B33A 2LY8A 3AV1B 5DNNC 4UUZB 5AY8B 5F99D 3AZMD 3AN2D 5GXQC 2F2AC 3X1TA 5B1LB 5B0YC 3W97D 3LZ1A 5B33B 3WKJA 3WTPC 3X1VD 3B0DC 5CP6C 3KUYD 5B2ID 1P3GA 3X1TB 3WKJB 3LZ1B 2G5HC 4J8WA 4XUJD 5B31G 3AZGC 2YFWA 5BO0A 2F8NG 3EPLA 4J8UC 1P3GB 1AOIC 1N1JA 4KUDD 3KWQD 4LD9A 4J8WB 5B32C 5AV9D 2YFWB 5BO0B 1U35A 1N1JB 4XZQC 5DNNA 4YM6C 2PYOD 3FDDA 4LD9B 5B40C 1P3OC 5GXQA 2IO5C 5B0YA 3WTPA 5C3IC 3AZLD 5DNNB 5CP6A 4H9OA 2ZY3A 5AV5C 4NE3A 5GXQB 4E44A 5BNXA 5B0YB 3WTPB 3B0DB 4H9OB 5CP6B 3RELC 3IP4C 3AZGA 5E5AD 2ZY4A 5B31C 4J8UA 1AOIA 1BH9A 3B6FC 3AZND 4G92C 5BNXB 5B32A 3REJA 3H0LC 3AZGB 1M18C 2NQBC 4J8UB 1AOIB 5KDMB 1BH9B 3VH6W 4XZQA 5BT1D 2UWXA 4J8VD 4YM6A 5CHLB 5B40A 3EG5B 5B32B 3REJB 1P3OA 2G5IC 4R8PA 5GT0D 4XZQB 4YM6B 3MGPD 5AV5A 5B40B 3MGRD 1P3OB 3VH5A 2IO5B 3REKC 4R8PB 2FFFB 1KX3D 4WZSB 5C3IB 5AV8C 3VH6T 3RELA 5AV5B 1P3MD 5B31A 3B6FA 3KXBD 2NZDC 2Y2MA 4J8XC 2VQRA 3RELB 1M18A 1P3AD 2NQBA 5B31B 3B6FB 3UTBD 3MGSA 5CPIC 1M18B 2NQBB 4WJ3C 3TU4C 3AZHC 2ZY5A 4UPKA 3AZJC 3MGSB 1A7WA 3C1BC 3REKA 4Z2MG 1WWIA 5BS7C 5AV8A 1HTAA 2NZDA 5B2JD 1P3PB 4CSRA 2Y2NA 3REKB 5GSUC 3UT9D 3MGQD 4M6BA 2HUEB 4J8XA 5AV8B 3AV2D 1P3MC 2Y2KA 3UTAB 3W96C 2NZDB 3NQUA 2CV5D 4CSRB 1P3FC 3P5JB 4X23A 5AVCC 4J8XB 5AVBD 3LZ0D 2HIOC 5CPIA 1F66A 3TU4A 3W99C 3AZHA 5CPKC 3NQUB 1P3LC 2Y2GA 4X23B 3AZJA 4ZUXC 1TAFA 2CWEA 5GT3D 4JJND 5CPIB 1F66B 3C1BA 2Y2IA 3TU4B 3AZHB 5BS7A 1P34D 3V9RA 1ID3C 1KX5D 1TZYD 5AV6C 3AZJB 1TAFB 1M19B 3AZIC 4G91C 2JCHA 2ZY2A 3F6TA 5B24C 3AZKD 3C1BB 1S32C 5B1MC 5GSUA 3V9RB 4Z5TC 1P3BD 3W96A 5JRGD 2FJ7C 1P3FA 5GSUB 3REIC 2HIOA 4E45A 4DRBA 1KX4C 2AROC 3W99A 5CPKA 3W96B 2F8NK 1P3FB 1P3LA 3AFAD 2HIOB 4ZBJC 4WU9C 3MVDC 4KHAA 3R45A 5DNMC 3W98C 5CPKB 4H9RA 1ID3A 1P3LB 1ULYA 1HQ3D 4QLCD 1R4VA 5AV6A 5GT3C 2XD5A 3AZIA 5B24A 4R8PD 3AZFD 4KHAB 3R45B 1S32A 2RVQC 5B1MA 3LJAD 4YS3C 4H9RB 3AZEC 1ID3B 3WAAD 3LELD 3X1UD 4Z5TA 3AZIB 4G91B 5B24B 4H9QA 3MNND 5B0ZC 1S32B 2FJ7A 5B1MB 4KGCD 2JE5A 3A1KA 3O62D 3REIA 1U35B 4Z5TB 1KX4A 3EPHA 2AROA 2F8ND 5F99C 3AZMC 2FJ7B 3AN2C 2BYMA 3W97C 3X1VC 4WU8D 4WU9A 3MVDA 1KX4B 5DNMA 3KUYC 2AROB 5B2IC 3W98A 3REHD 5FUGA 5CPJD 4Z66D 3AFAC 4XUJC 4WU9B 3MVDB 5DNMB 3W98B 4CAYA 5FUGB 4YS3A 4KUDC 3AZEA 3WTPE 2F8NH 3KWQC 1P3PD 5AV9C 2BYKA 5B0ZA 3A6ND 4CAYB 1EQZD 4YS3B 3UTAD 3AZEB 2PYOC 1P3ID 3B6GD 5F99A 3AZMA 2BYKB 5B0ZB 3AN2A 3W97A 3X1VA 3AZLC 3KUYA 3X1SD 5B2IA 5F99B 3AZMB 4X23D 3AN2B 3W97B 1KU5A 3X1VB 4XUJA 2RIQA 3KUYB 5E5AC 1ZLAD 5B2IB 1M1AD 4KUDA 1BFMA 3AZNC 1M19D 3KWQA 4G92B 2L5AA 3C1CD 3AYWD 1F1EA 4XUJB 1P3KD 5AV9A 3WA9D 4KUDB 5BT1C 3AV1D 4J8VC 3KWQB 2PYOA 5AY8D 5AV9B 5B1LD 5B33D 5GT0C 3AZLA 3NQJA 2PYOB 3MGPC 3MGRC 5G49A 2Y2OA 3X1TD 3WKJD 3LZ1D 1KX3C 2W8SA 3AZLB 3B0BA 3NQJB 5E5AA 5G49B 1P3GD 1PZRA 3KXBC 3AZNA 4J8WD 4HGAC 4H9SC 5E5AB 1P3AC 2YFVA 1Q9CA
chains in the Genus database with same CATH topology
3AZNB 4J8VA 3AYWC 4LD9D 3UTBC 4WV4B 1U35D 2YFVB 5GT0A 5DNND 4J8VB 3MGPA 2DF4C 3MGRA 3EPJA 5GXQD 5B0YD 5GT0B 3WTPD 1KX3A 4H9NA 5CP6D 4Z2MH 3MGPB 3MGRB 1P3MA 3KXBA 2Y2JA 5B2JC 2JSSA 3UT9C 1KX3B 2DQNC 4H9NB 3MGQC 5AVCA 3AZGD 4NE5A 3AV2C 4H9SA 1P3AA 1P3MB 4J8UD 1AOID 3KXBB 2CV5C 3VH6A 3UTBA 5B32D 3REJD 4NE6A 5AVCB 5AVBC 3LZ0C 4HGAB 4ZUXA 4AWLC 1P3AB 4XZQD 3W99B 4YM6D 4UUZA 3VH5T 3UTBB 5B40D 2Y2LA 1P3OD 4JJNC 4ZUXB 3KFUG 1P34C 1BH8A 2Y2PA 1KX5C 5AV5D 1TZYC 5AV6B 5B2JA 3AZKC 4NFTA 3UT9A 1BH8B 3MGQA 3RELD 3AV2A 1P3BC 5B31D 3B6FD 5JRGC 5B2JB 2CV5A 4EO5C 1WWSA 4H9QB 3UT9B 3MGQB 5AVBA 3LZ0A 3AV2B 1M18D 2NQBD 3REIB 2CV5B 3REJC 3MGSD 2BYMB 5AVBB 3LZ0B 5GT3A 4JJNA 4AWLB 2J8PA 