5B0ZB

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zB00
1P3OD 5AV6B 5F99D 4HGAC 1ID3B 3LZ1B 3X1UA 4J8VB 4WU9C 5GT0A 1P3PA 5AVCB 5DNMD 4QLCC 4H9OB 5GSUB 5B1LB 5GT3A 4YS3D 3KSYA 1P3GD 1M18C 1P34C 1BH8B 5AV9B 1U35B 4J8XB 4LD9B 4H9SA 5B33C 3W97D 2HIOD 3MVDA 1P3AD 4H9RA 2F8NA 4JJND 1HQ3C 3RELC 1M19D 3O62C 3MGPA 1KX4D 3KXBD 4H9QA 3AZND 2FJ7A 5C3IB 3REHC 1B67A 3V9RA 4H9RB 3VH5A 1P3KA 3WTPB 4YM6D 1P3FB 1AOID 5B24C 4J8UD 3AFAC 3REKA 3AZLA 5B0ZB 3LJAB 5B32G 3V9RB 3AZMB 3A6ND 4H9PA 2RVQD 1EQZC 4R8PA 4KGCA 5B0YC 3MGRC 3REIB 4G91B 3AV2B 1TAFB 5FUGB 1TZYD 1P3MA 3LZ0C 4Z2MH 5CP6C 5AV6C 3AZHB 2BYMB 1ID3C 2CV5C 5JA4B 5F99A 4X23A 3LZ1C 4J8VC 3AV1B 3KWQD 5GXQB 4WNNB 5BNXA 5AVCC 3WAAD 3W96D 1P3OB 5F99B 5GSUC 1P3BA 5B1LC 5E5AA 3AZGD 3TU4B 4YS3A 3WKJC 3AN2D 5DNNC 5AV9C 1U35C 4J8XC 3X1TD 1HTAA 4LD9C 4J8WA 3B6FC 1F66D 5DNMB 5CPKD 5CPJD 2BYKB 2HIOA 3W98B 4YS3B 1P3GB 4KUDA 4JJNA 5B1MC 5BNVA 3LELA 2PYOA 4KHAB 3REJB 1M1AA 1KX4A 3KXBA 5C3IC 3C1CA 3C1BA 3X1UD 3W97B 1KX5D 1P3AB 3NQUA 1WWSA 4WU8A 3WTPC 1P3FC 5GT0D 4YM6A 1P3PD 1M19B 4J8UA 3AZKB 3UTBC 3AZNB 5B0ZC 3LJAC 3AZIC 3X1SC 3AZMC 5KDMA 3A6NA 3MNNB 3AZFB 1AOIB 3NQJB 4G91C 3AV2C 5CHLB 4WU9A 2NZDD 1TZYA 3W99D 5CPIB 3AZHC 4QLCA 5B40B 2AROB 1BH9A 3B6GA 3AV1C 3MGPD 3MGSC 1KX3D 2FJ7D 5GXQC 3KWQA 3X1VA 1P3IB 1BFMA 2YFVA 4Z5TA 5B33A 1P3KD 3W96A 4XZQC 5AY8D 3TU4C 1P3LB 4NE5A 3O62A 5B32D 3AN2A 5JRGB 3WAAB 4R8PD 4KGCD 3W98C 5CPKA 3R45B 3KUYA 1P3GC 3AZGB 1P3MD 4CAYA 4ZUXC 3REJC 3X1TB 5B2JD 4X23D 3WA9C 3W97C 1F66B 1N1JA 5CPJB 1KX5A 1EQZA 5B0YA 3AZKC 3AZNC 1P3BD 5E5AD 3LZ0A 5BT1C 3X1UB 2CV5A 3MNNC 3AZFC 5GT0B 5AVBA 4AWLB 1AOIC 1P3PB 4J8WD 2NZDA 5CPIC 5GT3B 2AROC 3MGQD 5B40C 3W99A 1H3OA 4KUDD 3LELD 2NQBD 2PYOD 3WKJA 1M1AD 1KX3A 1P3IC 3C1CD 5B2ID 5BS7A 3C1BD 1ZLAA 3MVDB 3B6FA 4WU8D 2F8NB 1S32D 5B31D 4E44A 5AY8A 3MGPB 1P3LC 1KX3B 4H9QB 2FJ7B 2JSSA 5B32A 5JRGC 2LY8A 4E45A 3B0CT 3WAAC 3UTAA 1P3KB 4WU9D 3AZEC 3AZGC 3UT9A 3REKB 3AZLB 3X1TC 5AV8A 4QLCD 1JFIA 1KU5A 4H9PB 5B2JA 3AZIA 3B6GD 1F66C 3X1SA 4H9NA 4XUJA 4R8PB 1M18D 4KGCB 5CPJC 1P34D 3X1VD 1P3MB 4Z5TD 5B33D 4NE6A 4X23B 3X1UC 4UUZA 3RELD 3O62D 5GT0C 4ZBJB 3MGSA 5BNXB 1P3PC 3AYWA 1P3BB 5E5AB 5GT3C 3KUYD 3MGQA 4XZQA 5B24D 5AV5A 3AFAD 2NQBA 4J8WB 1A7WA 5B2IA 3MVDC 2HIOB 4Z66A 1EQZD 2CWEA 3MGQB 5B0YD 4KUDB 4JJNB 1S32A 5BNVB 5B31A 3LELB 2PYOB 3MGPC 3AZJA 1M1AB 1KX4B 3KXBB 3LZ0D 3C1CB 4DRAA 5B2IB 4ZUXA 3C1BB 5CP6D 5AV6D 4NE3A 2CV5D 3NQUB 1P3KC 4WU8B 5AVBD 1S32B 5B31B 4YM6B 1B6WA 3REIC 4J8UB 5AVCD 2YFWA 3REKC 3AZLC 4HGAB 5B1LD 5KDMB 3A6NB 4KGCC 3WKJD 1M18A 1P34A 5DNND 5AV9D 4WU9B 4LD9D 1TZYB 1ZLAD 3B6FD 1P3OC 4QLCB 5F99C 1BH9B 3B6GB 1M18B 5B1MD 1HQ3A 3X1VB 3KWQB 3RELA 4ZBJC 2YFVB 4Z5TB 5B33B 3UTAD 1WWIA 3W96B 5DNMC 3REHA 1P3BC 5E5AC 4YS3C 3UT9D 5B24A 3O62B 3AN2B 3AFAA 5AV8D 3UTBD 4J8WC 5B0ZD 3LJAD 3AZID 4EO5B 3B0DB 3X1SD 4XUJD 3AZMD 2HUEB 2HIOC 1P3AC 5CPKB 3KUYB 4Z2MG 5G49A 4G92B 4JJNC 3MGRA 1M19C 2PYOC 4CAYB 3AZEA 5BO0A 2IO5B 1KX4C 3KXBC 3C1CC 5AV6A 5CP6A 1ID3A 1N1JB 1KX5B 3B0CW 3AV1D 1EQZB 3LZ1A 3MGSD 4J8VA 4YM6C 5B0YB 4J8UC 5BO0B 3AYWD 5AVCA 3LZ0B 5CP6B 4XZQD 4H9OA 3A6NC 5AV5D 2RVQC 5GSUA 2CV5B 5B1LA 3TU4D 4CSRA 5AVBB 3B0BA 1BH8A 5DNNA 5AV9A 1U35A 1TZYC 4J8XA 3VH6T 4LD9A 2NZDB 4DRBA 4Z66D 3W99B 1H3OB 3B6GC 3W98D 4CSRB 3AZJD 3WKJB 3X1VC 3KWQC 5B1MA 5DNNB 4ZUXD 3REJD 4Z5TC 1ZLAB 3B6FB 3WA9D 3W96C 2L5AA 5AY8B 3WTPA 1P3FA 2F8NG 5B1MB 3AZKD 3AN2C 5B32B 3UTBA 4EO5C 5BT1D 3B0DC 5B0ZA 3LJAA 3UTAB 2HUEC 3AZMA 3MNND 5CPKC 3KUYC 3AZFD 4G92C 3UT9B 3REIA 3AV2A 1TAFA 2IO5C 5FUGA 5AV8B 1JFIB 3UTBB 5B2JB 3AZIB 5CPID 3X1SB 1F1EA 2AROD 4H9NB 5B40D 4XUJB 2BYMA 3AZHA 1KX5C 5JA4A 1HQ3D 3AV1A 4AWLC 1P3ID 5GXQA 4WNNA 3REHD 1P3OA 4UUZB 5AVBC 3MGSB 1P3LD 3TU4A 4H9SC 3AYWB 5JRGD 2NZDC 3W99C 5DNMA 4XZQB 3VH6A 2BYKA 5AV5B 3MGRD 3W98A 3AZED 2NQBB 1P3GA 1KX3C 2FJ7C 5BS7C 4KHAA 3REJA 1ZLAC 1ID3D 4Z66B 3LZ1D 3WA9A 3W97A 4J8VD 1P3AA 5AY8C 3AZJB 1M19A 5B32C 4ZUXB 3AZKA 3AZNA 1Q9CA 1R4VA 3VH5W 5GSUD 3UTAC 3WA9B 4NFTA 4R8PC 3MNNA 1U35D 4J8XD 3UT9C 3AZFA 1P3MC 2YFWB 3NQJA 1AOIA 5B31G 4WZSB 5AV8C 4WV4B 5B2JC 3WTPE 5GT3D 4X23C 5CPIA 4XUJC 2F8NH 2AROA 5B40A 1P34B 1ULYA 2F8NK 1P3IA 3MVDD 2F8ND 3WTPD 1P3FD 1HQ3B 3RELB 1P3LA 3VH5T 3AYWC 3REHB 5JRGA 3VH6W 3WAAA 3MGQC 5AV5C 4KUDC 3REID 5B24B 3R45A 3LELC 3AV2D 2NQBC 3AFAB 3AZGA 3REKD 3AZLD 1M1AC 5B2IC 3C1BC 3X1TA 3AZHD 4Z66C 4WU8C 5G49B 1F66A 1S32C 5B31C 5CPJA 3MGRB 3AZJC 5GXQD 3AZEB 4M6BA
