5B0ZB

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zB00
5CPJB 1JFIA 3AZED 3B6GA 4E45A 3MGQC 4WU9C 3LJAB 3REIC 2NQBA 1M18D 3AZJA 4Z66D 3LELD 5AVBA 1P3OA 3KWQA 5AV5B 1F66A 3MNNB 3MGRB 2NZDC 5AVCA 3AFAD 1S32A 4WU9B 1N1JB 2PYOA 3VH5W 1KX5C 4UUZA 4XZQC 3AN2C 1AOID 3V9RA 3AZFC 4KUDD 4CAYA 3AZEC 5GT0D 3UTAA 3X1SB 1KX5B 1M18C 4XZQB 4Z66C 3LELC 3AZFB 2F8NK 5GXQA 4ZBJC 2BYKA 4ZUXA 3AFAC 1TZYA 3B0CT 5B40A 1M18B 1H3OB 3O62B 3AZGD 3WAAB 3KXBD 4Z66B 3LELB 1P3AD 1AOIC 3WA9B 4ZBJB 2YFVA 3REKD 4KUDC 5GT3B 4X23B 2F8NH 3B0DC 5KDMA 2AROC 5GT0C 4XUJD 3W97A 1ID3D 4KUDB 1KX4A 3MGSB 2AROB 5GT0B 4M6BA 5B1LB 3AZGC 3KXBC 5B2JD 4G91C 3AV2B 1P3AC 1P3BA 4H9OB 3MVDD 5JRGD 4H9QB 4J8UB 5B0YB 5AY8D 3REKC 1M19A 3AZID 2FJ7C 1BH9A 2CV5D 3AZHD 1WWSA 3KXBB 1P3IB 4J8VD 2YFWA 3KSYA 4XUJC 3AZKD 5B32A 1ID3C 3R45B 1P3LA 2FJ7B 4WU8A 3B6FA 1P3KA 4XUJB 5B2JC 3AZLD 3W98D 4H9RA 5FUGA 3MVDC 5JRGC 3C1CD 3TU4B 3LZ1D 2IO5B 3AZMD 1U35A 1ID3B 1ZLAA 5AY8C 3X1TB 5B24D 5DNND 3AZIC 5CP6B 2CV5C 3AZHC 1P3PD 4JJND 4J8VC 3MVDB 3REJD 3KUYD 3AZKC 1A7WA 4J8XA 5JA4A 4LD9D 4R8PD 5CPJD 1KX3A 3AZLC 3W98C 3C1CC 3LZ1C 3UT9A 3LJAD 2F8NB 1P3GA 1P3PC 2BYMA 3MNND 4JJNC 5AV6A 3MGRD 5DNMB 3C1CB 5C3IC 5B2IB 4WU9D 2HIOB 3AZMA 1TAFB 4JJNB 5B24A 5DNNA 4LD9C 4R8PC 5C3IB 5CPJC 1P34A 3LZ0A 3LJAC 3WTPC 3RELA 5B33C 3REJA 3X1SD 3KUYA 5CPKD 5F99A 3AZFD 4LD9B 4R8PB 4QLCA 4CSRA 3MNNC 3MGRC 3NQUA 3W99D 3AYWB 3WTPB 5B33B 3W96B 3O62D 3WAAD 1B6WA 1P3FD 3AZND 3WA9D 5CPIC 5GT3D 5AV8C 4X23D 5AV5A 4H9NB 3AV1D 3UTBB 3X1SC 1JFIB 3MGQA 4WU9A 5CPKC 1P3MD 5B1MD 4H9SC 3REIA 5CPIB 3B6GB 2F8NG 2NQBB 3W99C 5AV8B 5B31D 3MGSD 2AROD 3KWQB 2NZDA 3WAAC 5B1LD 3O62C 5CPKB 3WKJC 5AVCB 3AV2D 1P3FC 3AZNC 3WA9C 1KX5A 2PYOB 4J8UD 3W99B 4XZQA 3AN2A 5B0YD 5GT3C 4X23C 3AZFA 4KGCD 3AV1C 3MGPD 3V9RB 3AZEA 1P3ID 3WKJB 1P3FB 4CAYB 3AZNB 1P3MC 5B1MC 1M18A 4WV4B 4Z66A 3LELA 3UTAB 5B31C 2FJ7D 3MGSC 3AV1B 4HGAC 5B0ZD 3AFAA 4H9PB 2BYKB 5B1LC 4ZUXB 5B1MB 1P3MB 3AV2C 3TU4D 5B40B 4J8UC 5B31B 1AOIA 5B0YC 4YS3D 3X1TD 5BS7C 4HGAB 5CP6D 4KGCC 3B0CW 4KUDA 2YFVB 3MGPC 1P3IC 2AROA 5GT0A 5BNVA 1B67A 4KGCB 4H9QA 4NE3A 3MGPB 4YM6D 2HUEB 5BT1D 5B0ZC 4KHAB 1KX4B 3AZGA 3KXBA 3TU4C 2IO5C 1P3AA 4YS3C 2F8ND 3X1TC 5CP6C 3REKA 5B0ZB 1P3BB 3X1UD 2FJ7A 5DNMD 1BH9B 4J8WD 5G49A 5B2ID 4YS3B 4XUJA 2HIOD 3X1VD 2YFWB 1ID3A 4YM6C 5BT1C 5B32B 1HQ3B 3C1BD 3B6FB 5B2JA 1M1AD 5BO0A 3A6ND 2L5AA 5GSUD 5JRGA 3MVDA 4YM6B 5AY8A 4H9RB 3X1UC 3AZIA 2CV5A 1ZLAB 5B31G 3AZHA 5DNMC 3B0BA 4J8WC 4J8VA 3AYWD 5B2IC 3WTPD 2HIOC 3NQJB 5B33D 3W96D 3X1VC 3REHC 4WNNA 5E5AD 3AZKA 3X1UB 4Z5TD 1EQZD 2F8NA 5AV9C 4J8WB 3C1BC 4J8XB 1M1AC 3AZLA 3W98A 5JA4B 3REHB 3X1VB 3A6NC 5GSUC 3C1CA 3UTBD 3LZ1A 1KX3B 5CPID 3B6GD 5AV9B 3C1BB 2NQBD 5AV8D 1P3PA 4JJNA 1BH8A 3AZJD 3AYWC 4EO5C 5BNXA 1HTAA 1P3GB 1P3OD 3A6NB 5GSUB 3KWQD 2BYMB 3W96C 5E5AC 4Z5TC 5AVCD 1S32D 1EQZC 4Z2MG 2PYOD 4EO5B 4LD9A 4R8PA 5CPJA 5B32G 5E5AB 3WKJD 4Z5TB 3UTBC 2CWEA 1EQZB 3LJAA 3WTPA 5B33A 3B6GC 1P34B 3RELB 3UTAD 2NQBC 3MNNA 3AZJC 3MGRA 5F99B 5AVBC 1P3OC 3KWQC 5GXQD 4QLCB 1F66C 3NQUB 1N1JA 4ZUXD 4H9NA 5AVCC 2JSSA 1S32C 5B40D 2PYOC 4Z2MH 3AZJB 5CPIA 1BFMA 5AVBB 1P3OB 1F66B 5AV8A 1S32B 1F1EA 4NE6A 3X1SA 4NE5A 5CPKA 4H9SA 3UTAC 4UUZB 3MGQB 4AWLC 3REIB 3W99A 5GXQC 3W97D 1KX4D 4ZUXC 1H3OA 3O62A 3WAAA 1TZYC 5B40C 3WKJA 2NZDB 1P3FA 3AZNA 3WA9A 2RVQD 4AWLB 5GXQB 1P3BD 5GT3A 4X23A 3AN2B 3AV1A 1M19D 1TZYB 4H9PA 1P3MA 5B1MA 3AZEB 4DRAA 4WZSB 5B31A 3MGSA 2HUEC 3W97C 5B32D 1KX4C 1P3LD 4WU8D 1HQ3D 5B1LA 5KDMB 3B6FD 3AV2A 3AFAB 4H9OA 2RVQC 1P3KD 4J8UA 5B0YA 1P3BC 3W97B 5BS7A 1U35D 4NFTA 1ZLAD 4KGCA 1AOIB 3MGPA 1M19C 1P3IA 4KHAA 3B0DB 5CHLB 3R45A 5BNVB 5B32C 1M19B 5B0ZA 1P3LC 4WU8C 1HQ3C 3B6FC 4J8XD 3REHD 3TU4A 1P3KC 1R4VA 1KX3D 4YS3A 3AZGB 4E44A 3X1TA 4DRBA 5AV9D 4G91B 1U35C 5CP6A 1P3AB 1ZLAC 1P3LB 3UT9D 4WU8B 3REKB 1P3GD 1P3KB 1HQ3A 2LY8A 5AV6D 5FUGB 3VH6A 1U35B 5G49B 4YM6A 1ULYA 4J8XC 1KX3C 3NQJA 5B2JB 1P34D 3LZ0D 5BO0B 3X1UA 3RELD 5JRGB 3UT9C 5AY8B 1P3GC 5F99D 3AZIB 5DNMA 4QLCD 4J8WA 3AZHB 2CV5B 5AV6C 5B2IA 1Q9CA 2HIOA 4J8VB 3X1VA 3REHA 3VH6T 3UT9B 1KU5A 1TAFA 4G92C 3VH5A 4WNNB 3AZMC 3AZKB 5AV9A 5AVBD 1F66D 5AV6B 3C1BA 5B24C 5DNNC 1M1AA 3A6NA 5GSUA 5AV5D 1M1AB 1P34C 3LZ0C 4G92B 3AZLB 3W98B 3AZMB 3WTPE 3RELC 3LZ1B 3REJC 3MGQD 3KUYC 3REID 5F99C 5B24B 5DNNB 4QLCC 3AYWA 1P3PB 1BH8B 3W96A 1WWIA 3LZ0B 5BNXB 5E5AA 4Z5TA 2NZDD 3VH6W 1EQZA 3REJB 3KUYB 3VH5T 4CSRB 1KX5D 4XZQD 3AN2D 1TZYD 5AV5C 3UTBA
