5B0ZB

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Histone H3.2
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zB00
4EO5B 1P3MC 5GSUA 2HIOD 3AZIB 5B31B 1KX3B 2NQBA 3KXBA 1P3KD 4LD9A 3X1SD 1KX4C 3W99C 3LZ1A 5GSUD 3WAAA 5AVCD 5B33B 5B0YA 3AV2A 4H9OB 3B6FC 4WU8D 5AV8C 5B2ID 5B1MA 5AV5D 3AZED 3X1TC 2YFVB 3REJB 5DNND 1P3MD 3WAAC 4LD9B 5C3IC 5BO0B 3VH6A 1P3LA 1EQZB 4XZQA 5GSUC 4AWLC 3AZGC 3AZFD 3R45B 1KX5B 1M19A 1ZLAC 2HUEB 1A7WA 3AN2D 5AY8D 5KDMA 2PYOC 3KWQC 4JJNC 2NZDD 1S32B 4ZBJC 3A6ND 2F8NB 5AY8A 4Z66A 1F66C 3WA9B 3MGSB 1KX5C 3A6NA 1TAFB 4KHAA 5GXQD 4X23A 1ZLAD 5B32B 5C3IB 4WU8B 2NQBC 5B33D 4QLCD 4X23C 3KSYA 3KXBB 5DNMB 3MGPB 5GSUB 5CP6D 3AYWA 3UTBC 4KUDB 2CV5D 2PYOB 1P3KB 3MGPD 3MVDB 3W96D 4J8XC 3KUYC 3W97A 1EQZC 4H9PB 3W98D 1WWIA 3NQUB 3WTPD 5B24B 3LELC 3REKD 2FJ7A 1P3LB 4YS3A 3MGRD 2F8ND 1ID3A 4UUZA 1N1JB 3LZ0C 1P3FC 1BH8A 1P3GC 3X1TA 4Z2MG 3AZKB 4H9PA 1AOIB 5B31D 5AY8C 4R8PD 1F1EA 4HGAC 3LZ1C 4WU9B 4NE3A 3NQJA 5AV6B 3LZ1B 1F66D 1TAFA 3AZLC 1TZYC 3X1UB 3REHA 3W99D 3REJD 3AZMA 1P3IB 1BH8B 4QLCA 1AOIA 3WKJC 3LJAB 3REID 4YM6B 4XZQD 2L5AA 3MGQD 5BT1D 4G91B 4WU9A 3W98B 5BS7C 3AYWB 4CAYB 3UTBA 5BNXB 1P34B 3LJAA 4KUDD 5AVBC 3AN2B 4Z5TC 5CP6B 3B0DC 5GT3A 3B6GA 5B24A 2BYKA 2FJ7B 3MGQC 1P3AA 3LJAD 5BT1C 5CPIB 1BH9B 4J8WC 3TU4A 5GXQC 1U35D 1ID3B 5B33A 5B0YB 3AV2B 5B31G 3WTPB 4WU8C 3AV1B 1U35A 4WZSB 4QLCC 4X23D 4R8PA 1M19C 1ZLAA 4Z5TD 1M1AD 5AVCB 2NZDB 5BO0A 4R8PC 3MVDC 1B67A 3C1CD 3RELA 3AZKD 1EQZA 3W97C 3UTBD 3B0CT 5B1MD 4QLCB 1TZYD 1EQZD 5KDMB 5JRGA 3UTAB 5AV9B 1ZLAB 3AV1D 4JJND 3AFAA 5B0YC 3AV2C 2NZDC 2F8NA 3AZMC 4J8UD 4YM6D 4JJNB 3AZLA 3AFAD 3RELB 4ZUXD 4KHAB 1M18C 5BNXA 3AZND 3LZ0D 1P3FD 5AVCC 3X1TB 5GT0D 3UT9D 1P34C 1F66A 3X1TD 5GT3B 3B6GB 5CHLB 4Z5TB 5JA4B 5CP6C 2PYOA 1BH9A 3MVDA 1M18D 1P3PD 3AZGA 2F8NK 2FJ7C 3VH6W 3AZJC 1U35B 3REIB 3AN2C 1KU5A 2CV5A 1TZYB 5F99D 3AZIC 3A6NC 4NE5A 4KGCB 3X1SC 4WU9D 4ZUXA 3W97D 3O62C 3X1UC 5CPKD 4H9OA 1P3IC 1M1AB 4G92C 4H9RB 3C1BB 2YFVA 3B6FD 3AN2A 2CV5B 5FUGA 1P3OA 1JFIB 5G49B 4M6BA 5AVBD 1ID3D 1P3LC 5DNNC 3AZNB 3TU4B 2CWEA 4YM6C 3AZJB 1U35C 2BYMA 4H9QB 1HQ3D 4WU9C 3VH5W 1M1AA 1P3PA 5GXQA 5E5AD 4J8XD 3X1SB 2IO5B 3NQUA 1JFIA 2AROB 5CPJC 3KWQD 1HTAA 5AVCA 1P3KC 3VH5A 3MVDD 3C1CC 4Z5TA 5JA4A 3UTBB 1M18A 3W99A 3AYWD 5AY8B 3KXBC 4KGCC 1HQ3B 5B1MC 3X1SA 4KUDC 3B0BA 3AFAB 2AROA 5B40A 5DNMC 4J8UC 3VH6T 1P3AB 5B32G 5B0ZC 4JJNA 5B0YD 3AV2D 1M18B 4H9NA 3WTPE 5AV6A 4J8VA 5AV5A 5B2IA 3AZEA 3W96B 3AZLD 3MGRA 3AZMB 3REHC 1HQ3A 1S32D 3W97B 1P3OD 1WWSA 4NFTA 3MNNA 3WKJD 5G49A 4J8XA 5GT0C 1P3OB 4CSRB 5B31A 2NQBB 3UTAC 1P3AC 3AZGB 5E5AA 5GXQB 1P3PB 5CPIC 1P3OC 5AV8D 4YS3C 3AV1C 1BFMA 4CSRA 3C1CA 2F8NG 5B40D 3W99B 5CPJA 3AFAC 5F99A 4DRAA 4ZUXC 1KX3C 5AV6D 5GT0B 3X1VA 3C1BD 3B6FB 4EO5C 3WTPA 3AZFC 5CPKB 2AROD 3REJC 3C1BA 4AWLB 3W98C 3R45A 4YM6A 1H3OB 3W96C 4J8VD 3AZNA 5F99B 5B1LA 3MGRB 1P3LD 2BYMB 4G91C 4H9QA 3TU4D 3UT9A 3AZID 3W98A 5E5AC 2AROC 3UTAA 4XUJD 5JRGC 3MNNB 1P34A 2RVQC 1KX4B 5B32A 4KGCA 3AZMD 3V9RA 5B31C 3AZLB 2CV5C 5CPJD 5B1LB 3LJAC 1AOID 5B1LC 5E5AB 3UT9B 3VH5T 4KGCD 5B2JA 2IO5C 5CPIA 5DNNB 3AZNC 4XZQB 3KXBD 1P3KA 1P3BD 1KX5A 3REIC 5CPID 5JRGB 3LELD 1B6WA 1M1AC 1S32A 4H9NB 4J8UA 4J8VB 5B40C 4WNNA 5AV9D 1AOIC 1KX3A 3WKJA 5B1LD 3B6FA 5DNNA 1P3GB 5B24C 3A6NB 5GT3D 3B6GD 5AV9A 5AVBA 1H3OA 1N1JA 4J8XB 4Z2MH 5BNVB 4XUJA 3AZFB 5B32C 3LELB 3LZ0B 1P3FB 3O62A 4WV4B 5DNMA 5AV8A 4ZUXB 4KUDA 1P3BB 3MGPC 3O62D 4H9SC 3X1UD 5CPKC 5B24D 3REKB 1P3ID 5GT3C 3B6GC 3AZGD 1P3AD 3KWQA 3AZHB 1F66B 3WA9C 3MGSD 3RELC 1KX4A 5BNVA 3X1VD 2YFWA 3V9RB 3LELA 4CAYA 1KX4D 5B2JD 2HIOC 3WA9A 4YS3B 5B2JB 1KX3D 3REHD 1KX5D 1S32C 4UUZB 1P3PC 4H9SA 5CPKA 3KWQB 1P3GD 4X23B 2HUEC 3MGSC 3RELD 3AZKA 3REIA 2YFWB 2BYKB 3WAAD 4J8UB 4ZBJB 1TZYA 4J8WD 5B2JC 4WNNB 3UTAD 4E44A 3NQJB 3AZHC 4LD9C 5AV9C 5B0ZB 4H9RA 1P3MA 5AVBB 3X1UA 3REHB 1P3IA 4YS3D 2PYOD 1M19B 3C1CB 1Q9CA 3KUYA 5BS7A 5CPJB 5DNMD 1R4VA 2HIOB 3LZ0A 1P34D 1P3FA 1ULYA 2RVQD 3B0DB 3WTPC 5FUGB 4R8PB 3REKC 3AZFA 3AZIA 1ID3C 5GT0A 3X1VB 5B32D 1P3BA 5AV8B 4J8WB 3B0CW 3AZHD 4LD9D 3AZJA 1P3MB 3MGQB 2LY8A 1HQ3C 3WAAB 3AZHA 5B2IC 5AV5C 3AZEC 3AZJD 1P3BC 4J8VC 3REJA 4WU8A 5CP6A 5B1MB 5B33C 2JSSA 3MGPA 3WKJB 3LZ1D 4E45A 4J8WA 3TU4C 4Z66C 3AYWC 1P3GA 3MGQA 2F8NH 4NE6A 3UT9C 5JRGD 4XUJC 3AV1A 4XUJB 3MNND 4HGAB 4G92B 3KUYD 1M19D 3O62B 4XZQC 5B40B 3MGRC 4Z66B 5B0ZD 3W96A 5B2IB 5AV5B 3AZEB 2NZDA 3MGSA 3AZKC 5AV6C 4DRBA 3C1BC 4Z66D 3REKA 5B0ZA 2FJ7D 3KUYB 3X1VC 2HIOA 2NQBD 3MNNC 5F99C 3WA9D