chains in the Genus database with same CATH superfamily
1P3OD 5AV6B 5F99D 4HGAC 1ID3B 3LZ1B 3X1UA 4J8VB 4WU9C 5GT0A 1P3PA 5AVCB 5DNMD 4QLCC 4H9OB 5GSUB 5B1LB 5GT3A 4YS3D 3KSYA 1P3GD 1M18C 1P34C 1BH8B 5AV9B 1U35B 4J8XB 4LD9B 4H9SA 2Y2OA 5B33C 2Y2PA 3W97D 2HIOD 3MVDA 1P3AD 4H9RA 2F8NA 4JJND 1HQ3C 2W8SA 3RELC 1M19D 3O62C 3MGPA 1KX4D 3KXBD 4H9QA 3AZND 2FJ7A 5C3IB 3REHC 1B67A 3V9RA 2Y2QA 4H9RB 3VH5A 1P3KA 1PZRA 3WTPB 4YM6D 1P3FB 1AOID 5B24C 4J8UD 3AFAC 3REKA 3AZLA 5B0ZB 2Y2GA 3LJAB 5B32G 3V9RB 3AZMB 3A6ND 4H9PA 2RVQD 1EQZC 4R8PA 4KGCA 3A1IA 5B0YC 3MGRC 4G91B 3REIB 3AV2B 3KFUG 1TAFB 5FUGB 1TZYD 1P3MA 4WJ3C 3LZ0C 4Z2MH 5CP6C 5AV6C 3AZHB 2BYMB 1ID3C 3AL0C 2CV5C 5JA4B 5F99A 4X23A 3LZ1C 4J8VC 3AV1B 3KWQD 5GXQB 4WNNB 5BNXA 5AVCC 3WAAD 3W96D 1P3OB 5F99B 5GSUC 1P3BA 5B1LC 5E5AA 3AZGD 3TU4B 4YS3A 2JCHA 3WKJC 3AN2D 5DNNC 5AV9C 1U35C 4J8XC 3X1TD 1HTAA 4LD9C 4J8WA 3B6FC 1F66D 5DNMB 1Z2CB 5CPKD 5CPJD 2BYKB 2HIOA 3W98B 4YS3B 1P3GB 4KUDA 4JJNA 5B1MC 5BNVA 3LELA 2PYOA 4KHAB 3REJB 1M1AA 1KX4A 3KXBA 5C3IC 3C1CA 3C1BA 3X1UD 3W97B 1KX5D 1P3AB 3NQUA 1WWSA 4WU8A 3WTPC 1P3FC 5GT0D 4YM6A 1P3PD 1M19B 3F6TA 4J8UA 3AZKB 3UTBC 3AZNB 5B0ZC 3LJAC 3AZIC 3X1SC 3AZMC 5KDMA 3A6NA 3MNNB 3AZFB 1AOIB 3NQJB 4G91C 3AV2C 5CHLB 2ZY3A 4WU9A 2NZDD 1TZYA 3W99D 5CPIB 3AZHC 4QLCA 5B40B 2AROB 1BH9A 3B6GA 3AV1C 3MGPD 3MGSC 2XD1A 1KX3D 2FJ7D 5GXQC 3KWQA 3X1VA 1P3IB 1BFMA 2YFVA 2VQRA 4Z5TA 5B33A 1P3KD 3W96A 4XZQC 5AY8D 3TU4C 1P3LB 4NE5A 3O62A 5B32D 3AN2A 5JRGB 3WAAB 4R8PD 2ZY5A 4KGCD 3W98C 5CPKA 3R45B 3KUYA 3EPLA 1P3GC 3AZGB 1P3MD 3FDDA 4CAYA 4ZUXC 3REJC 3X1TB 5B2JD 2Y2NA 4X23D 3WA9C 3W97C 2J8PA 1F66B 1N1JA 5CPJB 1KX5A 1EQZA 5B0YA 3AZKC 3AZNC 1P3BD 5E5AD 3H0LC 5BT1C 3LZ0A 3X1UB 2CV5A 3MNNC 3AZFC 5GT0B 5AVBA 4AWLB 1AOIC 1P3PB 4J8WD 2NZDA 5CPIC 3IP4C 3EPKA 5GT3B 2AROC 3MGQD 5B40C 3W99A 1H3OA 4KUDD 2G5HC 3LELD 2NQBD 2PYOD 2Y2JA 3WKJA 1M1AD 1KX3A 1P3IC 3C1CD 5B2ID 5BS7A 3C1BD 1ZLAA 3MVDB 3B6FA 4WU8D 2F8NB 1S32D 5B31D 4E44A 5AY8A 3MGPB 1P3LC 1KX3B 4H9QB 2FJ7B 2JSSA 5B32A 3H0MC 2LY8A 4E45A 5JRGC 3B0CT 3WAAC 4DQYB 3UTAA 1P3KB 4WU9D 3AZEC 3AZGC 3UT9A 3REKB 3AZLB 3X1TC 5AV8A 4QLCD 1JFIA 1KU5A 4H9PB 5B2JA 3AZIA 3B6GD 2Y2MA 1F66C 3X1SA 4H9NA 4XUJA 4R8PB 1M18D 4KGCB 5CPJC 1P34D 3X1VD 1P3MB 4Z5TD 5B33D 4NE6A 3EG5B 4UPKA 4X23B 3X1UC 4UUZA 1T3UA 3RELD 3O62D 5GT0C 4ZBJB 3MGSA 5BNXB 1P3PC 3AYWA 2Y2IA 1P3BB 5E5AB 5GT3C 3KUYD 3MGQA 4XZQA 5B24D 5AV5A 3AFAD 2NQBA 2G5IC 4J8WB 1A7WA 5B2IA 3MVDC 2HIOB 4Z66A 1EQZD 2CWEA 3MGQB 5B0YD 4KUDB 4JJNB 1S32A 5BNVB 5B31A 3LELB 2PYOB 3MGPC 3AZJA 1M1AB 2DQNC 1KX4B 3KXBB 3LZ0D 3C1CB 4DRAA 5B2IB 4ZUXA 3C1BB 5CP6D 5AV6D 4NE3A 2CV5D 2BG1A 3NQUB 1P3KC 4WU8B 2ZY2A 5AVBD 1S32B 5B31B 4YM6B 1B6WA 3REIC 4J8UB 5AVCD 2YFWA 3EPJA 3REKC 3AZLC 2XD5A 4HGAB 3A1KA 5B1LD 5KDMB 3A6NB 2Y2KA 4KGCC 3WKJD 1M18A 1P34A 5DNND 5AV9D 4WU9B 4LD9D 1TZYB 1ZLAD 3B6FD 1P3OC 4QLCB 5F99C 1BH9B 3B6GB 1M18B 5B1MD 1HQ3A 2ZY4A 3KWQB 3RELA 3X1VB 4ZBJC 2YFVB 3H0RC 4Z5TB 5B33B 3UTAD 1WWIA 3W96B 5DNMC 3REHA 1P3BC 5E5AC 2Y2LA 2F2AC 4YS3C 3UT9D 5B24A 3O62B 3AN2B 3AFAA 5AV8D 3UTBD 4J8WC 5B0ZD 3LJAD 3AZID 4EO5B 3B0DB 3X1SD 4XUJD 3AZMD 2HUEB 2HIOC 1P3AC 5CPKB 3KUYB 4Z2MG 5G49A 4G92B 4JJNC 3MGRA 1M19C 2PYOC 4CAYB 3AZEA 5BO0A 2IO5B 1KX4C 3KXBC 3C1CC 5AV6A 5CP6A 1ID3A 1N1JB 1KX5B 3B0CW 3AV1D 1EQZB 3LZ1A 3MGSD 4J8VA 4YM6C 5B0YB 4J8UC 5BO0B 3AYWD 2Y2HA 5AVCA 3LZ0B 5CP6B 4XZQD 4H9OA 3A6NC 5AV5D 2RVQC 5GSUA 2CV5B 5B1LA 3P5JB 3TU4D 4CSRA 5AVBB 3B0BA 1BH8A 5DNNA 5AV9A 1U35A 1TZYC 1W2EA 4J8XA 3VH6T 4LD9A 2NZDB 4DRBA 4Z66D 3W99B 1H3OB 3B6GC 3W98D 4CSRB 3AZJD 3WKJB 3X1VC 3KWQC 5B1MA 5DNNB 4ZUXD 3REJD 4Z5TC 1ZLAB 3B6FB 3WA9D 3W96C 2L5AA 5AY8B 3WTPA 1P3FA 2F8NG 5B1MB 3AZKD 3AN2C 5B32B 3UTBA 4EO5C 5BT1D 3B0DC 5B0ZA 3LJAA 3UTAB 2HUEC 3AZMA 3MNND 5CPKC 3KUYC 3AZFD 2FFFB 4G92C 3UT9B 3REIA 3AV2A 1TAFA 2IO5C 5FUGA 5AV8B 1JFIB 3UTBB 5B2JB 3AZIB 5CPID 1F1EA 2AROD 4H9NB 5B40D 4XUJB 3X1SB 2BYMA 3AZHA 1KX5C 5JA4A 1HQ3D 2JE5A 3AV1A 4AWLC 1P3ID 5GXQA 2DF4C 4WNNA 3REHD 1P3OA 4UUZB 5AVBC 3MGSB 1P3LD 3TU4A 4H9SC 3AYWB 5JRGD 2NZDC 3W99C 5DNMA 4XZQB 3VH6A 2BYKA 5AV5B 3MGRD 3W98A 3AZED 2NQBB 1P3GA 1KX3C 2FJ7C 5BS7C 4KHAA 3REJA 1ZLAC 1ID3D 4Z66B 3LZ1D 3WA9A 3W97A 4J8VD 1P3AA 5AY8C 3AZJB 1M19A 5B32C 4ZUXB 3AZKA 3AZNA 1Q9CA 1R4VA 3VH5W 5GSUD 3UTAC 3WA9B 4NFTA 4R8PC 3MNNA 1U35D 4J8XD 3UT9C 3AZFA 1P3MC 2YFWB 3NQJA 1AOIA 5B31G 4WZSB 5AV8C 4WV4B 5B2JC 3WTPE 5GT3D 4X23C 5CPIA 4XUJC 2F8NH 2AROA 5B40A 1P34B 1ULYA 2F8NK 1P3IA 3MVDD 2F8ND 3WTPD 1P3FD 1HQ3B 3EPHA 3RELB 1P3LA 3VH5T 2ZM5A 3AYWC 3REHB 5JRGA 3VH6W 3WAAA 3MGQC 5AV5C 2UWXA 3REID 4KUDC 5B24B 3R45A 3LELC 3AV2D 2NQBC 3AFAB 3AZGA 3REKD 3AZLD 1M1AC 2RIQA 5B2IC 3C1BC 3X1TA 3AZHD 4Z66C 4WU8C 5G49B 1F66A 1S32C 5B31C 5CPJA 3MGRB 3AZJC 5GXQD 3AZEB 4M6BA