chains in the Genus database with same CATH superfamily
5CPJB 1JFIA 3AZED 3B6GA 4E45A 3MGQC 4WU9C 3LJAB 3REIC 2NQBA 1M18D 3AZJA 4Z66D 3LELD 5AVBA 1P3OA 3KWQA 5AV5B 1F66A 3MNNB 3MGRB 2BG1A 2NZDC 5AVCA 3AFAD 1S32A 4WU9B 1N1JB 2PYOA 3VH5W 1KX5C 4UUZA 4XZQC 3AN2C 1AOID 1T3UA 3V9RA 3AZFC 2Y2HA 3EG5B 4KUDD 4CAYA 3AZEC 2ZY5A 5GT0D 3UTAA 3X1SB 1KX5B 1M18C 4XZQB 2ZY2A 4Z66C 3LELC 3AZFB 2F8NK 5GXQA 4ZBJC 2BYKA 4ZUXA 3AFAC 1TZYA 3B0CT 5B40A 1M18B 1H3OB 3O62B 3AZGD 3WAAB 3KXBD 4Z66B 3LELB 1P3AD 1AOIC 3WA9B 4ZBJB 2YFVA 3REKD 4KUDC 5GT3B 4X23B 2F8NH 4DQYB 3B0DC 5KDMA 2AROC 3F6TA 5GT0C 2Y2MA 4XUJD 3W97A 1ID3D 4KUDB 1KX4A 3MGSB 2AROB 5GT0B 4M6BA 5B1LB 3AZGC 3KXBC 5B2JD 4G91C 3AV2B 1P3AC 1P3BA 4H9OB 3MVDD 5JRGD 4H9QB 4J8UB 5B0YB 5AY8D 3REKC 1M19A 3AZID 2FJ7C 1BH9A 2CV5D 3AZHD 1WWSA 3KXBB 1P3IB 4J8VD 2YFWA 3KSYA 4XUJC 1Z2CB 3AZKD 5B32A 1ID3C 2JCHA 3R45B 1P3LA 2FJ7B 4WU8A 3B6FA 1P3KA 4XUJB 5B2JC 3AZLD 3W98D 4H9RA 5FUGA 3MVDC 5JRGC 3C1CD 3TU4B 3LZ1D 2IO5B 3AZMD 1U35A 1ID3B 1ZLAA 5AY8C 3X1TB 5B24D 5DNND 3AZIC 5CP6B 2CV5C 3AZHC 1P3PD 4JJND 4J8VC 3MVDB 3REJD 3KUYD 3AZKC 1A7WA 4J8XA 5JA4A 4LD9D 4R8PD 5CPJD 1KX3A 3AZLC 3W98C 3C1CC 3LZ1C 3UT9A 3LJAD 2F8NB 1P3GA 1P3PC 2BYMA 3MNND 4JJNC 5AV6A 3MGRD 5DNMB 3C1CB 5C3IC 5B2IB 4WU9D 2HIOB 2Y2OA 3AZMA 1TAFB 4JJNB 2DF4C 5B24A 5DNNA 4LD9C 4R8PC 2RIQA 5C3IB 5CPJC 3EPKA 1P34A 3LZ0A 3LJAC 3WTPC 3RELA 5B33C 3REJA 3X1SD 3KUYA 5CPKD 2XD5A 2ZM5A 5F99A 3AZFD 2JE5A 4R8PB 4QLCA 4CSRA 3MNNC 4LD9B 3MGRC 3NQUA 3W99D 3AYWB 3WTPB 5B33B 3W96B 3O62D 3A1KA 3WAAD 1B6WA 1P3FD 3AZND 3WA9D 5CPIC 3IP4C 5GT3D 5AV8C 4X23D 5AV5A 3EPLA 3KFUG 4H9NB 3AV1D 3UTBB 3X1SC 1JFIB 3MGQA 4WU9A 5CPKC 1P3MD 5B1MD 4H9SC 3REIA 5CPIB 2VQRA 3B6GB 2F8NG 2NQBB 3W99C 5AV8B 5B31D 3MGSD 2AROD 3KWQB 2NZDA 4WJ3C 3WAAC 2Y2NA 5B1LD 3O62C 5CPKB 3WKJC 5AVCB 3AV2D 1P3FC 3AZNC 3WA9C 1KX5A 2PYOB 4J8UD 3W99B 4XZQA 3AN2A 5B0YD 1PZRA 5GT3C 4X23C 3AZFA 4KGCD 3AV1C 3MGPD 3V9RB 3AZEA 1P3ID 3WKJB 1P3FB 4CAYB 3AZNB 1P3MC 5B1MC 1M18A 4WV4B 4Z66A 3LELA 3UTAB 5B31C 2FJ7D 3MGSC 2Y2QA 3AV1B 4HGAC 5B0ZD 3AFAA 4H9PB 2BYKB 5B1LC 4ZUXB 5B1MB 1P3MB 3AV2C 3TU4D 5B40B 4J8UC 5B31B 4UPKA 5B0YC 4YS3D 1AOIA 3X1TD 5BS7C 4HGAB 5CP6D 4KGCC 3B0CW 4KUDA 2YFVB 3MGPC 1P3IC 2AROA 5GT0A 5BNVA 1B67A 4KGCB 2DQNC 4H9QA 4NE3A 3MGPB 4YM6D 2HUEB 5BT1D 5B0ZC 4KHAB 1KX4B 3AZGA 3KXBA 3TU4C 2IO5C 1P3AA 4YS3C 2F8ND 3X1TC 5CP6C 3REKA 5B0ZB 1P3BB 3X1UD 2FJ7A 3A1IA 5DNMD 1BH9B 4J8WD 5G49A 5B2ID 4YS3B 2W8SA 4XUJA 2HIOD 3X1VD 2YFWB 1ID3A 2ZY3A 4YM6C 5BT1C 5B32B 1HQ3B 3C1BD 3B6FB 5B2JA 1M1AD 5BO0A 3A6ND 2L5AA 5GSUD 5JRGA 3MVDA 4YM6B 5AY8A 2Y2JA 4H9RB 3X1UC 3AZIA 2FFFB 2CV5A 1ZLAB 5B31G 3AZHA 5DNMC 3B0BA 4J8WC 4J8VA 3AYWD 5B2IC 3WTPD 2HIOC 3NQJB 5B33D 3W96D 3X1VC 3REHC 4WNNA 5E5AD 3AZKA 3X1UB 4Z5TD 1EQZD 2F8NA 5AV9C 4J8WB 3C1BC 4J8XB 1M1AC 3AZLA 3W98A 5JA4B 3REHB 3X1VB 3A6NC 5GSUC 3C1CA 3UTBD 3LZ1A 1KX3B 5CPID 3B6GD 5AV9B 3C1BB 2NQBD 5AV8D 3P5JB 1P3PA 4JJNA 1BH8A 3AZJD 3AYWC 4EO5C 5BNXA 1HTAA 1P3GB 1P3OD 3A6NB 5GSUB 3KWQD 2BYMB 3W96C 5E5AC 4Z5TC 5AVCD 1S32D 1EQZC 4Z2MG 2PYOD 4EO5B 4LD9A 4R8PA 5CPJA 5B32G 5E5AB 3WKJD 4Z5TB 3UTBC 2CWEA 1EQZB 3LJAA 3WTPA 5B33A 3B6GC 1P34B 3RELB 3UTAD 2NQBC 3MNNA 3AZJC 3MGRA 5F99B 5AVBC 1P3OC 3KWQC 5GXQD 4QLCB 1F66C 3NQUB 4ZUXD 1N1JA 4H9NA 5AVCC 2JSSA 1S32C 5B40D 2PYOC 4Z2MH 3AZJB 5CPIA 1BFMA 5AVBB 1P3OB 1F66B 2J8PA 5AV8A 1S32B 1F1EA 4NE6A 3X1SA 4NE5A 2ZY4A 5CPKA 2G5HC 4H9SA 3UTAC 4UUZB 3MGQB 4AWLC 3EPJA 3REIB 3W99A 5GXQC 3W97D 2Y2IA 1KX4D 4ZUXC 1H3OA 3O62A 3WAAA 1TZYC 3H0MC 5B40C 2G5IC 3WKJA 1P3FA 2NZDB 3AZNA 3WA9A 2RVQD 4AWLB 5GXQB 1P3BD 5GT3A 4X23A 3AN2B 3AV1A 1M19D 1TZYB 4H9PA 1P3MA 5B1MA 3AZEB 4DRAA 4WZSB 5B31A 3MGSA 2HUEC 3W97C 5B32D 1KX4C 1P3LD 4WU8D 1HQ3D 5B1LA 5KDMB 3B6FD 3AV2A 3AFAB 4H9OA 2RVQC 1P3KD 4J8UA 2XD1A 5B0YA 1P3BC 3W97B 5BS7A 1U35D 4NFTA 1ZLAD 4KGCA 1AOIB 3MGPA 1M19C 1P3IA 4KHAA 2UWXA 3B0DB 5CHLB 3R45A 5BNVB 5B32C 1M19B 2Y2GA 5B0ZA 1P3LC 4WU8C 2Y2LA 1HQ3C 3B6FC 1W2EA 4J8XD 3REHD 3TU4A 1P3KC 1R4VA 1KX3D 4YS3A 3AZGB 4E44A 3X1TA 4DRBA 5AV9D 4G91B 1U35C 5CP6A 1P3AB 1ZLAC 1P3LB 3UT9D 4WU8B 3H0LC 3REKB 1P3GD 1P3KB 1HQ3A 2LY8A 5AV6D 2F2AC 5FUGB 3VH6A 1U35B 5G49B 4YM6A 1ULYA 4J8XC 1KX3C 3NQJA 5B2JB 1P34D 3LZ0D 5BO0B 3X1UA 3RELD 5JRGB 3UT9C 5AY8B 1P3GC 5F99D 3AZIB 5DNMA 4QLCD 4J8WA 3AZHB 2CV5B 5AV6C 5B2IA 1Q9CA 2HIOA 3H0RC 4J8VB 3X1VA 3REHA 3VH6T 3UT9B 1KU5A 3EPHA 1TAFA 4G92C 3VH5A 4WNNB 3AZMC 3AZKB 5AV9A 5AVBD 1F66D 5AV6B 3C1BA 5B24C 5DNNC 1M1AA 3A6NA 5GSUA 5AV5D 1M1AB 1P34C 3LZ0C 4G92B 3AZLB 3W98B 3AZMB 3WTPE 3RELC 3LZ1B 3REJC 3MGQD 3KUYC 3REID 5F99C 5B24B 5DNNB 4QLCC 3AYWA 1P3PB 1BH8B 3W96A 2Y2PA 1WWIA 3LZ0B 5BNXB 3AL0C 5E5AA 4Z5TA 2Y2KA 3VH6W 1EQZA 3REJB 2NZDD 3KUYB 3VH5T 4CSRB 1KX5D 4XZQD 3FDDA 3AN2D 1TZYD 5AV5C 3UTBA