chains in the Genus database with same CATH superfamily
4EO5B 1P3MC 5GSUA 2HIOD 3AZIB 5B31B 1KX3B 2NQBA 3KXBA 1P3KD 4LD9A 3X1SD 2G5IC 1KX4C 3W99C 3LZ1A 5GSUD 3WAAA 5AVCD 5B33B 5B0YA 3AV2A 4H9OB 3B6FC 4WU8D 5AV8C 5B2ID 5B1MA 5AV5D 3AZED 3X1TC 2YFVB 3REJB 5DNND 1P3MD 3EPKA 3WAAC 4LD9B 5C3IC 2ZY3A 5BO0B 3VH6A 3FDDA 1P3LA 1EQZB 4XZQA 5GSUC 4AWLC 3AZGC 3AZFD 3H0LC 3R45B 1KX5B 1M19A 1ZLAC 2HUEB 1A7WA 3AN2D 5AY8D 5KDMA 3H0MC 3A1IA 3KWQC 2PYOC 4JJNC 2NZDD 1S32B 4ZBJC 3A6ND 2F8NB 5AY8A 4Z66A 1F66C 3WA9B 3MGSB 1KX5C 3A6NA 1TAFB 4KHAA 5GXQD 4X23A 1ZLAD 3F6TA 5B32B 5C3IB 4WU8B 2NQBC 5B33D 4QLCD 4X23C 3KSYA 3KXBB 5DNMB 3MGPB 5GSUB 5CP6D 3AYWA 3UTBC 4KUDB 2CV5D 2PYOB 1P3KB 3MGPD 3MVDB 2Y2OA 2Y2NA 3W96D 4J8XC 3KUYC 3W97A 1EQZC 4H9PB 3AL0C 3W98D 1WWIA 3NQUB 3EPLA 3WTPD 2Y2QA 5B24B 3LELC 3REKD 2FJ7A 1P3LB 4YS3A 3MGRD 2F8ND 1ID3A 4UUZA 2W8SA 1N1JB 3LZ0C 1P3FC 1BH8A 1P3GC 3X1TA 4Z2MG 3AZKB 4H9PA 1AOIB 5B31D 5AY8C 4R8PD 1F1EA 3P5JB 4HGAC 3LZ1C 4WU9B 4NE3A 3NQJA 5AV6B 3LZ1B 1F66D 1TAFA 3AZLC 1TZYC 3X1UB 3REHA 3W99D 3REJD 3AZMA 1P3IB 1BH8B 2XD1A 4QLCA 1AOIA 3WKJC 3LJAB 3REID 4YM6B 4XZQD 2L5AA 3MGQD 5BT1D 4G91B 4WU9A 3W98B 5BS7C 3AYWB 4CAYB 3UTBA 5BNXB 1P34B 3LJAA 4KUDD 5AVBC 3AN2B 4Z5TC 5CP6B 3B0DC 1W2EA 5GT3A 3B6GA 5B24A 2BYKA 2FJ7B 3MGQC 1P3AA 3LJAD 5BT1C 5CPIB 1BH9B 4J8WC 3TU4A 2UWXA 5GXQC 1U35D 1ID3B 5B33A 5B0YB 3AV2B 5B31G 3WTPB 4WU8C 3H0RC 3AV1B 2ZM5A 1U35A 4WZSB 4QLCC 4X23D 4R8PA 1M19C 1ZLAA 4Z5TD 1M1AD 5AVCB 2NZDB 5BO0A 4R8PC 3MVDC 1B67A 3C1CD 3RELA 3AZKD 1EQZA 3W97C 3UTBD 2RIQA 2FFFB 3B0CT 5B1MD 4QLCB 1TZYD 1EQZD 5KDMB 2Y2GA 5JRGA 5AV9B 3UTAB 1ZLAB 3AV1D 4JJND 3AFAA 5B0YC 3AV2C 2NZDC 2F8NA 3AZMC 4J8UD 2JCHA 4YM6D 4JJNB 3AZLA 3AFAD 3EG5B 3RELB 4ZUXD 4KHAB 1M18C 5BNXA 3AZND 2DQNC 3LZ0D 1P3FD 5AVCC 3X1TB 5GT0D 3UT9D 1P34C 1F66A 3X1TD 5GT3B 3B6GB 5CHLB 4Z5TB 5JA4B 5CP6C 2PYOA 1BH9A 3MVDA 1M18D 1P3PD 3AZGA 2F8NK 2FJ7C 3VH6W 3AZJC 1U35B 3REIB 3AN2C 1KU5A 2CV5A 1TZYB 5F99D 3AZIC 2Y2HA 3A6NC 4NE5A 4KGCB 2Y2MA 3X1SC 4WU9D 4ZUXA 3W97D 3O62C 3X1UC 5CPKD 4H9OA 1P3IC 1M1AB 4G92C 4H9RB 3C1BB 2YFVA 3B6FD 3AN2A 2CV5B 5FUGA 1P3OA 1JFIB 5G49B 1PZRA 4M6BA 5AVBD 1ID3D 1P3LC 5DNNC 3AZNB 3TU4B 2CWEA 4YM6C 3AZJB 1U35C 2BYMA 4H9QB 1HQ3D 4WU9C 2Y2LA 3VH5W 1M1AA 1P3PA 5GXQA 5E5AD 4J8XD 3X1SB 2IO5B 2XD5A 3NQUA 1JFIA 2AROB 5CPJC 1T3UA 3KWQD 1HTAA 5AVCA 1P3KC 3VH5A 3MVDD 3C1CC 4Z5TA 5JA4A 3UTBB 1M18A 3W99A 3AYWD 5AY8B 3KXBC 4KGCC 1HQ3B 5B1MC 3X1SA 4KUDC 3B0BA 3AFAB 2AROA 5B40A 5DNMC 4J8UC 3VH6T 1P3AB 5B32G 5B0ZC 3EPJA 4JJNA 5B0YD 3AV2D 1M18B 4H9NA 3WTPE 5AV6A 4J8VA 5AV5A 5B2IA 3AZEA 3W96B 3AZLD 3MGRA 3AZMB 3REHC 1HQ3A 1S32D 3W97B 1P3OD 1WWSA 4NFTA 3MNNA 3WKJD 5G49A 4J8XA 5GT0C 1P3OB 4CSRB 5B31A 4DQYB 2NQBB 3UTAC 1P3AC 3AZGB 5E5AA 5GXQB 1P3PB 5CPIC 1P3OC 5AV8D 4YS3C 3AV1C 1BFMA 2F2AC 4CSRA 3C1CA 2F8NG 5B40D 3W99B 5CPJA 2BG1A 3AFAC 5F99A 4DRAA 4ZUXC 1KX3C 5AV6D 5GT0B 3X1VA 3C1BD 3B6FB 4EO5C 3WTPA 3AZFC 5CPKB 2AROD 3REJC 3C1BA 4AWLB 3W98C 3R45A 4YM6A 1H3OB 3W96C 2Y2IA 4J8VD 2ZY4A 3AZNA 5F99B 5B1LA 3MGRB 1P3LD 2BYMB 4G91C 4H9QA 3TU4D 3UT9A 3AZID 3W98A 5E5AC 2AROC 3UTAA 4XUJD 5JRGC 3MNNB 1P34A 2RVQC 1KX4B 5B32A 4KGCA 3AZMD 3V9RA 5B31C 3AZLB 2ZY5A 2CV5C 5CPJD 5B1LB 3KFUG 3LJAC 1AOID 5B1LC 5E5AB 3UT9B 3VH5T 4KGCD 5B2JA 2IO5C 5CPIA 5DNNB 3AZNC 4XZQB 3KXBD 1P3KA 1P3BD 1KX5A 3REIC 5CPID 3LELD 1B6WA 2Y2PA 3A1KA 1M1AC 1S32A 4H9NB 4J8UA 4J8VB 5B40C 4WNNA 5AV9D 1AOIC 1KX3A 3WKJA 5B1LD 3B6FA 5DNNA 1P3GB 5B24C 3A6NB 5GT3D 3B6GD 5AV9A 5AVBA 1H3OA 1N1JA 4J8XB 4Z2MH 5BNVB 4XUJA 3AZFB 5B32C 3LELB 3LZ0B 1P3FB 3O62A 4WV4B 5DNMA 5AV8A 4ZUXB 4KUDA 1P3BB 3MGPC 4UPKA 3O62D 4H9SC 3X1UD 3MNNC 5B24D 3REKB 5CPKC 5GT3C 1P3ID 3B6GC 3AZGD 1P3AD 3KWQA 3AZHB 1F66B 3WA9C 3MGSD 3RELC 1KX4A 5BNVA 3X1VD 2YFWA 3V9RB 2Y2KA 3LELA 4CAYA 1KX4D 5B2JD 2HIOC 2J8PA 3WA9A 4YS3B 5B2JB 1KX3D 3REHD 1KX5D 1S32C 4UUZB 1P3PC 4H9SA 5CPKA 3KWQB 1P3GD 4X23B 2HUEC 3MGSC 3RELD 3AZKA 3REIA 2YFWB 2BYKB 3WAAD 4J8UB 4ZBJB 1TZYA 4J8WD 5B2JC 4WNNB 3UTAD 2DF4C 4E44A 3NQJB 3AZHC 4LD9C 5AV9C 5B0ZB 4H9RA 3EPHA 1P3MA 5AVBB 3X1UA 3REHB 1P3IA 4YS3D 2PYOD 4WJ3C 1M19B 3C1CB 1Q9CA 3KUYA 3IP4C 5BS7A 5CPJB 5DNMD 1R4VA 2HIOB 3LZ0A 1P34D 1P3FA 1ULYA 2RVQD 3B0DB 3WTPC 5FUGB 4R8PB 3REKC 3AZFA 3AZIA 1ID3C 5GT0A 3X1VB 5B32D 1P3BA 2JE5A 5AV8B 4J8WB 3B0CW 3AZHD 4LD9D 3AZJA 1P3MB 3MGQB 2LY8A 1HQ3C 3WAAB 3AZHA 2G5HC 5B2IC 5AV5C 3AZEC 3AZJD 1P3BC 4J8VC 3REJA 4WU8A 5CP6A 5B1MB 5B33C 2JSSA 3MGPA 1Z2CB 3WKJB 3LZ1D 4E45A 4J8WA 3TU4C 4Z66C 2ZY2A 3AYWC 1P3GA 3MGQA 2F8NH 4NE6A 3UT9C 5JRGD 4XUJC 3AV1A 4XUJB 3MNND 4HGAB 4G92B 3KUYD 1M19D 3O62B 4XZQC 5B40B 3MGRC 4Z66B 5B0ZD 3W96A 5B2IB 5AV5B 3AZEB 2NZDA 3MGSA 3AZKC 5AV6C 4DRBA 3C1BC 4Z66D 3REKA 2Y2JA 5B0ZA 2FJ7D 2VQRA 3KUYB 3X1VC 2HIOA 2NQBD 5JRGB 5F99C 3WA9D
