5FUGB

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
90
structure length
90
Chain Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 90
sequence length 90
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2016-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugB00
1P34A 3W97C 3LJAA 3WA9A 5AY8B 3MGRA 3W96C 5AV9D 2NQBC 3AZJC 5AVBC 4NFTA 3RELD 3WTPA 1ID3D 3X1TA 3AV1B 4Z66C 5C3IB 1EQZD 5CP6D 3MGPD 1ZLAD 4Z5TC 3LZ0C 2HIOC 5CPKB 5GT0B 2CV5A 2HUEB 4H9OA 3LJAB 3AZGB 3WA9B 5AV8B 3MGRB 5BNXA 5AY8D 5B33A 5B0ZB 4H9NB 1TZYA 1F66A 3AZIA 5B32B 4QLCC 2F8NA 3REIB 5JA4A 3KXBA 1A7WA 3AZFA 5B24A 5CPKD 3X1SA 5GT0D 4ZUXA 4JJNC 4M6BA 5AV8D 5B0ZD 4E44A 5AVCB 5B2JC 5B32D 1AOIA 1M19A 3B6FA 5CPJB 3AZMC 1P3PC 1M1AB 5DNNB 1KX4C 4KUDB 3TU4A 1BH9A 4XUJC 4J8XA 3REHA 4J8VD 3AZLA 5F99B 1KX5B 3AN2C 1P3LD 4WU9C 4H9PA 1KX3A 1P3OC 5B40A 1P3FB 2NZDC 5AVCD 5BT1D 3MGQD 3B6FB 4G91C 4NE3A 3UTAA 3REJC 5CPJD 3AZEC 1M18B 1M1AD 5B31B 3AZNA 4KUDD 5GXQC 4J8XB 5F99D 1P3GA 4YM6D 3AFAB 5B2IC 3A6NC 4R8PA 3AYWB 1P3AC 3UTBA 1U35A 4H9PB 3UT9C 5B31G 5GT3D 1H3OB 3AZHB 4XZQD 1P3FD 1HQ3A 4J8UD 4J8WA 4H9RB 3REKA 5B31D 5GSUA 3WAAD 5AV5A 3MGSC 3KUYA 3X1VA 1P3GB 3B6GC 5B0YA 3AFAD 4R8PB 1P3BB 3AYWD 3X1UB 2PYOB 1P34C 4DRAA 5E5AB 1R4VA 5DNMD 3O62B 3AZHD 1S32C 4CAYB 2YFWA 5BNVB 5AV9A 3W97D 3WTPC 3REKB 3AZJD 5AV5B 3X1TC 4G92C 3RELA 4WNNA 4ZBJC 1ID3A 1P3IB 2IO5B 3KSYA 3C1BB 1EQZA 1P3MB 5CP6A 3MGPA 1ZLAA 4KGCC 2CV5C 2PYOD 5E5AD 3LZ0D 2HIOD 3O62D 5B33C 1ULYA 5B1MB 1TZYC 3R45B 5AY8A 3NQUB 3AZIC 1F66C 2FJ7B 3C1CB 1JFIB 2AROB 3KXBC 5G49A 3MVDB 5CHLB 3AZFC 5B24C 3C1BD 3MGPB 3AZKB 3X1SC 1P3MD 4ZUXC 3VH5A 3VH5T 2RVQD 4H9QB 4X23B 5CPKA 5GT0A 2L5AA 5CPIB 5B1MD 3AZGA 4CSRB 5AV8A 2FJ7D 3WKJB 5B0ZA 4H9NA 1M19C 1AOIC 3C1CD 2AROD 5B32A 5G49B 3LZ1B 3TU4C 5BS7A 3MVDD 3REHC 3AZLC 3VH6W 3REIA 3W98C 5BO0B 4KHAB 3AZKD 4XUJD 3LELB 3KWQB 4LD9B 2BYMA 4X23D 1KX3C 1P3LA 5CPID 5B40C 3WKJD 5AV6B 3UTAC 5AVCA 4Z2MH 1P3OD 3AZNC 4HGAB 2NZDD 5CPJA 1M1AA 3LZ1D 5DNNA 4KUDA 1P3KC 4J8VB 4AWLB 5GXQD 5F99A 3UTBC 3LELD 2BYMB 3KWQD 1U35C 4LD9D 3B0DB 1P3LB 1KX5A 5B32G 1BFMA 1HQ3C 4J8WC 1P3FA 4XZQA 5AV6D 4WU8B 3MGQB 5GSUC 4YS3B 1M18A 4WV4B 3B0CW 5B31A 3KUYC 3WAAA 5B1LB 3X1VC 5KDMA 5B0YC 4EO5C 4YM6B 3AFAA 3AYWA 3MNNB 3NQJB 5DNMA 1P34D 5GT3B 5AV9C 4XZQB 1H3OA 3AZHA 3VH6T 4J8UB 4WU8D 1S32D 4YS3D 3RELC 4H9RA 3WAAB 1ID3C 5B1LD 5KDMB 1EQZC 3X1TD 5JRGB 1KU5A 5CP6C 1ZLAC 1P3BA 3W99C 3MNND 4NE6A 3X1UA 3AV2C 2PYOA 5E5AA 5DNMB 4KGCD 3O62A 5AY8C 1WWIA 1TAFB 4CAYA 5BNVA 3W97B 3W96B 1F66D 2NQBB 3AZJB 5AVBB 3AV1C 5C3IC 5JRGD 1P3IA 3C1BA 3B0BA 4Z66B 5CPKC 3AZFD 1P3MA 5GT0C 2LY8A 2HUEC 4Z5TB 3LZ0B 2HIOB 3WTPE 3LJAC 5AV8C 3MGRC 3AZGC 3WA9C 5B1MA 5B0ZC 3R45A 2FJ7A 3NQUA 5B32C 3C1CA 3W96D 1JFIA 2NQBD 5BS7C 2AROA 5AVBD 3REIC 3MVDA 3REHD 4Z66D 2CWEA 3AZKA 4XUJA 3W98D 4H9QA 4Z5TD 4X23A 5CPIA 5AVCC 5BT1C 4CSRA 4JJNB 3WKJA 5CPJC 1M1AC 1P3OA 4H9SA 5DNNC 4KUDC 5B2JB 3LZ1A 1KX4B 3AZMB 1P3PB 4QLCD 5F99C 4UUZB 5BO0A 4KHAA 4XUJB 1P3KD 1KX5C 3LELA 3KWQA 4LD9A 5FUGA 1BH8B 3AN2B 1P3FC 4XZQC 4WU9B 4JJND 2F8NH 3B6FC 5AV6A 1P3OB 1M18C 5B31C 2NZDB 5B2JD 4J8XC 4G91B 3AZEB 3REJB 1KX4D 3AZMD 1P3PD 3AFAC 4J8VA 5GXQB 2BYKB 3AYWC 1N1JB 1Q9CA 3V9RA 4E45A 5DNMC 2YFVB 5B2IB 1B6WA 5FUGB 3A6NB 1P3AB 3AZHC 3AN2D 4WU9D 3UT9B 4WU8A 3MGQA 1S32A 4YS3A 3AZED 3REJD 5B1LA 1P3GC 1P3BC 4R8PC 3V9RB 3X1UC 4YM6A 3MGSB 2PYOC 5E5AC 3MNNA 3B6GB 5B2ID 3A6ND 3O62C 3NQJA 3W99D 1P3AD 3AV2D 4DRBA 4KGCA 1P34B 5GT3A 3UT9D 4J8UA 3REKC 1S32B 5AV5C 3WTPB 1P3IC 2IO5C 3C1BC 3X1TB 3AV1D 4G92B 1P3MC 5JRGA 4ZBJB 3MGSD 2RVQC 3B6GD 5B1MC 4KGCB 2CV5B 4H9OB 3VH6A 2FJ7C 3LJAD 3AZGD 1TAFA 5BNXB 5B33B 3MGRD 3C1CC 3WA9D 2AROC 3W97A 1TZYB 1F66B 3W96A 3AZIB 2JSSA 2NQBA 3AZJA 3MVDC 5AVBA 3WTPD 4NE5A 2F8NB 5JA4B 3KXBB 3MGPC 3REID 3AZKC 1B67A 4Z66A 3AZFB 5B24B 4X23C 2F8NK 3W98A 5CPIC 3X1SB 4Z5TA 4ZUXB 2HIOA 3LZ0A 2CV5D 3WKJC 5B33D 4H9SC 2F8NG 1TZYD 3LZ1C 3AZID 1AOIB 1M19B 5DNND 2F8ND 3TU4B 4QLCA 1BH9B 1WWSA 3KXBD 3REHB 3LELC 3AZLB 3KWQC 4LD9C 5B24D 1P3KA 3W98B 3X1SD 1KX5D 4ZUXD 3B0CT 1KX3B 5AV6C 5B40B 4JJNA 4HGAC 4Z2MG 1AOID 3VH5W 3UTAB 4WZSB 1M19D 3B6FD 1M18D 5B2JA 3AZNB 4J8VC 4QLCB 4AWLC 3TU4D 3AZMA 1P3PA 1KX4A 4J8XD 4UUZA 3AZLD 1P3KB 3B0DC 1P3LC 3UTBB 1U35B 1KX3D 1BH8A 3AN2A 5B40D 3MGQC 4WU8C 4WU9A 4YS3C 1HQ3B 4J8WB 3UTAD 2NZDA 5B1LC 3AZND 5GSUB 3AZEA 3REJA 4YM6C 3KUYB 5GXQA 2BYKA 3X1VB 1P3GD 3MNNC 1N1JA 5B0YB 1P3BD 4R8PD 4EO5B 3UTBD 3X1UD 5B2IA 2YFVA 3A6NA 1U35D 5GT3C 3W99A 1P3AA 3AV2A 1HTAA 4J8UC 3UT9A 2YFWB 1HQ3D 4J8WD 5AV9B 3WAAC 3REKD 5GSUD 5AV5D 3RELB 5JRGC 4WNNB 1ID3B 3KUYD 3AV1A 3X1VD 1P3ID 5B0YD 1EQZB 3MGSA 5CP6B 1ZLAB 3B6GA 1F1EA 3W99B 3AV2B