chains in the Genus database with same CATH topology
5CPJB 1JFIA 3AZED 3B6GA 4E45A 3MGQC 4WU9C 3LJAB 3REIC 2NQBA 1M18D 3AZJA 4Z66D 3LELD 5AVBA 1P3OA 3KWQA 5AV5B 1F66A 3MNNB 3MGRB 2BG1A 2NZDC 5AVCA 3AFAD 1S32A 4WU9B 1N1JB 2PYOA 3VH5W 1KX5C 4UUZA 4XZQC 3AN2C 1AOID 1T3UA 3V9RA 3AZFC 2Y2HA 3EG5B 4KUDD 4CAYA 3AZEC 2ZY5A 5GT0D 3UTAA 3X1SB 1KX5B 1M18C 4XZQB 2ZY2A 4Z66C 3LELC 3AZFB 2F8NK 5GXQA 4ZBJC 2BYKA 4ZUXA 3AFAC 1TZYA 3B0CT 5B40A 1M18B 1H3OB 3O62B 3AZGD 3WAAB 3KXBD 4Z66B 3LELB 1P3AD 1AOIC 3WA9B 4ZBJB 2YFVA 3REKD 4KUDC 5GT3B 4X23B 2F8NH 4DQYB 3B0DC 5KDMA 2AROC 3F6TA 5GT0C 2Y2MA 4XUJD 3W97A 1ID3D 4KUDB 1KX4A 3MGSB 2AROB 5GT0B 4M6BA 5B1LB 3AZGC 3KXBC 5B2JD 4G91C 3AV2B 1P3AC 1P3BA 4H9OB 3MVDD 5JRGD 4H9QB 4J8UB 5B0YB 5AY8D 3REKC 1M19A 3AZID 2FJ7C 1BH9A 2CV5D 3AZHD 1WWSA 3KXBB 1P3IB 4J8VD 2YFWA 3KSYA 4XUJC 1Z2CB 3AZKD 5B32A 1ID3C 2JCHA 3R45B 1P3LA 2FJ7B 4WU8A 3B6FA 1P3KA 4XUJB 5B2JC 3AZLD 3W98D 4H9RA 5FUGA 3MVDC 5JRGC 3C1CD 3TU4B 3LZ1D 2IO5B 3AZMD 1U35A 1ID3B 1ZLAA 5AY8C 3X1TB 5B24D 5DNND 3AZIC 5CP6B 2CV5C 3AZHC 1P3PD 4JJND 4J8VC 3MVDB 3REJD 3KUYD 3AZKC 1A7WA 4J8XA 5JA4A 4LD9D 4R8PD 5CPJD 1KX3A 3AZLC 3W98C 3C1CC 3LZ1C 3UT9A 3LJAD 2F8NB 1P3GA 1P3PC 2BYMA 3MNND 4JJNC 5AV6A 3MGRD 5DNMB 3C1CB 5C3IC 5B2IB 4WU9D 2HIOB 2Y2OA 3AZMA 1TAFB 4JJNB 2DF4C 5B24A 5DNNA 4LD9C 4R8PC 2RIQA 5C3IB 5CPJC 3EPKA 1P34A 3LZ0A 3LJAC 3WTPC 3RELA 5B33C 3REJA 3X1SD 3KUYA 5CPKD 2XD5A 2ZM5A 5F99A 3AZFD 2JE5A 4R8PB 4QLCA 4CSRA 3MNNC 4LD9B 3MGRC 3NQUA 3W99D 3AYWB 3WTPB 5B33B 3W96B 3O62D 3A1KA 3WAAD 1B6WA 1P3FD 3AZND 3WA9D 5CPIC 3IP4C 5GT3D 5AV8C 4X23D 5AV5A 3EPLA 3KFUG 4H9NB 3AV1D 3UTBB 3X1SC 1JFIB 3MGQA 4WU9A 5CPKC 1P3MD 5B1MD 4H9SC 3REIA 5CPIB 2VQRA 3B6GB 2F8NG 2NQBB 3W99C 5AV8B 5B31D 3MGSD 2AROD 3KWQB 2NZDA 4WJ3C 3WAAC 2Y2NA 5B1LD 3O62C 5CPKB 3WKJC 5AVCB 3AV2D 1P3FC 3AZNC 3WA9C 1KX5A 2PYOB 4J8UD 3W99B 4XZQA 3AN2A 5B0YD 1PZRA 5GT3C 4X23C 3AZFA 4KGCD 3AV1C 3MGPD 3V9RB 3AZEA 1P3ID 3WKJB 1P3FB 4CAYB 3AZNB 1P3MC 5B1MC 1M18A 4WV4B 4Z66A 3LELA 3UTAB 5B31C 2FJ7D 3MGSC 2Y2QA 3AV1B 4HGAC 5B0ZD 3AFAA 4H9PB 2BYKB 5B1LC 4ZUXB 5B1MB 1P3MB 3AV2C 3TU4D 5B40B 4J8UC 5B31B 4UPKA 5B0YC 4YS3D 1AOIA 3X1TD 5BS7C 4HGAB 5CP6D 4KGCC 3B0CW 4KUDA 2YFVB 3MGPC 1P3IC 2AROA 5GT0A 5BNVA 1B67A 4KGCB 2DQNC 4H9QA 4NE3A 3MGPB 4YM6D 2HUEB 5BT1D 5B0ZC 4KHAB 1KX4B 3AZGA 3KXBA 3TU4C 2IO5C 1P3AA 4YS3C 2F8ND 3X1TC 5CP6C 3REKA 5B0ZB 1P3BB 3X1UD 2FJ7A 3A1IA 5DNMD 1BH9B 4J8WD 5G49A 5B2ID 4YS3B 2W8SA 4XUJA 2HIOD 3X1VD 2YFWB 1ID3A 2ZY3A 4YM6C 5BT1C 5B32B 1HQ3B 3C1BD 3B6FB 5B2JA 1M1AD 5BO0A 3A6ND 2L5AA 5GSUD 5JRGA 3MVDA 4YM6B 5AY8A 2Y2JA 4H9RB 3X1UC 3AZIA 2FFFB 2CV5A 1ZLAB 5B31G 3AZHA 5DNMC 3B0BA 4J8WC 4J8VA 3AYWD 5B2IC 3WTPD 2HIOC 3NQJB 5B33D 3W96D 3X1VC 3REHC 4WNNA 5E5AD 3AZKA 3X1UB 4Z5TD 1EQZD 2F8NA 5AV9C 4J8WB 3C1BC 4J8XB 1M1AC 3AZLA 3W98A 5JA4B 3REHB 3X1VB 3A6NC 5GSUC 3C1CA 3UTBD 3LZ1A 1KX3B 5CPID 3B6GD 5AV9B 3C1BB 2NQBD 5AV8D 3P5JB 1P3PA 4JJNA 1BH8A 3AZJD 3AYWC 4EO5C 5BNXA 1HTAA 1P3GB 1P3OD 3A6NB 5GSUB 3KWQD 2BYMB 3W96C 5E5AC 4Z5TC 5AVCD 1S32D 1EQZC 4Z2MG 2PYOD 4EO5B 4LD9A 4R8PA 5CPJA 5B32G 5E5AB 3WKJD 4Z5TB 3UTBC 2CWEA 1EQZB 3LJAA 3WTPA 5B33A 3B6GC 1P34B 3RELB 3UTAD 2NQBC 3MNNA 3AZJC 3MGRA 5F99B 5AVBC 1P3OC 3KWQC 5GXQD 4QLCB 1F66C 3NQUB 4ZUXD 1N1JA 4H9NA 5AVCC 2JSSA 1S32C 5B40D 2PYOC 4Z2MH 3AZJB 5CPIA 1BFMA 5AVBB 1P3OB 1F66B 2J8PA 5AV8A 1S32B 1F1EA 4NE6A 3X1SA 4NE5A 2ZY4A 5CPKA 2G5HC 4H9SA 3UTAC 4UUZB 3MGQB 4AWLC 3EPJA 3REIB 3W99A 5GXQC 3W97D 2Y2IA 1KX4D 4ZUXC 1H3OA 3O62A 3WAAA 1TZYC 3H0MC 5B40C 2G5IC 3WKJA 1P3FA 2NZDB 3AZNA 3WA9A 2RVQD 4AWLB 5GXQB 1P3BD 5GT3A 4X23A 3AN2B 3AV1A 1M19D 1TZYB 4H9PA 1P3MA 5B1MA 3AZEB 4DRAA 4WZSB 5B31A 3MGSA 2HUEC 3W97C 5B32D 1KX4C 1P3LD 4WU8D 1HQ3D 5B1LA 5KDMB 3B6FD 3AV2A 3AFAB 4H9OA 2RVQC 1P3KD 4J8UA 2XD1A 5B0YA 1P3BC 3W97B 5BS7A 1U35D 4NFTA 1ZLAD 4KGCA 1AOIB 3MGPA 1M19C 1P3IA 