chains in the Genus database with same CATH topology
4EO5B 1P3MC 5GSUA 2HIOD 3AZIB 5B31B 1KX3B 2NQBA 3KXBA 1P3KD 4LD9A 3X1SD 2G5IC 1KX4C 3W99C 3LZ1A 5GSUD 3WAAA 5AVCD 5B33B 5B0YA 3AV2A 4H9OB 3B6FC 4WU8D 5AV8C 5B2ID 5B1MA 5AV5D 3AZED 3X1TC 2YFVB 3REJB 5DNND 1P3MD 3EPKA 3WAAC 4LD9B 5C3IC 2ZY3A 5BO0B 3VH6A 3FDDA 1P3LA 1EQZB 4XZQA 5GSUC 4AWLC 3AZGC 3AZFD 3H0LC 3R45B 1KX5B 1M19A 1ZLAC 2HUEB 1A7WA 3AN2D 5AY8D 5KDMA 3H0MC 3A1IA 3KWQC 2PYOC 4JJNC 2NZDD 1S32B 4ZBJC 3A6ND 2F8NB 5AY8A 4Z66A 1F66C 3WA9B 3MGSB 1KX5C 3A6NA 1TAFB 4KHAA 5GXQD 4X23A 1ZLAD 3F6TA 5B32B 5C3IB 4WU8B 2NQBC 5B33D 4QLCD 4X23C 3KSYA 3KXBB 5DNMB 3MGPB 5GSUB 5CP6D 3AYWA 3UTBC 4KUDB 2CV5D 2PYOB 1P3KB 3MGPD 3MVDB 2Y2OA 2Y2NA 3W96D 4J8XC 3KUYC 3W97A 1EQZC 4H9PB 3AL0C 3W98D 1WWIA 3NQUB 3EPLA 3WTPD 2Y2QA 5B24B 3LELC 3REKD 2FJ7A 1P3LB 4YS3A 3MGRD 2F8ND 1ID3A 4UUZA 2W8SA 1N1JB 3LZ0C 1P3FC 1BH8A 1P3GC 3X1TA 4Z2MG 3AZKB 4H9PA 1AOIB 5B31D 5AY8C 4R8PD 1F1EA 3P5JB 4HGAC 3LZ1C 4WU9B 4NE3A 3NQJA 5AV6B 3LZ1B 1F66D 1TAFA 3AZLC 1TZYC 3X1UB 3REHA 3W99D 3REJD 3AZMA 1P3IB 1BH8B 2XD1A 4QLCA 1AOIA 3WKJC 3LJAB 3REID 4YM6B 4XZQD 2L5AA 3MGQD 5BT1D 4G91B 4WU9A 3W98B 5BS7C 3AYWB 4CAYB 3UTBA 5BNXB 1P34B 3LJAA 4KUDD 5AVBC 3AN2B 4Z5TC 5CP6B 3B0DC 1W2EA 5GT3A 3B6GA 5B24A 2BYKA 2FJ7B 3MGQC 1P3AA 3LJAD 5BT1C 5CPIB 1BH9B 4J8WC 3TU4A 2UWXA 5GXQC 1U35D 1ID3B 5B33A 5B0YB 3AV2B 5B31G 3WTPB 4WU8C 3H0RC 3AV1B 2ZM5A 1U35A 4WZSB 4QLCC 4X23D 4R8PA 1M19C 1ZLAA 4Z5TD 1M1AD 5AVCB 2NZDB 5BO0A 4R8PC 3MVDC 1B67A 3C1CD 3RELA 3AZKD 1EQZA 3W97C 3UTBD 2RIQA 2FFFB 3B0CT 5B1MD 4QLCB 1TZYD 1EQZD 5KDMB 2Y2GA 5JRGA 5AV9B 3UTAB 1ZLAB 3AV1D 4JJND 3AFAA 5B0YC 3AV2C 2NZDC 2F8NA 3AZMC 4J8UD 2JCHA 4YM6D 4JJNB 3AZLA 3AFAD 3EG5B 3RELB 4ZUXD 4KHAB 1M18C 5BNXA 3AZND 2DQNC 3LZ0D 1P3FD 5AVCC 3X1TB 5GT0D 3UT9D 1P34C 1F66A 3X1TD 5GT3B 3B6GB 5CHLB 4Z5TB 5JA4B 5CP6C 2PYOA 1BH9A 3MVDA 1M18D 1P3PD 3AZGA 2F8NK 2FJ7C 3VH6W 3AZJC 1U35B 3REIB 3AN2C 1KU5A 2CV5A 1TZYB 5F99D 3AZIC 2Y2HA 3A6NC 4NE5A 4KGCB 2Y2MA 3X1SC 4WU9D 4ZUXA 3W97D 3O62C 3X1UC 5CPKD 4H9OA 1P3IC 1M1AB 4G92C 4H9RB 3C1BB 2YFVA 3B6FD 3AN2A 2CV5B 5FUGA 1P3OA 1JFIB 5G49B 1PZRA 4M6BA 5AVBD 1ID3D 1P3LC 5DNNC 3AZNB 3TU4B 2CWEA 4YM6C 3AZJB 1U35C 2BYMA 4H9QB 1HQ3D 4WU9C 2Y2LA 3VH5W 1M1AA 1P3PA 5GXQA 5E5AD 4J8XD 3X1SB 2IO5B 2XD5A 3NQUA 1JFIA 2AROB 5CPJC 1T3UA 3KWQD 1HTAA 5AVCA 1P3KC 3VH5A 3MVDD 3C1CC 4Z5TA 5JA4A 3UTBB 1M18A 3W99A 3AYWD 5AY8B 3KXBC 4KGCC 1HQ3B 5B1MC 3X1SA 4KUDC 3B0BA 3AFAB 2AROA 5B40A 5DNMC 4J8UC 3VH6T 1P3AB 5B32G 5B0ZC 3EPJA 4JJNA 5B0YD 3AV2D 1M18B 4H9NA 3WTPE 5AV6A 4J8VA 5AV5A 5B2IA 3AZEA 3W96B 3AZLD 3MGRA 3AZMB 3REHC 1HQ3A 1S32D 3W97B 1P3OD 1WWSA 4NFTA 3MNNA 3WKJD 5G49A 4J8XA 5GT0C 1P3OB 4CSRB 5B31A 4DQYB 2NQBB 3UTAC 1P3AC 3AZGB 5E5AA 5GXQB 1P3PB 5CPIC 1P3OC 5AV8D 4YS3C 3AV1C 1BFMA 2F2AC 4CSRA 3C1CA 2F8NG 5B40D 3W99B 5CPJA 2BG1A 3AFAC 5F99A 4DRAA 4ZUXC 1KX3C 5AV6D 5GT0B 3X1VA 3C1BD 3B6FB 4EO5C 3WTPA 3AZFC 5CPKB 2AROD 3REJC 3C1BA 4AWLB 3W98C 3R45A 4YM6A 1H3OB 3W96C 2Y2IA 4J8VD 2ZY4A 3AZNA 5F99B 5B1LA 3MGRB 1P3LD 2BYMB 4G91C 4H9QA 3TU4D 3UT9A 3AZID 3W98A 5E5AC 2AROC 3UTAA 4XUJD 5JRGC 3MNNB 1P34A 2RVQC 1KX4B 5B32A 4KGCA 3AZMD 3V9RA 5B31C 3AZLB 2ZY5A 2CV5C 5CPJD 5B1LB 3KFUG 3LJAC 1AOID 5B1LC 5E5AB 3UT9B 3VH5T 4KGCD 5B2JA 2IO5C 5CPIA 5DNNB 3AZNC 4XZQB 3KXBD 1P3KA 1P3BD 1KX5A 3REIC 5CPID 3LELD 1B6WA 2Y2PA 3A1KA 1M1AC 1S32A 4H9NB 4J8UA 4J8VB 5B40C 4WNNA 5AV9D 1AOIC 1KX3A 3WKJA 5B1LD 3B6FA 5DNNA 1P3GB 5B24C 3A6NB 5GT3D 3B6GD 5AV9A 5AVBA 1H3OA 1N1JA 4J8XB 4Z2MH 5BNVB 4XUJA 3AZFB 5B32C 3LELB 3LZ0B 1P3FB 3O62A 4WV4B 5DNMA 5AV8A 4ZUXB 4KUDA 1P3BB 3MGPC 4UPKA 3O62D 4H9SC 3X1UD 3MNNC 5B24D 3REKB 5CPKC 5GT3C 1P3ID 3B6GC 3AZGD 1P3AD 3KWQA 3AZHB 1F66B 3WA9C 3MGSD 3RELC 1KX4A 5BNVA 3X1VD 2YFWA 3V9RB 2Y2KA 3LELA 4CAYA 1KX4D 5B2JD 2HIOC 2J8PA 3WA9A 4YS3B 5B2JB 