chains in the Genus database with same CATH superfamily
1P34A 3W97C 3LJAA 3WA9A 5AY8B 3MGRA 3W96C 5AV9D 2NQBC 3AZJC 5AVBC 4NFTA 3RELD 3WTPA 1ID3D 3X1TA 3AV1B 4Z66C 5C3IB 1EQZD 2FFFB 5CP6D 3MGPD 2VQRA 4Z5TC 3LZ0C 2HIOC 1ZLAD 5CPKB 5GT0B 2CV5A 2HUEB 4H9OA 3LJAB 3AZGB 3WA9B 5AV8B 3MGRB 5BNXA 5AY8D 5B33A 5B0ZB 4H9NB 1TZYA 1F66A 3AZIA 5B32B 4QLCC 2F8NA 3REIB 5JA4A 3KXBA 1A7WA 3AZFA 5B24A 5CPKD 3X1SA 5GT0D 4ZUXA 4JJNC 4M6BA 5AV8D 5B0ZD 4E44A 5AVCB 5B2JC 5B32D 1AOIA 1M19A 3B6FA 5CPJB 3AZMC 1P3PC 1M1AB 5DNNB 1KX4C 4KUDB 3TU4A 1BH9A 4XUJC 4J8XA 3REHA 4J8VD 3AZLA 5F99B 2Y2GA 1KX5B 3AN2C 1P3LD 4WU9C 4H9PA 1T3UA 1KX3A 1P3OC 5B40A 1P3FB 2NZDC 5AVCD 5BT1D 3MGQD 3B6FB 4G91C 4NE3A 3UTAA 3REJC 5CPJD 3AZEC 1M18B 1M1AD 5B31B 3AZNA 4KUDD 5GXQC 4J8XB 2ZY4A 5F99D 1P3GA 3F6TA 4YM6D 5B2IC 3A6NC 4R8PA 3AFAB 3AYWB 1P3AC 3UTBA 1U35A 4H9PB 3UT9C 5B31G 5GT3D 1H3OB 3AZHB 4XZQD 1P3FD 1HQ3A 4J8UD 4J8WA 4H9RB 3REKA 5B31D 5GSUA 3WAAD 5AV5A 2ZY2A 3MGSC 3KUYA 3X1VA 1P3GB 3B6GC 5B0YA 3AFAD 4R8PB 1P3BB 3AYWD 3X1UB 2PYOB 1P34C 4DRAA 5E5AB 1R4VA 5DNMD 3O62B 3AZHD 1S32C 4CAYB 2YFWA 5BNVB 5AV9A 3W97D 3WTPC 3REKB 3AL0C 3AZJD 5AV5B 3X1TC 4G92C 3RELA 2Y2MA 1PZRA 4WNNA 4ZBJC 1ID3A 2Y2OA 1P3IB 2IO5B 3KSYA 3C1BB 1EQZA 1P3MB 2Y2IA 5CP6A 3MGPA 1ZLAA 4KGCC 2CV5C 2PYOD 2DF4C 5E5AD 3LZ0D 2HIOD 3O62D 5B33C 1ULYA 5B1MB 1TZYC 3R45B 5AY8A 2J8PA 3NQUB 3AZIC 1F66C 2FJ7B 3C1CB 1JFIB 3EPJA 2AROB 3KXBC 2Y2QA 5G49A 3MVDB 5CHLB 3AZFC 5B24C 3C1BD 4DQYB 3MGPB 3AZKB 3X1SC 1P3MD 4ZUXC 3VH5A 3VH5T 2RVQD 4H9QB 4X23B 5CPKA 5GT0A 2L5AA 5CPIB 5B1MD 3AZGA 3EPHA 3H0LC 4CSRB 5AV8A 2FJ7D 3WKJB 5B0ZA 4H9NA 1M19C 1AOIC 3C1CD 2UWXA 2AROD 5B32A 5G49B 3LZ1B 3TU4C 5BS7A 3MVDD 3REHC 3AZLC 3VH6W 4WJ3C 3REIA 3W98C 5BO0B 4KHAB 3AZKD 4XUJD 3LELB 3KWQB 4LD9B 2BYMA 4X23D 1KX3C 1P3LA 5CPID 5B40C 2ZM5A 3WKJD 5AV6B 3UTAC 5AVCA 4Z2MH 1P3OD 2DQNC 3AZNC 4HGAB 2NZDD 5CPJA 1M1AA 3LZ1D 5DNNA 2F2AC 4KUDA 1P3KC 4J8VB 4AWLB 5GXQD 3H0RC 5F99A 3UTBC 3LELD 2BYMB 3KWQD 1U35C 4LD9D 3B0DB 1P3LB 1KX5A 5B32G 1BFMA 1HQ3C 4J8WC 1P3FA 4XZQA 5AV6D 4WU8B 3MGQB 5GSUC 4YS3B 1M18A 4WV4B 3B0CW 5B31A 3KUYC 3WAAA 5B1LB 3X1VC 5KDMA 5B0YC 4EO5C 4YM6B 3AFAA 3AYWA 3MNNB 3NQJB 3IP4C 2G5HC 5DNMA 1P34D 5GT3B 5AV9C 4XZQB 1H3OA 3AZHA 3VH6T 4J8UB 4WU8D 2Y2NA 1S32D 4YS3D 3RELC 4H9RA 3WAAB 1ID3C 5B1LD 5KDMB 1EQZC 3X1TD 5JRGB 1KU5A 5CP6C 1ZLAC 1P3BA 3W99C 3MNND 4NE6A 3X1UA 3AV2C 2PYOA 5E5AA 2JE5A 5DNMB 4KGCD 3O62A 5AY8C 1WWIA 1TAFB 4CAYA 5BNVA 3W97B 3W96B 1F66D 2NQBB 3AZJB 5AVBB 3AV1C 5C3IC 5JRGD 1P3IA 3C1BA 3B0BA 4Z66B 5CPKC 3AZFD 1P3MA 5GT0C 2LY8A 2HUEC 4Z5TB 3LZ0B 2HIOB 3WTPE 3LJAC 5AV8C 3MGRC 3AZGC 3WA9C 5B1MA 5B0ZC 3R45A 2FJ7A 3NQUA 5B32C 3C1CA 3W96D 1JFIA 2NQBD 5BS7C 2AROA 5AVBD 2Y2LA 3REIC 3MVDA 3REHD 4Z66D 2CWEA 3AZKA 4XUJA 3W98D 4H9QA 4Z5TD 4X23A 5CPIA 5AVCC 5BT1C 4CSRA 3FDDA 4JJNB 3WKJA 5CPJC 1M1AC 1P3OA 4H9SA 5DNNC 4KUDC 5B2JB 3LZ1A 2G5IC 3AZMB 1P3PB 4QLCD 5F99C 1KX4B 4UUZB 5BO0A 4KHAA 4XUJB 1P3KD 1KX5C 3LELA 3KWQA 4LD9A 5FUGA 1BH8B 3AN2B 1P3FC 4XZQC 3A1IA 4WU9B 4JJND 2F8NH 3B6FC 5AV6A 1P3OB 1M18C 5B31C 1W2EA 2NZDB 5B2JD 4J8XC 4G91B 3AZEB 3REJB 1KX4D 3AZMD 1P3PD 3AFAC 4J8VA 5GXQB 2BYKB 3AYWC 1N1JB 1Q9CA 3V9RA 4E45A 5DNMC 2YFVB 5B2IB 1B6WA 5FUGB 3A6NB 1P3AB 3AZHC 3AN2D 4WU9D 3UT9B 4WU8A 3MGQA 2BG1A 1S32A 4YS3A 3AZED 3REJD 5B1LA 1P3GC 1P3BC 4R8PC 3V9RB 2W8SA 4YM6A 3X1UC 3MGSB 2PYOC 5E5AC 3MNNA 3B6GB 5B2ID 3A6ND 3O62C 3NQJA 3W99D 1P3AD 3AV2D 4DRBA 4KGCA 1P34B 5GT3A 3UT9D 4J8UA 3REKC 1S32B 5AV5C 3WTPB 1P3IC 2IO5C 3C1BC 3X1TB 3AV1D 4G92B 1P3MC 5JRGA 4ZBJB 3MGSD 2RVQC 3B6GD 5B1MC 4KGCB 2CV5B 3A1KA 4H9OB 3VH6A 2FJ7C 3LJAD 3AZGD 1TAFA 5BNXB 5B33B 3MGRD 3C1CC 3WA9D 2AROC 3W97A 1TZYB 1F66B 3W96A 3AZIB 2JSSA 2NQBA 3AZJA 3MVDC 5AVBA 3WTPD 3EG5B 4NE5A 2F8NB 5JA4B 3KXBB 3MGPC 3REID 3AZKC 1B67A 4Z66A 3AZFB 5B24B 4X23C 2F8NK 3W98A 5CPIC 3X1SB 4Z5TA 4ZUXB 2HIOA 3LZ0A 2CV5D 3WKJC 5B33D 4H9SC 2F8NG 2Y2PA 1TZYD 3LZ1C 3AZID 1AOIB 1M19B 5DNND 2ZY5A 3TU4B 2F8ND 4QLCA 1BH9B 1WWSA 3KXBD 3REHB 3LELC 3AZLB 3KWQC 4LD9C 5B24D 1P3KA 3W98B 2XD1A 3X1SD 1KX5D 4ZUXD 3B0CT 1KX3B 5AV6C 5B40B 3KFUG 4JJNA 4HGAC 4Z2MG 4UPKA 1AOID 3VH5W 3UTAB 4WZSB 1M19D 3B6FD 1M18D 5B2JA 3AZNB 4J8VC 2XD5A 4QLCB 4AWLC 3TU4D 3AZMA 1P3PA 1KX4A 4J8XD 4UUZA 3EPLA 3AZLD 2ZY3A 1P3KB 3B0DC 1P3LC 3P5JB 3UTBB 1U35B 1KX3D 1BH8A 3AN2A 5B40D 3MGQC 4WU8C 4WU9A 4YS3C 1HQ3B 4J8WB 3EPKA 2RIQA 3UTAD 2NZDA 5B1LC 3AZND 5GSUB 3AZEA 3REJA 2JCHA 4YM6C 3KUYB 5GXQA 2BYKA 3X1VB 1P3GD 3MNNC 1N1JA 5B0YB 1P3BD 4R8PD 2Y2KA 4EO5B 3UTBD 3X1UD 5B2IA 2YFVA 3H0MC 3A6NA 1U35D 5GT3C 3W99A 1P3AA 3AV2A 1HTAA 4J8UC 3UT9A 2YFWB 1HQ3D 4J8WD 5AV9B 3WAAC 1Z2CB 3REKD 5GSUD 5AV5D 3RELB 5JRGC 4WNNB 1ID3B 3KUYD 2Y2HA 3AV1A 3X1VD 1P3ID 5B0YD 1EQZB 2Y2JA 3MGSA 5CP6B 1ZLAB 3B6GA 1F1EA 3W99B 3AV2B