4KHAA 2UWXA 3B0DB 5CHLB 3R45A 5BNVB 5B32C 1M19B 2Y2GA 5B0ZA 1P3LC 4WU8C 2Y2LA 1HQ3C 3B6FC 1W2EA 4J8XD 3REHD 3TU4A 1P3KC 1R4VA 1KX3D 4YS3A 3AZGB 4E44A 3X1TA 4DRBA 5AV9D 4G91B 1U35C 5CP6A 1P3AB 1ZLAC 1P3LB 3UT9D 4WU8B 3H0LC 3REKB 1P3GD 1P3KB 1HQ3A 2LY8A 5AV6D 2F2AC 5FUGB 3VH6A 1U35B 5G49B 4YM6A 1ULYA 4J8XC 1KX3C 3NQJA 5B2JB 1P34D 3LZ0D 5BO0B 3X1UA 3RELD 5JRGB 3UT9C 5AY8B 1P3GC 5F99D 3AZIB 5DNMA 4QLCD 4J8WA 3AZHB 2CV5B 5AV6C 5B2IA 1Q9CA 2HIOA 3H0RC 4J8VB 3X1VA 3REHA 3VH6T 3UT9B 1KU5A 3EPHA 1TAFA 4G92C 3VH5A 4WNNB 3AZMC 3AZKB 5AV9A 5AVBD 1F66D 5AV6B 3C1BA 5B24C 5DNNC 1M1AA 3A6NA 5GSUA 5AV5D 1M1AB 1P34C 3LZ0C 4G92B 3AZLB 3W98B 3AZMB 3WTPE 3RELC 3LZ1B 3REJC 3MGQD 3KUYC 3REID 5F99C 5B24B 5DNNB 4QLCC 3AYWA 1P3PB 1BH8B 3W96A 2Y2PA 1WWIA 3LZ0B 5BNXB 3AL0C 5E5AA 4Z5TA 2Y2KA 3VH6W 1EQZA 3REJB 2NZDD 3KUYB 3VH5T 4CSRB 1KX5D 4XZQD 3FDDA 3AN2D 1TZYD 5AV5C 3UTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  1JFI A;  3AZE D;  3B6G A;  4E45 A;  3MGQ C;  4WU9 C;  3LJA B;  3REI C;  2NQB A;  1M18 D;  3AZJ A;  4Z66 D;  3LEL D;  5AVB A;  1P3O A;  3KWQ A;  5AV5 B;  1F66 A;  3MNN B;  3MGR B;  2NZD C;  5AVC A;  3AFA D;  1S32 A;  4WU9 B;  1N1J B;  2PYO A;  3VH5 W;  1KX5 C;  4UUZ A;  4XZQ C;  3AN2 C;  1AOI D;  3V9R A;  3AZF C;  4KUD D;  4CAY A;  3AZE C;  5GT0 D;  3UTA A;  3X1S B;  1KX5 B;  1M18 C;  4XZQ B;  4Z66 C;  3LEL C;  3AZF B;  2F8N K;  5GXQ A;  4ZBJ C;  2BYK A;  4ZUX A;  3AFA C;  1TZY A;  3B0C T;  5B40 A;  1M18 B;  1H3O B;  3O62 B;  3AZG D;  3WAA B;  3KXB D;  4Z66 B;  3LEL B;  1P3A D;  1AOI C;  3WA9 B;  4ZBJ B;  2YFV A;  3REK D;  4KUD C;  5GT3 B;  4X23 B;  2F8N H;  3B0D C;  5KDM A;  2ARO C;  5GT0 C;  4XUJ D;  3W97 A;  1ID3 D;  4KUD B;  1KX4 A;  3MGS B;  2ARO B;  5GT0 B;  4M6B A;  5B1L B;  3AZG C;  3KXB C;  5B2J D;  4G91 C;  3AV2 B;  1P3A C;  1P3B A;  4H9O B;  3MVD D;  5JRG D;  4H9Q B;  4J8U B;  5B0Y B;  5AY8 D;  3REK C;  1M19 A;  3AZI D;  2FJ7 C;  1BH9 A;  2CV5 D;  3AZH D;  1WWS A;  3KXB B;  1P3I B;  4J8V D;  2YFW A;  3KSY A;  4XUJ C;  3AZK D;  5B32 A;  1ID3 C;  3R45 B;  1P3L A;  2FJ7 B;  4WU8 A;  3B6F A;  1P3K A;  4XUJ B;  5B2J C;  3AZL D;  3W98 D;  4H9R A;  5FUG A;  3MVD C;  5JRG C;  3C1C D;  3TU4 B;  3LZ1 D;  2IO5 B;  3AZM D;  1U35 A;  1ID3 B;  1ZLA A;  5AY8 C;  3X1T B;  5B24 D;  5DNN D;  3AZI C;  5CP6 B;  2CV5 C;  3AZH C;  1P3P D;  4JJN D;  4J8V C;  3MVD B;  3REJ D;  3KUY D;  3AZK C;  1A7W A;  4J8X A;  5JA4 A;  4LD9 D;  4R8P D;  5CPJ D;  1KX3 A;  3AZL C;  3W98 C;  3C1C C;  3LZ1 C;  3UT9 A;  3LJA D;  2F8N B;  1P3G A;  1P3P C;  2BYM A;  3MNN D;  4JJN C;  5AV6 A;  3MGR D;  5DNM B;  3C1C B;  5C3I C;  5B2I B;  4WU9 D;  2HIO B;  3AZM A;  1TAF B;  4JJN B;  5B24 A;  5DNN A;  4LD9 C;  4R8P C;  5C3I B;  5CPJ C;  1P34 A;  3LZ0 A;  3LJA C;  3WTP C;  3REL A;  5B33 C;  3REJ A;  3X1S D;  3KUY A;  5CPK D;  5F99 A;  3AZF D;  4LD9 B;  4R8P B;  4QLC A;  4CSR A;  3MNN C;  3MGR C;  3NQU A;  3W99 D;  3AYW B;  3WTP B;  5B33 B;  3W96 B;  3O62 D;  3WAA D;  1B6W A;  1P3F D;  3AZN D;  3WA9 D;  5CPI C;  5GT3 D;  5AV8 C;  4X23 D;  5AV5 A;  4H9N B;  3AV1 D;  3UTB B;  3X1S C;  1JFI B;  3MGQ A;  4WU9 A;  5CPK C;  1P3M D;  5B1M D;  4H9S C;  3REI A;  5CPI B;  3B6G B;  2F8N G;  2NQB B;  3W99 C;  5AV8 B;  5B31 D;  3MGS D;  2ARO D;  3KWQ B;  2NZD A;  3WAA C;  5B1L D;  3O62 C;  5CPK B;  3WKJ C;  5AVC B;  3AV2 D;  1P3F C;  3AZN C;  3WA9 C;  1KX5 A;  2PYO B;  4J8U D;  3W99 B;  4XZQ A;  3AN2 A;  5B0Y D;  5GT3 C;  4X23 C;  3AZF A;  4KGC D;  3AV1 C;  3MGP D;  3V9R B;  3AZE A;  1P3I D;  3WKJ B;  1P3F B;  4CAY B;  3AZN B;  1P3M C;  5B1M C;  1M18 A;  4WV4 B;  4Z66 A;  3LEL A;  3UTA B;  5B31 C;  2FJ7 D;  3MGS C;  3AV1 B;  4HGA C;  5B0Z D;  3AFA A;  4H9P B;  2BYK B;  5B1L C;  4ZUX B;  5B1M B;  1P3M B;  3AV2 C;  3TU4 D;  5B40 B;  4J8U C;  5B31 B;  1AOI A;  5B0Y C;  4YS3 D;  3X1T D;  5BS7 C;  4HGA B;  5CP6 D;  4KGC C;  3B0C W;  4KUD A;  2YFV B;  3MGP C;  1P3I C;  2ARO A;  5GT0 A;  5BNV A;  1B67 A;  4KGC B;  4H9Q A;  4NE3 A;  3MGP B;  4YM6 D;  2HUE B;  5BT1 D;  5B0Z C;  4KHA B;  1KX4 B;  3AZG A;  3KXB A;  3TU4 C;  2IO5 C;  1P3A A;  4YS3 C;  2F8N D;  3X1T C;  5CP6 C;  3REK A;  5B0Z B;  1P3B B;  3X1U D;  2FJ7 A;  5DNM D;  1BH9 B;  4J8W D;  5G49 A;  5B2I D;  4YS3 B;  4XUJ A;  2HIO D;  3X1V D;  2YFW B;  1ID3 A;  4YM6 C;  5BT1 C;  5B32 B;  1HQ3 B;  3C1B