5B0ZB

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zB00
3MVDC 3AYWB 5CPIA 1HQ3D 3WA9C 1P3LA 1P3OB 1P34D 1P3GC 3REHD 3MGSD 5B2JA 4XUJA 3REIA 3AV1A 5BO0A 3KXBC 1HQ3A 1H3OA 1TZYA 2IO5C 4DRBA 2YFWA 3MGSA 3NQUA 2F8NH 5FUGB 4J8WB 2HIOB 3C1BB 3AV2A 5AV9B 2FJ7D 3WAAA 5B0YB 5B2IB 3MVDD 5AV8B 1P3KB 3WA9D 3C1CA 1P3GD 3B6GB 3KWQB 3NQJA 5G49A 4J8VB 4H9QB 1KX3B 3MGQB 3KXBD 1P3MC 3WA9A 1BH9A 1TAFB 5GT0D 1P3GA 3WKJC 1KX5B 4UUZA 4ZUXA 3AZHC 3KXBA 5E5AC 5GT0A 4XZQA 3REKB 4WZSB 3UT9C 5B31C 1WWIA 5DNMC 4H9RB 1P3FC 1U35B 3LELB 5B0ZC 5B33B 4YM6B 4WU8A 3X1SC 1P3IC 3AZMB 1P3MD 1P3PB 2PYOB 3RELC 3AZIC 2YFVA 2AROC 3WKJD 2NZDC 4QLCC 3AZHD 1WWSA 4G91C 1P3MA 3A6NC 5CPKB 5E5AD 3X1UA 3WKJA 5B1LB 3X1VA 5B31D 4KUDC 5DNMD 5JRGB 1P3FD 4G92C 5DNNB 4YS3A 5E5AA 5B0ZD 4CSRA 3X1SD 1P3ID 5CP6B 1M18C 3RELD 3AZID 2NQBC 2AROD 3AZNB 5DNMA 3MGPC 2NZDD 1N1JA 4QLCD 3TU4A 5B0ZA 3MGRC 1M1AC 3A6ND 3RELA 3AZIA 3B6FA 2AROA 5CPJB 2NZDA 4QLCA 4KUDD 1M19A 4WV4B 4H9PB 5B24C 3AZLB 1KX4C 5AVBC 5B32C 3AZGA 3W99A 4X23C 3W97C 4EO5B 1M18D 2NQBD 5C3IC 4KUDA 5AV6B 1P3BA 2F8NG 3MGPD 3R45A 3AFAB 4LD9B 5JA4B 3MNNC 3MGRD 4R8PB 3AZJC 3AYWC 1M1AD 2NQBA 5GXQB 3UTAA 5BNVB 1P3OC 2BYMB 3WTPB 2JSSA 3LJAA 1Q9CA 5GSUB 3UTBB 5B24D 1KX4D 2F8NB 5AVBD 5B32D 4KHAB 4ZBJB 4X23D 3W97D 1S32B 5AV5C 4J8WC 5BNXB 3LZ0B 2HIOC 1KX4A 1P3AB 1A7WA 3C1BC 5AV9C 5F99B 3W96B 3MNND 3REJB 3W97A 5B0YC 4X23A 5B2IC 3AYWD 3AZJD 1JFIB 5AV8C 1P3KC 5CPIB 3B0BA 4KGCB 1P3OD 3B6GC 3B0CW 3KWQC 4J8VC 5B2JB 1P34A 3REHA 4AWLB 5B40B 3REIB 3MGQC 3AV1B 4Z66D 1TZYB 4NFTA 3V9RA 1BH8A 5AV5D 1KX5C 3MGSB 4J8WD 3C1BD 2CV5B 5AV9D 4Z66A 3AV2B 5B0YD 3KSYA 5B2ID 3REKC 3WAAB 5AV8D 1P3KD 5AV5A 2FJ7A 5FUGA 3C1CB 3MVDA 