4ZBJB 1P34A 1KX5A 1HQ3C 4QLCC 1TZYA 5GT3B 3H0MC 4JJNB 3AZKA 4R8PC 3AZFC 3REKD 3A1IA 3LJAC 1P34B 3WAAC 5AV8D 3LELC 1KX5B 3X1UC 1P3BA 1TZYB 1H3OA 2NZDD 5JRGA 3AZKB 3MNNC 3B0CW 4KGCC 3O62C 4J8XD 2Y2HA 1JFIA 1P3BB 1B6WA 5KDMA 1H3OB 5JRGB 4EO5B 2ZM5A 3AFAA 5CPID 4WU8C 1JFIB 1F66D 3TU4D 3AZHD 3REHC 5CPJC 3AL0C 3MGSC 1HQ3A 4QLCA 4Z66C 3AZJD 3AFAB 1B67A 3B0CT 3C1BD 3AZFA 3LJAA 1T3UA 3WAAA 3LELA 1HQ3B 3X1UA 4QLCB 1P3PC 3MNNA 3AZFB 3A6NC 5GSUD 1EQZC 2HUEC 3LJAB 4KGCA 3O62A 3UTAC 3WAAB 3LELB 3X1UB 4H9PA 2F8NA 3W96D 1P3IC 3B6GC 3MNNB 1P3FD 1W2EA 5AVCD 4KGCB 3O62B 2HIOD 4WU8A 4H9PB 3W99D 3X1SC 5CPKD 2F8NB 3REHA 1Z2CB 5CPJA 2BG1A 4X23C 1P3LD 4Z66A 4ZUXD 1F66C 4WU8B 1ZLAC 1M1AC 3REHB 5CPJB 1ID3D 4Z66B 5AV6D 1M19C 3C1CC 3AZID 1P3PA 3WA9C 1P3KC 3H0RC 5B24D 5JA4A 1S32D 3A6NA 5B1MD 1EQZA 3UTAA 3AV1C 4Z5TD 4WNNA 5AY8C 1P3IA 2FJ7D 5JA4B 3B6GA 2XD1A 3A6NB 5B1LC 1EQZB 5B33C 3EPKA 3REID 1KX4D 2AROD 3X1SA 4WNNB 1P3IB 3B6GB 3X1TC 3VH5W 3WKJC 3LZ1C 4WU9D 3MVDD 5DNMD 4DQYB 3W98D 3X1SB 1ZLAA 1M1AA 1P3GC 3KSYA 1M19A 3C1CA 4J8WC 3AYWA 3WA9A 5BNVA 1P3KA 4DRAA 2RVQD 1ZLAB 1M1AB 4YS3D 3AZED 5B32G 3AV1A 4LD9C 2Y2QA 3C1CB 3AYWB 3WA9B 5AY8A 5BNVB 1P3KB 5B0ZD 5B1LA 1U35C 5B33A 2LY8A 3AV1B 5DNNC 4UUZB 5AY8B 5F99D 3AZMD 3AN2D 5GXQC 2F2AC 3X1TA 5B1LB 5B0YC 3W97D 3LZ1A 5B33B 3WKJA 3WTPC 3X1VD 3B0DC 5CP6C 3KUYD 5B2ID 1P3GA 3X1TB 3WKJB 3LZ1B 2G5HC 4J8WA 4XUJD 5B31G 3AZGC 2YFWA 5BO0A 2F8NG 3EPLA 4J8UC 1P3GB 1AOIC 1N1JA 4KUDD 3KWQD 4LD9A 4J8WB 5B32C 5AV9D 2YFWB 5BO0B 1U35A 1N1JB 4XZQC 5DNNA 4YM6C 2PYOD 3FDDA 4LD9B 5B40C 1P3OC 5GXQA 2IO5C 5B0YA 3WTPA 5C3IC 3AZLD 5DNNB 5CP6A 4H9OA 2ZY3A 5AV5C 4NE3A 5GXQB 4E44A 5BNXA 5B0YB 3WTPB 3B0DB 4H9OB 5CP6B 3RELC 3IP4C 3AZGA 5E5AD 2ZY4A 5B31C 4J8UA 1AOIA 1BH9A 3B6FC 3AZND 4G92C 5BNXB 5B32A 3REJA 3H0LC 3AZGB 1M18C 2NQBC 4J8UB 1AOIB 5KDMB 1BH9B 3VH6W 4XZQA 5BT1D 2UWXA 4J8VD 4YM6A 5CHLB 5B40A 3EG5B 5B32B 3REJB 1P3OA 2G5IC 4R8PA 5GT0D 4XZQB 4YM6B 3MGPD 5AV5A 5B40B 3MGRD 1P3OB 3VH5A 2IO5B 3REKC 4R8PB 2FFFB 1KX3D 4WZSB 5C3IB 5AV8C 3VH6T 3RELA 5AV5B 1P3MD 5B31A 3B6FA 3KXBD 2NZDC 2Y2MA 4J8XC 2VQRA 3RELB 1M18A 1P3AD 2NQBA 5B31B 3B6FB 3UTBD 3MGSA 5CPIC 1M18B 2NQBB 4WJ3C 3TU4C 3AZHC 2ZY5A 4UPKA 3AZJC 3MGSB 1A7WA 3C1BC 3REKA 4Z2MG 1WWIA 5BS7C 5AV8A 1HTAA 2NZDA 5B2JD 1P3PB 4CSRA 2Y2NA 3REKB 5GSUC 3UT9D 3MGQD 4M6BA 2HUEB 4J8XA 5AV8B 3AV2D 1P3MC 2Y2KA 3UTAB 3W96C 2NZDB 3NQUA 2CV5D 4CSRB 1P3FC 3P5JB 4X23A 5AVCC 4J8XB 5AVBD 3LZ0D 2HIOC 5CPIA 1F66A 3TU4A 3W99C 3AZHA 5CPKC 3NQUB 1P3LC 2Y2GA 4X23B 3AZJA 4ZUXC 1TAFA 2CWEA 5GT3D 4JJND 5CPIB 1F66B 3C1BA 2Y2IA 3TU4B 3AZHB 5BS7A 1P34D 3V9RA 1ID3C 1KX5D 1TZYD 5AV6C 3AZJB 1TAFB 1M19B 3AZIC 4G91C 2JCHA 2ZY2A 3F6TA 5B24C 3AZKD 3C1BB 1S32C 5B1MC 5GSUA 3V9RB 4Z5TC 1P3BD 3W96A 5JRGD 2FJ7C 1P3FA 5GSUB 3REIC 2HIOA 4E45A 4DRBA 1KX4C 2AROC 3W99A 5CPKA 3W96B 2F8NK 1P3FB 1P3LA 3AFAD 2HIOB 4ZBJC 4WU9C 3MVDC 4KHAA 3R45A 5DNMC 3W98C 5CPKB 4H9RA 1ID3A 1P3LB 1ULYA 1HQ3D 4QLCD 1R4VA 5AV6A 5GT3C 2XD5A 3AZIA 5B24A 4R8PD 3AZFD 4KHAB 3R45B 1S32A 2RVQC 5B1MA 3LJAD 4YS3C 4H9RB 3AZEC 1ID3B 3WAAD 3LELD 3X1UD 4Z5TA 3AZIB 4G91B 5B24B 4H9QA 3MNND 5B0ZC 1S32B 2FJ7A 5B1MB 4KGCD 2JE5A 3A1KA 3O62D 3REIA 1U35B 4Z5TB 1KX4A 3EPHA 2AROA 2F8ND 5F99C 3AZMC 2FJ7B 3AN2C 2BYMA 3W97C 3X1VC 4WU8D 4WU9A 3MVDA 1KX4B 5DNMA 3KUYC 2AROB 5B2IC 3W98A 3REHD 5FUGA 5CPJD 4Z66D 3AFAC 4XUJC 4WU9B 3MVDB 5DNMB 3W98B 4CAYA 5FUGB 4YS3A 4KUDC 3AZEA 3WTPE 2F8NH 3KWQC 1P3PD 5AV9C 2BYKA 5B0ZA 3A6ND 4CAYB 1EQZD 4YS3B 3UTAD 3AZEB 2PYOC 1P3ID 3B6GD 5F99A 3AZMA 2BYKB 5B0ZB 3AN2A 3W97A 