D;  3B6F B;  5B2J A;  1M1A D;  5BO0 A;  3A6N D;  2L5A A;  5GSU D;  5JRG A;  3MVD A;  4YM6 B;  5AY8 A;  4H9R B;  3X1U C;  3AZI A;  2CV5 A;  1ZLA B;  5B31 G;  3AZH A;  5DNM C;  3B0B A;  4J8W C;  4J8V A;  3AYW D;  5B2I C;  3WTP D;  2HIO C;  3NQJ B;  5B33 D;  3W96 D;  3X1V C;  3REH C;  4WNN A;  5E5A D;  3AZK A;  3X1U B;  4Z5T D;  1EQZ D;  2F8N A;  5AV9 C;  4J8W B;  3C1B C;  4J8X B;  1M1A C;  3AZL A;  3W98 A;  5JA4 B;  3REH B;  3X1V B;  3A6N C;  5GSU C;  3C1C A;  3UTB D;  3LZ1 A;  1KX3 B;  5CPI D;  3B6G D;  5AV9 B;  3C1B B;  2NQB D;  5AV8 D;  1P3P A;  4JJN A;  1BH8 A;  3AZJ D;  3AYW C;  4EO5 C;  5BNX A;  1HTA A;  1P3G B;  1P3O D;  3A6N B;  5GSU B;  3KWQ D;  2BYM B;  3W96 C;  5E5A C;  4Z5T C;  5AVC D;  1S32 D;  1EQZ C;  4Z2M G;  2PYO D;  4EO5 B;  4LD9 A;  4R8P A;  5CPJ A;  5B32 G;  5E5A B;  3WKJ D;  4Z5T B;  3UTB C;  2CWE A;  1EQZ B;  3LJA A;  3WTP A;  5B33 A;  3B6G C;  1P34 B;  3REL B;  3UTA D;  2NQB C;  3MNN A;  3AZJ C;  3MGR A;  5F99 B;  5AVB C;  1P3O C;  3KWQ C;  5GXQ D;  4QLC B;  1F66 C;  3NQU B;  1N1J A;  4ZUX D;  4H9N A;  5AVC C;  2JSS A;  1S32 C;  5B40 D;  2PYO C;  4Z2M H;  3AZJ B;  5CPI A;  1BFM A;  5AVB B;  1P3O B;  1F66 B;  5AV8 A;  1S32 B;  1F1E A;  4NE6 A;  3X1S A;  4NE5 A;  5CPK A;  4H9S A;  3UTA C;  4UUZ B;  3MGQ B;  4AWL C;  3REI B;  3W99 A;  5GXQ C;  3W97 D;  1KX4 D;  4ZUX C;  1H3O A;  3O62 A;  3WAA A;  1TZY C;  5B40 C;  3WKJ A;  2NZD B;  1P3F A;  3AZN A;  3WA9 A;  2RVQ D;  4AWL B;  5GXQ B;  1P3B D;  5GT3 A;  4X23 A;  3AN2 B;  3AV1 A;  1M19 D;  1TZY B;  4H9P A;  1P3M A;  5B1M A;  3AZE B;  4DRA A;  4WZS B;  5B31 A;  3MGS A;  2HUE C;  3W97 C;  5B32 D;  1KX4 C;  1P3L D;  4WU8 D;  1HQ3 D;  5B1L A;  5KDM B;  3B6F D;  3AV2 A;  3AFA B;  4H9O A;  2RVQ C;  1P3K D;  4J8U A;  5B0Y A;  1P3B C;  3W97 B;  5BS7 A;  1U35 D;  4NFT A;  1ZLA D;  4KGC A;  1AOI B;  3MGP A;  1M19 C;  1P3I A;  4KHA A;  3B0D B;  5CHL B;  3R45 A;  5BNV B;  5B32 C;  1M19 B;  5B0Z A;  1P3L C;  4WU8 C;  1HQ3 C;  3B6F C;  4J8X D;  3REH D;  3TU4 A;  1P3K C;  1R4V A;  1KX3 D;  4YS3 A;  3AZG B;  4E44 A;  3X1T A;  4DRB A;  5AV9 D;  4G91 B;  1U35 C;  5CP6 A;  1P3A B;  1ZLA C;  1P3L B;  3UT9 D;  4WU8 B;  3REK B;  1P3G D;  1P3K B;  1HQ3 A;  2LY8 A;  5AV6 D;  5FUG B;  3VH6 A;  1U35 B;  5G49 B;  4YM6 A;  1ULY A;  4J8X C;  1KX3 C;  3NQJ A;  5B2J B;  1P34 D;  3LZ0 D;  5BO0 B;  3X1U A;  3REL D;  5JRG B;  3UT9 C;  5AY8 B;  1P3G C;  5F99 D;  3AZI B;  5DNM A;  4QLC D;  4J8W A;  3AZH B;  2CV5 B;  5AV6 C;  5B2I A;  1Q9C A;  2HIO A;  4J8V B;  3X1V A;  3REH A;  3VH6 T;  3UT9 B;  1KU5 A;  1TAF A;  4G92 C;  3VH5 A;  4WNN B;  3AZM C;  3AZK B;  5AV9 A;  5AVB D;  1F66 D;  5AV6 B;  3C1B A;  5B24 C;  5DNN C;  1M1A A;  3A6N A;  5GSU A;  5AV5 D;  1M1A B;  1P34 C;  3LZ0 C;  4G92 B;  3AZL B;  3W98 B;  3AZM B;  3WTP E;  3REL C;  3LZ1 B;  3REJ C;  3MGQ D;  3KUY C;  3REI D;  5F99 C;  5B24 B;  5DNN B;  4QLC C;  3AYW A;  1P3P B;  1BH8 B;  3W96 A;  1WWI A;  3LZ0 B;  5BNX B;  5E5A A;  4Z5T A;  2NZD D;  3VH6 W;  1EQZ A;  3REJ B;  3KUY B;  3VH5 T;  4CSR B;  1KX5 D;  4XZQ D;  3AN2 D;  1TZY D;  5AV5 C;  3UTB A; 
#chains in the Genus database with same CATH topology
 5CPJ B;  1JFI A;  3AZE D;  3B6G A;  4E45 A;  3MGQ C;  4WU9 C;  3LJA B;  3REI C;  2NQB A;  1M18 D;  3AZJ A;  4Z66 D;  3LEL D;  5AVB A;  1P3O A;  3KWQ A;  5AV5 B;  1F66 A;  3MNN B;  3MGR B;  2BG1 A;  2NZD C;  5AVC A;  3AFA D;  1S32 A;  4WU9 B;  1N1J B;  2PYO A;  3VH5 W;  1KX5 C;  4UUZ A;  4XZQ C;  3AN2 C;  1AOI D;  1T3U A;  3V9R A;  3AZF C;  2Y2H A;  3EG5 B;  4KUD D;  4CAY A;  3AZE C;  2ZY5 A;  5GT0 D;  3UTA A;  3X1S B;  1KX5 B;  1M18 C;  4XZQ B;  2ZY2 A;  4Z66 C;  3LEL C;  3AZF B;  2F8N K;  5GXQ A;  4ZBJ C;  2BYK A;  4ZUX A;  3AFA C;  1TZY A;  3B0C T;  5B40 A;  1M18 B;  1H3O B;  3O62 B;  3AZG D;  3WAA B;  3KXB D;  4Z66 B;  3LEL B;  1P3A D;  1AOI C;  3WA9 B;  4ZBJ B;  2YFV A;  3REK D;  4KUD C;  5GT3 B;  4X23 B;  2F8N H;  4DQY B;  3B0D C;  5KDM A;  2ARO C;  3F6T A;  5GT0 C;  2Y2M A;  4XUJ D;  3W97 A;  1ID3 D;  4KUD B;  1KX4 A;  3MGS B;  2ARO B;  5GT0 B;  4M6B A;  5B1L B;  3AZG C;  3KXB C;  5B2J D;  4G91 C;  3AV2 B;  1P3A C;  1P3B A;  4H9O B;  3MVD D;  5JRG D;  4H9Q B;  4J8U B;  5B0Y B;  5AY8 D;  3REK C;  1M19 A;  3AZI D;  2FJ7 C;  1BH9 A;  2CV5 D;  3AZH D;  1WWS A;  3KXB B;  1P3I B;  4J8V D;  2YFW A;  