1KX3D 3REHD 1KX5D 1S32C 4UUZB 1P3PC 4H9SA 5CPKA 3KWQB 1P3GD 4X23B 2HUEC 3MGSC 3RELD 3AZKA 3REIA 2YFWB 2BYKB 3WAAD 4J8UB 4ZBJB 1TZYA 4J8WD 5B2JC 4WNNB 3UTAD 2DF4C 4E44A 3NQJB 3AZHC 4LD9C 5AV9C 5B0ZB 4H9RA 3EPHA 1P3MA 5AVBB 3X1UA 3REHB 1P3IA 4YS3D 2PYOD 4WJ3C 1M19B 3C1CB 1Q9CA 3KUYA 3IP4C 5BS7A 5CPJB 5DNMD 1R4VA 2HIOB 3LZ0A 1P34D 1P3FA 1ULYA 2RVQD 3B0DB 3WTPC 5FUGB 4R8PB 3REKC 3AZFA 3AZIA 1ID3C 5GT0A 3X1VB 5B32D 1P3BA 2JE5A 5AV8B 4J8WB 3B0CW 3AZHD 4LD9D 3AZJA 1P3MB 3MGQB 2LY8A 1HQ3C 3WAAB 3AZHA 2G5HC 5B2IC 5AV5C 3AZEC 3AZJD 1P3BC 4J8VC 3REJA 4WU8A 5CP6A 5B1MB 5B33C 2JSSA 3MGPA 1Z2CB 3WKJB 3LZ1D 4E45A 4J8WA 3TU4C 4Z66C 2ZY2A 3AYWC 1P3GA 3MGQA 2F8NH 4NE6A 3UT9C 5JRGD 4XUJC 3AV1A 4XUJB 3MNND 4HGAB 4G92B 3KUYD 1M19D 3O62B 4XZQC 5B40B 3MGRC 4Z66B 5B0ZD 3W96A 5B2IB 5AV5B 3AZEB 2NZDA 3MGSA 3AZKC 5AV6C 4DRBA 3C1BC 4Z66D 3REKA 2Y2JA 5B0ZA 2FJ7D 2VQRA 3KUYB 3X1VC 2HIOA 2NQBD 5JRGB 5F99C 3WA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO5 B;  1P3M C;  5GSU A;  2HIO D;  3AZI B;  5B31 B;  1KX3 B;  2NQB A;  3KXB A;  1P3K D;  4LD9 A;  3X1S D;  1KX4 C;  3W99 C;  3LZ1 A;  5GSU D;  3WAA A;  5AVC D;  5B33 B;  5B0Y A;  3AV2 A;  4H9O B;  3B6F C;  4WU8 D;  5AV8 C;  5B2I D;  5B1M A;  5AV5 D;  3AZE D;  3X1T C;  2YFV B;  3REJ B;  5DNN D;  1P3M D;  3WAA C;  4LD9 B;  5C3I C;  5BO0 B;  3VH6 A;  1P3L A;  1EQZ B;  4XZQ A;  5GSU C;  4AWL C;  3AZG C;  3AZF D;  3R45 B;  1KX5 B;  1M19 A;  1ZLA C;  2HUE B;  1A7W A;  3AN2 D;  5AY8 D;  5KDM A;  2PYO C;  3KWQ C;  4JJN C;  2NZD D;  1S32 B;  4ZBJ C;  3A6N D;  2F8N B;  5AY8 A;  4Z66 A;  1F66 C;  3WA9 B;  3MGS B;  1KX5 C;  3A6N A;  1TAF B;  4KHA A;  5GXQ D;  4X23 A;  1ZLA D;  5B32 B;  5C3I B;  4WU8 B;  2NQB C;  5B33 D;  4QLC D;  4X23 C;  3KSY A;  3KXB B;  5DNM B;  3MGP B;  5GSU B;  5CP6 D;  3AYW A;  3UTB C;  4KUD B;  2CV5 D;  2PYO B;  1P3K B;  3MGP D;  3MVD B;  3W96 D;  4J8X C;  3KUY C;  3W97 A;  1EQZ C;  4H9P B;  3W98 D;  1WWI A;  3NQU B;  3WTP D;  5B24 B;  3LEL C;  3REK D;  2FJ7 A;  1P3L B;  4YS3 A;  3MGR D;  2F8N D;  1ID3 A;  4UUZ A;  1N1J B;  3LZ0 C;  1P3F C;  1BH8 A;  1P3G C;  3X1T A;  4Z2M G;  3AZK B;  4H9P A;  1AOI B;  5B31 D;  5AY8 C;  4R8P D;  1F1E A;  4HGA C;  3LZ1 C;  4WU9 B;  4NE3 A;  3NQJ A;  5AV6 B;  3LZ1 B;  1F66 D;  1TAF A;  3AZL C;  1TZY C;  3X1U B;  3REH A;  3W99 D;  3REJ D;  3AZM A;  1P3I B;  1BH8 B;  4QLC A;  1AOI A;  3WKJ C;  3LJA B;  3REI D;  4YM6 B;  4XZQ D;  2L5A A;  3MGQ D;  5BT1 D;  4G91 B;  4WU9 A;  3W98 B;  5BS7 C;  3AYW B;  4CAY B;  3UTB A;  5BNX B;  1P34 B;  3LJA A;  4KUD D;  5AVB C;  3AN2 B;  4Z5T C;  5CP6 B;  3B0D C;  5GT3 A;  3B6G A;  5B24 A;  2BYK A;  2FJ7 B;  3MGQ C;  1P3A A;  3LJA D;  5BT1 C;  5CPI B;  1BH9 B;  4J8W C;  3TU4 A;  5GXQ C;  1U35 D;  1ID3 B;  5B33 A;  5B0Y B;  3AV2 B;  5B31 G;  3WTP B;  4WU8 C;  3AV1 B;  1U35 A;  4WZS B;  4QLC C;  4X23 D;  4R8P A;  1M19 C;  1ZLA A;  4Z5T D;  1M1A D;  5AVC B;  2NZD B;  5BO0 A;  4R8P C;  3MVD C;  1B67 A;  3C1C D;  3REL A;  3AZK D;  1EQZ A;  3W97 C;  3UTB D;  3B0C T;  5B1M D;  4QLC B;  1TZY D;  1EQZ D;  5KDM B;  5JRG A;  3UTA B;  5AV9 B;  1ZLA B;  3AV1 D;  4JJN D;  3AFA A;  5B0Y C;  3AV2 C;  2NZD C;  2F8N A;  3AZM C;  4J8U D;  4YM6 D;  4JJN B;  3AZL A;  3AFA D;  3REL B;  4ZUX D;  4KHA B;  1M18 C;  5BNX A;  3AZN D;  3LZ0 D;  1P3F D;  5AVC C;  3X1T B;  5GT0 D;  3UT9 D;  1P34 C;  1F66 A;  3X1T D;  5GT3 B;  3B6G B;  5CHL B;  4Z5T B;  5JA4 B;  5CP6 C;  2PYO A;  1BH9 A;  3MVD A;  1M18 D;  1P3P D;  3AZG A;  2F8N K;  2FJ7 C;  3VH6 W;  3AZJ C;  1U35 B;  3REI B;  3AN2 C;  1KU5 A;  2CV5 A;  1TZY B;  5F99 D;  3AZI C;  3A6N C;  4NE5 A;  4KGC B;  3X1S C;  4WU9 D;  4ZUX A;  3W97 D;  3O62 C;  3X1U C;  5CPK D;  4H9O A;  1P3I C;  1M1A B;  4G92 C;  4H9R B;  3C1B B;  2YFV A;  3B6F D;  3AN2 A;  2CV5 B;  5FUG A;  1P3O A;  1JFI B;  5G49 B;  4M6B A;  5AVB D;  1ID3 D;  1P3L C;  5DNN C;  3AZN B;  3TU4 B;  2CWE A;  4YM6 C;  3AZJ B;  1U35 C;  2BYM A;  4H9Q B;  1HQ3 D;  4WU9 C;  3VH5 W;  1M1A A;  1P3P A;  5GXQ A;  5E5A D;  4J8X D;  3X1S B;  2IO5 B;  3NQU A;  1JFI A;  2ARO B;  5CPJ C;  3KWQ D;  1HTA A;  5AVC A;  1P3K C;  3VH5 A;  3MVD D;  3C1C C;  4Z5T A;  5JA4 A;  3UTB B;  1M18 A;  3W99 A;  3AYW D;  5AY8 B;  3KXB C;  4KGC C;  1HQ3 B;  5B1M C;  3X1S A;  4KUD C;  3B0B A;  3AFA B;  2ARO A;  5B40 A;  5DNM C;  4J8U C;  3VH6 T;  1P3A