3X1VA 3AZLC 3KUYA 3X1SD 5B2IA 5F99B 3AZMB 4X23D 3AN2B 3W97B 1KU5A 3X1VB 4XUJA 2RIQA 3KUYB 5E5AC 1ZLAD 5B2IB 1M1AD 4KUDA 1BFMA 3AZNC 1M19D 3KWQA 4G92B 2L5AA 3C1CD 3AYWD 1F1EA 4XUJB 1P3KD 5AV9A 3WA9D 4KUDB 5BT1C 3AV1D 4J8VC 3KWQB 2PYOA 5AY8D 5AV9B 5B1LD 5B33D 5GT0C 3AZLA 3NQJA 2PYOB 3MGPC 3MGRC 5G49A 2Y2OA 3X1TD 3WKJD 3LZ1D 1KX3C 2W8SA 3AZLB 3B0BA 3NQJB 5E5AA 5G49B 1P3GD 1PZRA 3KXBC 3AZNA 4J8WD 4HGAC 4H9SC 5E5AB 1P3AC 2YFVA 1Q9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  4J8V A;  3AYW C;  4LD9 D;  3UTB C;  4WV4 B;  1U35 D;  2YFV B;  5GT0 A;  5DNN D;  4J8V B;  3MGP A;  3MGR A;  5GXQ D;  5B0Y D;  5GT0 B;  3WTP D;  1KX3 A;  4H9N A;  5CP6 D;  4Z2M H;  3MGP B;  3MGR B;  1P3M A;  3KXB A;  5B2J C;  2JSS A;  3UT9 C;  1KX3 B;  3MGQ C;  4H9N B;  5AVC A;  3AZG D;  4NE5 A;  3AV2 C;  4H9S A;  1P3A A;  1P3M B;  4J8U D;  1AOI D;  3KXB B;  2CV5 C;  3VH6 A;  3UTB A;  5B32 D;  3REJ D;  4NE6 A;  5AVC B;  5AVB C;  3LZ0 C;  4HGA B;  4ZUX A;  4AWL C;  1P3A B;  4XZQ D;  3W99 B;  4YM6 D;  4UUZ A;  3VH5 T;  3UTB B;  5B40 D;  1P3O D;  4JJN C;  4ZUX B;  1P34 C;  1BH8 A;  1KX5 C;  5AV5 D;  1TZY C;  5AV6 B;  5B2J A;  3AZK C;  4NFT A;  3UT9 A;  1BH8 B;  3MGQ A;  3REL D;  3AV2 A;  1P3B C;  5B31 D;  3B6F D;  5JRG C;  5B2J B;  2CV5 A;  4EO5 C;  1WWS A;  4H9Q B;  3UT9 B;  3MGQ B;  5AVB A;  3LZ0 A;  3AV2 B;  1M18 D;  2NQB D;  3REI B;  2CV5 B;  3REJ C;  3MGS D;  2BYM B;  5AVB B;  3LZ0 B;  5GT3 A;  4JJN A;  4AWL B;  4ZBJ B;  1P34 A;  1KX5 A;  1HQ3 C;  4QLC C;  1TZY A;  5GT3 B;  4JJN B;  3AZK A;  4R8P C;  3AZF C;  3REK D;  3LJA C;  1P34 B;  3WAA C;  5AV8 D;  3LEL C;  1KX5 B;  3X1U C;  1P3B A;  1TZY B;  1H3O A;  2NZD D;  5JRG A;  3AZK B;  3MNN C;  3B0C W;  4KGC C;  3O62 C;  4J8X D;  1JFI A;  1P3B B;  1B6W A;  5KDM A;  1H3O B;  5JRG B;  4EO5 B;  3AFA A;  5CPI D;  4WU8 C;  1JFI B;  1F66 D;  3TU4 D;  3AZH D;  3REH C;  5CPJ C;  3MGS C;  1HQ3 A;  4QLC A;  4Z66 C;  3AZJ D;  3AFA B;  1B67 A;  3B0C T;  3C1B D;  3AZF A;  3LJA A;  3WAA A;  3LEL A;  1HQ3 B;  3X1U A;  4QLC B;  1P3P C;  3MNN A;  3AZF B;  3A6N C;  5GSU D;  1EQZ C;  2HUE C;  3LJA B;  4KGC A;  3O62 A;  3UTA C;  3WAA B;  3LEL B;  3X1U B;  4H9P A;  2F8N A;  3W96 D;  1P3I C;  3B6G C;  3MNN B;  1P3F D;  5AVC D;  4KGC B;  3O62 B;  2HIO D;  4WU8 A;  4H9P B;  3W99 D;  3X1S C;  5CPK D;  2F8N B;  3REH A;  5CPJ A;  4X23 C;  1P3L D;  4Z66 A;  4ZUX D;  1F66 C;  4WU8 B;  1ZLA C;  1M1A C;  3REH B;  5CPJ B;  1ID3 D;  4Z66 B;  5AV6 D;  1M19 C;  3C1C C;  3AZI D;  1P3P A;  3WA9 C;  1P3K C;  5B24 D;  5JA4 A;  1S32 D;  3A6N A;  5B1M D;  1EQZ A;  3UTA A;  3AV1 C;  4Z5T D;  4WNN A;  5AY8 C;  1P3I A;  2FJ7 D;  5JA4 B;  3B6G A;  3A6N B;  5B1L C;  1EQZ B;  5B33 C;  3REI D;  1KX4 D;  2ARO D;  3X1S A;  4WNN B;  1P3I B;  3B6G B;  3X1T C;  3VH5 W;  3WKJ C;  3LZ1 C;  4WU9 D;  3MVD D;  5DNM D;  3W98 D;  3X1S B;  1ZLA A;  1M1A A;  1P3G C;  3KSY A;  1M19 A;  3C1C A;  4J8W C;  3AYW A;  3WA9 A;  5BNV A;  1P3K A;  4DRA A;  2RVQ D;  1ZLA B;  1M1A B;  4YS3 D;  3AZE D;  5B32 G;  3AV1 A;  4LD9 C;  3C1C B;  3AYW B;  3WA9 B;  5AY8 A;  5BNV B;  1P3K B;  5B0Z D;  5B1L A;  1U35 C;  5B33 A;  2LY8 A;  3AV1 B;  5DNN C;  4UUZ B;  5AY8 B;  5F99 D;  3AZM D;  3AN2 D;  5GXQ C;  3X1T A;  5B1L B;  5B0Y C;  3W97 D;  3LZ1 A;  5B33 B;  3WKJ A;  3WTP C;  3X1V D;  3B0D C;  5CP6 C;  3KUY D;  5B2I D;  1P3G A;  3X1T B;  3WKJ B;  3LZ1 B;  4J8W A;  4XUJ D;  5B31 G;  3AZG C;  2YFW A;  5BO0 A;  2F8N G;  4J8U C;  1P3G B;  1AOI C;  1N1J A;  4KUD D;  3KWQ D;  4LD9 A;  4J8W B;  5B32 C;  