chains in the Genus database with same CATH topology
1P3OD 5AV6B 5F99D 4HGAC 1ID3B 3LZ1B 3X1UA 4J8VB 4WU9C 5GT0A 1P3PA 5AVCB 5DNMD 4QLCC 4H9OB 5GSUB 5B1LB 5GT3A 4YS3D 3KSYA 1P3GD 1M18C 1P34C 1BH8B 5AV9B 1U35B 4J8XB 4LD9B 4H9SA 2Y2OA 5B33C 2Y2PA 3W97D 2HIOD 3MVDA 1P3AD 4H9RA 2F8NA 4JJND 1HQ3C 2W8SA 3RELC 1M19D 3O62C 3MGPA 1KX4D 3KXBD 4H9QA 3AZND 2FJ7A 5C3IB 3REHC 1B67A 3V9RA 2Y2QA 4H9RB 3VH5A 1P3KA 1PZRA 3WTPB 4YM6D 1P3FB 1AOID 5B24C 4J8UD 3AFAC 3REKA 3AZLA 5B0ZB 2Y2GA 3LJAB 5B32G 3V9RB 3AZMB 3A6ND 4H9PA 2RVQD 1EQZC 4R8PA 4KGCA 3A1IA 5B0YC 3MGRC 4G91B 3REIB 3AV2B 3KFUG 1TAFB 5FUGB 1TZYD 1P3MA 4WJ3C 3LZ0C 4Z2MH 5CP6C 5AV6C 3AZHB 2BYMB 1ID3C 3AL0C 2CV5C 5JA4B 5F99A 4X23A 3LZ1C 4J8VC 3AV1B 3KWQD 5GXQB 4WNNB 5BNXA 5AVCC 3WAAD 3W96D 1P3OB 5F99B 5GSUC 1P3BA 5B1LC 5E5AA 3AZGD 3TU4B 4YS3A 2JCHA 3WKJC 3AN2D 5DNNC 5AV9C 1U35C 4J8XC 3X1TD 1HTAA 4LD9C 4J8WA 3B6FC 1F66D 5DNMB 1Z2CB 5CPKD 5CPJD 2BYKB 2HIOA 3W98B 4YS3B 1P3GB 4KUDA 4JJNA 5B1MC 5BNVA 3LELA 2PYOA 4KHAB 3REJB 1M1AA 1KX4A 3KXBA 5C3IC 3C1CA 3C1BA 3X1UD 3W97B 1KX5D 1P3AB 3NQUA 1WWSA 4WU8A 3WTPC 1P3FC 5GT0D 4YM6A 1P3PD 1M19B 3F6TA 4J8UA 3AZKB 3UTBC 3AZNB 5B0ZC 3LJAC 3AZIC 3X1SC 3AZMC 5KDMA 3A6NA 3MNNB 3AZFB 1AOIB 3NQJB 4G91C 3AV2C 5CHLB 2ZY3A 4WU9A 2NZDD 1TZYA 3W99D 5CPIB 3AZHC 4QLCA 5B40B 2AROB 1BH9A 3B6GA 3AV1C 3MGPD 3MGSC 2XD1A 1KX3D 2FJ7D 5GXQC 3KWQA 3X1VA 1P3IB 1BFMA 2YFVA 2VQRA 4Z5TA 5B33A 1P3KD 3W96A 4XZQC 5AY8D 3TU4C 1P3LB 4NE5A 3O62A 5B32D 3AN2A 5JRGB 3WAAB 4R8PD 2ZY5A 4KGCD 3W98C 5CPKA 3R45B 3KUYA 3EPLA 1P3GC 3AZGB 1P3MD 3FDDA 4CAYA 4ZUXC 3REJC 3X1TB 5B2JD 2Y2NA 4X23D 3WA9C 3W97C 2J8PA 1F66B 1N1JA 5CPJB 1KX5A 1EQZA 5B0YA 3AZKC 3AZNC 1P3BD 5E5AD 3H0LC 5BT1C 3LZ0A 3X1UB 2CV5A 3MNNC 3AZFC 5GT0B 5AVBA 4AWLB 1AOIC 1P3PB 4J8WD 2NZDA 5CPIC 3IP4C 3EPKA 5GT3B 2AROC 3MGQD 5B40C 3W99A 1H3OA 4KUDD 2G5HC 3LELD 2NQBD 2PYOD 2Y2JA 3WKJA 1M1AD 1KX3A 1P3IC 3C1CD 5B2ID 5BS7A 3C1BD 1ZLAA 3MVDB 3B6FA 4WU8D 2F8NB 1S32D 5B31D 4E44A 5AY8A 3MGPB 1P3LC 1KX3B 4H9QB 2FJ7B 2JSSA 5B32A 3H0MC 2LY8A 4E45A 5JRGC 3B0CT 3WAAC 4DQYB 3UTAA 1P3KB 4WU9D 3AZEC 3AZGC 3UT9A 3REKB 3AZLB 3X1TC 5AV8A 4QLCD 1JFIA 1KU5A 4H9PB 5B2JA 3AZIA 3B6GD 2Y2MA 1F66C 3X1SA 4H9NA 4XUJA 4R8PB 1M18D 4KGCB 5CPJC 1P34D 3X1VD 1P3MB 4Z5TD 5B33D 4NE6A 3EG5B 4UPKA 4X23B 3X1UC 4UUZA 1T3UA 3RELD 3O62D 5GT0C 4ZBJB 3MGSA 5BNXB 1P3PC 3AYWA 2Y2IA 1P3BB 5E5AB 5GT3C 3KUYD 3MGQA 4XZQA 5B24D 5AV5A 3AFAD 2NQBA 2G5IC 4J8WB 1A7WA 5B2IA 3MVDC 2HIOB 4Z66A 1EQZD 2CWEA 3MGQB 5B0YD 4KUDB 4JJNB 1S32A 5BNVB 5B31A 3LELB 2PYOB 3MGPC 3AZJA 1M1AB 2DQNC 1KX4B 3KXBB 3LZ0D 3C1CB 4DRAA 5B2IB 4ZUXA 3C1BB 5CP6D 5AV6D 4NE3A 2CV5D 2BG1A 3NQUB 1P3KC 4WU8B 2ZY2A 5AVBD 1S32B 5B31B 4YM6B 1B6WA 3REIC 4J8UB 5AVCD 2YFWA 3EPJA 3REKC 3AZLC 2XD5A 4HGAB 3A1KA 5B1LD 5KDMB 3A6NB 2Y2KA 4KGCC 3WKJD 1M18A 1P34A 5DNND 5AV9D 4WU9B 4LD9D 1TZYB 1ZLAD 3B6FD 1P3OC 4QLCB 5F99C 1BH9B 3B6GB 1M18B 5B1MD 1HQ3A 2ZY4A 3KWQB 3RELA 3X1VB 4ZBJC 2YFVB 3H0RC 4Z5TB 5B33B 3UTAD 1WWIA 3W96B 5DNMC 3REHA 1P3BC 5E5AC 2Y2LA 2F2AC 4YS3C 3UT9D 5B24A 3O62B 3AN2B 3AFAA 5AV8D 3UTBD 4J8WC 5B0ZD 3LJAD 3AZID 4EO5B 3B0DB 3X1SD 4XUJD 3AZMD 2HUEB 2HIOC 1P3AC 5CPKB 3KUYB 4Z2MG 5G49A 4G92B 4JJNC 3MGRA 1M19C 2PYOC 4CAYB 3AZEA 5BO0A 2IO5B 1KX4C 3KXBC 3C1CC 5AV6A 5CP6A 1ID3A 1N1JB 1KX5B 3B0CW 3AV1D 1EQZB 3LZ1A 3MGSD 4J8VA 4YM6C 5B0YB 4J8UC 5BO0B 3AYWD 2Y2HA 5AVCA 3LZ0B 5CP6B 4XZQD 4H9OA 3A6NC 5AV5D 2RVQC 5GSUA 2CV5B 5B1LA 3P5JB 3TU4D 4CSRA 5AVBB 3B0BA 1BH8A 5DNNA 5AV9A 1U35A 1TZYC 1W2EA 4J8XA 3VH6T 4LD9A 2NZDB 4DRBA 4Z66D 3W99B 1H3OB 3B6GC 3W98D 4CSRB 3AZJD 3WKJB 3X1VC 3KWQC 5B1MA 5DNNB 4ZUXD 3REJD 4Z5TC 1ZLAB 3B6FB 3WA9D 3W96C 2L5AA 5AY8B 3WTPA 1P3FA 2F8NG 5B1MB 3AZKD 3AN2C 5B32B 3UTBA 4EO5C 5BT1D 3B0DC 5B0ZA 3LJAA 3UTAB 2HUEC 3AZMA 3MNND 5CPKC 3KUYC 3AZFD 2FFFB 4G92C 3UT9B 3REIA 3AV2A 1TAFA 2IO5C 5FUGA 5AV8B 1JFIB 3UTBB 5B2JB 3AZIB 