3KSY A;  4XUJ C;  1Z2C B;  3AZK D;  5B32 A;  1ID3 C;  2JCH A;  3R45 B;  1P3L A;  2FJ7 B;  4WU8 A;  3B6F A;  1P3K A;  4XUJ B;  5B2J C;  3AZL D;  3W98 D;  4H9R A;  5FUG A;  3MVD C;  5JRG C;  3C1C D;  3TU4 B;  3LZ1 D;  2IO5 B;  3AZM D;  1U35 A;  1ID3 B;  1ZLA A;  5AY8 C;  3X1T B;  5B24 D;  5DNN D;  3AZI C;  5CP6 B;  2CV5 C;  3AZH C;  1P3P D;  4JJN D;  4J8V C;  3MVD B;  3REJ D;  3KUY D;  3AZK C;  1A7W A;  4J8X A;  5JA4 A;  4LD9 D;  4R8P D;  5CPJ D;  1KX3 A;  3AZL C;  3W98 C;  3C1C C;  3LZ1 C;  3UT9 A;  3LJA D;  2F8N B;  1P3G A;  1P3P C;  2BYM A;  3MNN D;  4JJN C;  5AV6 A;  3MGR D;  5DNM B;  3C1C B;  5C3I C;  5B2I B;  4WU9 D;  2HIO B;  2Y2O A;  3AZM A;  1TAF B;  4JJN B;  2DF4 C;  5B24 A;  5DNN A;  4LD9 C;  4R8P C;  2RIQ A;  5C3I B;  5CPJ C;  3EPK A;  1P34 A;  3LZ0 A;  3LJA C;  3WTP C;  3REL A;  5B33 C;  3REJ A;  3X1S D;  3KUY A;  5CPK D;  2XD5 A;  2ZM5 A;  5F99 A;  3AZF D;  2JE5 A;  4R8P B;  4QLC A;  4CSR A;  3MNN C;  4LD9 B;  3MGR C;  3NQU A;  3W99 D;  3AYW B;  3WTP B;  5B33 B;  3W96 B;  3O62 D;  3A1K A;  3WAA D;  1B6W A;  1P3F D;  3AZN D;  3WA9 D;  5CPI C;  3IP4 C;  5GT3 D;  5AV8 C;  4X23 D;  5AV5 A;  3EPL A;  3KFU G;  4H9N B;  3AV1 D;  3UTB B;  3X1S C;  1JFI B;  3MGQ A;  4WU9 A;  5CPK C;  1P3M D;  5B1M D;  4H9S C;  3REI A;  5CPI B;  2VQR A;  3B6G B;  2F8N G;  2NQB B;  3W99 C;  5AV8 B;  5B31 D;  3MGS D;  2ARO D;  3KWQ B;  2NZD A;  4WJ3 C;  3WAA C;  2Y2N A;  5B1L D;  3O62 C;  5CPK B;  3WKJ C;  5AVC B;  3AV2 D;  1P3F C;  3AZN C;  3WA9 C;  1KX5 A;  2PYO B;  4J8U D;  3W99 B;  4XZQ A;  3AN2 A;  5B0Y D;  1PZR A;  5GT3 C;  4X23 C;  3AZF A;  4KGC D;  3AV1 C;  3MGP D;  3V9R B;  3AZE A;  1P3I D;  3WKJ B;  1P3F B;  4CAY B;  3AZN B;  1P3M C;  5B1M C;  1M18 A;  4WV4 B;  4Z66 A;  3LEL A;  3UTA B;  5B31 C;  2FJ7 D;  3MGS C;  2Y2Q A;  3AV1 B;  4HGA C;  5B0Z D;  3AFA A;  4H9P B;  2BYK B;  5B1L C;  4ZUX B;  5B1M B;  1P3M B;  3AV2 C;  3TU4 D;  5B40 B;  4J8U C;  5B31 B;  4UPK A;  5B0Y C;  4YS3 D;  1AOI A;  3X1T D;  5BS7 C;  4HGA B;  5CP6 D;  4KGC C;  3B0C W;  4KUD A;  2YFV B;  3MGP C;  1P3I C;  2ARO A;  5GT0 A;  5BNV A;  1B67 A;  4KGC B;  2DQN C;  4H9Q A;  4NE3 A;  3MGP B;  4YM6 D;  2HUE B;  5BT1 D;  5B0Z C;  4KHA B;  1KX4 B;  3AZG A;  3KXB A;  3TU4 C;  2IO5 C;  1P3A A;  4YS3 C;  2F8N D;  3X1T C;  5CP6 C;  3REK A;  5B0Z B;  1P3B B;  3X1U D;  2FJ7 A;  3A1I A;  5DNM D;  1BH9 B;  4J8W D;  5G49 A;  5B2I D;  4YS3 B;  2W8S A;  4XUJ A;  2HIO D;  3X1V D;  2YFW B;  1ID3 A;  2ZY3 A;  4YM6 C;  5BT1 C;  5B32 B;  1HQ3 B;  3C1B D;  3B6F B;  5B2J A;  1M1A D;  5BO0 A;  3A6N D;  2L5A A;  5GSU D;  5JRG A;  3MVD A;  4YM6 B;  5AY8 A;  2Y2J A;  4H9R B;  3X1U C;  3AZI A;  2FFF B;  2CV5 A;  1ZLA B;  5B31 G;  3AZH A;  5DNM C;  3B0B A;  4J8W C;  4J8V A;  3AYW D;  5B2I C;  3WTP D;  2HIO C;  3NQJ B;  5B33 D;  3W96 D;  3X1V C;  3REH C;  4WNN A;  5E5A D;  3AZK A;  3X1U B;  4Z5T D;  1EQZ D;  2F8N A;  5AV9 C;  4J8W B;  3C1B C;  4J8X B;  1M1A C;  3AZL A;  3W98 A;  5JA4 B;  3REH B;  3X1V B;  3A6N C;  5GSU C;  3C1C A;  3UTB D;  3LZ1 A;  1KX3 B;  5CPI D;  3B6G D;  5AV9 B;  3C1B B;  2NQB D;  5AV8 D;  3P5J B;  1P3P A;  4JJN A;  1BH8 A;  3AZJ D;  3AYW C;  4EO5 C;  5BNX A;  1HTA A;  1P3G B;  1P3O D;  3A6N B;  5GSU B;  3KWQ D;  2BYM B;  3W96 C;  5E5A C;  4Z5T C;  5AVC D;  1S32 D;  1EQZ C;  4Z2M G;  2PYO D;  4EO5 B;  4LD9 A;  4R8P A;  5CPJ A;  5B32 G;  5E5A B;  3WKJ D;  4Z5T B;  3UTB C;  2CWE A;  1EQZ B;  3LJA A;  3WTP A;  5B33 A;  3B6G C;  1P34 B;  3REL B;  3UTA D;  2NQB C;  3MNN A;  3AZJ C;  3MGR A;  5F99 B;  5AVB C;  1P3O C;  3KWQ C;  5GXQ D;  4QLC B;  1F66 C;  3NQU B;  4ZUX D;  1N1J A;  4H9N A;  5AVC C;  2JSS A;  1S32 C;  5B40 D;  2PYO C;  4Z2M H;  3AZJ B;  5CPI A;  1BFM A;  5AVB B;  1P3O B;  1F66 B;  2J8P A;  5AV8 A;  1S32 B;  1F1E A;  4NE6 A;  3X1S A;  4NE5 A;  2ZY4 A;  5CPK A;  2G5H C;  4H9S A;  3UTA C;  4UUZ B;  3MGQ B;  4AWL C;  3EPJ A;  3REI B;  3W99 A;  5GXQ C;  3W97 D;  2Y2I A;  1KX4 D;  4ZUX C;  1H3O A;  3O62 A;  3WAA A;  1TZY C;  3H0M C;  5B40 C;  2G5I C;  3WKJ A;  1P3F A;  2NZD B;  3AZN A;  3WA9 A;  2RVQ D;  4AWL B;  5GXQ B;  1P3B D;  5GT3 A;  4X23 A;  3AN2 B;  3AV1 A;  1M19 D;  1TZY B;  4H9P A;  1P3M A;  5B1M A;  3AZE B;  4DRA A;  4WZS B;  5B31 A;  3MGS A;  2HUE C;  3W97 C;  5B32 D;  1KX4 C;  1P3L D;  4WU8 D;  1HQ3 D;  5B1L A;  5KDM