5AV9 D;  2YFW B;  5BO0 B;  1U35 A;  1N1J B;  4XZQ C;  5DNN A;  4YM6 C;  2PYO D;  4LD9 B;  5B40 C;  1P3O C;  5GXQ A;  2IO5 C;  5B0Y A;  3WTP A;  5C3I C;  3AZL D;  5DNN B;  5CP6 A;  4H9O A;  5AV5 C;  4NE3 A;  5GXQ B;  4E44 A;  5BNX A;  5B0Y B;  3WTP B;  3B0D B;  4H9O B;  5CP6 B;  3REL C;  3AZG A;  5E5A D;  5B31 C;  4J8U A;  1AOI A;  1BH9 A;  3B6F C;  3AZN D;  4G92 C;  5BNX B;  5B32 A;  3REJ A;  3AZG B;  1M18 C;  2NQB C;  4J8U B;  1AOI B;  5KDM B;  1BH9 B;  3VH6 W;  4XZQ A;  5BT1 D;  4J8V D;  4YM6 A;  5CHL B;  5B40 A;  5B32 B;  3REJ B;  1P3O A;  4R8P A;  5GT0 D;  4XZQ B;  4YM6 B;  3MGP D;  5AV5 A;  5B40 B;  3MGR D;  1P3O B;  3VH5 A;  2IO5 B;  3REK C;  4R8P B;  1KX3 D;  4WZS B;  5C3I B;  5AV8 C;  3VH6 T;  3REL A;  5AV5 B;  1P3M D;  5B31 A;  3B6F A;  3KXB D;  2NZD C;  4J8X C;  3REL B;  1M18 A;  1P3A D;  2NQB A;  5B31 B;  3B6F B;  3UTB D;  3MGS A;  5CPI C;  1M18 B;  2NQB B;  3TU4 C;  3AZH C;  3AZJ C;  3MGS B;  1A7W A;  3C1B C;  3REK A;  4Z2M G;  1WWI A;  5BS7 C;  5AV8 A;  1HTA A;  2NZD A;  5B2J D;  1P3P B;  4CSR A;  3REK B;  5GSU C;  3UT9 D;  3MGQ D;  4M6B A;  2HUE B;  4J8X A;  5AV8 B;  3AV2 D;  1P3M C;  3UTA B;  3W96 C;  2NZD B;  3NQU A;  2CV5 D;  4CSR B;  1P3F C;  4X23 A;  5AVC C;  4J8X B;  5AVB D;  3LZ0 D;  2HIO C;  5CPI A;  1F66 A;  3TU4 A;  3W99 C;  3AZH A;  5CPK C;  3NQU B;  1P3L C;  4X23 B;  3AZJ A;  4ZUX C;  1TAF A;  2CWE A;  5GT3 D;  4JJN D;  5CPI B;  1F66 B;  3C1B A;  3TU4 B;  3AZH B;  5BS7 A;  1P34 D;  3V9R A;  1ID3 C;  1KX5 D;  1TZY D;  5AV6 C;  3AZJ B;  1TAF B;  1M19 B;  3AZI C;  4G91 C;  3AZK D;  5B24 C;  3C1B B;  1S32 C;  5B1M C;  5GSU A;  3V9R B;  4Z5T C;  1P3B D;  3W96 A;  5JRG D;  2FJ7 C;  1P3F A;  5GSU B;  3REI C;  2HIO A;  4E45 A;  4DRB A;  1KX4 C;  2ARO C;  3W99 A;  5CPK A;  3W96 B;  2F8N K;  1P3F B;  1P3L A;  3AFA D;  2HIO B;  4ZBJ C;  4WU9 C;  3MVD C;  4KHA A;  3R45 A;  5DNM C;  3W98 C;  5CPK B;  4H9R A;  1ID3 A;  1P3L B;  1ULY A;  1HQ3 D;  4QLC D;  1R4V A;  5AV6 A;  5GT3 C;  3AZI A;  5B24 A;  4R8P D;  3AZF D;  4KHA B;  3R45 B;  1S32 A;  2RVQ C;  5B1M A;  3LJA D;  4YS3 C;  4H9R B;  3AZE C;  1ID3 B;  3WAA D;  3LEL D;  3X1U D;  4Z5T A;  3AZI B;  4G91 B;  5B24 B;  4H9Q A;  3MNN D;  5B0Z C;  1S32 B;  2FJ7 A;  5B1M B;  4KGC D;  3O62 D;  3REI A;  1U35 B;  4Z5T B;  1KX4 A;  2ARO A;  2F8N D;  5F99 C;  3AZM C;  2FJ7 B;  3AN2 C;  2BYM A;  3W97 C;  3X1V C;  4WU8 D;  4WU9 A;  3MVD A;  1KX4 B;  5DNM A;  3KUY C;  2ARO B;  5B2I C;  3W98 A;  3REH D;  5FUG A;  5CPJ D;  4Z66 D;  3AFA C;  4XUJ C;  4WU9 B;  3MVD B;  5DNM B;  3W98 B;  4CAY A;  5FUG B;  4YS3 A;  4KUD C;  3AZE A;  3WTP E;  2F8N H;  3KWQ C;  1P3P D;  5AV9 C;  2BYK A;  5B0Z A;  3A6N D;  4CAY B;  1EQZ D;  4YS3 B;  3UTA D;  3AZE B;  2PYO C;  1P3I D;  3B6G D;  5F99 A;  3AZM A;  2BYK B;  5B0Z B;  3AN2 A;  3W97 A;  3X1V A;  3AZL C;  3KUY A;  3X1S D;  5B2I A;  5F99 B;  3AZM B;  4X23 D;  3AN2 B;  3W97 B;  1KU5 A;  3X1V B;  4XUJ A;  3KUY B;  5E5A C;  1ZLA D;  5B2I B;  1M1A D;  4KUD A;  1BFM A;  3AZN C;  1M19 D;  3KWQ A;  4G92 B;  2L5A A;  3C1C D;  3AYW D;  1F1E A;  4XUJ B;  1P3K D;  5AV9 A;  3WA9 D;  4KUD B;  5BT1 C;  3AV1 D;  4J8V C;  3KWQ B;  2PYO A;  5AY8 D;  5AV9 B;  5B1L D;  5B33 D;  5GT0 C;  3AZL A;  3NQJ A;  2PYO B;  3MGP C;  3MGR C;  5G49 A;  3X1T D;  3WKJ D;  3LZ1 D;  1KX3 C;  3AZL B;  3B0B A;  3NQJ B;  5E5A A;  5G49 B;  1P3G D;  3KXB C;  3AZN A;  4J8W D;  4HGA C;  4H9S C;  5E5A B;  1P3A C;  2YFV A;  1Q9C A; 
#chains in the Genus database with same CATH topology