5CPID 1F1EA 2AROD 4H9NB 5B40D 4XUJB 3X1SB 2BYMA 3AZHA 1KX5C 5JA4A 1HQ3D 2JE5A 3AV1A 4AWLC 1P3ID 5GXQA 2DF4C 4WNNA 3REHD 1P3OA 4UUZB 5AVBC 3MGSB 1P3LD 3TU4A 4H9SC 3AYWB 5JRGD 2NZDC 3W99C 5DNMA 4XZQB 3VH6A 2BYKA 5AV5B 3MGRD 3W98A 3AZED 2NQBB 1P3GA 1KX3C 2FJ7C 5BS7C 4KHAA 3REJA 1ZLAC 1ID3D 4Z66B 3LZ1D 3WA9A 3W97A 4J8VD 1P3AA 5AY8C 3AZJB 1M19A 5B32C 4ZUXB 3AZKA 3AZNA 1Q9CA 1R4VA 3VH5W 5GSUD 3UTAC 3WA9B 4NFTA 4R8PC 3MNNA 1U35D 4J8XD 3UT9C 3AZFA 1P3MC 2YFWB 3NQJA 1AOIA 5B31G 4WZSB 5AV8C 4WV4B 5B2JC 3WTPE 5GT3D 4X23C 5CPIA 4XUJC 2F8NH 2AROA 5B40A 1P34B 1ULYA 2F8NK 1P3IA 3MVDD 2F8ND 3WTPD 1P3FD 1HQ3B 3EPHA 3RELB 1P3LA 3VH5T 2ZM5A 3AYWC 3REHB 5JRGA 3VH6W 3WAAA 3MGQC 5AV5C 2UWXA 3REID 4KUDC 5B24B 3R45A 3LELC 3AV2D 2NQBC 3AFAB 3AZGA 3REKD 3AZLD 1M1AC 2RIQA 5B2IC 3C1BC 3X1TA 3AZHD 4Z66C 4WU8C 5G49B 1F66A 1S32C 5B31C 5CPJA 3MGRB 3AZJC 5GXQD 3AZEB 4M6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O D;  5AV6 B;  5F99 D;  4HGA C;  1ID3 B;  3LZ1 B;  3X1U A;  4J8V B;  4WU9 C;  5GT0 A;  1P3P A;  5AVC B;  5DNM D;  4QLC C;  4H9O B;  5GSU B;  5B1L B;  5GT3 A;  4YS3 D;  3KSY A;  1P3G D;  1M18 C;  1P34 C;  1BH8 B;  5AV9 B;  1U35 B;  4J8X B;  4LD9 B;  4H9S A;  5B33 C;  3W97 D;  2HIO D;  3MVD A;  1P3A D;  4H9R A;  2F8N A;  4JJN D;  1HQ3 C;  3REL C;  1M19 D;  3O62 C;  3MGP A;  1KX4 D;  3KXB D;  4H9Q A;  3AZN D;  2FJ7 A;  5C3I B;  3REH C;  1B67 A;  3V9R A;  4H9R B;  3VH5 A;  1P3K A;  3WTP B;  4YM6 D;  1P3F B;  1AOI D;  5B24 C;  4J8U D;  3AFA C;  3REK A;  3AZL A;  5B0Z B;  3LJA B;  5B32 G;  3V9R B;  3AZM B;  3A6N D;  4H9P A;  2RVQ D;  1EQZ C;  4R8P A;  4KGC A;  5B0Y C;  3MGR C;  3REI B;  4G91 B;  3AV2 B;  1TAF B;  5FUG B;  1TZY D;  1P3M A;  3LZ0 C;  4Z2M H;  5CP6 C;  5AV6 C;  3AZH B;  2BYM B;  1ID3 C;  2CV5 C;  5JA4 B;  5F99 A;  4X23 A;  3LZ1 C;  4J8V C;  3AV1 B;  3KWQ D;  5GXQ B;  4WNN B;  5BNX A;  5AVC C;  3WAA D;  3W96 D;  1P3O B;  5F99 B;  5GSU C;  1P3B A;  5B1L C;  5E5A A;  3AZG D;  3TU4 B;  4YS3 A;  3WKJ C;  3AN2 D;  5DNN C;  5AV9 C;  1U35 C;  4J8X C;  3X1T D;  1HTA A;  4LD9 C;  4J8W A;  3B6F C;  1F66 D;  5DNM B;  5CPK D;  5CPJ D;  2BYK B;  2HIO A;  3W98 B;  4YS3 B;  1P3G B;  4KUD A;  4JJN A;  5B1M C;  5BNV A;  3LEL A;  2PYO A;  4KHA B;  3REJ B;  1M1A A;  1KX4 A;  3KXB A;  5C3I C;  3C1C A;  3C1B A;  3X1U D;  3W97 B;  1KX5 D;  1P3A B;  3NQU A;  1WWS A;  4WU8 A;  3WTP C;  1P3F C;  5GT0 D;  4YM6 A;  1P3P D;  1M19 B;  4J8U A;  3AZK B;  3UTB C;  3AZN B;  5B0Z C;  3LJA C;  3AZI C;  3X1S C;  3AZM C;  5KDM A;  3A6N A;  3MNN B;  3AZF B;  1AOI B;  3NQJ B;  4G91 C;  3AV2 C;  5CHL B;  4WU9 A;  2NZD D;  1TZY A;  3W99 D;  5CPI B;  3AZH C;  4QLC A;  5B40 B;  2ARO B;  1BH9 A;  3B6G A;  3AV1 C;  3MGP D;  3MGS C;  1KX3 D;  2FJ7 D;  5GXQ C;  3KWQ A;  3X1V A;  1P3I B;  1BFM A;  2YFV A;  4Z5T A;  5B33 A;  1P3K D;  3W96 A;  4XZQ C;  5AY8 D;  3TU4 C;  1P3L B;  4NE5 A;  3O62 A;  5B32 D;  3AN2 A;  5JRG B;  3WAA B;  4R8P D;  4KGC D;  3W98 C;  5CPK A;  3R45 B;  3KUY A;  1P3G C;  3AZG B;  1P3M D;  4CAY A;  4ZUX C;  3REJ C;  3X1T B;  5B2J D;  4X23 D;  3WA9 C;  3W97 C;  1F66 B;  1N1J A;  5CPJ B;  1KX5 A;  1EQZ A;  5B0Y A;  3AZK C;  3AZN C;  1P3B D;  5E5A D;  3LZ0 A;  5BT1 C;  3X1U B;  2CV5 A;  3MNN C;  3AZF C;  5GT0 B;  5AVB A;  4AWL B;  1AOI C;  1P3P B;  4J8W D;  2NZD A;  5CPI C;  5GT3 B;  2ARO C;  3MGQ D;  5B40 C;  3W99 A;  1H3O A;  4KUD D;  3LEL D;  2NQB D;  2PYO D;  3WKJ A;  1M1A D;  1KX3 A;  1P3I C;  3C1C D;  5B2I D;  5BS7 A;  3C1B D;  1ZLA A;  3MVD B;  3B6F A;  4WU8 D;  2F8N B;  1S32 D;  5B31 D;  4E44 A;  5AY8 A;  3MGP B;  1P3L C;  1KX3 B;  4H9Q B;  2FJ7 B;  2JSS A;  5B32 A;  5JRG C;  2LY8 A;  4E45 A;  3B0C T;  3WAA C;  3UTA A;  1P3K B;  4WU9 D;  3AZE C;  3AZG C;  3UT9 A;  3REK B;  3AZL B;  3X1T C;  5AV8 A;  4QLC D;  1JFI A;  1KU5 A;  4H9P B;  5B2J A;  3AZI A;  3B6G D;  1F66 C;  3X1S A;  4H9N A;  4XUJ A;  4R8P B;  1M18 D;  4KGC B;  5CPJ C;  1P34 D;  3X1V D;  1P3M B;  4Z5T D;  5B33 D;  4NE6 A;  4X23 B;  3X1U C;  4UUZ A;  3REL D;  3O62 D;  5GT0 C;  4ZBJ B;  3MGS A;  5BNX B;  1P3P C;  3AYW A;  1P3B B;  5E5A B;  5GT3 C;  3KUY D;  3MGQ A;  4XZQ A;  5B24 D;  5AV5 A;  3AFA D;  2NQB A;  4J8W B;  1A7W A;  5B2I A;  3MVD C;  2HIO B;  4Z66 A;  1EQZ D;  2CWE A;  3MGQ B;  5B0Y D;  4KUD B;  4JJN B;  1S32 A;  5BNV B;  5B31 A;  3LEL B;  2PYO