B;  5B32 G;  5B0Z C;  4JJN A;  5B0Y D;  3AV2 D;  1M18 B;  4H9N A;  3WTP E;  5AV6 A;  4J8V A;  5AV5 A;  5B2I A;  3AZE A;  3W96 B;  3AZL D;  3MGR A;  3AZM B;  3REH C;  1HQ3 A;  1S32 D;  3W97 B;  1P3O D;  1WWS A;  4NFT A;  3MNN A;  3WKJ D;  5G49 A;  4J8X A;  5GT0 C;  1P3O B;  4CSR B;  5B31 A;  2NQB B;  3UTA C;  1P3A C;  3AZG B;  5E5A A;  5GXQ B;  1P3P B;  5CPI C;  1P3O C;  5AV8 D;  4YS3 C;  3AV1 C;  1BFM A;  4CSR A;  3C1C A;  2F8N G;  5B40 D;  3W99 B;  5CPJ A;  3AFA C;  5F99 A;  4DRA A;  4ZUX C;  1KX3 C;  5AV6 D;  5GT0 B;  3X1V A;  3C1B D;  3B6F B;  4EO5 C;  3WTP A;  3AZF C;  5CPK B;  2ARO D;  3REJ C;  3C1B A;  4AWL B;  3W98 C;  3R45 A;  4YM6 A;  1H3O B;  3W96 C;  4J8V D;  3AZN A;  5F99 B;  5B1L A;  3MGR B;  1P3L D;  2BYM B;  4G91 C;  4H9Q A;  3TU4 D;  3UT9 A;  3AZI D;  3W98 A;  5E5A C;  2ARO C;  3UTA A;  4XUJ D;  5JRG C;  3MNN B;  1P34 A;  2RVQ C;  1KX4 B;  5B32 A;  4KGC A;  3AZM D;  3V9R A;  5B31 C;  3AZL B;  2CV5 C;  5CPJ D;  5B1L B;  3LJA C;  1AOI D;  5B1L C;  5E5A B;  3UT9 B;  3VH5 T;  4KGC D;  5B2J A;  2IO5 C;  5CPI A;  5DNN B;  3AZN C;  4XZQ B;  3KXB D;  1P3K A;  1P3B D;  1KX5 A;  3REI C;  5CPI D;  5JRG B;  3LEL D;  1B6W A;  1M1A C;  1S32 A;  4H9N B;  4J8U A;  4J8V B;  5B40 C;  4WNN A;  5AV9 D;  1AOI C;  1KX3 A;  3WKJ A;  5B1L D;  3B6F A;  5DNN A;  1P3G B;  5B24 C;  3A6N B;  5GT3 D;  3B6G D;  5AV9 A;  5AVB A;  1H3O A;  1N1J A;  4J8X B;  4Z2M H;  5BNV B;  4XUJ A;  3AZF B;  5B32 C;  3LEL B;  3LZ0 B;  1P3F B;  3O62 A;  4WV4 B;  5DNM A;  5AV8 A;  4ZUX B;  4KUD A;  1P3B B;  3MGP C;  3O62 D;  4H9S C;  3X1U D;  5CPK C;  5B24 D;  3REK B;  1P3I D;  5GT3 C;  3B6G C;  3AZG D;  1P3A D;  3KWQ A;  3AZH B;  1F66 B;  3WA9 C;  3MGS D;  3REL C;  1KX4 A;  5BNV A;  3X1V D;  2YFW A;  3V9R B;  3LEL A;  4CAY A;  1KX4 D;  5B2J D;  2HIO C;  3WA9 A;  4YS3 B;  5B2J B;  1KX3 D;  3REH D;  1KX5 D;  1S32 C;  4UUZ B;  1P3P C;  4H9S A;  5CPK A;  3KWQ B;  1P3G D;  4X23 B;  2HUE C;  3MGS C;  3REL D;  3AZK A;  3REI A;  2YFW B;  2BYK B;  3WAA D;  4J8U B;  4ZBJ B;  1TZY A;  4J8W D;  5B2J C;  4WNN B;  3UTA D;  4E44 A;  3NQJ B;  3AZH C;  4LD9 C;  5AV9 C;  5B0Z B;  4H9R A;  1P3M A;  5AVB B;  3X1U A;  3REH B;  1P3I A;  4YS3 D;  2PYO D;  1M19 B;  3C1C B;  1Q9C A;  3KUY A;  5BS7 A;  5CPJ B;  5DNM D;  1R4V A;  2HIO B;  3LZ0 A;  1P34 D;  1P3F A;  1ULY A;  2RVQ D;  3B0D B;  3WTP C;  5FUG B;  4R8P B;  3REK C;  3AZF A;  3AZI A;  1ID3 C;  5GT0 A;  3X1V B;  5B32 D;  1P3B A;  5AV8 B;  4J8W B;  3B0C W;  3AZH D;  4LD9 D;  3AZJ A;  1P3M B;  3MGQ B;  2LY8 A;  1HQ3 C;  3WAA B;  3AZH A;  5B2I C;  5AV5 C;  3AZE C;  3AZJ D;  1P3B C;  4J8V C;  3REJ A;  4WU8 A;  5CP6 A;  5B1M B;  5B33 C;  2JSS A;  3MGP A;  3WKJ B;  3LZ1 D;  4E45 A;  4J8W A;  3TU4 C;  4Z66 C;  3AYW C;  1P3G A;  3MGQ A;  2F8N H;  4NE6 A;  3UT9 C;  5JRG D;  4XUJ C;  3AV1 A;  4XUJ B;  3MNN D;  4HGA B;  4G92 B;  3KUY D;  1M19 D;  3O62 B;  4XZQ C;  5B40 B;  3MGR C;  4Z66 B;  5B0Z D;  3W96 A;  5B2I B;  5AV5 B;  3AZE B;  2NZD A;  3MGS A;  3AZK C;  5AV6 C;  4DRB A;  3C1B C;  4Z66 D;  3REK A;  5B0Z A;  2FJ7 D;  3KUY B;  3X1V C;  2HIO A;  2NQB D;  3MNN C;  5F99 C;  3WA9 D; 
#chains in the Genus database with same CATH topology
 4EO5 B;  1P3M C;  5GSU A;  2HIO D;  3AZI B;  5B31 B;  1KX3 B;  2NQB A;  3KXB A;  1P3K D;  4LD9 A;  3X1S D;  2G5I C;  1KX4 C;  3W99 C;  3LZ1 A;  5GSU D;  3WAA A;  5AVC D;  5B33 B;  5B0Y A;  3AV2 A;  4H9O B;  3B6F C;  4WU8 D;  5AV8 C;  5B2I D;  5B1M A;  5AV5 D;  3AZE D;  3X1T C;  2YFV B;  3REJ B;  5DNN D;  1P3M D;  3EPK A;  3WAA C;  4LD9 B;  5C3I C;  2ZY3 A;  5BO0 B;  3VH6 A;  3FDD A;  1P3L A;  1EQZ B;  4XZQ A;  5GSU C;  4AWL C;  3AZG C;  3AZF D;  3H0L C;  3R45 B;  1KX5 B;  1M19 A;  1ZLA C;  2HUE B;  1A7W A;  3AN2 D;  5AY8 D;  5KDM A;  3H0M C;  3A1I A;  3KWQ C;  2PYO C;  4JJN C;  2NZD D;  1S32 B;  4ZBJ C;  3A6N D;  2F8N B;  5AY8 A;  4Z66 A;  1F66 C;  3WA9 B;  3MGS B;  1KX5 C;  3A6N A;  1TAF B;  4KHA A;  5GXQ D;  4X23 A;  1ZLA D;  3F6T A;  5B32 B;  5C3I B;  4WU8 B;  2NQB C;  5B33 D;  4QLC D;  4X23 C;  3KSY A;  3KXB B;  5DNM B;  3MGP B;  5GSU B;  5CP6 D;  3AYW A;  3UTB C;  4KUD B;  2CV5 D;  2PYO B;  1P3K B;  3MGP D;  3MVD B;  2Y2O A;  2Y2N A;  3W96 D;  4J8X C;  3KUY C;  3W97 A;  1EQZ C;  4H9P B;  3AL0 C;  3W98 D;  1WWI A;  3NQU B;  3EPL A;  3WTP D;  2Y2Q A;  5B24 B;  3LEL C;  