chains in the Genus database with same CATH topology
1P34A 3W97C 3LJAA 3WA9A 5AY8B 3MGRA 3W96C 5AV9D 2NQBC 3AZJC 5AVBC 4NFTA 3RELD 3WTPA 1ID3D 3X1TA 3AV1B 4Z66C 5C3IB 1EQZD 2FFFB 5CP6D 3MGPD 2VQRA 4Z5TC 3LZ0C 2HIOC 1ZLAD 5CPKB 5GT0B 2CV5A 2HUEB 4H9OA 3LJAB 3AZGB 3WA9B 5AV8B 3MGRB 5BNXA 5AY8D 5B33A 5B0ZB 4H9NB 1TZYA 1F66A 3AZIA 5B32B 4QLCC 2F8NA 3REIB 5JA4A 3KXBA 1A7WA 3AZFA 5B24A 5CPKD 3X1SA 5GT0D 4ZUXA 4JJNC 4M6BA 5AV8D 5B0ZD 4E44A 5AVCB 5B2JC 5B32D 1AOIA 1M19A 3B6FA 5CPJB 3AZMC 1P3PC 1M1AB 5DNNB 1KX4C 4KUDB 3TU4A 1BH9A 4XUJC 4J8XA 3REHA 4J8VD 3AZLA 5F99B 2Y2GA 1KX5B 3AN2C 1P3LD 4WU9C 4H9PA 1T3UA 1KX3A 1P3OC 5B40A 1P3FB 2NZDC 5AVCD 5BT1D 3MGQD 3B6FB 4G91C 4NE3A 3UTAA 3REJC 5CPJD 3AZEC 1M18B 1M1AD 5B31B 3AZNA 4KUDD 5GXQC 4J8XB 2ZY4A 5F99D 1P3GA 3F6TA 4YM6D 5B2IC 3A6NC 4R8PA 3AFAB 3AYWB 1P3AC 3UTBA 1U35A 4H9PB 3UT9C 5B31G 5GT3D 1H3OB 3AZHB 4XZQD 1P3FD 1HQ3A 4J8UD 4J8WA 4H9RB 3REKA 5B31D 5GSUA 3WAAD 5AV5A 2ZY2A 3MGSC 3KUYA 3X1VA 1P3GB 3B6GC 5B0YA 3AFAD 4R8PB 1P3BB 3AYWD 3X1UB 2PYOB 1P34C 4DRAA 5E5AB 1R4VA 5DNMD 3O62B 3AZHD 1S32C 4CAYB 2YFWA 5BNVB 5AV9A 3W97D 3WTPC 3REKB 3AL0C 3AZJD 5AV5B 3X1TC 4G92C 3RELA 2Y2MA 1PZRA 4WNNA 4ZBJC 1ID3A 2Y2OA 1P3IB 2IO5B 3KSYA 3C1BB 1EQZA 1P3MB 2Y2IA 5CP6A 3MGPA 1ZLAA 4KGCC 2CV5C 2PYOD 2DF4C 5E5AD 3LZ0D 2HIOD 3O62D 5B33C 1ULYA 5B1MB 1TZYC 3R45B 5AY8A 2J8PA 3NQUB 3AZIC 1F66C 2FJ7B 3C1CB 1JFIB 3EPJA 2AROB 3KXBC 2Y2QA 5G49A 3MVDB 5CHLB 3AZFC 5B24C 3C1BD 4DQYB 3MGPB 3AZKB 3X1SC 1P3MD 4ZUXC 3VH5A 3VH5T 2RVQD 4H9QB 4X23B 5CPKA 5GT0A 2L5AA 5CPIB 5B1MD 3AZGA 3EPHA 3H0LC 4CSRB 5AV8A 2FJ7D 3WKJB 5B0ZA 4H9NA 1M19C 1AOIC 3C1CD 2UWXA 2AROD 5B32A 5G49B 3LZ1B 3TU4C 5BS7A 3MVDD 3REHC 3AZLC 3VH6W 4WJ3C 3REIA 3W98C 5BO0B 4KHAB 3AZKD 4XUJD 3LELB 3KWQB 4LD9B 2BYMA 4X23D 1KX3C 1P3LA 5CPID 5B40C 2ZM5A 3WKJD 5AV6B 3UTAC 5AVCA 4Z2MH 1P3OD 2DQNC 3AZNC 4HGAB 2NZDD 5CPJA 1M1AA 3LZ1D 5DNNA 2F2AC 4KUDA 1P3KC 4J8VB 4AWLB 5GXQD 3H0RC 5F99A 3UTBC 3LELD 2BYMB 3KWQD 1U35C 4LD9D 3B0DB 1P3LB 1KX5A 5B32G 1BFMA 1HQ3C 4J8WC 1P3FA 4XZQA 5AV6D 4WU8B 3MGQB 5GSUC 4YS3B 1M18A 4WV4B 3B0CW 5B31A 3KUYC 3WAAA 5B1LB 3X1VC 5KDMA 5B0YC 4EO5C 4YM6B 3AFAA 3AYWA 3MNNB 3NQJB 3IP4C 2G5HC 5DNMA 1P34D 5GT3B 5AV9C 4XZQB 1H3OA 3AZHA 3VH6T 4J8UB 4WU8D 2Y2NA 1S32D 4YS3D 3RELC 4H9RA 3WAAB 1ID3C 5B1LD 5KDMB 1EQZC 3X1TD 5JRGB 1KU5A 5CP6C 1ZLAC 1P3BA 3W99C 3MNND 4NE6A 3X1UA 3AV2C 2PYOA 5E5AA 2JE5A 5DNMB 4KGCD 3O62A 5AY8C 1WWIA 1TAFB 4CAYA 5BNVA 3W97B 3W96B 1F66D 2NQBB 3AZJB 5AVBB 3AV1C 5C3IC 5JRGD 1P3IA 3C1BA 3B0BA 4Z66B 5CPKC 3AZFD 1P3MA 5GT0C 2LY8A 2HUEC 4Z5TB 3LZ0B 2HIOB 3WTPE 3LJAC 5AV8C 3MGRC 3AZGC 3WA9C 5B1MA 5B0ZC 3R45A 2FJ7A 3NQUA 5B32C 3C1CA 3W96D 1JFIA 2NQBD 5BS7C 2AROA 5AVBD 2Y2LA 3REIC 3MVDA 3REHD 4Z66D 2CWEA 3AZKA 4XUJA 3W98D 4H9QA 4Z5TD 4X23A 5CPIA 5AVCC 5BT1C 4CSRA 3FDDA 4JJNB 3WKJA 5CPJC 1M1AC 1P3OA 4H9SA 5DNNC 4KUDC 5B2JB 3LZ1A 2G5IC 3AZMB 1P3PB 4QLCD 5F99C 1KX4B 4UUZB 5BO0A 4KHAA 4XUJB 1P3KD 1KX5C 3LELA 3KWQA 4LD9A 5FUGA 1BH8B 3AN2B 1P3FC 4XZQC 3A1IA 4WU9B 4JJND 2F8NH 3B6FC 5AV6A 1P3OB 1M18C 5B31C 1W2EA 2NZDB 5B2JD 4J8XC 4G91B 3AZEB 3REJB 1KX4D 3AZMD 1P3PD 3AFAC 4J8VA 5GXQB 2BYKB 3AYWC 1N1JB 1Q9CA 3V9RA 4E45A 5DNMC 2YFVB 5B2IB 1B6WA 5FUGB 3A6NB 1P3AB 3AZHC 3AN2D 4WU9D 3UT9B 4WU8A 3MGQA 2BG1A 1S32A 4YS3A 3AZED 3REJD 5B1LA 1P3GC 1P3BC 4R8PC 3V9RB 2W8SA 4YM6A 3X1UC 3MGSB 2PYOC 5E5AC 3MNNA 3B6GB 5B2ID 3A6ND 3O62C 3NQJA 3W99D 1P3AD 3AV2D 4DRBA 4KGCA 1P34B 5GT3A 3UT9D 4J8UA 3REKC 1S32B 5AV5C 3WTPB 1P3IC 2IO5C 3C1BC 3X1TB 3AV1D 4G92B 1P3MC 5JRGA 4ZBJB 3MGSD 2RVQC 3B6GD 5B1MC 4KGCB 2CV5B 3A1KA 4H9OB 3VH6A 2FJ7C 3LJAD 3AZGD 1TAFA 5BNXB 5B33B 3MGRD 3C1CC 3WA9D 2AROC 3W97A 1TZYB 1F66B 3W96A 3AZIB 2JSSA 2NQBA 3AZJA 3MVDC 5AVBA 