 3AZN B;  4J8V A;  3AYW C;  4LD9 D;  3UTB C;  4WV4 B;  1U35 D;  2YFV B;  5GT0 A;  5DNN D;  4J8V B;  3MGP A;  2DF4 C;  3MGR A;  3EPJ A;  5GXQ D;  5B0Y D;  5GT0 B;  3WTP D;  1KX3 A;  4H9N A;  5CP6 D;  4Z2M H;  3MGP B;  3MGR B;  1P3M A;  3KXB A;  2Y2J A;  5B2J C;  2JSS A;  3UT9 C;  1KX3 B;  2DQN C;  4H9N B;  3MGQ C;  5AVC A;  3AZG D;  4NE5 A;  3AV2 C;  4H9S A;  1P3A A;  1P3M B;  4J8U D;  1AOI D;  3KXB B;  2CV5 C;  3VH6 A;  3UTB A;  5B32 D;  3REJ D;  4NE6 A;  5AVC B;  5AVB C;  3LZ0 C;  4HGA B;  4ZUX A;  4AWL C;  1P3A B;  4XZQ D;  3W99 B;  4YM6 D;  4UUZ A;  3VH5 T;  3UTB B;  5B40 D;  2Y2L A;  1P3O D;  4JJN C;  4ZUX B;  3KFU G;  1P34 C;  1BH8 A;  2Y2P A;  1KX5 C;  5AV5 D;  1TZY C;  5AV6 B;  5B2J A;  3AZK C;  4NFT A;  3UT9 A;  1BH8 B;  3MGQ A;  3REL D;  3AV2 A;  1P3B C;  5B31 D;  3B6F D;  5JRG C;  5B2J B;  2CV5 A;  4EO5 C;  1WWS A;  4H9Q B;  3UT9 B;  3MGQ B;  5AVB A;  3LZ0 A;  3AV2 B;  1M18 D;  2NQB D;  3REI B;  2CV5 B;  3REJ C;  3MGS D;  2BYM B;  5AVB B;  3LZ0 B;  5GT3 A;  4JJN A;  4AWL B;  2J8P A;  4ZBJ B;  1P34 A;  1KX5 A;  1HQ3 C;  4QLC C;  1TZY A;  5GT3 B;  3H0M C;  4JJN B;  3AZK A;  4R8P C;  3AZF C;  3REK D;  3A1I A;  3LJA C;  1P34 B;  3WAA C;  5AV8 D;  3LEL C;  1KX5 B;  3X1U C;  1P3B A;  1TZY B;  1H3O A;  2NZD D;  5JRG A;  3AZK B;  3MNN C;  3B0C W;  4KGC C;  3O62 C;  4J8X D;  2Y2H A;  1JFI A;  1P3B B;  1B6W A;  5KDM A;  1H3O B;  5JRG B;  4EO5 B;  2ZM5 A;  3AFA A;  5CPI D;  4WU8 C;  1JFI B;  1F66 D;  3TU4 D;  3AZH D;  3REH C;  5CPJ C;  3AL0 C;  3MGS C;  1HQ3 A;  4QLC A;  4Z66 C;  3AZJ D;  3AFA B;  1B67 A;  3B0C T;  3C1B D;  3AZF A;  3LJA A;  1T3U A;  3WAA A;  3LEL A;  1HQ3 B;  3X1U A;  4QLC B;  1P3P C;  3MNN A;  3AZF B;  3A6N C;  5GSU D;  1EQZ C;  2HUE C;  3LJA B;  4KGC A;  3O62 A;  3UTA C;  3WAA B;  3LEL B;  3X1U B;  4H9P A;  2F8N A;  3W96 D;  1P3I C;  3B6G C;  3MNN B;  1P3F D;  1W2E A;  5AVC D;  4KGC B;  3O62 B;  2HIO D;  4WU8 A;  4H9P B;  3W99 D;  3X1S C;  5CPK D;  2F8N B;  3REH A;  1Z2C B;  5CPJ A;  2BG1 A;  4X23 C;  1P3L D;  4Z66 A;  4ZUX D;  1F66 C;  4WU8 B;  1ZLA C;  1M1A C;  3REH B;  5CPJ B;  1ID3 D;  4Z66 B;  5AV6 D;  1M19 C;  3C1C C;  3AZI D;  1P3P A;  3WA9 C;  1P3K C;  3H0R C;  5B24 D;  5JA4 A;  1S32 D;  3A6N A;  5B1M D;  1EQZ A;  3UTA A;  3AV1 C;  4Z5T D;  4WNN A;  5AY8 C;  1P3I A;  2FJ7 D;  5JA4 B;  3B6G A;  2XD1 A;  3A6N B;  5B1L C;  1EQZ B;  5B33 C;  3EPK A;  3REI D;  1KX4 D;  2ARO D;  3X1S A;  4WNN B;  1P3I B;  3B6G B;  3X1T C;  3VH5 W;  3WKJ C;  3LZ1 C;  4WU9 D;  3MVD D;  5DNM D;  4DQY B;  3W98 D;  3X1S B;  1ZLA A;  1M1A A;  1P3G C;  3KSY A;  1M19 A;  3C1C A;  4J8W C;  3AYW A;  3WA9 A;  5BNV A;  1P3K A;  4DRA A;  2RVQ D;  1ZLA B;  1M1A B;  4YS3 D;  3AZE D;  5B32 G;  3AV1 A;  4LD9 C;  2Y2Q A;  3C1C B;  3AYW B;  3WA9 B;  5AY8 A;  5BNV B;  1P3K B;  5B0Z D;  5B1L A;  1U35 C;  5B33 A;  2LY8 A;  3AV1 B;  5DNN C;  4UUZ B;  5AY8 B;  5F99 D;  3AZM D;  3AN2 D;  5GXQ C;  2F2A C;  3X1T A;  5B1L B;  5B0Y C;  3W97 D;  3LZ1 A;  5B33 B;  3WKJ A;  3WTP C;  3X1V D;  3B0D C;  5CP6 C;  3KUY D;  5B2I D;  1P3G A;  3X1T B;  3WKJ B;  3LZ1 B;  2G5H C;  4J8W A;  4XUJ D;  5B31 G;  3AZG C;  2YFW A;  5BO0 A;  2F8N G;  3EPL A;  4J8U C;  1P3G B;  1AOI C;  1N1J A;  4KUD D;  3KWQ D;  4LD9 A;  4J8W B;  5B32 C;  5AV9 D;  2YFW B;  5BO0 B;  1U35 A;  1N1J B;  4XZQ C;  5DNN A;  4YM6 C;  2PYO D;  3FDD A;  4LD9 B;  5B40 C;  1P3O C;  5GXQ A;  2IO5 C;  5B0Y A;  3WTP A;  5C3I C;  3AZL D;  5DNN B;  5CP6 A;  4H9O A;  2ZY3 A;  5AV5 C;  4NE3 A;  5GXQ B;  4E44 A;  5BNX A;  5B0Y B;  