3KWQD 4J8VD 3C1BA 1U35C 3LELC 1ZLAB 4Z5TB 5B2IA 5B33C 4YM6C 3MGQD 5AV8A 1P3KA 3AZMC 1P3PC 2PYOC 3VH6W 4NE6A 4J8VA 4H9QA 4ZUXB 3O62B 5CPKC 5B1LC 3REKD 4H9OA 5GT0B 4XZQB 1BFMA 3X1TB 4J8UB 5JRGC 1U35D 3LELD 3VH6A 5DNNC 3VH6T 4YM6D 3REKA 1P3PD 2PYOD 3AZMD 5CP6C 4WU8B 1HTAA 3AZNC 4WNNA 2YFVB 4H9RA 1U35A 1F1EA 3LELA 5BS7C 4YM6A 1P3PA 4WU9B 3UT9D 2HUEB 4Z2MH 5B1MB 3AZHA 5CPKD 5B1LD 3X1UB 4H9NB 5CPJC 4HGAB 4M6BA 3LZ1B 2BYKB 3X1VB 5JRGD 3AZLC 1ID3B 3UT9A 5DNND 5B31A 3AZEB 2CWEA 1KU5A 5B1LA 4YS3B 1P3FA 4CSRB 5CP6D 4JJNB 4EO5C 3AN2B 3KUYB 3AZND 3X1SA 3AZFB 5AV6C 4CAYB 1P3IA 4J8XB 5JRGA 3AFAC 3AZKB 5DNNA 4LD9C 4R8PC 3TU4B 5CP6A 1AOIB 5GXQC 3B6FB 3WTPC 3A6NA 5CPJD 5GSUC 3UTBC 3AZLD 1M19B 5AVCB 4ZBJC 1F66B 3AZGB 3W99B 5AY8B 5GT3B 1S32C 1EQZB 5AV6D 3LZ0C 1P3BB 1M18A 4H9PA 3WTPE 3AZLA 3AFAD 1P3AC 4LD9D 3B0DB 5F99C 3W96C 3MGPA 3REJC 4R8PD 5KDMB 5GXQD 5CPIC 5AV6A 4KGCC 3MGRA 3WTPD 3UTAB 1M1AA 5B2JC 3LJAB 3VH5W 4LD9A 5GSUD 4R8PA 4AWLC 3REIC 3UTBD 5B40C 2F8ND 3W98B 3AV1C 5BNVA 3WTPA 2BYMA 5B24A 1TZYC 5AVBA 1S32D 5B32A 3LZ0D 5GSUA 3UTBA 1P3AD 2CV5C 5F99D 4KHAA 3AV2C 3W96D 3REJD 1P3LB 3WAAC 1S32A 5CPID 4E45A 1KX3C 4XUJB 3MNNA 4H9SC 3AZJA 3LZ0A 3C1CC 2LY8A 3AYWA 4KGCD 1P3AA 5BO0B 4NE5A 1HQ3B 1H3OB 5F99A 5B2JD 1P3OA 1ZLAC 3REJA 1JFIA 5B40D 4Z5TC 3REID 1P34B 3REHB 2YFWB 3NQUB 3AV1D 4KGCA 2HIOD 1TZYD 3V9RB 1BH8B 5B40A 4ZUXC 3B0CT 3O62C 2CV5D 4J8WA 3B6GD 3AV2D 2HIOA 4Z2MG 4Z66B 3WAAD 5GT0C 3NQJB 4XZQC 5AV9A 5G49B 1KX3D 5AV5B 5B0YA 3C1CD 1B67A 2FJ7B 3X1TC 4J8UC 3MVDB 2CV5A 3WA9B 1BH9B 3B6GA 1ZLAD 3KWQA 4Z5TD 1P3GB 1KX5D 4WU8C 4UUZB 1KX3A 4H9SA 3MGQA 1TAFA 3KXBB 1ZLAA 4ZUXD 4Z5TA 2IO5B 3O62D 1KX5A 4WU9C 2HUEC 5B1MC 1ULYA 