B;  3B6F D;  3AV2 A;  3AFA B;  4H9O A;  2RVQ C;  1P3K D;  4J8U A;  2XD1 A;  5B0Y A;  1P3B C;  3W97 B;  5BS7 A;  1U35 D;  4NFT A;  1ZLA D;  4KGC A;  1AOI B;  3MGP A;  1M19 C;  1P3I A;  4KHA A;  2UWX A;  3B0D B;  5CHL B;  3R45 A;  5BNV B;  5B32 C;  1M19 B;  2Y2G A;  5B0Z A;  1P3L C;  4WU8 C;  2Y2L A;  1HQ3 C;  3B6F C;  1W2E A;  4J8X D;  3REH D;  3TU4 A;  1P3K C;  1R4V A;  1KX3 D;  4YS3 A;  3AZG B;  4E44 A;  3X1T A;  4DRB A;  5AV9 D;  4G91 B;  1U35 C;  5CP6 A;  1P3A B;  1ZLA C;  1P3L B;  3UT9 D;  4WU8 B;  3H0L C;  3REK B;  1P3G D;  1P3K B;  1HQ3 A;  2LY8 A;  5AV6 D;  2F2A C;  5FUG B;  3VH6 A;  1U35 B;  5G49 B;  4YM6 A;  1ULY A;  4J8X C;  1KX3 C;  3NQJ A;  5B2J B;  1P34 D;  3LZ0 D;  5BO0 B;  3X1U A;  3REL D;  5JRG B;  3UT9 C;  5AY8 B;  1P3G C;  5F99 D;  3AZI B;  5DNM A;  4QLC D;  4J8W A;  3AZH B;  2CV5 B;  5AV6 C;  5B2I A;  1Q9C A;  2HIO A;  3H0R C;  4J8V B;  3X1V A;  3REH A;  3VH6 T;  3UT9 B;  1KU5 A;  3EPH A;  1TAF A;  4G92 C;  3VH5 A;  4WNN B;  3AZM C;  3AZK B;  5AV9 A;  5AVB D;  1F66 D;  5AV6 B;  3C1B A;  5B24 C;  5DNN C;  1M1A A;  3A6N A;  5GSU A;  5AV5 D;  1M1A B;  1P34 C;  3LZ0 C;  4G92 B;  3AZL B;  3W98 B;  3AZM B;  3WTP E;  3REL C;  3LZ1 B;  3REJ C;  3MGQ D;  3KUY C;  3REI D;  5F99 C;  5B24 B;  5DNN B;  4QLC C;  3AYW A;  1P3P B;  1BH8 B;  3W96 A;  2Y2P A;  1WWI A;  3LZ0 B;  5BNX B;  3AL0 C;  5E5A A;  4Z5T A;  2Y2K A;  3VH6 W;  1EQZ A;  3REJ B;  2NZD D;  3KUY B;  3VH5 T;  4CSR B;  1KX5 D;  4XZQ D;  3FDD A;  3AN2 D;  1TZY D;  5AV5 C;  3UTB A; 
#chains in the Genus database with same CATH homology
 5CPJ B;  1JFI A;  3AZE D;  3B6G A;  4E45 A;  3MGQ C;  4WU9 C;  3LJA B;  3REI C;  2NQB A;  1M18 D;  3AZJ A;  4Z66 D;  3LEL D;  5AVB A;  1P3O A;  3KWQ A;  5AV5 B;  1F66 A;  3MNN B;  3MGR B;  2BG1 A;  2NZD C;  5AVC A;  3AFA D;  1S32 A;  4WU9 B;  1N1J B;  2PYO A;  3VH5 W;  1KX5 C;  4UUZ A;  4XZQ C;  3AN2 C;  1AOI D;  1T3U A;  3V9R A;  3AZF C;  2Y2H A;  3EG5 B;  4KUD D;  4CAY A;  3AZE C;  2ZY5 A;  5GT0 D;  3UTA A;  3X1S B;  1KX5 B;  1M18 C;  4XZQ B;  2ZY2 A;  4Z66 C;  3LEL C;  3AZF B;  2F8N K;  5GXQ A;  4ZBJ C;  2BYK A;  4ZUX A;  3AFA C;  1TZY A;  3B0C T;  5B40 A;  1M18 B;  1H3O B;  3O62 B;  3AZG D;  3WAA B;  3KXB D;  4Z66 B;  3LEL B;  1P3A D;  1AOI C;  3WA9 B;  4ZBJ B;  2YFV A;  3REK D;  4KUD C;  5GT3 B;  4X23 B;  2F8N H;  4DQY B;  3B0D C;  5KDM A;  2ARO C;  3F6T A;  5GT0 C;  2Y2M A;  4XUJ D;  3W97 A;  1ID3 D;  4KUD B;  1KX4 A;  3MGS B;  2ARO B;  5GT0 B;  4M6B A;  5B1L B;  3AZG C;  3KXB C;  5B2J D;  4G91 C;  3AV2 B;  1P3A C;  1P3B A;  4H9O B;  3MVD D;  5JRG D;  4H9Q B;  4J8U B;  5B0Y B;  5AY8 D;  3REK C;  1M19 A;  3AZI D;  2FJ7 C;  1BH9 A;  2CV5 D;  3AZH D;  1WWS A;  3KXB B;  1P3I B;  4J8V D;  2YFW A;  3KSY A;  4XUJ C;  1Z2C B;  3AZK D;  5B32 A;  1ID3 C;  2JCH A;  3R45 B;  1P3L A;  2FJ7 B;  4WU8 A;  3B6F A;  1P3K A;  4XUJ B;  5B2J C;  3AZL D;  3W98 D;  4H9R A;  5FUG A;  3MVD C;  5JRG C;  3C1C D;  3TU4 B;  3LZ1 D;  2IO5 B;  3AZM D;  1U35 A;  1ID3 B;  1ZLA A;  5AY8 C;  3X1T B;  5B24 D;  5DNN D;  3AZI C;  5CP6 B;  2CV5 C;  3AZH C;  1P3P D;  4JJN D;  4J8V C;  3MVD B;  3REJ D;  3KUY D;  3AZK C;  1A7W A;  4J8X A;  5JA4 A;  4LD9 D;  4R8P D;  5CPJ D;  1KX3 A;  3AZL C;  3W98 C;  3C1C C;  3LZ1 C;  3UT9 A;  3LJA D;  2F8N B;  1P3G A;  1P3P C;  2BYM A;  3MNN D;  4JJN C;  5AV6 A;  3MGR D;  5DNM B;  3C1C B;  5C3I C;  5B2I B;  4WU9 D;  2HIO B;  2Y2O A;  3AZM A;  1TAF B;  4JJN B;  2DF4 C;  5B24 A;  5DNN A;  4LD9 C;  4R8P C;  2RIQ A;  5C3I B;  5CPJ C;  3EPK A;  1P34 A;  3LZ0 A;  3LJA C;  3WTP C;  3REL A;  5B33 C;  3REJ A;  3X1S D;  3KUY A;  5CPK D;  2XD5 A;  2ZM5 A;  5F99 A;  3AZF D;  2JE5 A;  4R8P B;  4QLC A;  4CSR A;  3MNN C;  4LD9 B;  3MGR C;  3NQU A;  3W99 D;  3AYW B;  3WTP B;  5B33 B;  3W96 B;  3O62 D;  3A1K A;  3WAA D;  1B6W A;  1P3F D;  3AZN D;  3WA9 D;  5CPI C;  3IP4 C;  5GT3 D;  5AV8 C;  4X23 D;  5AV5 A;  3EPL A;  3KFU G;  4H9N B;  3AV1 D;  3UTB B;  3X1S C;  1JFI B;  3MGQ A;  4WU9 A;  5CPK C;  1P3M D;  5B1M D;  4H9S C;  3REI A;  5CPI B;  2VQR A;  3B6G B;  2F8N G;  2NQB B;  3W99 C;  5AV8 B;  5B31 D;  3MGS D;  2ARO D;  3KWQ B;  2NZD A;  4WJ3 C;  3WAA C;  2Y2N A;  5B1L D;  3O62 C;  5CPK B;  3WKJ C;  5AVC B;  3AV2 D;  1P3F C;  3AZN C;  3WA9 C;  1KX5 A;  2PYO B;  4J8U D;  3W99 B;  4XZQ A;  3AN2 A;  5B0Y D;  