3WTP B;  3B0D B;  4H9O B;  5CP6 B;  3REL C;  3IP4 C;  3AZG A;  5E5A D;  2ZY4 A;  5B31 C;  4J8U A;  1AOI A;  1BH9 A;  3B6F C;  3AZN D;  4G92 C;  5BNX B;  5B32 A;  3REJ A;  3H0L C;  3AZG B;  1M18 C;  2NQB C;  4J8U B;  1AOI B;  5KDM B;  1BH9 B;  3VH6 W;  4XZQ A;  5BT1 D;  2UWX A;  4J8V D;  4YM6 A;  5CHL B;  5B40 A;  3EG5 B;  5B32 B;  3REJ B;  1P3O A;  2G5I C;  4R8P A;  5GT0 D;  4XZQ B;  4YM6 B;  3MGP D;  5AV5 A;  5B40 B;  3MGR D;  1P3O B;  3VH5 A;  2IO5 B;  3REK C;  4R8P B;  2FFF B;  1KX3 D;  4WZS B;  5C3I B;  5AV8 C;  3VH6 T;  3REL A;  5AV5 B;  1P3M D;  5B31 A;  3B6F A;  3KXB D;  2NZD C;  2Y2M A;  4J8X C;  2VQR A;  3REL B;  1M18 A;  1P3A D;  2NQB A;  5B31 B;  3B6F B;  3UTB D;  3MGS A;  5CPI C;  1M18 B;  2NQB B;  4WJ3 C;  3TU4 C;  3AZH C;  2ZY5 A;  4UPK A;  3AZJ C;  3MGS B;  1A7W A;  3C1B C;  3REK A;  4Z2M G;  1WWI A;  5BS7 C;  5AV8 A;  1HTA A;  2NZD A;  5B2J D;  1P3P B;  4CSR A;  2Y2N A;  3REK B;  5GSU C;  3UT9 D;  3MGQ D;  4M6B A;  2HUE B;  4J8X A;  5AV8 B;  3AV2 D;  1P3M C;  2Y2K A;  3UTA B;  3W96 C;  2NZD B;  3NQU A;  2CV5 D;  4CSR B;  1P3F C;  3P5J B;  4X23 A;  5AVC C;  4J8X B;  5AVB D;  3LZ0 D;  2HIO C;  5CPI A;  1F66 A;  3TU4 A;  3W99 C;  3AZH A;  5CPK C;  3NQU B;  1P3L C;  2Y2G A;  4X23 B;  3AZJ A;  4ZUX C;  1TAF A;  2CWE A;  5GT3 D;  4JJN D;  5CPI B;  1F66 B;  3C1B A;  2Y2I A;  3TU4 B;  3AZH B;  5BS7 A;  1P34 D;  3V9R A;  1ID3 C;  1KX5 D;  1TZY D;  5AV6 C;  3AZJ B;  1TAF B;  1M19 B;  3AZI C;  4G91 C;  2JCH A;  2ZY2 A;  3F6T A;  5B24 C;  3AZK D;  3C1B B;  1S32 C;  5B1M C;  5GSU A;  3V9R B;  4Z5T C;  1P3B D;  3W96 A;  5JRG D;  2FJ7 C;  1P3F A;  5GSU B;  3REI C;  2HIO A;  4E45 A;  4DRB A;  1KX4 C;  2ARO C;  3W99 A;  5CPK A;  3W96 B;  2F8N K;  1P3F B;  1P3L A;  3AFA D;  2HIO B;  4ZBJ C;  4WU9 C;  3MVD C;  4KHA A;  3R45 A;  5DNM C;  3W98 C;  5CPK B;  4H9R A;  1ID3 A;  1P3L B;  1ULY A;  1HQ3 D;  4QLC D;  1R4V A;  5AV6 A;  5GT3 C;  2XD5 A;  3AZI A;  5B24 A;  4R8P D;  3AZF D;  4KHA B;  3R45 B;  1S32 A;  2RVQ C;  5B1M A;  3LJA D;  4YS3 C;  4H9R B;  3AZE C;  1ID3 B;  3WAA D;  3LEL D;  3X1U D;  4Z5T A;  3AZI B;  4G91 B;  5B24 B;  4H9Q A;  3MNN D;  5B0Z C;  1S32 B;  2FJ7 A;  5B1M B;  4KGC D;  2JE5 A;  3A1K A;  3O62 D;  3REI A;  1U35 B;  4Z5T B;  1KX4 A;  3EPH A;  2ARO A;  2F8N D;  5F99 C;  3AZM C;  2FJ7 B;  3AN2 C;  2BYM A;  3W97 C;  3X1V C;  4WU8 D;  4WU9 A;  3MVD A;  1KX4 B;  5DNM A;  3KUY C;  2ARO B;  5B2I C;  3W98 A;  3REH D;  5FUG A;  5CPJ D;  4Z66 D;  3AFA C;  4XUJ C;  4WU9 B;  3MVD B;  5DNM B;  3W98 B;  4CAY A;  5FUG B;  4YS3 A;  4KUD C;  3AZE A;  3WTP E;  2F8N H;  3KWQ C;  1P3P D;  5AV9 C;  2BYK A;  5B0Z A;  3A6N D;  4CAY B;  1EQZ D;  4YS3 B;  3UTA D;  3AZE B;  2PYO C;  1P3I D;  3B6G D;  5F99 A;  3AZM A;  2BYK B;  5B0Z B;  3AN2 A;  3W97 A;  3X1V A;  3AZL C;  3KUY A;  3X1S D;  5B2I A;  5F99 B;  3AZM B;  4X23 D;  3AN2 B;  3W97 B;  1KU5 A;  3X1V B;  4XUJ A;  2RIQ A;  3KUY B;  5E5A C;  1ZLA D;  5B2I B;  1M1A D;  4KUD A;  1BFM A;  3AZN C;  1M19 D;  3KWQ A;  4G92 B;  2L5A A;  3C1C D;  3AYW D;  1F1E A;  4XUJ B;  1P3K D;  5AV9 A;  3WA9 D;  4KUD B;  5BT1 C;  3AV1 D;  4J8V C;  3KWQ B;  2PYO A;  5AY8 D;  5AV9 B;  5B1L D;  5B33 D;  5GT0 C;  3AZL A;  3NQJ A;  2PYO B;  3MGP C;  3MGR C;  5G49 A;  2Y2O A;  3X1T D;  3WKJ D;  3LZ1 D;  1KX3 C;  2W8S A;  3AZL B;  3B0B A;  3NQJ B;  5E5A A;  5G49 B;  1P3G D;  1PZR A;  3KXB C;  3AZN A;  4J8W D;  4HGA C;  4H9S C;  5E5A B;  1P3A C;  2YFV A;  1Q9C A; 
#chains in the Genus database with same CATH homology