3WTPD 3EG5B 4NE5A 2F8NB 5JA4B 3KXBB 3MGPC 3REID 3AZKC 1B67A 4Z66A 3AZFB 5B24B 4X23C 2F8NK 3W98A 5CPIC 3X1SB 4Z5TA 4ZUXB 2HIOA 3LZ0A 2CV5D 3WKJC 5B33D 4H9SC 2F8NG 2Y2PA 1TZYD 3LZ1C 3AZID 1AOIB 1M19B 5DNND 2ZY5A 3TU4B 2F8ND 4QLCA 1BH9B 1WWSA 3KXBD 3REHB 3LELC 3AZLB 3KWQC 4LD9C 5B24D 1P3KA 3W98B 2XD1A 3X1SD 1KX5D 4ZUXD 3B0CT 1KX3B 5AV6C 5B40B 3KFUG 4JJNA 4HGAC 4Z2MG 4UPKA 1AOID 3VH5W 3UTAB 4WZSB 1M19D 3B6FD 1M18D 5B2JA 3AZNB 4J8VC 2XD5A 4QLCB 4AWLC 3TU4D 3AZMA 1P3PA 1KX4A 4J8XD 4UUZA 3EPLA 3AZLD 2ZY3A 1P3KB 3B0DC 1P3LC 3P5JB 3UTBB 1U35B 1KX3D 1BH8A 3AN2A 5B40D 3MGQC 4WU8C 4WU9A 4YS3C 1HQ3B 4J8WB 3EPKA 2RIQA 3UTAD 2NZDA 5B1LC 3AZND 5GSUB 3AZEA 3REJA 2JCHA 4YM6C 3KUYB 5GXQA 2BYKA 3X1VB 1P3GD 3MNNC 1N1JA 5B0YB 1P3BD 4R8PD 2Y2KA 4EO5B 3UTBD 3X1UD 5B2IA 2YFVA 3H0MC 3A6NA 1U35D 5GT3C 3W99A 1P3AA 3AV2A 1HTAA 4J8UC 3UT9A 2YFWB 1HQ3D 4J8WD 5AV9B 3WAAC 1Z2CB 3REKD 5GSUD 5AV5D 3RELB 5JRGC 4WNNB 1ID3B 3KUYD 2Y2HA 3AV1A 3X1VD 1P3ID 5B0YD 1EQZB 2Y2JA 3MGSA 5CP6B 1ZLAB 3B6GA 1F1EA 3W99B 3AV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 A;  3W97 C;  3LJA A;  3WA9 A;  5AY8 B;  3MGR A;  3W96 C;  5AV9 D;  2NQB C;  3AZJ C;  5AVB C;  4NFT A;  3REL D;  3WTP A;  1ID3 D;  3X1T A;  3AV1 B;  4Z66 C;  5C3I B;  1EQZ D;  5CP6 D;  3MGP D;  1ZLA D;  4Z5T C;  3LZ0 C;  2HIO C;  5CPK B;  5GT0 B;  2CV5 A;  2HUE B;  4H9O A;  3LJA B;  3AZG B;  3WA9 B;  5AV8 B;  3MGR B;  5BNX A;  5AY8 D;  5B33 A;  5B0Z B;  4H9N B;  1TZY A;  1F66 A;  3AZI A;  5B32 B;  4QLC C;  2F8N A;  3REI B;  5JA4 A;  3KXB A;  1A7W A;  3AZF A;  5B24 A;  5CPK D;  3X1S A;  5GT0 D;  4ZUX A;  4JJN C;  4M6B A;  5AV8 D;  5B0Z D;  4E44 A;  5AVC B;  5B2J C;  5B32 D;  1AOI A;  1M19 A;  3B6F A;  5CPJ B;  3AZM C;  1P3P C;  1M1A B;  5DNN B;  1KX4 C;  4KUD B;  3TU4 A;  1BH9 A;  4XUJ C;  4J8X A;  3REH A;  4J8V D;  3AZL A;  5F99 B;  1KX5 B;  3AN2 C;  1P3L D;  4WU9 C;  4H9P A;  1KX3 A;  1P3O C;  5B40 A;  1P3F B;  2NZD C;  5AVC D;  5BT1 D;  3MGQ D;  3B6F B;  4G91 C;  4NE3 A;  3UTA A;  3REJ C;  5CPJ D;  3AZE C;  1M18 B;  1M1A D;  5B31 B;  3AZN A;  4KUD D;  5GXQ C;  4J8X B;  5F99 D;  1P3G A;  4YM6 D;  3AFA B;  5B2I C;  3A6N C;  4R8P A;  3AYW B;  1P3A C;  3UTB A;  1U35 A;  4H9P B;  3UT9 C;  5B31 G;  5GT3 D;  1H3O B;  3AZH B;  4XZQ D;  1P3F D;  1HQ3 A;  4J8U D;  4J8W A;  4H9R B;  3REK A;  5B31 D;  5GSU A;  3WAA D;  5AV5 A;  3MGS C;  3KUY A;  3X1V A;  1P3G B;  3B6G C;  5B0Y A;  3AFA D;  4R8P B;  1P3B B;  3AYW D;  3X1U B;  2PYO B;  1P34 C;  4DRA A;  5E5A B;  1R4V A;  5DNM D;  3O62 B;  3AZH D;  1S32 C;  4CAY B;  2YFW A;  5BNV B;  5AV9 A;  3W97 D;  3WTP C;  3REK B;  3AZJ D;  5AV5 B;  3X1T C;  4G92 C;  3REL A;  4WNN A;  4ZBJ C;  1ID3 A;  1P3I B;  2IO5 B;  3KSY A;  3C1B B;  1EQZ A;  1P3M B;  5CP6 A;  3MGP A;  1ZLA A;  4KGC C;  2CV5 C;  2PYO D;  5E5A D;  3LZ0 D;  2HIO D;  3O62 D;  5B33 C;  1ULY A;  5B1M B;  1TZY C;  3R45 B;  5AY8 A;  3NQU B;  3AZI C;  1F66 C;  2FJ7 B;  3C1C B;  1JFI B;  2ARO B;  3KXB C;  5G49 A;  3MVD B;  5CHL B;  3AZF C;  5B24 C;  3C1B D;  3MGP B;  3AZK B;  3X1S C;  1P3M D;  4ZUX C;  3VH5 A;  3VH5 T;  2RVQ D;  4H9Q B;  4X23 B;  5CPK A;  5GT0 A;  2L5A A;  5CPI B;  5B1M D;  3AZG A;  4CSR B;  5AV8 A;  2FJ7 D;  3WKJ B;  5B0Z A;  4H9N A;  1M19 C;  1AOI C;  3C1C D;  2ARO D;  5B32 A;  5G49 B;  3LZ1 B;  3TU4 C;  5BS7 A;  3MVD D;  3REH C;  3AZL C;  3VH6 W;  3REI A;  3W98 C;  5BO0 B;  4KHA B;  3AZK D;  4XUJ D;  3LEL B;  3KWQ B;  4LD9 B;  2BYM A;  4X23 D;  1KX3 C;  1P3L A;  5CPI D;  5B40 C;  3WKJ D;  5AV6 B;  3UTA C;  5AVC A;  4Z2M H;  1P3O D;  3AZN C;  4HGA B;  2NZD D;  5CPJ A;  1M1A A;  3LZ1 D;  5DNN A;  4KUD A;  1P3K C;  4J8V B;  4AWL B;  5GXQ D;  5F99 A;  3UTB C;  3LEL D;  2BYM B;  3KWQ D;  1U35 C;  4LD9 D;  3B0D B;  1P3L B;  1KX5 A;  5B32 G;  1BFM A;  1HQ3 C;  4J8W C;  1P3F A;  4XZQ A;  5AV6 D;  4WU8 B;  3MGQ B;  5GSU C;  4YS3 B;  1M18 A;  4WV4 B;  3B0C W;  5B31 A;  3KUY C;  3WAA A;  5B1L B;  3X1V C;  5KDM A;  5B0Y C;  4EO5 C;  4YM6 B;  3AFA A;  3AYW A;  3MNN B;  3NQJ B;  5DNM A;  1P34 D;  5GT3 B;  5AV9 C;  4XZQ B;  1H3O A;  3AZH A;  3VH6 T;  4J8U B;  4WU8 D;  1S32 D;  4YS3 D;  3REL C;  4H9R A;  3WAA B;  1ID3 C;  5B1L D;  5KDM B;  1EQZ C;  3X1T D;  5JRG B;  1KU5 A;  5CP6 C;  1ZLA C;  1P3B A;  3W99 C;  3MNN D;  4NE6 A;  3X1U A;  3AV2 C;  2PYO A;  5E5A A;  5DNM B;  4KGC D;  3O62 A;  5AY8 C;  1WWI