B;  3MGP C;  3AZJ A;  1M1A B;  1KX4 B;  3KXB B;  3LZ0 D;  3C1C B;  4DRA A;  5B2I B;  4ZUX A;  3C1B B;  5CP6 D;  5AV6 D;  4NE3 A;  2CV5 D;  3NQU B;  1P3K C;  4WU8 B;  5AVB D;  1S32 B;  5B31 B;  4YM6 B;  1B6W A;  3REI C;  4J8U B;  5AVC D;  2YFW A;  3REK C;  3AZL C;  4HGA B;  5B1L D;  5KDM B;  3A6N B;  4KGC C;  3WKJ D;  1M18 A;  1P34 A;  5DNN D;  5AV9 D;  4WU9 B;  4LD9 D;  1TZY B;  1ZLA D;  3B6F D;  1P3O C;  4QLC B;  5F99 C;  1BH9 B;  3B6G B;  1M18 B;  5B1M D;  1HQ3 A;  3X1V B;  3KWQ B;  3REL A;  4ZBJ C;  2YFV B;  4Z5T B;  5B33 B;  3UTA D;  1WWI A;  3W96 B;  5DNM C;  3REH A;  1P3B C;  5E5A C;  4YS3 C;  3UT9 D;  5B24 A;  3O62 B;  3AN2 B;  3AFA A;  5AV8 D;  3UTB D;  4J8W C;  5B0Z D;  3LJA D;  3AZI D;  4EO5 B;  3B0D B;  3X1S D;  4XUJ D;  3AZM D;  2HUE B;  2HIO C;  1P3A C;  5CPK B;  3KUY B;  4Z2M G;  5G49 A;  4G92 B;  4JJN C;  3MGR A;  1M19 C;  2PYO C;  4CAY B;  3AZE A;  5BO0 A;  2IO5 B;  1KX4 C;  3KXB C;  3C1C C;  5AV6 A;  5CP6 A;  1ID3 A;  1N1J B;  1KX5 B;  3B0C W;  3AV1 D;  1EQZ B;  3LZ1 A;  3MGS D;  4J8V A;  4YM6 C;  5B0Y B;  4J8U C;  5BO0 B;  3AYW D;  5AVC A;  3LZ0 B;  5CP6 B;  4XZQ D;  4H9O A;  3A6N C;  5AV5 D;  2RVQ C;  5GSU A;  2CV5 B;  5B1L A;  3TU4 D;  4CSR A;  5AVB B;  3B0B A;  1BH8 A;  5DNN A;  5AV9 A;  1U35 A;  1TZY C;  4J8X A;  3VH6 T;  4LD9 A;  2NZD B;  4DRB A;  4Z66 D;  3W99 B;  1H3O B;  3B6G C;  3W98 D;  4CSR B;  3AZJ D;  3WKJ B;  3X1V C;  3KWQ C;  5B1M A;  5DNN B;  4ZUX D;  3REJ D;  4Z5T C;  1ZLA B;  3B6F B;  3WA9 D;  3W96 C;  2L5A A;  5AY8 B;  3WTP A;  1P3F A;  2F8N G;  5B1M B;  3AZK D;  3AN2 C;  5B32 B;  3UTB A;  4EO5 C;  5BT1 D;  3B0D C;  5B0Z A;  3LJA A;  3UTA B;  2HUE C;  3AZM A;  3MNN D;  5CPK C;  3KUY C;  3AZF D;  4G92 C;  3UT9 B;  3REI A;  3AV2 A;  1TAF A;  2IO5 C;  5FUG A;  5AV8 B;  1JFI B;  3UTB B;  5B2J B;  3AZI B;  5CPI D;  3X1S B;  1F1E A;  2ARO D;  4H9N B;  5B40 D;  4XUJ B;  2BYM A;  3AZH A;  1KX5 C;  5JA4 A;  1HQ3 D;  3AV1 A;  4AWL C;  1P3I D;  5GXQ A;  4WNN A;  3REH D;  1P3O A;  4UUZ B;  5AVB C;  3MGS B;  1P3L D;  3TU4 A;  4H9S C;  3AYW B;  5JRG D;  2NZD C;  3W99 C;  5DNM A;  4XZQ B;  3VH6 A;  2BYK A;  5AV5 B;  3MGR D;  3W98 A;  3AZE D;  2NQB B;  1P3G A;  1KX3 C;  2FJ7 C;  5BS7 C;  4KHA A;  3REJ A;  1ZLA C;  1ID3 D;  4Z66 B;  3LZ1 D;  3WA9 A;  3W97 A;  4J8V D;  1P3A A;  5AY8 C;  3AZJ B;  1M19 A;  5B32 C;  4ZUX B;  3AZK A;  3AZN A;  1Q9C A;  1R4V A;  3VH5 W;  5GSU D;  3UTA C;  3WA9 B;  4NFT A;  4R8P C;  3MNN A;  1U35 D;  4J8X D;  3UT9 C;  3AZF A;  1P3M C;  2YFW B;  3NQJ A;  1AOI A;  5B31 G;  4WZS B;  5AV8 C;  4WV4 B;  5B2J C;  3WTP E;  5GT3 D;  4X23 C;  5CPI A;  4XUJ C;  2F8N H;  2ARO A;  5B40 A;  1P34 B;  1ULY A;  2F8N K;  1P3I A;  3MVD D;  2F8N D;  3WTP D;  1P3F D;  1HQ3 B;  3REL B;  1P3L A;  3VH5 T;  3AYW C;  3REH B;  5JRG A;  3VH6 W;  3WAA A;  3MGQ C;  5AV5 C;  4KUD C;  3REI D;  5B24 B;  3R45 A;  3LEL C;  3AV2 D;  2NQB C;  3AFA B;  3AZG A;  3REK D;  3AZL D;  1M1A C;  5B2I C;  3C1B C;  3X1T A;  3AZH D;  4Z66 C;  4WU8 C;  5G49 B;  1F66 A;  1S32 C;  5B31 C;  5CPJ A;  3MGR B;  3AZJ C;  5GXQ D;  3AZE B;  4M6B A; 
#chains in the Genus database with same CATH topology
 1P3O D;  5AV6 B;  5F99 D;  4HGA C;  1ID3 B;  3LZ1 B;  3X1U A;  4J8V B;  4WU9 C;  5GT0 A;  1P3P A;  5AVC B;  5DNM D;  4QLC C;  4H9O B;  5GSU B;  5B1L B;  5GT3 A;  4YS3 D;  3KSY A;  1P3G D;  1M18 C;  1P34 C;  1BH8 B;  5AV9 B;  1U35 B;  4J8X B;  4LD9 B;  4H9S A;  2Y2O A;  5B33 C;  2Y2P A;  3W97 D;  2HIO D;  3MVD A;  1P3A D;  4H9R A;  2F8N A;  4JJN D;  1HQ3 C;  2W8S A;  3REL C;  1M19 D;  3O62 C;  3MGP A;  1KX4 D;  3KXB D;  4H9Q A;  3AZN D;  2FJ7 A;  5C3I B;  3REH C;  1B67 A;  3V9R A;  2Y2Q A;  4H9R B;  3VH5 A;  1P3K A;  1PZR A;  3WTP B;  4YM6 D;  1P3F B;  1AOI D;  5B24 C;  4J8U D;  3AFA C;  3REK A;  3AZL A;  5B0Z B;  2Y2G A;  3LJA B;  5B32 G;  3V9R B;  3AZM B;  3A6N D;  4H9P A;  2RVQ D;  1EQZ C;  4R8P A;  4KGC A;  3A1I A;  5B0Y C;  3MGR C;  4G91 B;  3REI B;  3AV2 B;  3KFU G;  1TAF B;  5FUG B;  1TZY D;  1P3M A;  4WJ3 C;  3LZ0 C;  4Z2M H;  5CP6 C;  5AV6 C;  3AZH B;  2BYM B;  1ID3 C;  3AL0 C;  2CV5 C;  5JA4 B;  5F99 A;  4X23 A;  3LZ1 C;  4J8V C;  3AV1 B;  3KWQ D;  5GXQ B;  4WNN B;  5BNX A;  5AVC C;  3WAA D;  3W96 D;  1P3O B;  5F99 B;  5GSU C;  1P3B A;  5B1L C;  5E5A A;  3AZG D;  3TU4 B;  4YS3 A;  2JCH A;  