 3AZN B;  4J8V A;  3AYW C;  4LD9 D;  3UTB C;  4WV4 B;  1U35 D;  2YFV B;  5GT0 A;  5DNN D;  4J8V B;  3MGP A;  2DF4 C;  3MGR A;  3EPJ A;  5GXQ D;  5B0Y D;  5GT0 B;  3WTP D;  1KX3 A;  4H9N A;  5CP6 D;  4Z2M H;  3MGP B;  3MGR B;  1P3M A;  3KXB A;  2Y2J A;  5B2J C;  2JSS A;  3UT9 C;  1KX3 B;  2DQN C;  4H9N B;  3MGQ C;  5AVC A;  3AZG D;  4NE5 A;  3AV2 C;  4H9S A;  1P3A A;  1P3M B;  4J8U D;  1AOI D;  3KXB B;  2CV5 C;  3VH6 A;  3UTB A;  5B32 D;  3REJ D;  4NE6 A;  5AVC B;  5AVB C;  3LZ0 C;  4HGA B;  4ZUX A;  4AWL C;  1P3A B;  4XZQ D;  3W99 B;  4YM6 D;  4UUZ A;  3VH5 T;  3UTB B;  5B40 D;  2Y2L A;  1P3O D;  4JJN C;  4ZUX B;  3KFU G;  1P34 C;  1BH8 A;  2Y2P A;  1KX5 C;  5AV5 D;  1TZY C;  5AV6 B;  5B2J A;  3AZK C;  4NFT A;  3UT9 A;  1BH8 B;  3MGQ A;  3REL D;  3AV2 A;  1P3B C;  5B31 D;  3B6F D;  5JRG C;  5B2J B;  2CV5 A;  4EO5 C;  1WWS A;  4H9Q B;  3UT9 B;  3MGQ B;  5AVB A;  3LZ0 A;  3AV2 B;  1M18 D;  2NQB D;  3REI B;  2CV5 B;  3REJ C;  3MGS D;  2BYM B;  5AVB B;  3LZ0 B;  5GT3 A;  4JJN A;  4AWL B;  2J8P A;  4ZBJ B;  1P34 A;  1KX5 A;  1HQ3 C;  4QLC C;  1TZY A;  5GT3 B;  3H0M C;  4JJN B;  3AZK A;  4R8P C;  3AZF C;  3REK D;  3A1I A;  3LJA C;  1P34 B;  3WAA C;  5AV8 D;  3LEL C;  1KX5 B;  3X1U C;  1P3B A;  1TZY B;  1H3O A;  2NZD D;  5JRG A;  3AZK B;  3MNN C;  3B0C W;  4KGC C;  3O62 C;  4J8X D;  2Y2H A;  1JFI A;  1P3B B;  1B6W A;  5KDM A;  1H3O B;  5JRG B;  4EO5 B;  2ZM5 A;  3AFA A;  5CPI D;  4WU8 C;  1JFI B;  1F66 D;  3TU4 D;  3AZH D;  3REH C;  5CPJ C;  3AL0 C;  3MGS C;  1HQ3 A;  4QLC A;  4Z66 C;  3AZJ D;  3AFA B;  1B67 A;  3B0C T;  3C1B D;  3AZF A;  3LJA A;  1T3U A;  3WAA A;  3LEL A;  1HQ3 B;  3X1U A;  4QLC B;  1P3P C;  3MNN A;  3AZF B;  3A6N C;  5GSU D;  1EQZ C;  2HUE C;  3LJA B;  4KGC A;  3O62 A;  3UTA C;  3WAA B;  3LEL B;  3X1U B;  4H9P A;  2F8N A;  3W96 D;  1P3I C;  3B6G C;  3MNN B;  1P3F D;  1W2E A;  5AVC D;  4KGC B;  3O62 B;  2HIO D;  4WU8 A;  4H9P B;  3W99 D;  3X1S C;  5CPK D;  2F8N B;  3REH A;  1Z2C B;  5CPJ A;  2BG1 A;  4X23 C;  1P3L D;  4Z66 A;  4ZUX D;  1F66 C;  4WU8 B;  1ZLA C;  1M1A C;  3REH B;  5CPJ B;  1ID3 D;  4Z66 B;  5AV6 D;  1M19 C;  3C1C C;  3AZI D;  1P3P A;  3WA9 C;  1P3K C;  3H0R C;  5B24 D;  5JA4 A;  1S32 D;  3A6N A;  5B1M D;  1EQZ A;  3UTA A;  3AV1 C;  4Z5T D;  4WNN A;  5AY8 C;  1P3I A;  2FJ7 D;  5JA4 B;  3B6G A;  2XD1 A;  3A6N B;  5B1L C;  1EQZ B;  5B33 C;  3EPK A;  3REI D;  1KX4 D;  2ARO D;  3X1S A;  4WNN B;  1P3I B;  3B6G B;  3X1T C;  3VH5 W;  3WKJ C;  3LZ1 C;  4WU9 D;  3MVD D;  5DNM D;  4DQY B;  3W98 D;  3X1S B;  1ZLA A;  1M1A A;  1P3G C;  3KSY A;  1M19 A;  3C1C A;  4J8W C;  3AYW A;  3WA9 A;  5BNV A;  1P3K A;  4DRA A;  2RVQ D;  1ZLA B;  1M1A B;  4YS3 D;  3AZE D;  5B32 G;  3AV1 A;  4LD9 C;  2Y2Q A;  3C1C B;  3AYW B;  3WA9 B;  5AY8 A;  5BNV B;  1P3K B;  5B0Z D;  5B1L A;  1U35 C;  5B33 A;  2LY8 A;  3AV1 B;  5DNN C;  4UUZ B;  5AY8 B;  5F99 D;  3AZM D;  3AN2 D;  5GXQ C;  2F2A C;  3X1T A;  5B1L B;  5B0Y C;  3W97 D;  3LZ1 A;  5B33 B;  3WKJ A;  3WTP C;  3X1V D;  3B0D C;  5CP6 C;  3KUY D;  5B2I D;  1P3G A;  3X1T B;  3WKJ B;  3LZ1 B;  2G5H C;  4J8W A;  4XUJ D;  5B31 G;  3AZG C;  2YFW A;  5BO0 A;  2F8N G;  3EPL A;  4J8U C;  1P3G B;  1AOI C;  1N1J A;  4KUD D;  3KWQ D;  4LD9 A;  4J8W B;  5B32 C;  5AV9 D;  2YFW B;  5BO0 B;  1U35 A;  1N1J B;  4XZQ C;  5DNN A;  4YM6 C;  2PYO D;  3FDD A;  4LD9 B;  5B40 C;  1P3O C;  5GXQ A;  2IO5 C;  5B0Y A;  3WTP A;  5C3I C;  3AZL D;  5DNN B;  5CP6 A;  4H9O A;  2ZY3 A;  5AV5 C;  4NE3 A;  5GXQ B;  4E44 A;  5BNX A;  