3REK D;  2FJ7 A;  1P3L B;  4YS3 A;  3MGR D;  2F8N D;  1ID3 A;  4UUZ A;  2W8S A;  1N1J B;  3LZ0 C;  1P3F C;  1BH8 A;  1P3G C;  3X1T A;  4Z2M G;  3AZK B;  4H9P A;  1AOI B;  5B31 D;  5AY8 C;  4R8P D;  1F1E A;  3P5J B;  4HGA C;  3LZ1 C;  4WU9 B;  4NE3 A;  3NQJ A;  5AV6 B;  3LZ1 B;  1F66 D;  1TAF A;  3AZL C;  1TZY C;  3X1U B;  3REH A;  3W99 D;  3REJ D;  3AZM A;  1P3I B;  1BH8 B;  2XD1 A;  4QLC A;  1AOI A;  3WKJ C;  3LJA B;  3REI D;  4YM6 B;  4XZQ D;  2L5A A;  3MGQ D;  5BT1 D;  4G91 B;  4WU9 A;  3W98 B;  5BS7 C;  3AYW B;  4CAY B;  3UTB A;  5BNX B;  1P34 B;  3LJA A;  4KUD D;  5AVB C;  3AN2 B;  4Z5T C;  5CP6 B;  3B0D C;  1W2E A;  5GT3 A;  3B6G A;  5B24 A;  2BYK A;  2FJ7 B;  3MGQ C;  1P3A A;  3LJA D;  5BT1 C;  5CPI B;  1BH9 B;  4J8W C;  3TU4 A;  2UWX A;  5GXQ C;  1U35 D;  1ID3 B;  5B33 A;  5B0Y B;  3AV2 B;  5B31 G;  3WTP B;  4WU8 C;  3H0R C;  3AV1 B;  2ZM5 A;  1U35 A;  4WZS B;  4QLC C;  4X23 D;  4R8P A;  1M19 C;  1ZLA A;  4Z5T D;  1M1A D;  5AVC B;  2NZD B;  5BO0 A;  4R8P C;  3MVD C;  1B67 A;  3C1C D;  3REL A;  3AZK D;  1EQZ A;  3W97 C;  3UTB D;  2RIQ A;  2FFF B;  3B0C T;  5B1M D;  4QLC B;  1TZY D;  1EQZ D;  5KDM B;  2Y2G A;  5JRG A;  5AV9 B;  3UTA B;  1ZLA B;  3AV1 D;  4JJN D;  3AFA A;  5B0Y C;  3AV2 C;  2NZD C;  2F8N A;  3AZM C;  4J8U D;  2JCH A;  4YM6 D;  4JJN B;  3AZL A;  3AFA D;  3EG5 B;  3REL B;  4ZUX D;  4KHA B;  1M18 C;  5BNX A;  3AZN D;  2DQN C;  3LZ0 D;  1P3F D;  5AVC C;  3X1T B;  5GT0 D;  3UT9 D;  1P34 C;  1F66 A;  3X1T D;  5GT3 B;  3B6G B;  5CHL B;  4Z5T B;  5JA4 B;  5CP6 C;  2PYO A;  1BH9 A;  3MVD A;  1M18 D;  1P3P D;  3AZG A;  2F8N K;  2FJ7 C;  3VH6 W;  3AZJ C;  1U35 B;  3REI B;  3AN2 C;  1KU5 A;  2CV5 A;  1TZY B;  5F99 D;  3AZI C;  2Y2H A;  3A6N C;  4NE5 A;  4KGC B;  2Y2M A;  3X1S C;  4WU9 D;  4ZUX A;  3W97 D;  3O62 C;  3X1U C;  5CPK D;  4H9O A;  1P3I C;  1M1A B;  4G92 C;  4H9R B;  3C1B B;  2YFV A;  3B6F D;  3AN2 A;  2CV5 B;  5FUG A;  1P3O A;  1JFI B;  5G49 B;  1PZR A;  4M6B A;  5AVB D;  1ID3 D;  1P3L C;  5DNN C;  3AZN B;  3TU4 B;  2CWE A;  4YM6 C;  3AZJ B;  1U35 C;  2BYM A;  4H9Q B;  1HQ3 D;  4WU9 C;  2Y2L A;  3VH5 W;  1M1A A;  1P3P A;  5GXQ A;  5E5A D;  4J8X D;  3X1S B;  2IO5 B;  2XD5 A;  3NQU A;  1JFI A;  2ARO B;  5CPJ C;  1T3U A;  3KWQ D;  1HTA A;  5AVC A;  1P3K C;  3VH5 A;  3MVD D;  3C1C C;  4Z5T A;  5JA4 A;  3UTB B;  1M18 A;  3W99 A;  3AYW D;  5AY8 B;  3KXB C;  4KGC C;  1HQ3 B;  5B1M C;  3X1S A;  4KUD C;  3B0B A;  3AFA B;  2ARO A;  5B40 A;  5DNM C;  4J8U C;  3VH6 T;  1P3A B;  5B32 G;  5B0Z C;  3EPJ A;  4JJN A;  5B0Y D;  3AV2 D;  1M18 B;  4H9N A;  3WTP E;  5AV6 A;  4J8V A;  5AV5 A;  5B2I A;  3AZE A;  3W96 B;  3AZL D;  3MGR A;  3AZM B;  3REH C;  1HQ3 A;  1S32 D;  3W97 B;  1P3O D;  1WWS A;  4NFT A;  3MNN A;  3WKJ D;  5G49 A;  4J8X A;  5GT0 C;  1P3O B;  4CSR B;  5B31 A;  4DQY B;  2NQB B;  3UTA C;  1P3A C;  3AZG B;  5E5A A;  5GXQ B;  1P3P B;  5CPI C;  1P3O C;  5AV8 D;  4YS3 C;  3AV1 C;  1BFM A;  2F2A C;  4CSR A;  3C1C A;  2F8N G;  5B40 D;  3W99 B;  5CPJ A;  2BG1 A;  3AFA C;  5F99 A;  4DRA A;  4ZUX C;  1KX3 C;  5AV6 D;  5GT0 B;  3X1V A;  3C1B D;  3B6F B;  4EO5 C;  3WTP A;  3AZF C;  5CPK B;  2ARO D;  3REJ C;  3C1B A;  4AWL B;  3W98 C;  3R45 A;  4YM6 A;  1H3O B;  3W96 C;  2Y2I A;  4J8V D;  2ZY4 A;  3AZN A;  5F99 B;  5B1L A;  3MGR B;  1P3L D;  2BYM B;  4G91 C;  4H9Q A;  3TU4 D;  3UT9 A;  3AZI D;  3W98 A;  5E5A C;  2ARO C;  3UTA A;  4XUJ D;  5JRG C;  3MNN B;  1P34 A;  2RVQ C;  1KX4 B;  5B32 A;  4KGC A;  3AZM D;  3V9R A;  5B31 C;  3AZL B;  2ZY5 A;  2CV5 C;  5CPJ D;  5B1L B;  3KFU G;  3LJA C;  1AOI D;  5B1L C;  5E5A B;  3UT9 B;  3VH5 T;  4KGC D;  5B2J A;  2IO5 C;  5CPI A;  5DNN B;  3AZN C;  4XZQ B;  3KXB D;  1P3K A;  1P3B D;  1KX5 A;  3REI C;  5CPI D;  3LEL D;  1B6W A;  2Y2P A;  3A1K A;  1M1A C;  1S32 A;  4H9N B;  4J8U A;  4J8V B;  5B40 C;  4WNN A;  5AV9 D;  1AOI C;  1KX3 A;  3WKJ A;  5B1L D;  3B6F A;  5DNN A;  1P3G B;  5B24 C;  3A6N B;  5GT3 D;  3B6G D;  5AV9 A;  5AVB A;  1H3O A;  1N1J A;  4J8X B;  4Z2M H;  5BNV B;  4XUJ A;  3AZF B;  5B32 C;  3LEL B;  3LZ0 B;  1P3F B;  3O62 A;  4WV4 B;  5DNM A;  5AV8 A;  4ZUX B;  4KUD A;  1P3B B;  3MGP C;  4UPK A;  3O62 D;  4H9S C;  3X1U D;  3MNN C;  5B24 D;  3REK B;  5CPK C;  5GT3 C;  1P3I D;  3B6G C;  3AZG D;  1P3A D;  3KWQ A;  3AZH B;  1F66 B;  3WA9 C;  3MGS