3X1UC 4XZQD 4H9OB 4HGAC 4DRAA 3LZ1C 5B33D 3X1VC 3X1TD 4J8UD 3O62A 1ID3C 2RVQC 3AZEC 4YS3C 4JJNC 4WU8D 3AN2C 3KUYC 5B33A 3AZFC 3X1TA 2PYOA 4J8UA 3AZMA 4J8XC 4WNNB 1P3MB 5B31G 3AZKC 3WKJB 3TU4C 4WU9D 5CHLB 1AOIC 5B1MD 3B6FC 3X1UD 3AZHB 5CPKA 3LZ1D 3X1VD 5E5AB 4WU9A 1M19C 1ID3D 2RVQD 5AVCC 5B1MA 3UT9B 3AZED 4YS3D 5B31B 2F8NK 1F66C 4JJND 4H9NA 3W99C 5AY8C 5GT3C 5DNMB 3AZGC 1P3FB 3AN2D 3LZ1A 2BYKA 3KUYD 1N1JB 3AZFD 1EQZC 5B0ZB 3X1SB 4J8XD 1P3BC 1P3IB 1ID3A 3AZKD 3RELB 3AZIB 3AZNA 3AZEA 3B0DC 1B6WA 2AROB 3TU4D 4JJNA 5BS7A 1AOID 3AN2A 3KUYA 2NZDB 3AZFA 3B6FD 4QLCB 4CAYA 3UTAC 4J8XA 4G91B 5BT1C 3A6NB 3AZKA 3LJAC 5CPJA 1M19D 5AVCD 1AOIA 3W98C 4KUDB 1F66D 3AZGD 3W99D 5AY8D 3R45B 5GT3D 4G92B 1EQZD 1P3BD 5AVCA 1M18B 2NQBB 1P3LC 1F66A 5B32G 5AY8A 5GT3A 3AFAA 3MGPB 1EQZA 5JA4A 4XUJC 3UTAD 5BT1D 3MGRB 1R4VA 1M1AB 5GXQA 1HQ3C 3LJAD 4NE3A 5KDMA 1P34C 3REHC 3W98D 3MGSC 2F8NA 5B24B 1KX4B 2L5AA 5AVBB 5B32B 4X23B 3W97B 3W98A 5C3IB 3VH5A 5BNXA 1P3LD 3VH5T 4E44A 4Z66C 3W96A 4XUJD 2FJ7C 3MNNB 3AZJB
chains in the Genus database with same CATH superfamily
3MVDC 3AYWB 5CPIA 1HQ3D 3WA9C 1P3LA 1P3OB 1P34D 1P3GC 3REHD 3MGSD 5B2JA 4XUJA 3REIA 3EPKA 3AV1A 5BO0A 3KXBC 1HQ3A 1H3OA 1TZYA 2UWXA 2IO5C 4DRBA 2YFWA 3MGSA 3NQUA 2F8NH 5FUGB 4J8WB 2HIOB 2BG1A 3C1BB 3AV2A 5AV9B 2FJ7D 3WAAA 5B0YB 5B2IB 3MVDD 5AV8B 1P3KB 3WA9D 3AL0C 3C1CA 2XD5A 1P3GD 3B6GB 3KWQB 3NQJA 5G49A 4J8VB 4H9QB 1KX3B 3MGQB 3KXBD 1P3MC 3WA9A 1BH9A 1TAFB 5GT0D 1P3GA 3WKJC 1KX5B 4UUZA 4ZUXA 2ZM5A 3AZHC 4UPKA 3KXBA 2Y2NA 5E5AC 5GT0A 4XZQA 3REKB 4WZSB 3UT9C 5B31C 1WWIA 5DNMC 1T3UA 3IP4C 4H9RB 1U35B 2VQRA 1P3FC 3LELB 2FFFB 5B33B 5B0ZC 4YM6B 4WU8A 3X1SC 1P3IC 3AZMB 1P3MD 