A;  1TAF B;  4CAY A;  5BNV A;  3W97 B;  3W96 B;  1F66 D;  2NQB B;  3AZJ B;  5AVB B;  3AV1 C;  5C3I C;  5JRG D;  1P3I A;  3C1B A;  3B0B A;  4Z66 B;  5CPK C;  3AZF D;  1P3M A;  5GT0 C;  2LY8 A;  2HUE C;  4Z5T B;  3LZ0 B;  2HIO B;  3WTP E;  3LJA C;  5AV8 C;  3MGR C;  3AZG C;  3WA9 C;  5B1M A;  5B0Z C;  3R45 A;  2FJ7 A;  3NQU A;  5B32 C;  3C1C A;  3W96 D;  1JFI A;  2NQB D;  5BS7 C;  2ARO A;  5AVB D;  3REI C;  3MVD A;  3REH D;  4Z66 D;  2CWE A;  3AZK A;  4XUJ A;  3W98 D;  4H9Q A;  4Z5T D;  4X23 A;  5CPI A;  5AVC C;  5BT1 C;  4CSR A;  4JJN B;  3WKJ A;  5CPJ C;  1M1A C;  1P3O A;  4H9S A;  5DNN C;  4KUD C;  5B2J B;  3LZ1 A;  1KX4 B;  3AZM B;  1P3P B;  4QLC D;  5F99 C;  4UUZ B;  5BO0 A;  4KHA A;  4XUJ B;  1P3K D;  1KX5 C;  3LEL A;  3KWQ A;  4LD9 A;  5FUG A;  1BH8 B;  3AN2 B;  1P3F C;  4XZQ C;  4WU9 B;  4JJN D;  2F8N H;  3B6F C;  5AV6 A;  1P3O B;  1M18 C;  5B31 C;  2NZD B;  5B2J D;  4J8X C;  4G91 B;  3AZE B;  3REJ B;  1KX4 D;  3AZM D;  1P3P D;  3AFA C;  4J8V A;  5GXQ B;  2BYK B;  3AYW C;  1N1J B;  1Q9C A;  3V9R A;  4E45 A;  5DNM C;  2YFV B;  5B2I B;  1B6W A;  5FUG B;  3A6N B;  1P3A B;  3AZH C;  3AN2 D;  4WU9 D;  3UT9 B;  4WU8 A;  3MGQ A;  1S32 A;  4YS3 A;  3AZE D;  3REJ D;  5B1L A;  1P3G C;  1P3B C;  4R8P C;  3V9R B;  3X1U C;  4YM6 A;  3MGS B;  2PYO C;  5E5A C;  3MNN A;  3B6G B;  5B2I D;  3A6N D;  3O62 C;  3NQJ A;  3W99 D;  1P3A D;  3AV2 D;  4DRB A;  4KGC A;  1P34 B;  5GT3 A;  3UT9 D;  4J8U A;  3REK C;  1S32 B;  5AV5 C;  3WTP B;  1P3I C;  2IO5 C;  3C1B C;  3X1T B;  3AV1 D;  4G92 B;  1P3M C;  5JRG A;  4ZBJ B;  3MGS D;  2RVQ C;  3B6G D;  5B1M C;  4KGC B;  2CV5 B;  4H9O B;  3VH6 A;  2FJ7 C;  3LJA D;  3AZG D;  1TAF A;  5BNX B;  5B33 B;  3MGR D;  3C1C C;  3WA9 D;  2ARO C;  3W97 A;  1TZY B;  1F66 B;  3W96 A;  3AZI B;  2JSS A;  2NQB A;  3AZJ A;  3MVD C;  5AVB A;  3WTP D;  4NE5 A;  2F8N B;  5JA4 B;  3KXB B;  3MGP C;  3REI D;  3AZK C;  1B67 A;  4Z66 A;  3AZF B;  5B24 B;  4X23 C;  2F8N K;  3W98 A;  5CPI C;  3X1S B;  4Z5T A;  4ZUX B;  2HIO A;  3LZ0 A;  2CV5 D;  3WKJ C;  5B33 D;  4H9S C;  2F8N G;  1TZY D;  3LZ1 C;  3AZI D;  1AOI B;  1M19 B;  5DNN D;  2F8N D;  3TU4 B;  4QLC A;  1BH9 B;  1WWS A;  3KXB D;  3REH B;  3LEL C;  3AZL B;  3KWQ C;  4LD9 C;  5B24 D;  1P3K A;  3W98 B;  3X1S D;  1KX5 D;  4ZUX D;  3B0C T;  1KX3 B;  5AV6 C;  5B40 B;  4JJN A;  4HGA C;  4Z2M G;  1AOI D;  3VH5 W;  3UTA B;  4WZS B;  1M19 D;  3B6F D;  1M18 D;  5B2J A;  3AZN B;  4J8V C;  4QLC B;  4AWL C;  3TU4 D;  3AZM A;  1P3P A;  1KX4 A;  4J8X D;  4UUZ A;  3AZL D;  1P3K B;  3B0D C;  1P3L C;  3UTB B;  1U35 B;  1KX3 D;  1BH8 A;  3AN2 A;  5B40 D;  3MGQ C;  4WU8 C;  4WU9 A;  4YS3 C;  1HQ3 B;  4J8W B;  3UTA D;  2NZD A;  5B1L C;  3AZN D;  5GSU B;  3AZE A;  3REJ A;  4YM6 C;  3KUY B;  5GXQ A;  2BYK A;  3X1V B;  1P3G D;  3MNN C;  1N1J A;  5B0Y B;  1P3B D;  4R8P D;  4EO5 B;  3UTB D;  3X1U D;  5B2I A;  2YFV A;  3A6N A;  1U35 D;  5GT3 C;  3W99 A;  1P3A A;  3AV2 A;  1HTA A;  4J8U C;  3UT9 A;  2YFW B;  1HQ3 D;  4J8W D;  5AV9 B;  3WAA C;  3REK D;  5GSU D;  5AV5 D;  3REL B;  5JRG C;  4WNN B;  1ID3 B;  3KUY D;  3AV1 A;  3X1V D;  1P3I D;  5B0Y D;  1EQZ B;  3MGS A;  5CP6 B;  1ZLA B;  3B6G A;  1F1E A;  3W99 B;  3AV2 B; 
#chains in the Genus database with same CATH topology
 1P34 A;  3W97 C;  3LJA A;  3WA9 A;  5AY8 B;  3MGR A;  3W96 C;  5AV9 D;  2NQB C;  3AZJ C;  5AVB C;  4NFT A;  3REL D;  3WTP A;  1ID3 D;  3X1T A;  3AV1 B;  4Z66 C;  5C3I B;  1EQZ D;  2FFF B;  5CP6 D;  3MGP D;  2VQR A;  4Z5T C;  3LZ0 C;  2HIO C;  1ZLA D;  5CPK B;  5GT0 B;  2CV5 A;  2HUE B;  4H9O A;  3LJA B;  3AZG B;  3WA9 B;  5AV8 B;  3MGR B;  5BNX A;  5AY8 D;  5B33 A;  5B0Z B;  4H9N B;  1TZY A;  1F66 A;  3AZI A;  5B32 B;  4QLC C;  2F8N A;  3REI B;  5JA4 A;  3KXB A;  1A7W A;  3AZF A;  5B24 A;  5CPK D;  3X1S A;  5GT0 D;  4ZUX A;  4JJN C;  4M6B A;  5AV8 D;  5B0Z D;  4E44 A;  5AVC B;  5B2J C;  5B32 D;  1AOI A;  1M19 A;  3B6F A;  5CPJ B;  3AZM C;  1P3P C;  1M1A B;  5DNN B;  1KX4 C;  4KUD B;  3TU4 A;  1BH9 A;  4XUJ C;  4J8X A;  3REH A;  4J8V D;  3AZL A;  5F99 B;  2Y2G A;  1KX5 B;  3AN2 C;  1P3L D;  4WU9 C;  4H9P A;  1T3U A;  1KX3 A;  1P3O C;  5B40 A;  1P3F B;  2NZD C;  5AVC D;  5BT1 D;  3MGQ D;  3B6F B;  4G91 C;  4NE3 A;  3UTA A;  3REJ C;  5CPJ D;  3AZE C;  1M18 B;  1M1A D;  5B31 B;  3AZN A;  4KUD D;  5GXQ C;  4J8X B;  2ZY4 A;  