D;  3REL C;  1KX4 A;  5BNV A;  3X1V D;  2YFW A;  3V9R B;  2Y2K A;  3LEL A;  4CAY A;  1KX4 D;  5B2J D;  2HIO C;  2J8P A;  3WA9 A;  4YS3 B;  5B2J B;  1KX3 D;  3REH D;  1KX5 D;  1S32 C;  4UUZ B;  1P3P C;  4H9S A;  5CPK A;  3KWQ B;  1P3G D;  4X23 B;  2HUE C;  3MGS C;  3REL D;  3AZK A;  3REI A;  2YFW B;  2BYK B;  3WAA D;  4J8U B;  4ZBJ B;  1TZY A;  4J8W D;  5B2J C;  4WNN B;  3UTA D;  2DF4 C;  4E44 A;  3NQJ B;  3AZH C;  4LD9 C;  5AV9 C;  5B0Z B;  4H9R A;  3EPH A;  1P3M A;  5AVB B;  3X1U A;  3REH B;  1P3I A;  4YS3 D;  2PYO D;  4WJ3 C;  1M19 B;  3C1C B;  1Q9C A;  3KUY A;  3IP4 C;  5BS7 A;  5CPJ B;  5DNM D;  1R4V A;  2HIO B;  3LZ0 A;  1P34 D;  1P3F A;  1ULY A;  2RVQ D;  3B0D B;  3WTP C;  5FUG B;  4R8P B;  3REK C;  3AZF A;  3AZI A;  1ID3 C;  5GT0 A;  3X1V B;  5B32 D;  1P3B A;  2JE5 A;  5AV8 B;  4J8W B;  3B0C W;  3AZH D;  4LD9 D;  3AZJ A;  1P3M B;  3MGQ B;  2LY8 A;  1HQ3 C;  3WAA B;  3AZH A;  2G5H C;  5B2I C;  5AV5 C;  3AZE C;  3AZJ D;  1P3B C;  4J8V C;  3REJ A;  4WU8 A;  5CP6 A;  5B1M B;  5B33 C;  2JSS A;  3MGP A;  1Z2C B;  3WKJ B;  3LZ1 D;  4E45 A;  4J8W A;  3TU4 C;  4Z66 C;  2ZY2 A;  3AYW C;  1P3G A;  3MGQ A;  2F8N H;  4NE6 A;  3UT9 C;  5JRG D;  4XUJ C;  3AV1 A;  4XUJ B;  3MNN D;  4HGA B;  4G92 B;  3KUY D;  1M19 D;  3O62 B;  4XZQ C;  5B40 B;  3MGR C;  4Z66 B;  5B0Z D;  3W96 A;  5B2I B;  5AV5 B;  3AZE B;  2NZD A;  3MGS A;  3AZK C;  5AV6 C;  4DRB A;  3C1B C;  4Z66 D;  3REK A;  2Y2J A;  5B0Z A;  2FJ7 D;  2VQR A;  3KUY B;  3X1V C;  2HIO A;  2NQB D;  5JRG B;  5F99 C;  3WA9 D; 
#chains in the Genus database with same CATH homology
 4EO5 B;  1P3M C;  5GSU A;  2HIO D;  3AZI B;  5B31 B;  1KX3 B;  2NQB A;  3KXB A;  1P3K D;  4LD9 A;  3X1S D;  2G5I C;  1KX4 C;  3W99 C;  3LZ1 A;  5GSU D;  3WAA A;  5AVC D;  5B33 B;  5B0Y A;  3AV2 A;  4H9O B;  3B6F C;  4WU8 D;  5AV8 C;  5B2I D;  5B1M A;  5AV5 D;  3AZE D;  3X1T C;  2YFV B;  3REJ B;  5DNN D;  1P3M D;  3EPK A;  3WAA C;  4LD9 B;  5C3I C;  2ZY3 A;  5BO0 B;  3VH6 A;  3FDD A;  1P3L A;  1EQZ B;  4XZQ A;  5GSU C;  4AWL C;  3AZG C;  3AZF D;  3H0L C;  3R45 B;  1KX5 B;  1M19 A;  1ZLA C;  2HUE B;  1A7W A;  3AN2 D;  5AY8 D;  5KDM A;  3H0M C;  3A1I A;  3KWQ C;  2PYO C;  4JJN C;  2NZD D;  1S32 B;  4ZBJ C;  3A6N D;  2F8N B;  5AY8 A;  4Z66 A;  1F66 C;  3WA9 B;  3MGS B;  1KX5 C;  3A6N A;  1TAF B;  4KHA A;  5GXQ D;  4X23 A;  1ZLA D;  3F6T A;  5B32 B;  5C3I B;  4WU8 B;  2NQB C;  5B33 D;  4QLC D;  4X23 C;  3KSY A;  3KXB B;  5DNM B;  3MGP B;  5GSU B;  5CP6 D;  3AYW A;  3UTB C;  4KUD B;  2CV5 D;  2PYO B;  1P3K B;  3MGP D;  3MVD B;  2Y2O A;  2Y2N A;  3W96 D;  4J8X C;  3KUY C;  3W97 A;  1EQZ C;  4H9P B;  3AL0 C;  3W98 D;  1WWI A;  3NQU B;  3EPL A;  3WTP D;  2Y2Q A;  5B24 B;  3LEL C;  3REK D;  2FJ7 A;  1P3L B;  4YS3 A;  3MGR D;  2F8N D;  1ID3 A;  4UUZ A;  2W8S A;  1N1J B;  3LZ0 C;  1P3F C;  1BH8 A;  1P3G C;  3X1T A;  4Z2M G;  3AZK B;  4H9P A;  1AOI B;  5B31 D;  5AY8 C;  4R8P D;  1F1E A;  3P5J B;  4HGA C;  3LZ1 C;  4WU9 B;  4NE3 A;  3NQJ A;  5AV6 B;  3LZ1 B;  1F66 D;  1TAF A;  3AZL C;  1TZY C;  3X1U B;  3REH A;  3W99 D;  3REJ D;  3AZM A;  1P3I B;  1BH8 B;  2XD1 A;  4QLC A;  1AOI A;  3WKJ C;  3LJA B;  3REI D;  4YM6 B;  4XZQ D;  2L5A A;  3MGQ D;  5BT1 D;  4G91 B;  4WU9 A;  3W98 B;  5BS7 C;  3AYW B;  4CAY B;  3UTB A;  5BNX B;  1P34 B;  3LJA A;  4KUD D;  5AVB C;  3AN2 B;  4Z5T C;  5CP6 B;  3B0D C;  1W2E A;  5GT3 A;  3B6G A;  5B24 A;  2BYK A;  2FJ7 B;  3MGQ C;  1P3A A;  3LJA D;  5BT1 C;  5CPI B;  1BH9 B;  4J8W C;  3TU4 A;  2UWX A;  5GXQ C;  1U35 D;  1ID3 B;  5B33 A;  5B0Y B;  3AV2 B;  5B31 G;  3WTP B;  4WU8 C;  3H0R C;  3AV1 B;  2ZM5 A;  1U35 A;  4WZS B;  4QLC C;  4X23 D;  4R8P A;  1M19 C;  1ZLA A;  4Z5T D;  1M1A D;  5AVC B;  2NZD B;  5BO0 A;  4R8P C;  3MVD C;  1B67 A;  3C1C D;  3REL A;  3AZK D;  1EQZ A;  3W97 C;  3UTB D;  2RIQ A;  2FFF B;  3B0C T;  5B1M D;  4QLC B;  1TZY D;  1EQZ D;  5KDM B;  2Y2G A;  5JRG A;  5AV9 B;  3UTA B;  1ZLA B;  3AV1 D;  4JJN D;  3AFA A;  5B0Y C;  3AV2 C;  2NZD C;  2F8N A;  3AZM C;  4J8U D;  2JCH A;  4YM6 D;  4JJN B;  3AZL A;  3AFA D;  3EG5 B;  3REL B;  4ZUX D;  4KHA B;  1M18 C;  5BNX A;  3AZN D;  2DQN C;  3LZ0 D;  1P3F D;  5AVC C;  3X1T B;  5GT0 D;  3UT9 D;  1P34 C;  1F66 A;  3X1T D;  5GT3 B;  3B6G B;  5CHL B;  4Z5T B;  5JA4 B;  5CP6 C;  2PYO A;  1BH9 A;  3MVD A;  1M18 D;  