1P3PB 2PYOB 2Y2KA 3RELC 3AZIC 2YFVA 2AROC 2ZY3A 3WKJD 3A1IA 2NZDC 4QLCC 3AZHD 1WWSA 4G91C 1P3MA 3A6NC 5CPKB 5E5AD 3X1UA 3WKJA 5B1LB 3X1VA 5B31D 4KUDC 5DNMD 5JRGB 1P3FD 4G92C 5DNNB 4YS3A 5E5AA 5B0ZD 4CSRA 3X1SD 1P3ID 5CP6B 1M18C 3RELD 3AZID 3EPHA 2NQBC 2AROD 3AZNB 5DNMA 3MGPC 2NZDD 1N1JA 2W8SA 4QLCD 3TU4A 5B0ZA 3MGRC 1M1AC 3A6ND 3RELA 3AZIA 3B6FA 2AROA 5CPJB 2G5IC 2NZDA 4QLCA 4KUDD 1M19A 4WV4B 4H9PB 5B24C 3AZLB 1KX4C 2Y2OA 5AVBC 5B32C 3AZGA 3W99A 4X23C 3W97C 4EO5B 1M18D 2NQBD 5C3IC 4KUDA 5AV6B 1P3BA 2F8NG 3MGPD 3R45A 3AFAB 2XD1A 4LD9B 5JA4B 3MNNC 3MGRD 4R8PB 3H0RC 3AZJC 3AYWC 1M1AD 2NQBA 5GXQB 3UTAA 5BNVB 1P3OC 2BYMB 3WTPB 2JSSA 3LJAA 1Q9CA 5GSUB 3UTBB 5B24D 1KX4D 2F8NB 5AVBD 5B32D 4KHAB 2Y2IA 4ZBJB 4X23D 3W97D 1S32B 5AV5C 4J8WC 5BNXB 3LZ0B 2DQNC 2HIOC 1KX4A 1P3AB 1A7WA 3C1BC 5AV9C 5F99B 3W96B 3MNND 3REJB 3W97A 5B0YC 4X23A 5B2IC 3AYWD 3AZJD 1JFIB 5AV8C 1P3KC 5CPIB 3B0BA 4KGCB 1P3OD 2Y2MA 3B6GC 3B0CW 3KWQC 2ZY2A 4J8VC 5B2JB 1P34A 3REHA 4AWLB 5B40B 3REIB 3MGQC 3AV1B 4Z66D 1W2EA 3F6TA 1TZYB 4NFTA 2DF4C 3V9RA 1BH8A 5AV5D 1KX5C 3MGSB 4J8WD 3C1BD 2CV5B 5AV9D 4Z66A 3AV2B 5B0YD 3KSYA 5B2ID 3REKC 3WAAB 5AV8D 1P3KD 5AV5A 2FJ7A 5FUGA 3C1CB 3MVDA 3KWQD 4J8VD 3C1BA 1U35C 3LELC 1ZLAB 4Z5TB 5B2IA 5B33C 4YM6C 3MGQD 5AV8A 1P3KA 3AZMC 1P3PC 2PYOC 3VH6W 4NE6A 3A1KA 4J8VA 3P5JB 4H9QA 4ZUXB 3O62B 5CPKC 5B1LC 3REKD 4H9OA 5GT0B 4XZQB 1BFMA 3EPLA 3X1TB 4J8UB 5JRGC 1U35D 3LELD 3VH6A 5DNNC 3VH6T 4YM6D 3REKA 1P3PD 2PYOD 3AZMD 5CP6C 4WU8B 1HTAA 3AZNC 3H0LC 4WNNA 2YFVB 4H9RA 1U35A 1F1EA 3LELA 5BS7C 4YM6A 1P3PA 4WU9B 3UT9D 1PZRA 2HUEB 4Z2MH 5B1MB 3AZHA 5CPKD 5B1LD 3X1UB 4H9NB 5CPJC 4HGAB 4M6BA 3LZ1B 2BYKB 3X1VB 2ZY5A 5JRGD 3AZLC 