1PZR A;  5GT3 C;  4X23 C;  3AZF A;  4KGC D;  3AV1 C;  3MGP D;  3V9R B;  3AZE A;  1P3I D;  3WKJ B;  1P3F B;  4CAY B;  3AZN B;  1P3M C;  5B1M C;  1M18 A;  4WV4 B;  4Z66 A;  3LEL A;  3UTA B;  5B31 C;  2FJ7 D;  3MGS C;  2Y2Q A;  3AV1 B;  4HGA C;  5B0Z D;  3AFA A;  4H9P B;  2BYK B;  5B1L C;  4ZUX B;  5B1M B;  1P3M B;  3AV2 C;  3TU4 D;  5B40 B;  4J8U C;  5B31 B;  4UPK A;  5B0Y C;  4YS3 D;  1AOI A;  3X1T D;  5BS7 C;  4HGA B;  5CP6 D;  4KGC C;  3B0C W;  4KUD A;  2YFV B;  3MGP C;  1P3I C;  2ARO A;  5GT0 A;  5BNV A;  1B67 A;  4KGC B;  2DQN C;  4H9Q A;  4NE3 A;  3MGP B;  4YM6 D;  2HUE B;  5BT1 D;  5B0Z C;  4KHA B;  1KX4 B;  3AZG A;  3KXB A;  3TU4 C;  2IO5 C;  1P3A A;  4YS3 C;  2F8N D;  3X1T C;  5CP6 C;  3REK A;  5B0Z B;  1P3B B;  3X1U D;  2FJ7 A;  3A1I A;  5DNM D;  1BH9 B;  4J8W D;  5G49 A;  5B2I D;  4YS3 B;  2W8S A;  4XUJ A;  2HIO D;  3X1V D;  2YFW B;  1ID3 A;  2ZY3 A;  4YM6 C;  5BT1 C;  5B32 B;  1HQ3 B;  3C1B D;  3B6F B;  5B2J A;  1M1A D;  5BO0 A;  3A6N D;  2L5A A;  5GSU D;  5JRG A;  3MVD A;  4YM6 B;  5AY8 A;  2Y2J A;  4H9R B;  3X1U C;  3AZI A;  2FFF B;  2CV5 A;  1ZLA B;  5B31 G;  3AZH A;  5DNM C;  3B0B A;  4J8W C;  4J8V A;  3AYW D;  5B2I C;  3WTP D;  2HIO C;  3NQJ B;  5B33 D;  3W96 D;  3X1V C;  3REH C;  4WNN A;  5E5A D;  3AZK A;  3X1U B;  4Z5T D;  1EQZ D;  2F8N A;  5AV9 C;  4J8W B;  3C1B C;  4J8X B;  1M1A C;  3AZL A;  3W98 A;  5JA4 B;  3REH B;  3X1V B;  3A6N C;  5GSU C;  3C1C A;  3UTB D;  3LZ1 A;  1KX3 B;  5CPI D;  3B6G D;  5AV9 B;  3C1B B;  2NQB D;  5AV8 D;  3P5J B;  1P3P A;  4JJN A;  1BH8 A;  3AZJ D;  3AYW C;  4EO5 C;  5BNX A;  1HTA A;  1P3G B;  1P3O D;  3A6N B;  5GSU B;  3KWQ D;  2BYM B;  3W96 C;  5E5A C;  4Z5T C;  5AVC D;  1S32 D;  1EQZ C;  4Z2M G;  2PYO D;  4EO5 B;  4LD9 A;  4R8P A;  5CPJ A;  5B32 G;  5E5A B;  3WKJ D;  4Z5T B;  3UTB C;  2CWE A;  1EQZ B;  3LJA A;  3WTP A;  5B33 A;  3B6G C;  1P34 B;  3REL B;  3UTA D;  2NQB C;  3MNN A;  3AZJ C;  3MGR A;  5F99 B;  5AVB C;  1P3O C;  3KWQ C;  5GXQ D;  4QLC B;  1F66 C;  3NQU B;  4ZUX D;  1N1J A;  4H9N A;  5AVC C;  2JSS A;  1S32 C;  5B40 D;  2PYO C;  4Z2M H;  3AZJ B;  5CPI A;  1BFM A;  5AVB B;  1P3O B;  1F66 B;  2J8P A;  5AV8 A;  1S32 B;  1F1E A;  4NE6 A;  3X1S A;  4NE5 A;  2ZY4 A;  5CPK A;  2G5H C;  4H9S A;  3UTA C;  4UUZ B;  3MGQ B;  4AWL C;  3EPJ A;  3REI B;  3W99 A;  5GXQ C;  3W97 D;  2Y2I A;  1KX4 D;  4ZUX C;  1H3O A;  3O62 A;  3WAA A;  1TZY C;  3H0M C;  5B40 C;  2G5I C;  3WKJ A;  1P3F A;  2NZD B;  3AZN A;  3WA9 A;  2RVQ D;  4AWL B;  5GXQ B;  1P3B D;  5GT3 A;  4X23 A;  3AN2 B;  3AV1 A;  1M19 D;  1TZY B;  4H9P A;  1P3M A;  5B1M A;  3AZE B;  4DRA A;  4WZS B;  5B31 A;  3MGS A;  2HUE C;  3W97 C;  5B32 D;  1KX4 C;  1P3L D;  4WU8 D;  1HQ3 D;  5B1L A;  5KDM B;  3B6F D;  3AV2 A;  3AFA B;  4H9O A;  2RVQ C;  1P3K D;  4J8U A;  2XD1 A;  5B0Y A;  1P3B C;  3W97 B;  5BS7 A;  1U35 D;  4NFT A;  1ZLA D;  4KGC A;  1AOI B;  3MGP A;  1M19 C;  1P3I A;  4KHA A;  2UWX A;  3B0D B;  5CHL B;  3R45 A;  5BNV B;  5B32 C;  1M19 B;  2Y2G A;  5B0Z A;  1P3L C;  4WU8 C;  2Y2L A;  1HQ3 C;  3B6F C;  1W2E A;  4J8X D;  3REH D;  3TU4 A;  1P3K C;  1R4V A;  1KX3 D;  4YS3 A;  3AZG B;  4E44 A;  3X1T A;  4DRB A;  5AV9 D;  4G91 B;  1U35 C;  5CP6 A;  1P3A B;  1ZLA C;  1P3L B;  3UT9 D;  4WU8 B;  3H0L C;  3REK B;  1P3G D;  1P3K B;  1HQ3 A;  2LY8 A;  5AV6 D;  2F2A C;  5FUG B;  3VH6 A;  1U35 B;  5G49 B;  4YM6 A;  1ULY A;  4J8X C;  1KX3 C;  3NQJ A;  5B2J B;  1P34 D;  3LZ0 D;  5BO0 B;  3X1U A;  3REL D;  5JRG B;  3UT9 C;  5AY8 B;  1P3G C;  5F99 D;  3AZI B;  5DNM A;  4QLC D;  4J8W A;  3AZH B;  2CV5 B;  5AV6 C;  5B2I A;  1Q9C A;  2HIO A;  3H0R C;  4J8V B;  3X1V A;  3REH A;  3VH6 T;  3UT9 B;  1KU5 A;  3EPH A;  1TAF A;  4G92 C;  3VH5 A;  4WNN B;  3AZM C;  3AZK B;  5AV9 A;  5AVB D;  1F66 D;  5AV6 B;  3C1B A;  5B24 C;  5DNN C;  1M1A A;  3A6N A;  5GSU A;  5AV5 D;  1M1A B;  1P34 C;  3LZ0 C;  4G92 B;  3AZL B;  3W98 B;  3AZM B;  3WTP E;  3REL C;  3LZ1 B;  3REJ C;  3MGQ D;  3KUY C;  3REI D;  5F99 C;  5B24 B;  5DNN B;  4QLC C;  3AYW A;  1P3P B;  1BH8 B;  3W96 A;  2Y2P A;  1WWI A;  3LZ0 B;  5BNX B;  3AL0 C;  5E5A A;  4Z5T A;  2Y2K A;  3VH6 W;  1EQZ A;  3REJ B;  2NZD D;  3KUY B;  3VH5 T;  4CSR B;  1KX5 D;  4XZQ D;  3FDD A;  3AN2 D;  1TZY D;  5AV5 C;  3UTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...