5F99 D;  1P3G A;  3F6T A;  4YM6 D;  5B2I C;  3A6N C;  4R8P A;  3AFA B;  3AYW B;  1P3A C;  3UTB A;  1U35 A;  4H9P B;  3UT9 C;  5B31 G;  5GT3 D;  1H3O B;  3AZH B;  4XZQ D;  1P3F D;  1HQ3 A;  4J8U D;  4J8W A;  4H9R B;  3REK A;  5B31 D;  5GSU A;  3WAA D;  5AV5 A;  2ZY2 A;  3MGS C;  3KUY A;  3X1V A;  1P3G B;  3B6G C;  5B0Y A;  3AFA D;  4R8P B;  1P3B B;  3AYW D;  3X1U B;  2PYO B;  1P34 C;  4DRA A;  5E5A B;  1R4V A;  5DNM D;  3O62 B;  3AZH D;  1S32 C;  4CAY B;  2YFW A;  5BNV B;  5AV9 A;  3W97 D;  3WTP C;  3REK B;  3AL0 C;  3AZJ D;  5AV5 B;  3X1T C;  4G92 C;  3REL A;  2Y2M A;  1PZR A;  4WNN A;  4ZBJ C;  1ID3 A;  2Y2O A;  1P3I B;  2IO5 B;  3KSY A;  3C1B B;  1EQZ A;  1P3M B;  2Y2I A;  5CP6 A;  3MGP A;  1ZLA A;  4KGC C;  2CV5 C;  2PYO D;  2DF4 C;  5E5A D;  3LZ0 D;  2HIO D;  3O62 D;  5B33 C;  1ULY A;  5B1M B;  1TZY C;  3R45 B;  5AY8 A;  2J8P A;  3NQU B;  3AZI C;  1F66 C;  2FJ7 B;  3C1C B;  1JFI B;  3EPJ A;  2ARO B;  3KXB C;  2Y2Q A;  5G49 A;  3MVD B;  5CHL B;  3AZF C;  5B24 C;  3C1B D;  4DQY B;  3MGP B;  3AZK B;  3X1S C;  1P3M D;  4ZUX C;  3VH5 A;  3VH5 T;  2RVQ D;  4H9Q B;  4X23 B;  5CPK A;  5GT0 A;  2L5A A;  5CPI B;  5B1M D;  3AZG A;  3EPH A;  3H0L C;  4CSR B;  5AV8 A;  2FJ7 D;  3WKJ B;  5B0Z A;  4H9N A;  1M19 C;  1AOI C;  3C1C D;  2UWX A;  2ARO D;  5B32 A;  5G49 B;  3LZ1 B;  3TU4 C;  5BS7 A;  3MVD D;  3REH C;  3AZL C;  3VH6 W;  4WJ3 C;  3REI A;  3W98 C;  5BO0 B;  4KHA B;  3AZK D;  4XUJ D;  3LEL B;  3KWQ B;  4LD9 B;  2BYM A;  4X23 D;  1KX3 C;  1P3L A;  5CPI D;  5B40 C;  2ZM5 A;  3WKJ D;  5AV6 B;  3UTA C;  5AVC A;  4Z2M H;  1P3O D;  2DQN C;  3AZN C;  4HGA B;  2NZD D;  5CPJ A;  1M1A A;  3LZ1 D;  5DNN A;  2F2A C;  4KUD A;  1P3K C;  4J8V B;  4AWL B;  5GXQ D;  3H0R C;  5F99 A;  3UTB C;  3LEL D;  2BYM B;  3KWQ D;  1U35 C;  4LD9 D;  3B0D B;  1P3L B;  1KX5 A;  5B32 G;  1BFM A;  1HQ3 C;  4J8W C;  1P3F A;  4XZQ A;  5AV6 D;  4WU8 B;  3MGQ B;  5GSU C;  4YS3 B;  1M18 A;  4WV4 B;  3B0C W;  5B31 A;  3KUY C;  3WAA A;  5B1L B;  3X1V C;  5KDM A;  5B0Y C;  4EO5 C;  4YM6 B;  3AFA A;  3AYW A;  3MNN B;  3NQJ B;  3IP4 C;  2G5H C;  5DNM A;  1P34 D;  5GT3 B;  5AV9 C;  4XZQ B;  1H3O A;  3AZH A;  3VH6 T;  4J8U B;  4WU8 D;  2Y2N A;  1S32 D;  4YS3 D;  3REL C;  4H9R A;  3WAA B;  1ID3 C;  5B1L D;  5KDM B;  1EQZ C;  3X1T D;  5JRG B;  1KU5 A;  5CP6 C;  1ZLA C;  1P3B A;  3W99 C;  3MNN D;  4NE6 A;  3X1U A;  3AV2 C;  2PYO A;  5E5A A;  2JE5 A;  5DNM B;  4KGC D;  3O62 A;  5AY8 C;  1WWI A;  1TAF B;  4CAY A;  5BNV A;  3W97 B;  3W96 B;  1F66 D;  2NQB B;  3AZJ B;  5AVB B;  3AV1 C;  5C3I C;  5JRG D;  1P3I A;  3C1B A;  3B0B A;  4Z66 B;  5CPK C;  3AZF D;  1P3M A;  5GT0 C;  2LY8 A;  2HUE C;  4Z5T B;  3LZ0 B;  2HIO B;  3WTP E;  3LJA C;  5AV8 C;  3MGR C;  3AZG C;  3WA9 C;  5B1M A;  5B0Z C;  3R45 A;  2FJ7 A;  3NQU A;  5B32 C;  3C1C A;  3W96 D;  1JFI A;  2NQB D;  5BS7 C;  2ARO A;  5AVB D;  2Y2L A;  3REI C;  3MVD A;  3REH D;  4Z66 D;  2CWE A;  3AZK A;  4XUJ A;  3W98 D;  4H9Q A;  4Z5T D;  4X23 A;  5CPI A;  5AVC C;  5BT1 C;  4CSR A;  3FDD A;  4JJN B;  3WKJ A;  5CPJ C;  1M1A C;  1P3O A;  4H9S A;  5DNN C;  4KUD C;  5B2J B;  3LZ1 A;  2G5I C;  3AZM B;  1P3P B;  4QLC D;  5F99 C;  1KX4 B;  4UUZ B;  5BO0 A;  4KHA A;  4XUJ B;  1P3K D;  1KX5 C;  3LEL A;  3KWQ A;  4LD9 A;  5FUG A;  1BH8 B;  3AN2 B;  1P3F C;  4XZQ C;  3A1I A;  4WU9 B;  4JJN D;  2F8N H;  3B6F C;  5AV6 A;  1P3O B;  1M18 C;  5B31 C;  1W2E A;  2NZD B;  5B2J D;  4J8X C;  4G91 B;  3AZE B;  3REJ B;  1KX4 D;  3AZM D;  1P3P D;  3AFA C;  4J8V A;  5GXQ B;  2BYK B;  3AYW C;  1N1J B;  1Q9C A;  3V9R A;  4E45 A;  5DNM C;  2YFV B;  5B2I B;  1B6W A;  5FUG B;  3A6N B;  1P3A B;  3AZH C;  3AN2 D;  4WU9 D;  3UT9 B;  4WU8 A;  3MGQ A;  2BG1 A;  1S32 A;  4YS3 A;  3AZE D;  3REJ D;  5B1L A;  1P3G C;  1P3B C;  4R8P C;  3V9R B;  2W8S A;  4YM6 A;  3X1U C;  3MGS B;  2PYO C;  5E5A C;  3MNN A;  3B6G B;  5B2I D;  3A6N D;  3O62 C;  3NQJ A;  3W99 D;  1P3A D;  3AV2 D;  4DRB A;  4KGC A;  1P34 B;  5GT3 A;  3UT9 D;  4J8U A;  3REK C;  1S32 B;  5AV5 C;  3WTP B;  1P3I C;  2IO5 C;  3C1B C;  3X1T B;  3AV1 D;  4G92 B;  1P3M C;  5JRG A;  4ZBJ B;  3MGS D;  2RVQ C;  3B6G D;  5B1M C;  4KGC B;  2CV5 B;  3A1K A;  4H9O B;  3VH6 A;  2FJ7 C;  3LJA D;  3AZG D;  1TAF A;  5BNX B;  5B33 B;  3MGR D;  3C1C C;  3WA9 D;  2ARO C;  3W97 A;  1TZY B;  1F66 B;  3W96 A;  3AZI B;  2JSS