1ID3B 3UT9A 5DNND 5B31A 1Z2CB 3AZEB 2CWEA 1KU5A 5B1LA 4YS3B 1P3FA 2ZY4A 4CSRB 5CP6D 4JJNB 4EO5C 3AN2B 3KUYB 3AZND 3X1SA 3AZFB 5AV6C 4CAYB 1P3IA 4J8XB 5JRGA 3AFAC 3AZKB 5DNNA 2JE5A 4LD9C 4R8PC 3TU4B 5CP6A 1AOIB 5GXQC 3B6FB 2Y2JA 3WTPC 3A6NA 5CPJD 5GSUC 3UTBC 3AZLD 1M19B 5AVCB 4ZBJC 1F66B 3AZGB 3W99B 5AY8B 5GT3B 1S32C 1EQZB 5AV6D 3LZ0C 1P3BB 1M18A 4H9PA 3WTPE 3AZLA 3AFAD 1P3AC 4LD9D 3B0DB 5F99C 3W96C 3MGPA 3REJC 4R8PD 5KDMB 5GXQD 5CPIC 5AV6A 4KGCC 3MGRA 3WTPD 3UTAB 1M1AA 5B2JC 3LJAB 2Y2HA 3VH5W 4LD9A 5GSUD 4R8PA 4AWLC 3REIC 3UTBD 5B40C 2F8ND 3W98B 2Y2GA 3AV1C 5BNVA 2BYMA 3WTPA 5B24A 1TZYC 5AVBA 1S32D 5B32A 3LZ0D 5GSUA 3UTBA 4DQYB 1P3AD 2CV5C 5F99D 4KHAA 3AV2C 3W96D 3REJD 1P3LB 3WAAC 1S32A 5CPID 4E45A 1KX3C 4XUJB 3MNNA 4H9SC 3AZJA 3LZ0A 3C1CC 2LY8A 3AYWA 4KGCD 1P3AA 5BO0B 4NE5A 1HQ3B 1H3OB 5F99A 5B2JD 1P3OA 2Y2LA 3REJA 1JFIA 5B40D 4Z5TC 3REID 1P34B 3REHB 1ZLAC 2YFWB 3NQUB 3AV1D 4KGCA 2HIOD 1TZYD 3V9RB 1BH8B 5B40A 4ZUXC 3B0CT 3O62C 2CV5D 4J8WA 3B6GD 3AV2D 2HIOA 4Z2MG 4Z66B 3WAAD 5GT0C 3NQJB 4XZQC 5AV9A 5G49B 1KX3D 5AV5B 5B0YA 3C1CD 1B67A 2FJ7B 3X1TC 4J8UC 3MVDB 2CV5A 3WA9B 1BH9B 3B6GA 1ZLAD 3KWQA 4Z5TD 1P3GB 1KX5D 4WJ3C 4WU8C 4UUZB 1KX3A 4H9SA 3MGQA 3H0MC 1TAFA 3KXBB 1ZLAA 4ZUXD 4Z5TA 2IO5B 3O62D 1KX5A 4WU9C 2HUEC 5B1MC 2RIQA 1ULYA 3X1UC 4XZQD 4H9OB 4HGAC 4DRAA 3LZ1C 5B33D 3X1VC 3X1TD 4J8UD 3O62A 1ID3C 2RVQC 3AZEC 2G5HC 4YS3C 4JJNC 4WU8D 3AN2C 3KUYC 5B33A 3AZFC 3X1TA 2PYOA 4J8UA 3AZMA 4J8XC 4WNNB 1P3MB 5B31G 3AZKC 3WKJB 3TU4C 4WU9D 5CHLB 1AOIC 5B1MD 3B6FC 3X1UD 3AZHB 2Y2PA 5CPKA 3LZ1D 3X1VD 5E5AB 2Y2QA 4WU9A 1M19C 1ID3D 2RVQD 5AVCC 2F2AC 5B1MA 3UT9B 3AZED 4YS3D 5B31B 2F8NK 1F66C 4JJND 4H9NA 3W99C 