3WKJ C;  3AN2 D;  5DNN C;  5AV9 C;  1U35 C;  4J8X C;  3X1T D;  1HTA A;  4LD9 C;  4J8W A;  3B6F C;  1F66 D;  5DNM B;  1Z2C B;  5CPK D;  5CPJ D;  2BYK B;  2HIO A;  3W98 B;  4YS3 B;  1P3G B;  4KUD A;  4JJN A;  5B1M C;  5BNV A;  3LEL A;  2PYO A;  4KHA B;  3REJ B;  1M1A A;  1KX4 A;  3KXB A;  5C3I C;  3C1C A;  3C1B A;  3X1U D;  3W97 B;  1KX5 D;  1P3A B;  3NQU A;  1WWS A;  4WU8 A;  3WTP C;  1P3F C;  5GT0 D;  4YM6 A;  1P3P D;  1M19 B;  3F6T A;  4J8U A;  3AZK B;  3UTB C;  3AZN B;  5B0Z C;  3LJA C;  3AZI C;  3X1S C;  3AZM C;  5KDM A;  3A6N A;  3MNN B;  3AZF B;  1AOI B;  3NQJ B;  4G91 C;  3AV2 C;  5CHL B;  2ZY3 A;  4WU9 A;  2NZD D;  1TZY A;  3W99 D;  5CPI B;  3AZH C;  4QLC A;  5B40 B;  2ARO B;  1BH9 A;  3B6G A;  3AV1 C;  3MGP D;  3MGS C;  2XD1 A;  1KX3 D;  2FJ7 D;  5GXQ C;  3KWQ A;  3X1V A;  1P3I B;  1BFM A;  2YFV A;  2VQR A;  4Z5T A;  5B33 A;  1P3K D;  3W96 A;  4XZQ C;  5AY8 D;  3TU4 C;  1P3L B;  4NE5 A;  3O62 A;  5B32 D;  3AN2 A;  5JRG B;  3WAA B;  4R8P D;  2ZY5 A;  4KGC D;  3W98 C;  5CPK A;  3R45 B;  3KUY A;  3EPL A;  1P3G C;  3AZG B;  1P3M D;  3FDD A;  4CAY A;  4ZUX C;  3REJ C;  3X1T B;  5B2J D;  2Y2N A;  4X23 D;  3WA9 C;  3W97 C;  2J8P A;  1F66 B;  1N1J A;  5CPJ B;  1KX5 A;  1EQZ A;  5B0Y A;  3AZK C;  3AZN C;  1P3B D;  5E5A D;  3H0L C;  5BT1 C;  3LZ0 A;  3X1U B;  2CV5 A;  3MNN C;  3AZF C;  5GT0 B;  5AVB A;  4AWL B;  1AOI C;  1P3P B;  4J8W D;  2NZD A;  5CPI C;  3IP4 C;  3EPK A;  5GT3 B;  2ARO C;  3MGQ D;  5B40 C;  3W99 A;  1H3O A;  4KUD D;  2G5H C;  3LEL D;  2NQB D;  2PYO D;  2Y2J A;  3WKJ A;  1M1A D;  1KX3 A;  1P3I C;  3C1C D;  5B2I D;  5BS7 A;  3C1B D;  1ZLA A;  3MVD B;  3B6F A;  4WU8 D;  2F8N B;  1S32 D;  5B31 D;  4E44 A;  5AY8 A;  3MGP B;  1P3L C;  1KX3 B;  4H9Q B;  2FJ7 B;  2JSS A;  5B32 A;  3H0M C;  2LY8 A;  4E45 A;  5JRG C;  3B0C T;  3WAA C;  4DQY B;  3UTA A;  1P3K B;  4WU9 D;  3AZE C;  3AZG C;  3UT9 A;  3REK B;  3AZL B;  3X1T C;  5AV8 A;  4QLC D;  1JFI A;  1KU5 A;  4H9P B;  5B2J A;  3AZI A;  3B6G D;  2Y2M A;  1F66 C;  3X1S A;  4H9N A;  4XUJ A;  4R8P B;  1M18 D;  4KGC B;  5CPJ C;  1P34 D;  3X1V D;  1P3M B;  4Z5T D;  5B33 D;  4NE6 A;  3EG5 B;  4UPK A;  4X23 B;  3X1U C;  4UUZ A;  1T3U A;  3REL D;  3O62 D;  5GT0 C;  4ZBJ B;  3MGS A;  5BNX B;  1P3P C;  3AYW A;  2Y2I A;  1P3B B;  5E5A B;  5GT3 C;  3KUY D;  3MGQ A;  4XZQ A;  5B24 D;  5AV5 A;  3AFA D;  2NQB A;  2G5I C;  4J8W B;  1A7W A;  5B2I A;  3MVD C;  2HIO B;  4Z66 A;  1EQZ D;  2CWE A;  3MGQ B;  5B0Y D;  4KUD B;  4JJN B;  1S32 A;  5BNV B;  5B31 A;  3LEL B;  2PYO B;  3MGP C;  3AZJ A;  1M1A B;  2DQN C;  1KX4 B;  3KXB B;  3LZ0 D;  3C1C B;  4DRA A;  5B2I B;  4ZUX A;  3C1B B;  5CP6 D;  5AV6 D;  4NE3 A;  2CV5 D;  2BG1 A;  3NQU B;  1P3K C;  4WU8 B;  2ZY2 A;  5AVB D;  1S32 B;  5B31 B;  4YM6 B;  1B6W A;  3REI C;  4J8U B;  5AVC D;  2YFW A;  3EPJ A;  3REK C;  3AZL C;  2XD5 A;  4HGA B;  3A1K A;  5B1L D;  5KDM B;  3A6N B;  2Y2K A;  4KGC C;  3WKJ D;  1M18 A;  1P34 A;  5DNN D;  5AV9 D;  4WU9 B;  4LD9 D;  1TZY B;  1ZLA D;  3B6F D;  1P3O C;  4QLC B;  5F99 C;  1BH9 B;  3B6G B;  1M18 B;  5B1M D;  1HQ3 A;  2ZY4 A;  3KWQ B;  3REL A;  3X1V B;  4ZBJ C;  2YFV B;  3H0R C;  4Z5T B;  5B33 B;  3UTA D;  1WWI A;  3W96 B;  5DNM C;  3REH A;  1P3B C;  5E5A C;  2Y2L A;  2F2A C;  4YS3 C;  3UT9 D;  5B24 A;  3O62 B;  3AN2 B;  3AFA A;  5AV8 D;  3UTB D;  4J8W C;  5B0Z D;  3LJA D;  3AZI D;  4EO5 B;  3B0D B;  3X1S D;  4XUJ D;  3AZM D;  2HUE B;  2HIO C;  1P3A C;  5CPK B;  3KUY B;  4Z2M G;  5G49 A;  4G92 B;  4JJN C;  3MGR A;  1M19 C;  2PYO C;  4CAY B;  3AZE A;  5BO0 A;  2IO5 B;  1KX4 C;  3KXB C;  3C1C C;  5AV6 A;  5CP6 A;  1ID3 A;  1N1J B;  1KX5 B;  3B0C W;  3AV1 D;  1EQZ B;  3LZ1 A;  3MGS D;  4J8V A;  4YM6 C;  5B0Y B;  4J8U C;  5BO0 B;  3AYW D;  2Y2H A;  5AVC A;  3LZ0 B;  5CP6 B;  4XZQ D;  4H9O A;  3A6N C;  5AV5 D;  2RVQ C;  5GSU A;  2CV5 B;  5B1L A;  3P5J B;  3TU4 D;  4CSR A;  5AVB B;  3B0B A;  1BH8 A;  5DNN A;  5AV9 A;  1U35 A;  1TZY C;  1W2E A;  4J8X A;  3VH6 T;  4LD9 A;  2NZD B;  4DRB A;  4Z66 D;  3W99 B;  1H3O B;  3B6G C;  3W98 D;  4CSR B;  3AZJ D;  3WKJ B;  3X1V C;  3KWQ C;  5B1M A;  5DNN B;  4ZUX D;  3REJ D;  4Z5T C;  1ZLA B;  3B6F B;  3WA9 D;  3W96 C;  2L5A A;  5AY8 B;  3WTP A;  1P3F A;  2F8N G;  5B1M B;  3AZK D;  3AN2 C;  5B32 B;  3UTB A;  4EO5 C;  5BT1 D;  3B0D C;  5B0Z