5B0Y B;  3WTP B;  3B0D B;  4H9O B;  5CP6 B;  3REL C;  3IP4 C;  3AZG A;  5E5A D;  2ZY4 A;  5B31 C;  4J8U A;  1AOI A;  1BH9 A;  3B6F C;  3AZN D;  4G92 C;  5BNX B;  5B32 A;  3REJ A;  3H0L C;  3AZG B;  1M18 C;  2NQB C;  4J8U B;  1AOI B;  5KDM B;  1BH9 B;  3VH6 W;  4XZQ A;  5BT1 D;  2UWX A;  4J8V D;  4YM6 A;  5CHL B;  5B40 A;  3EG5 B;  5B32 B;  3REJ B;  1P3O A;  2G5I C;  4R8P A;  5GT0 D;  4XZQ B;  4YM6 B;  3MGP D;  5AV5 A;  5B40 B;  3MGR D;  1P3O B;  3VH5 A;  2IO5 B;  3REK C;  4R8P B;  2FFF B;  1KX3 D;  4WZS B;  5C3I B;  5AV8 C;  3VH6 T;  3REL A;  5AV5 B;  1P3M D;  5B31 A;  3B6F A;  3KXB D;  2NZD C;  2Y2M A;  4J8X C;  2VQR A;  3REL B;  1M18 A;  1P3A D;  2NQB A;  5B31 B;  3B6F B;  3UTB D;  3MGS A;  5CPI C;  1M18 B;  2NQB B;  4WJ3 C;  3TU4 C;  3AZH C;  2ZY5 A;  4UPK A;  3AZJ C;  3MGS B;  1A7W A;  3C1B C;  3REK A;  4Z2M G;  1WWI A;  5BS7 C;  5AV8 A;  1HTA A;  2NZD A;  5B2J D;  1P3P B;  4CSR A;  2Y2N A;  3REK B;  5GSU C;  3UT9 D;  3MGQ D;  4M6B A;  2HUE B;  4J8X A;  5AV8 B;  3AV2 D;  1P3M C;  2Y2K A;  3UTA B;  3W96 C;  2NZD B;  3NQU A;  2CV5 D;  4CSR B;  1P3F C;  3P5J B;  4X23 A;  5AVC C;  4J8X B;  5AVB D;  3LZ0 D;  2HIO C;  5CPI A;  1F66 A;  3TU4 A;  3W99 C;  3AZH A;  5CPK C;  3NQU B;  1P3L C;  2Y2G A;  4X23 B;  3AZJ A;  4ZUX C;  1TAF A;  2CWE A;  5GT3 D;  4JJN D;  5CPI B;  1F66 B;  3C1B A;  2Y2I A;  3TU4 B;  3AZH B;  5BS7 A;  1P34 D;  3V9R A;  1ID3 C;  1KX5 D;  1TZY D;  5AV6 C;  3AZJ B;  1TAF B;  1M19 B;  3AZI C;  4G91 C;  2JCH A;  2ZY2 A;  3F6T A;  5B24 C;  3AZK D;  3C1B B;  1S32 C;  5B1M C;  5GSU A;  3V9R B;  4Z5T C;  1P3B D;  3W96 A;  5JRG D;  2FJ7 C;  1P3F A;  5GSU B;  3REI C;  2HIO A;  4E45 A;  4DRB A;  1KX4 C;  2ARO C;  3W99 A;  5CPK A;  3W96 B;  2F8N K;  1P3F B;  1P3L A;  3AFA D;  2HIO B;  4ZBJ C;  4WU9 C;  3MVD C;  4KHA A;  3R45 A;  5DNM C;  3W98 C;  5CPK B;  4H9R A;  1ID3 A;  1P3L B;  1ULY A;  1HQ3 D;  4QLC D;  1R4V A;  5AV6 A;  5GT3 C;  2XD5 A;  3AZI A;  5B24 A;  4R8P D;  3AZF D;  4KHA B;  3R45 B;  1S32 A;  2RVQ C;  5B1M A;  3LJA D;  4YS3 C;  4H9R B;  3AZE C;  1ID3 B;  3WAA D;  3LEL D;  3X1U D;  4Z5T A;  3AZI B;  4G91 B;  5B24 B;  4H9Q A;  3MNN D;  5B0Z C;  1S32 B;  2FJ7 A;  5B1M B;  4KGC D;  2JE5 A;  3A1K A;  3O62 D;  3REI A;  1U35 B;  4Z5T B;  1KX4 A;  3EPH A;  2ARO A;  2F8N D;  5F99 C;  3AZM C;  2FJ7 B;  3AN2 C;  2BYM A;  3W97 C;  3X1V C;  4WU8 D;  4WU9 A;  3MVD A;  1KX4 B;  5DNM A;  3KUY C;  2ARO B;  5B2I C;  3W98 A;  3REH D;  5FUG A;  5CPJ D;  4Z66 D;  3AFA C;  4XUJ C;  4WU9 B;  3MVD B;  5DNM B;  3W98 B;  4CAY A;  5FUG B;  4YS3 A;  4KUD C;  3AZE A;  3WTP E;  2F8N H;  3KWQ C;  1P3P D;  5AV9 C;  2BYK A;  5B0Z A;  3A6N D;  4CAY B;  1EQZ D;  4YS3 B;  3UTA D;  3AZE B;  2PYO C;  1P3I D;  3B6G D;  5F99 A;  3AZM A;  2BYK B;  5B0Z B;  3AN2 A;  3W97 A;  3X1V A;  3AZL C;  3KUY A;  3X1S D;  5B2I A;  5F99 B;  3AZM B;  4X23 D;  3AN2 B;  3W97 B;  1KU5 A;  3X1V B;  4XUJ A;  2RIQ A;  3KUY B;  5E5A C;  1ZLA D;  5B2I B;  1M1A D;  4KUD A;  1BFM A;  3AZN C;  1M19 D;  3KWQ A;  4G92 B;  2L5A A;  3C1C D;  3AYW D;  1F1E A;  4XUJ B;  1P3K D;  5AV9 A;  3WA9 D;  4KUD B;  5BT1 C;  3AV1 D;  4J8V C;  3KWQ B;  2PYO A;  5AY8 D;  5AV9 B;  5B1L D;  5B33 D;  5GT0 C;  3AZL A;  3NQJ A;  2PYO B;  3MGP C;  3MGR C;  5G49 A;  2Y2O A;  3X1T D;  3WKJ D;  3LZ1 D;  1KX3 C;  2W8S A;  3AZL B;  3B0B A;  3NQJ B;  5E5A A;  5G49 B;  1P3G D;  1PZR A;  3KXB C;  3AZN A;  4J8W D;  4HGA C;  4H9S C;  5E5A B;  1P3A C;  2YFV A;  1Q9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...