5AY8C 5GT3C 5DNMB 3AZGC 1P3FB 3AN2D 3LZ1A 2BYKA 3KUYD 1N1JB 3AZFD 1EQZC 5B0ZB 3X1SB 4J8XD 1P3BC 1P3IB 1ID3A 3AZKD 3RELB 3AZIB 3AZNA 3AZEA 1B6WA 2AROB 3B0DC 3TU4D 4JJNA 5BS7A 1AOID 3AN2A 3KUYA 2NZDB 3AZFA 3B6FD 4QLCB 4CAYA 3UTAC 4J8XA 3EG5B 4G91B 5BT1C 3A6NB 3AZKA 3LJAC 5CPJA 1M19D 5AVCD 1AOIA 3W98C 3KFUG 4KUDB 1F66D 3AZGD 3W99D 5AY8D 3R45B 5GT3D 4G92B 2J8PA 2JCHA 1EQZD 1P3BD 5AVCA 1M18B 2NQBB 1P3LC 1F66A 5B32G 5AY8A 5GT3A 3AFAA 3MGPB 1EQZA 5JA4A 4XUJC 3UTAD 5BT1D 3MGRB 1R4VA 1M1AB 5GXQA 1HQ3C 3LJAD 4NE3A 5KDMA 1P34C 3REHC 3W98D 3MGSC 3FDDA 2F8NA 5B24B 1KX4B 2L5AA 5AVBB 3EPJA 5B32B 4X23B 3W97B 3W98A 5C3IB 3VH5A 5BNXA 1P3LD 3VH5T 4E44A 4Z66C 3W96A 4XUJD 2FJ7C 3MNNB 3AZJB
chains in the Genus database with same CATH topology
3MVDC 3AYWB 5CPIA 1HQ3D 3WA9C 1P3LA 1P3OB 1P34D 1P3GC 3REHD 3MGSD 5B2JA 4XUJA 3REIA 3EPKA 3AV1A 5BO0A 3KXBC 1HQ3A 1H3OA 1TZYA 2UWXA 2IO5C 4DRBA 2YFWA 3MGSA 3NQUA 2F8NH 5FUGB 4J8WB 2HIOB 2BG1A 3C1BB 3AV2A 5AV9B 2FJ7D 3WAAA 5B0YB 5B2IB 3MVDD 5AV8B 1P3KB 3WA9D 3AL0C 3C1CA 2XD5A 1P3GD 3B6GB 3KWQB 3NQJA 5G49A 4J8VB 4H9QB 1KX3B 3MGQB 3KXBD 1P3MC 3WA9A 1BH9A 1TAFB 5GT0D 1P3GA 3WKJC 1KX5B 4UUZA 4ZUXA 2ZM5A 3AZHC 4UPKA 3KXBA 2Y2NA 5E5AC 5GT0A 4XZQA 3REKB 4WZSB 3UT9C 5B31C 1WWIA 5DNMC 1T3UA 3IP4C 4H9RB 1U35B 2VQRA 1P3FC 3LELB 2FFFB 5B33B 5B0ZC 4YM6B 4WU8A 3X1SC 1P3IC 3AZMB 1P3MD 1P3PB 2PYOB 2Y2KA 3RELC 3AZIC 2YFVA 2AROC 2ZY3A 3WKJD 3A1IA 2NZDC 4QLCC 3AZHD 1WWSA 4G91C 1P3MA 3A6NC 5CPKB 5E5AD 3X1UA 3WKJA 5B1LB 3X1VA 5B31D 4KUDC 5DNMD 5JRGB 1P3FD 4G92C 5DNNB 4YS3A 5E5AA 5B0ZD 4CSRA 3X1SD 1P3ID 5CP6B 1M18C 3RELD 3AZID 3EPHA 2NQBC 2AROD 3AZNB 5DNMA 3MGPC 2NZDD 1N1JA 2W8SA 4QLCD 3TU4A 5B0ZA 3MGRC 