A;  3LJA A;  3UTA B;  2HUE C;  3AZM A;  3MNN D;  5CPK C;  3KUY C;  3AZF D;  2FFF B;  4G92 C;  3UT9 B;  3REI A;  3AV2 A;  1TAF A;  2IO5 C;  5FUG A;  5AV8 B;  1JFI B;  3UTB B;  5B2J B;  3AZI B;  5CPI D;  1F1E A;  2ARO D;  4H9N B;  5B40 D;  4XUJ B;  3X1S B;  2BYM A;  3AZH A;  1KX5 C;  5JA4 A;  1HQ3 D;  2JE5 A;  3AV1 A;  4AWL C;  1P3I D;  5GXQ A;  2DF4 C;  4WNN A;  3REH D;  1P3O A;  4UUZ B;  5AVB C;  3MGS B;  1P3L D;  3TU4 A;  4H9S C;  3AYW B;  5JRG D;  2NZD C;  3W99 C;  5DNM A;  4XZQ B;  3VH6 A;  2BYK A;  5AV5 B;  3MGR D;  3W98 A;  3AZE D;  2NQB B;  1P3G A;  1KX3 C;  2FJ7 C;  5BS7 C;  4KHA A;  3REJ A;  1ZLA C;  1ID3 D;  4Z66 B;  3LZ1 D;  3WA9 A;  3W97 A;  4J8V D;  1P3A A;  5AY8 C;  3AZJ B;  1M19 A;  5B32 C;  4ZUX B;  3AZK A;  3AZN A;  1Q9C A;  1R4V A;  3VH5 W;  5GSU D;  3UTA C;  3WA9 B;  4NFT A;  4R8P C;  3MNN A;  1U35 D;  4J8X D;  3UT9 C;  3AZF A;  1P3M C;  2YFW B;  3NQJ A;  1AOI A;  5B31 G;  4WZS B;  5AV8 C;  4WV4 B;  5B2J C;  3WTP E;  5GT3 D;  4X23 C;  5CPI A;  4XUJ C;  2F8N H;  2ARO A;  5B40 A;  1P34 B;  1ULY A;  2F8N K;  1P3I A;  3MVD D;  2F8N D;  3WTP D;  1P3F D;  1HQ3 B;  3EPH A;  3REL B;  1P3L A;  3VH5 T;  2ZM5 A;  3AYW C;  3REH B;  5JRG A;  3VH6 W;  3WAA A;  3MGQ C;  5AV5 C;  2UWX A;  3REI D;  4KUD C;  5B24 B;  3R45 A;  3LEL C;  3AV2 D;  2NQB C;  3AFA B;  3AZG A;  3REK D;  3AZL D;  1M1A C;  2RIQ A;  5B2I C;  3C1B C;  3X1T A;  3AZH D;  4Z66 C;  4WU8 C;  5G49 B;  1F66 A;  1S32 C;  5B31 C;  5CPJ A;  3MGR B;  3AZJ C;  5GXQ D;  3AZE B;  4M6B A; 
#chains in the Genus database with same CATH homology
 1P3O D;  5AV6 B;  5F99 D;  4HGA C;  1ID3 B;  3LZ1 B;  3X1U A;  4J8V B;  4WU9 C;  5GT0 A;  1P3P A;  5AVC B;  5DNM D;  4QLC C;  4H9O B;  5GSU B;  5B1L B;  5GT3 A;  4YS3 D;  3KSY A;  1P3G D;  1M18 C;  1P34 C;  1BH8 B;  5AV9 B;  1U35 B;  4J8X B;  4LD9 B;  4H9S A;  2Y2O A;  5B33 C;  2Y2P A;  3W97 D;  2HIO D;  3MVD A;  1P3A D;  4H9R A;  2F8N A;  4JJN D;  1HQ3 C;  2W8S A;  3REL C;  1M19 D;  3O62 C;  3MGP A;  1KX4 D;  3KXB D;  4H9Q A;  3AZN D;  2FJ7 A;  5C3I B;  3REH C;  1B67 A;  3V9R A;  2Y2Q A;  4H9R B;  3VH5 A;  1P3K A;  1PZR A;  3WTP B;  4YM6 D;  1P3F B;  1AOI D;  5B24 C;  4J8U D;  3AFA C;  3REK A;  3AZL A;  5B0Z B;  2Y2G A;  3LJA B;  5B32 G;  3V9R B;  3AZM B;  3A6N D;  4H9P A;  2RVQ D;  1EQZ C;  4R8P A;  4KGC A;  3A1I A;  5B0Y C;  3MGR C;  4G91 B;  3REI B;  3AV2 B;  3KFU G;  1TAF B;  5FUG B;  1TZY D;  1P3M A;  4WJ3 C;  3LZ0 C;  4Z2M H;  5CP6 C;  5AV6 C;  3AZH B;  2BYM B;  1ID3 C;  3AL0 C;  2CV5 C;  5JA4 B;  5F99 A;  4X23 A;  3LZ1 C;  4J8V C;  3AV1 B;  3KWQ D;  5GXQ B;  4WNN B;  5BNX A;  5AVC C;  3WAA D;  3W96 D;  1P3O B;  5F99 B;  5GSU C;  1P3B A;  5B1L C;  5E5A A;  3AZG D;  3TU4 B;  4YS3 A;  2JCH A;  3WKJ C;  3AN2 D;  5DNN C;  5AV9 C;  1U35 C;  4J8X C;  3X1T D;  1HTA A;  4LD9 C;  4J8W A;  3B6F C;  1F66 D;  5DNM B;  1Z2C B;  5CPK D;  5CPJ D;  2BYK B;  2HIO A;  3W98 B;  4YS3 B;  1P3G B;  4KUD A;  4JJN A;  5B1M C;  5BNV A;  3LEL A;  2PYO A;  4KHA B;  3REJ B;  1M1A A;  1KX4 A;  3KXB A;  5C3I C;  3C1C A;  3C1B A;  3X1U D;  3W97 B;  1KX5 D;  1P3A B;  3NQU A;  1WWS A;  4WU8 A;  3WTP C;  1P3F C;  5GT0 D;  4YM6 A;  1P3P D;  1M19 B;  3F6T A;  4J8U A;  3AZK B;  3UTB C;  3AZN B;  5B0Z C;  3LJA C;  3AZI C;  3X1S C;  3AZM C;  5KDM A;  3A6N A;  3MNN B;  3AZF B;  1AOI B;  3NQJ B;  4G91 C;  3AV2 C;  5CHL B;  2ZY3 A;  4WU9 A;  2NZD D;  1TZY A;  3W99 D;  5CPI B;  3AZH C;  4QLC A;  5B40 B;  2ARO B;  1BH9 A;  3B6G A;  3AV1 C;  3MGP D;  3MGS C;  2XD1 A;  1KX3 D;  2FJ7 D;  5GXQ C;  3KWQ A;  3X1V A;  1P3I B;  1BFM A;  2YFV A;  2VQR A;  4Z5T A;  5B33 A;  1P3K D;  3W96 A;  4XZQ C;  5AY8 D;  3TU4 C;  1P3L B;  4NE5 A;  3O62 A;  5B32 D;  3AN2 A;  5JRG B;  3WAA B;  4R8P D;  2ZY5 A;  4KGC D;  3W98 C;  5CPK A;  3R45 B;  3KUY A;  3EPL A;  1P3G C;  3AZG B;  1P3M D;  3FDD A;  4CAY A;  4ZUX C;  3REJ C;  3X1T B;  5B2J D;  2Y2N A;  4X23 D;  3WA9 C;  3W97 C;  2J8P A;  1F66 B;  1N1J A;  5CPJ B;  1KX5 A;  1EQZ A;  5B0Y A;  3AZK C;  3AZN C;  1P3B D;  5E5A D;  3H0L C;  5BT1 C;  3LZ0 A;  3X1U B;  2CV5 A;  3MNN C;  3AZF C;  5GT0 B;  5AVB A;  4AWL B;  1AOI C;  1P3P B;  4J8W D;  2NZD A;  5CPI C;  3IP4 C;  3EPK A;  5GT3 B;  2ARO C;  3MGQ D;  5B40 C;  3W99 A;  1H3O A;  4KUD D;  2G5H C;  3LEL D;  2NQB D;  2PYO D;  2Y2J A;  3WKJ A;  1M1A D;  