A;  2NQB A;  3AZJ A;  3MVD C;  5AVB A;  3WTP D;  3EG5 B;  4NE5 A;  2F8N B;  5JA4 B;  3KXB B;  3MGP C;  3REI D;  3AZK C;  1B67 A;  4Z66 A;  3AZF B;  5B24 B;  4X23 C;  2F8N K;  3W98 A;  5CPI C;  3X1S B;  4Z5T A;  4ZUX B;  2HIO A;  3LZ0 A;  2CV5 D;  3WKJ C;  5B33 D;  4H9S C;  2F8N G;  2Y2P A;  1TZY D;  3LZ1 C;  3AZI D;  1AOI B;  1M19 B;  5DNN D;  2ZY5 A;  3TU4 B;  2F8N D;  4QLC A;  1BH9 B;  1WWS A;  3KXB D;  3REH B;  3LEL C;  3AZL B;  3KWQ C;  4LD9 C;  5B24 D;  1P3K A;  3W98 B;  2XD1 A;  3X1S D;  1KX5 D;  4ZUX D;  3B0C T;  1KX3 B;  5AV6 C;  5B40 B;  3KFU G;  4JJN A;  4HGA C;  4Z2M G;  4UPK A;  1AOI D;  3VH5 W;  3UTA B;  4WZS B;  1M19 D;  3B6F D;  1M18 D;  5B2J A;  3AZN B;  4J8V C;  2XD5 A;  4QLC B;  4AWL C;  3TU4 D;  3AZM A;  1P3P A;  1KX4 A;  4J8X D;  4UUZ A;  3EPL A;  3AZL D;  2ZY3 A;  1P3K B;  3B0D C;  1P3L C;  3P5J B;  3UTB B;  1U35 B;  1KX3 D;  1BH8 A;  3AN2 A;  5B40 D;  3MGQ C;  4WU8 C;  4WU9 A;  4YS3 C;  1HQ3 B;  4J8W B;  3EPK A;  2RIQ A;  3UTA D;  2NZD A;  5B1L C;  3AZN D;  5GSU B;  3AZE A;  3REJ A;  2JCH A;  4YM6 C;  3KUY B;  5GXQ A;  2BYK A;  3X1V B;  1P3G D;  3MNN C;  1N1J A;  5B0Y B;  1P3B D;  4R8P D;  2Y2K A;  4EO5 B;  3UTB D;  3X1U D;  5B2I A;  2YFV A;  3H0M C;  3A6N A;  1U35 D;  5GT3 C;  3W99 A;  1P3A A;  3AV2 A;  1HTA A;  4J8U C;  3UT9 A;  2YFW B;  1HQ3 D;  4J8W D;  5AV9 B;  3WAA C;  1Z2C B;  3REK D;  5GSU D;  5AV5 D;  3REL B;  5JRG C;  4WNN B;  1ID3 B;  3KUY D;  2Y2H A;  3AV1 A;  3X1V D;  1P3I D;  5B0Y D;  1EQZ B;  2Y2J A;  3MGS A;  5CP6 B;  1ZLA B;  3B6G A;  1F1E A;  3W99 B;  3AV2 B; 
#chains in the Genus database with same CATH homology
 1P34 A;  3W97 C;  3LJA A;  3WA9 A;  5AY8 B;  3MGR A;  3W96 C;  5AV9 D;  2NQB C;  3AZJ C;  5AVB C;  4NFT A;  3REL D;  3WTP A;  1ID3 D;  3X1T A;  3AV1 B;  4Z66 C;  5C3I B;  1EQZ D;  2FFF B;  5CP6 D;  3MGP D;  2VQR A;  4Z5T C;  3LZ0 C;  2HIO C;  1ZLA D;  5CPK B;  5GT0 B;  2CV5 A;  2HUE B;  4H9O A;  3LJA B;  3AZG B;  3WA9 B;  5AV8 B;  3MGR B;  5BNX A;  5AY8 D;  5B33 A;  5B0Z B;  4H9N B;  1TZY A;  1F66 A;  3AZI A;  5B32 B;  4QLC C;  2F8N A;  3REI B;  5JA4 A;  3KXB A;  1A7W A;  3AZF A;  5B24 A;  5CPK D;  3X1S A;  5GT0 D;  4ZUX A;  4JJN C;  4M6B A;  5AV8 D;  5B0Z D;  4E44 A;  5AVC B;  5B2J C;  5B32 D;  1AOI A;  1M19 A;  3B6F A;  5CPJ B;  3AZM C;  1P3P C;  1M1A B;  5DNN B;  1KX4 C;  4KUD B;  3TU4 A;  1BH9 A;  4XUJ C;  4J8X A;  3REH A;  4J8V D;  3AZL A;  5F99 B;  2Y2G A;  1KX5 B;  3AN2 C;  1P3L D;  4WU9 C;  4H9P A;  1T3U A;  1KX3 A;  1P3O C;  5B40 A;  1P3F B;  2NZD C;  5AVC D;  5BT1 D;  3MGQ D;  3B6F B;  4G91 C;  4NE3 A;  3UTA A;  3REJ C;  5CPJ D;  3AZE C;  1M18 B;  1M1A D;  5B31 B;  3AZN A;  4KUD D;  5GXQ C;  4J8X B;  2ZY4 A;  5F99 D;  1P3G A;  3F6T A;  4YM6 D;  5B2I C;  3A6N C;  4R8P A;  3AFA B;  3AYW B;  1P3A C;  3UTB A;  1U35 A;  4H9P B;  3UT9 C;  5B31 G;  5GT3 D;  1H3O B;  3AZH B;  4XZQ D;  1P3F D;  1HQ3 A;  4J8U D;  4J8W A;  4H9R B;  3REK A;  5B31 D;  5GSU A;  3WAA D;  5AV5 A;  2ZY2 A;  3MGS C;  3KUY A;  3X1V A;  1P3G B;  3B6G C;  5B0Y A;  3AFA D;  4R8P B;  1P3B B;  3AYW D;  3X1U B;  2PYO B;  1P34 C;  4DRA A;  5E5A B;  1R4V A;  5DNM D;  3O62 B;  3AZH D;  1S32 C;  4CAY B;  2YFW A;  5BNV B;  5AV9 A;  3W97 D;  3WTP C;  3REK B;  3AL0 C;  3AZJ D;  5AV5 B;  3X1T C;  4G92 C;  3REL A;  2Y2M A;  1PZR A;  4WNN A;  4ZBJ C;  1ID3 A;  2Y2O A;  1P3I B;  2IO5 B;  3KSY A;  3C1B B;  1EQZ A;  1P3M B;  2Y2I A;  5CP6 A;  3MGP A;  1ZLA A;  4KGC C;  2CV5 C;  2PYO D;  2DF4 C;  5E5A D;  3LZ0 D;  2HIO D;  3O62 D;  5B33 C;  1ULY A;  5B1M B;  1TZY C;  3R45 B;  5AY8 A;  2J8P A;  3NQU B;  3AZI C;  1F66 C;  2FJ7 B;  3C1C B;  1JFI B;  3EPJ A;  2ARO B;  3KXB C;  2Y2Q A;  5G49 A;  3MVD B;  5CHL B;  3AZF C;  5B24 C;  3C1B D;  4DQY B;  3MGP B;  3AZK B;  3X1S C;  1P3M D;  4ZUX C;  3VH5 A;  3VH5 T;  2RVQ D;  4H9Q B;  4X23 B;  5CPK A;  5GT0 A;  2L5A A;  5CPI B;  5B1M D;  3AZG A;  3EPH A;  3H0L C;  4CSR B;  5AV8 A;  2FJ7 D;  3WKJ B;  5B0Z A;  4H9N A;  1M19 C;  1AOI C;  3C1C D;  2UWX A;  2ARO D;  5B32 A;  5G49 B;  3LZ1 B;  3TU4 C;  5BS7 A;  3MVD D;  3REH C;  3AZL C;  3VH6 W;  4WJ3 C;  3REI A;  3W98 C;  5BO0 B;  4KHA B;  3AZK D;  4XUJ D;  3LEL B;  3KWQ B;  4LD9 B;  2BYM A;  4X23 D;  1KX3 C;  1P3L A;  5CPI D;  5B40 C;  2ZM5 A;  3WKJ D;  5AV6 B;  3UTA C;  5AVC A;  4Z2M H;  1P3O D;  2DQN C;  3AZN C;  4HGA B;  