1P3P D;  3AZG A;  2F8N K;  2FJ7 C;  3VH6 W;  3AZJ C;  1U35 B;  3REI B;  3AN2 C;  1KU5 A;  2CV5 A;  1TZY B;  5F99 D;  3AZI C;  2Y2H A;  3A6N C;  4NE5 A;  4KGC B;  2Y2M A;  3X1S C;  4WU9 D;  4ZUX A;  3W97 D;  3O62 C;  3X1U C;  5CPK D;  4H9O A;  1P3I C;  1M1A B;  4G92 C;  4H9R B;  3C1B B;  2YFV A;  3B6F D;  3AN2 A;  2CV5 B;  5FUG A;  1P3O A;  1JFI B;  5G49 B;  1PZR A;  4M6B A;  5AVB D;  1ID3 D;  1P3L C;  5DNN C;  3AZN B;  3TU4 B;  2CWE A;  4YM6 C;  3AZJ B;  1U35 C;  2BYM A;  4H9Q B;  1HQ3 D;  4WU9 C;  2Y2L A;  3VH5 W;  1M1A A;  1P3P A;  5GXQ A;  5E5A D;  4J8X D;  3X1S B;  2IO5 B;  2XD5 A;  3NQU A;  1JFI A;  2ARO B;  5CPJ C;  1T3U A;  3KWQ D;  1HTA A;  5AVC A;  1P3K C;  3VH5 A;  3MVD D;  3C1C C;  4Z5T A;  5JA4 A;  3UTB B;  1M18 A;  3W99 A;  3AYW D;  5AY8 B;  3KXB C;  4KGC C;  1HQ3 B;  5B1M C;  3X1S A;  4KUD C;  3B0B A;  3AFA B;  2ARO A;  5B40 A;  5DNM C;  4J8U C;  3VH6 T;  1P3A B;  5B32 G;  5B0Z C;  3EPJ A;  4JJN A;  5B0Y D;  3AV2 D;  1M18 B;  4H9N A;  3WTP E;  5AV6 A;  4J8V A;  5AV5 A;  5B2I A;  3AZE A;  3W96 B;  3AZL D;  3MGR A;  3AZM B;  3REH C;  1HQ3 A;  1S32 D;  3W97 B;  1P3O D;  1WWS A;  4NFT A;  3MNN A;  3WKJ D;  5G49 A;  4J8X A;  5GT0 C;  1P3O B;  4CSR B;  5B31 A;  4DQY B;  2NQB B;  3UTA C;  1P3A C;  3AZG B;  5E5A A;  5GXQ B;  1P3P B;  5CPI C;  1P3O C;  5AV8 D;  4YS3 C;  3AV1 C;  1BFM A;  2F2A C;  4CSR A;  3C1C A;  2F8N G;  5B40 D;  3W99 B;  5CPJ A;  2BG1 A;  3AFA C;  5F99 A;  4DRA A;  4ZUX C;  1KX3 C;  5AV6 D;  5GT0 B;  3X1V A;  3C1B D;  3B6F B;  4EO5 C;  3WTP A;  3AZF C;  5CPK B;  2ARO D;  3REJ C;  3C1B A;  4AWL B;  3W98 C;  3R45 A;  4YM6 A;  1H3O B;  3W96 C;  2Y2I A;  4J8V D;  2ZY4 A;  3AZN A;  5F99 B;  5B1L A;  3MGR B;  1P3L D;  2BYM B;  4G91 C;  4H9Q A;  3TU4 D;  3UT9 A;  3AZI D;  3W98 A;  5E5A C;  2ARO C;  3UTA A;  4XUJ D;  5JRG C;  3MNN B;  1P34 A;  2RVQ C;  1KX4 B;  5B32 A;  4KGC A;  3AZM D;  3V9R A;  5B31 C;  3AZL B;  2ZY5 A;  2CV5 C;  5CPJ D;  5B1L B;  3KFU G;  3LJA C;  1AOI D;  5B1L C;  5E5A B;  3UT9 B;  3VH5 T;  4KGC D;  5B2J A;  2IO5 C;  5CPI A;  5DNN B;  3AZN C;  4XZQ B;  3KXB D;  1P3K A;  1P3B D;  1KX5 A;  3REI C;  5CPI D;  3LEL D;  1B6W A;  2Y2P A;  3A1K A;  1M1A C;  1S32 A;  4H9N B;  4J8U A;  4J8V B;  5B40 C;  4WNN A;  5AV9 D;  1AOI C;  1KX3 A;  3WKJ A;  5B1L D;  3B6F A;  5DNN A;  1P3G B;  5B24 C;  3A6N B;  5GT3 D;  3B6G D;  5AV9 A;  5AVB A;  1H3O A;  1N1J A;  4J8X B;  4Z2M H;  5BNV B;  4XUJ A;  3AZF B;  5B32 C;  3LEL B;  3LZ0 B;  1P3F B;  3O62 A;  4WV4 B;  5DNM A;  5AV8 A;  4ZUX B;  4KUD A;  1P3B B;  3MGP C;  4UPK A;  3O62 D;  4H9S C;  3X1U D;  3MNN C;  5B24 D;  3REK B;  5CPK C;  5GT3 C;  1P3I D;  3B6G C;  3AZG D;  1P3A D;  3KWQ A;  3AZH B;  1F66 B;  3WA9 C;  3MGS D;  3REL C;  1KX4 A;  5BNV A;  3X1V D;  2YFW A;  3V9R B;  2Y2K A;  3LEL A;  4CAY A;  1KX4 D;  5B2J D;  2HIO C;  2J8P A;  3WA9 A;  4YS3 B;  5B2J B;  1KX3 D;  3REH D;  1KX5 D;  1S32 C;  4UUZ B;  1P3P C;  4H9S A;  5CPK A;  3KWQ B;  1P3G D;  4X23 B;  2HUE C;  3MGS C;  3REL D;  3AZK A;  3REI A;  2YFW B;  2BYK B;  3WAA D;  4J8U B;  4ZBJ B;  1TZY A;  4J8W D;  5B2J C;  4WNN B;  3UTA D;  2DF4 C;  4E44 A;  3NQJ B;  3AZH C;  4LD9 C;  5AV9 C;  5B0Z B;  4H9R A;  3EPH A;  1P3M A;  5AVB B;  3X1U A;  3REH B;  1P3I A;  4YS3 D;  2PYO D;  4WJ3 C;  1M19 B;  3C1C B;  1Q9C A;  3KUY A;  3IP4 C;  5BS7 A;  5CPJ B;  5DNM D;  1R4V A;  2HIO B;  3LZ0 A;  1P34 D;  1P3F A;  1ULY A;  2RVQ D;  3B0D B;  3WTP C;  5FUG B;  4R8P B;  3REK C;  3AZF A;  3AZI A;  1ID3 C;  5GT0 A;  3X1V B;  5B32 D;  1P3B A;  2JE5 A;  5AV8 B;  4J8W B;  3B0C W;  3AZH D;  4LD9 D;  3AZJ A;  1P3M B;  3MGQ B;  2LY8 A;  1HQ3 C;  3WAA B;  3AZH A;  2G5H C;  5B2I C;  5AV5 C;  3AZE C;  3AZJ D;  1P3B C;  4J8V C;  3REJ A;  4WU8 A;  5CP6 A;  5B1M B;  5B33 C;  2JSS A;  3MGP A;  1Z2C B;  3WKJ B;  3LZ1 D;  4E45 A;  4J8W A;  3TU4 C;  4Z66 C;  2ZY2 A;  3AYW C;  1P3G A;  3MGQ A;  2F8N H;  4NE6 A;  3UT9 C;  5JRG D;  4XUJ C;  3AV1 A;  4XUJ B;  3MNN D;  4HGA B;  4G92 B;  3KUY D;  1M19 D;  3O62 B;  4XZQ C;  5B40 B;  3MGR C;  4Z66 B;  5B0Z D;  3W96 A;  5B2I B;  5AV5 B;  3AZE B;  2NZD A;  3MGS A;  3AZK C;  5AV6 C;  4DRB A;  3C1B C;  4Z66 D;  3REK A;  2Y2J A;  5B0Z A;  2FJ7 D;  2VQR A;  3KUY B;  3X1V C;  2HIO A;  2NQB D;  5JRG B;  5F99 C;  3WA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...