1KX3 A;  1P3I C;  3C1C D;  5B2I D;  5BS7 A;  3C1B D;  1ZLA A;  3MVD B;  3B6F A;  4WU8 D;  2F8N B;  1S32 D;  5B31 D;  4E44 A;  5AY8 A;  3MGP B;  1P3L C;  1KX3 B;  4H9Q B;  2FJ7 B;  2JSS A;  5B32 A;  3H0M C;  2LY8 A;  4E45 A;  5JRG C;  3B0C T;  3WAA C;  4DQY B;  3UTA A;  1P3K B;  4WU9 D;  3AZE C;  3AZG C;  3UT9 A;  3REK B;  3AZL B;  3X1T C;  5AV8 A;  4QLC D;  1JFI A;  1KU5 A;  4H9P B;  5B2J A;  3AZI A;  3B6G D;  2Y2M A;  1F66 C;  3X1S A;  4H9N A;  4XUJ A;  4R8P B;  1M18 D;  4KGC B;  5CPJ C;  1P34 D;  3X1V D;  1P3M B;  4Z5T D;  5B33 D;  4NE6 A;  3EG5 B;  4UPK A;  4X23 B;  3X1U C;  4UUZ A;  1T3U A;  3REL D;  3O62 D;  5GT0 C;  4ZBJ B;  3MGS A;  5BNX B;  1P3P C;  3AYW A;  2Y2I A;  1P3B B;  5E5A B;  5GT3 C;  3KUY D;  3MGQ A;  4XZQ A;  5B24 D;  5AV5 A;  3AFA D;  2NQB A;  2G5I C;  4J8W B;  1A7W A;  5B2I A;  3MVD C;  2HIO B;  4Z66 A;  1EQZ D;  2CWE A;  3MGQ B;  5B0Y D;  4KUD B;  4JJN B;  1S32 A;  5BNV B;  5B31 A;  3LEL B;  2PYO B;  3MGP C;  3AZJ A;  1M1A B;  2DQN C;  1KX4 B;  3KXB B;  3LZ0 D;  3C1C B;  4DRA A;  5B2I B;  4ZUX A;  3C1B B;  5CP6 D;  5AV6 D;  4NE3 A;  2CV5 D;  2BG1 A;  3NQU B;  1P3K C;  4WU8 B;  2ZY2 A;  5AVB D;  1S32 B;  5B31 B;  4YM6 B;  1B6W A;  3REI C;  4J8U B;  5AVC D;  2YFW A;  3EPJ A;  3REK C;  3AZL C;  2XD5 A;  4HGA B;  3A1K A;  5B1L D;  5KDM B;  3A6N B;  2Y2K A;  4KGC C;  3WKJ D;  1M18 A;  1P34 A;  5DNN D;  5AV9 D;  4WU9 B;  4LD9 D;  1TZY B;  1ZLA D;  3B6F D;  1P3O C;  4QLC B;  5F99 C;  1BH9 B;  3B6G B;  1M18 B;  5B1M D;  1HQ3 A;  2ZY4 A;  3KWQ B;  3REL A;  3X1V B;  4ZBJ C;  2YFV B;  3H0R C;  4Z5T B;  5B33 B;  3UTA D;  1WWI A;  3W96 B;  5DNM C;  3REH A;  1P3B C;  5E5A C;  2Y2L A;  2F2A C;  4YS3 C;  3UT9 D;  5B24 A;  3O62 B;  3AN2 B;  3AFA A;  5AV8 D;  3UTB D;  4J8W C;  5B0Z D;  3LJA D;  3AZI D;  4EO5 B;  3B0D B;  3X1S D;  4XUJ D;  3AZM D;  2HUE B;  2HIO C;  1P3A C;  5CPK B;  3KUY B;  4Z2M G;  5G49 A;  4G92 B;  4JJN C;  3MGR A;  1M19 C;  2PYO C;  4CAY B;  3AZE A;  5BO0 A;  2IO5 B;  1KX4 C;  3KXB C;  3C1C C;  5AV6 A;  5CP6 A;  1ID3 A;  1N1J B;  1KX5 B;  3B0C W;  3AV1 D;  1EQZ B;  3LZ1 A;  3MGS D;  4J8V A;  4YM6 C;  5B0Y B;  4J8U C;  5BO0 B;  3AYW D;  2Y2H A;  5AVC A;  3LZ0 B;  5CP6 B;  4XZQ D;  4H9O A;  3A6N C;  5AV5 D;  2RVQ C;  5GSU A;  2CV5 B;  5B1L A;  3P5J B;  3TU4 D;  4CSR A;  5AVB B;  3B0B A;  1BH8 A;  5DNN A;  5AV9 A;  1U35 A;  1TZY C;  1W2E A;  4J8X A;  3VH6 T;  4LD9 A;  2NZD B;  4DRB A;  4Z66 D;  3W99 B;  1H3O B;  3B6G C;  3W98 D;  4CSR B;  3AZJ D;  3WKJ B;  3X1V C;  3KWQ C;  5B1M A;  5DNN B;  4ZUX D;  3REJ D;  4Z5T C;  1ZLA B;  3B6F B;  3WA9 D;  3W96 C;  2L5A A;  5AY8 B;  3WTP A;  1P3F A;  2F8N G;  5B1M B;  3AZK D;  3AN2 C;  5B32 B;  3UTB A;  4EO5 C;  5BT1 D;  3B0D C;  5B0Z A;  3LJA A;  3UTA B;  2HUE C;  3AZM A;  3MNN D;  5CPK C;  3KUY C;  3AZF D;  2FFF B;  4G92 C;  3UT9 B;  3REI A;  3AV2 A;  1TAF A;  2IO5 C;  5FUG A;  5AV8 B;  1JFI B;  3UTB B;  5B2J B;  3AZI B;  5CPI D;  1F1E A;  2ARO D;  4H9N B;  5B40 D;  4XUJ B;  3X1S B;  2BYM A;  3AZH A;  1KX5 C;  5JA4 A;  1HQ3 D;  2JE5 A;  3AV1 A;  4AWL C;  1P3I D;  5GXQ A;  2DF4 C;  4WNN A;  3REH D;  1P3O A;  4UUZ B;  5AVB C;  3MGS B;  1P3L D;  3TU4 A;  4H9S C;  3AYW B;  5JRG D;  2NZD C;  3W99 C;  5DNM A;  4XZQ B;  3VH6 A;  2BYK A;  5AV5 B;  3MGR D;  3W98 A;  3AZE D;  2NQB B;  1P3G A;  1KX3 C;  2FJ7 C;  5BS7 C;  4KHA A;  3REJ A;  1ZLA C;  1ID3 D;  4Z66 B;  3LZ1 D;  3WA9 A;  3W97 A;  4J8V D;  1P3A A;  5AY8 C;  3AZJ B;  1M19 A;  5B32 C;  4ZUX B;  3AZK A;  3AZN A;  1Q9C A;  1R4V A;  3VH5 W;  5GSU D;  3UTA C;  3WA9 B;  4NFT A;  4R8P C;  3MNN A;  1U35 D;  4J8X D;  3UT9 C;  3AZF A;  1P3M C;  2YFW B;  3NQJ A;  1AOI A;  5B31 G;  4WZS B;  5AV8 C;  4WV4 B;  5B2J C;  3WTP E;  5GT3 D;  4X23 C;  5CPI A;  4XUJ C;  2F8N H;  2ARO A;  5B40 A;  1P34 B;  1ULY A;  2F8N K;  1P3I A;  3MVD D;  2F8N D;  3WTP D;  1P3F D;  1HQ3 B;  3EPH A;  3REL B;  1P3L A;  3VH5 T;  2ZM5 A;  3AYW C;  3REH B;  5JRG A;  3VH6 W;  3WAA A;  3MGQ C;  5AV5 C;  2UWX A;  3REI D;  4KUD C;  5B24 B;  3R45 A;  3LEL C;  3AV2 D;  2NQB C;  3AFA B;  3AZG A;  3REK D;  3AZL D;  1M1A C;  2RIQ A;  5B2I C;  3C1B C;  3X1T A;  3AZH D;  4Z66 C;  4WU8 C;  5G49 B;  1F66 A;  1S32 C;  5B31 C;  5CPJ A;  3MGR B;  3AZJ C;  5GXQ D;  3AZE B;  4M6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...