2NZD D;  5CPJ A;  1M1A A;  3LZ1 D;  5DNN A;  2F2A C;  4KUD A;  1P3K C;  4J8V B;  4AWL B;  5GXQ D;  3H0R C;  5F99 A;  3UTB C;  3LEL D;  2BYM B;  3KWQ D;  1U35 C;  4LD9 D;  3B0D B;  1P3L B;  1KX5 A;  5B32 G;  1BFM A;  1HQ3 C;  4J8W C;  1P3F A;  4XZQ A;  5AV6 D;  4WU8 B;  3MGQ B;  5GSU C;  4YS3 B;  1M18 A;  4WV4 B;  3B0C W;  5B31 A;  3KUY C;  3WAA A;  5B1L B;  3X1V C;  5KDM A;  5B0Y C;  4EO5 C;  4YM6 B;  3AFA A;  3AYW A;  3MNN B;  3NQJ B;  3IP4 C;  2G5H C;  5DNM A;  1P34 D;  5GT3 B;  5AV9 C;  4XZQ B;  1H3O A;  3AZH A;  3VH6 T;  4J8U B;  4WU8 D;  2Y2N A;  1S32 D;  4YS3 D;  3REL C;  4H9R A;  3WAA B;  1ID3 C;  5B1L D;  5KDM B;  1EQZ C;  3X1T D;  5JRG B;  1KU5 A;  5CP6 C;  1ZLA C;  1P3B A;  3W99 C;  3MNN D;  4NE6 A;  3X1U A;  3AV2 C;  2PYO A;  5E5A A;  2JE5 A;  5DNM B;  4KGC D;  3O62 A;  5AY8 C;  1WWI A;  1TAF B;  4CAY A;  5BNV A;  3W97 B;  3W96 B;  1F66 D;  2NQB B;  3AZJ B;  5AVB B;  3AV1 C;  5C3I C;  5JRG D;  1P3I A;  3C1B A;  3B0B A;  4Z66 B;  5CPK C;  3AZF D;  1P3M A;  5GT0 C;  2LY8 A;  2HUE C;  4Z5T B;  3LZ0 B;  2HIO B;  3WTP E;  3LJA C;  5AV8 C;  3MGR C;  3AZG C;  3WA9 C;  5B1M A;  5B0Z C;  3R45 A;  2FJ7 A;  3NQU A;  5B32 C;  3C1C A;  3W96 D;  1JFI A;  2NQB D;  5BS7 C;  2ARO A;  5AVB D;  2Y2L A;  3REI C;  3MVD A;  3REH D;  4Z66 D;  2CWE A;  3AZK A;  4XUJ A;  3W98 D;  4H9Q A;  4Z5T D;  4X23 A;  5CPI A;  5AVC C;  5BT1 C;  4CSR A;  3FDD A;  4JJN B;  3WKJ A;  5CPJ C;  1M1A C;  1P3O A;  4H9S A;  5DNN C;  4KUD C;  5B2J B;  3LZ1 A;  2G5I C;  3AZM B;  1P3P B;  4QLC D;  5F99 C;  1KX4 B;  4UUZ B;  5BO0 A;  4KHA A;  4XUJ B;  1P3K D;  1KX5 C;  3LEL A;  3KWQ A;  4LD9 A;  5FUG A;  1BH8 B;  3AN2 B;  1P3F C;  4XZQ C;  3A1I A;  4WU9 B;  4JJN D;  2F8N H;  3B6F C;  5AV6 A;  1P3O B;  1M18 C;  5B31 C;  1W2E A;  2NZD B;  5B2J D;  4J8X C;  4G91 B;  3AZE B;  3REJ B;  1KX4 D;  3AZM D;  1P3P D;  3AFA C;  4J8V A;  5GXQ B;  2BYK B;  3AYW C;  1N1J B;  1Q9C A;  3V9R A;  4E45 A;  5DNM C;  2YFV B;  5B2I B;  1B6W A;  5FUG B;  3A6N B;  1P3A B;  3AZH C;  3AN2 D;  4WU9 D;  3UT9 B;  4WU8 A;  3MGQ A;  2BG1 A;  1S32 A;  4YS3 A;  3AZE D;  3REJ D;  5B1L A;  1P3G C;  1P3B C;  4R8P C;  3V9R B;  2W8S A;  4YM6 A;  3X1U C;  3MGS B;  2PYO C;  5E5A C;  3MNN A;  3B6G B;  5B2I D;  3A6N D;  3O62 C;  3NQJ A;  3W99 D;  1P3A D;  3AV2 D;  4DRB A;  4KGC A;  1P34 B;  5GT3 A;  3UT9 D;  4J8U A;  3REK C;  1S32 B;  5AV5 C;  3WTP B;  1P3I C;  2IO5 C;  3C1B C;  3X1T B;  3AV1 D;  4G92 B;  1P3M C;  5JRG A;  4ZBJ B;  3MGS D;  2RVQ C;  3B6G D;  5B1M C;  4KGC B;  2CV5 B;  3A1K A;  4H9O B;  3VH6 A;  2FJ7 C;  3LJA D;  3AZG D;  1TAF A;  5BNX B;  5B33 B;  3MGR D;  3C1C C;  3WA9 D;  2ARO C;  3W97 A;  1TZY B;  1F66 B;  3W96 A;  3AZI B;  2JSS A;  2NQB A;  3AZJ A;  3MVD C;  5AVB A;  3WTP D;  3EG5 B;  4NE5 A;  2F8N B;  5JA4 B;  3KXB B;  3MGP C;  3REI D;  3AZK C;  1B67 A;  4Z66 A;  3AZF B;  5B24 B;  4X23 C;  2F8N K;  3W98 A;  5CPI C;  3X1S B;  4Z5T A;  4ZUX B;  2HIO A;  3LZ0 A;  2CV5 D;  3WKJ C;  5B33 D;  4H9S C;  2F8N G;  2Y2P A;  1TZY D;  3LZ1 C;  3AZI D;  1AOI B;  1M19 B;  5DNN D;  2ZY5 A;  3TU4 B;  2F8N D;  4QLC A;  1BH9 B;  1WWS A;  3KXB D;  3REH B;  3LEL C;  3AZL B;  3KWQ C;  4LD9 C;  5B24 D;  1P3K A;  3W98 B;  2XD1 A;  3X1S D;  1KX5 D;  4ZUX D;  3B0C T;  1KX3 B;  5AV6 C;  5B40 B;  3KFU G;  4JJN A;  4HGA C;  4Z2M G;  4UPK A;  1AOI D;  3VH5 W;  3UTA B;  4WZS B;  1M19 D;  3B6F D;  1M18 D;  5B2J A;  3AZN B;  4J8V C;  2XD5 A;  4QLC B;  4AWL C;  3TU4 D;  3AZM A;  1P3P A;  1KX4 A;  4J8X D;  4UUZ A;  3EPL A;  3AZL D;  2ZY3 A;  1P3K B;  3B0D C;  1P3L C;  3P5J B;  3UTB B;  1U35 B;  1KX3 D;  1BH8 A;  3AN2 A;  5B40 D;  3MGQ C;  4WU8 C;  4WU9 A;  4YS3 C;  1HQ3 B;  4J8W B;  3EPK A;  2RIQ A;  3UTA D;  2NZD A;  5B1L C;  3AZN D;  5GSU B;  3AZE A;  3REJ A;  2JCH A;  4YM6 C;  3KUY B;  5GXQ A;  2BYK A;  3X1V B;  1P3G D;  3MNN C;  1N1J A;  5B0Y B;  1P3B D;  4R8P D;  2Y2K A;  4EO5 B;  3UTB D;  3X1U D;  5B2I A;  2YFV A;  3H0M C;  3A6N A;  1U35 D;  5GT3 C;  3W99 A;  1P3A A;  3AV2 A;  1HTA A;  4J8U C;  3UT9 A;  2YFW B;  1HQ3 D;  4J8W D;  5AV9 B;  3WAA C;  1Z2C B;  3REK D;  5GSU D;  5AV5 D;  3REL B;  5JRG C;  4WNN B;  1ID3 B;  3KUY D;  2Y2H A;  3AV1 A;  3X1V D;  1P3I D;  5B0Y D;  1EQZ B;  2Y2J A;  3MGS A;  5CP6 B;  1ZLA B;  3B6G A;  1F1E A;  3W99 B;  3AV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...