1M1AC 3A6ND 3RELA 3AZIA 3B6FA 2AROA 5CPJB 2G5IC 2NZDA 4QLCA 4KUDD 1M19A 4WV4B 4H9PB 5B24C 3AZLB 1KX4C 2Y2OA 5AVBC 5B32C 3AZGA 3W99A 4X23C 3W97C 4EO5B 1M18D 2NQBD 5C3IC 4KUDA 5AV6B 1P3BA 2F8NG 3MGPD 3R45A 3AFAB 2XD1A 4LD9B 5JA4B 3MNNC 3MGRD 4R8PB 3H0RC 3AZJC 3AYWC 1M1AD 2NQBA 5GXQB 3UTAA 5BNVB 1P3OC 2BYMB 3WTPB 2JSSA 3LJAA 1Q9CA 5GSUB 3UTBB 5B24D 1KX4D 2F8NB 5AVBD 5B32D 4KHAB 2Y2IA 4ZBJB 4X23D 3W97D 1S32B 5AV5C 4J8WC 5BNXB 3LZ0B 2DQNC 2HIOC 1KX4A 1P3AB 1A7WA 3C1BC 5AV9C 5F99B 3W96B 3MNND 3REJB 3W97A 5B0YC 4X23A 5B2IC 3AYWD 3AZJD 1JFIB 5AV8C 1P3KC 5CPIB 3B0BA 4KGCB 1P3OD 2Y2MA 3B6GC 3B0CW 3KWQC 2ZY2A 4J8VC 5B2JB 1P34A 3REHA 4AWLB 5B40B 3REIB 3MGQC 3AV1B 4Z66D 1W2EA 3F6TA 1TZYB 4NFTA 2DF4C 3V9RA 1BH8A 5AV5D 1KX5C 3MGSB 4J8WD 3C1BD 2CV5B 5AV9D 4Z66A 3AV2B 5B0YD 3KSYA 5B2ID 3REKC 3WAAB 5AV8D 1P3KD 5AV5A 2FJ7A 5FUGA 3C1CB 3MVDA 3KWQD 4J8VD 3C1BA 1U35C 3LELC 1ZLAB 4Z5TB 5B2IA 5B33C 4YM6C 3MGQD 5AV8A 1P3KA 3AZMC 1P3PC 2PYOC 3VH6W 4NE6A 3A1KA 4J8VA 3P5JB 4H9QA 4ZUXB 3O62B 5CPKC 5B1LC 3REKD 4H9OA 5GT0B 4XZQB 1BFMA 3EPLA 3X1TB 4J8UB 5JRGC 1U35D 3LELD 3VH6A 5DNNC 3VH6T 4YM6D 3REKA 1P3PD 2PYOD 3AZMD 5CP6C 4WU8B 1HTAA 3AZNC 3H0LC 4WNNA 2YFVB 4H9RA 1U35A 1F1EA 3LELA 5BS7C 4YM6A 1P3PA 4WU9B 3UT9D 1PZRA 2HUEB 4Z2MH 5B1MB 3AZHA 5CPKD 5B1LD 3X1UB 4H9NB 5CPJC 4HGAB 4M6BA 3LZ1B 2BYKB 3X1VB 2ZY5A 5JRGD 3AZLC 1ID3B 3UT9A 5DNND 5B31A 1Z2CB 3AZEB 2CWEA 1KU5A 5B1LA 4YS3B 1P3FA 2ZY4A 4CSRB 5CP6D 4JJNB 4EO5C 3AN2B 3KUYB 3AZND 3X1SA 3AZFB 5AV6C 4CAYB 1P3IA 4J8XB 5JRGA 3AFAC 3AZKB 5DNNA 2JE5A 4LD9C 4R8PC 3TU4B 5CP6A 1AOIB 5GXQC 3B6FB 2Y2JA 3WTPC 3A6NA 5CPJD 5GSUC 3UTBC 3AZLD 1M19B 5AVCB 4ZBJC 1F66B 3AZGB 3W99B 5AY8B 5GT3B 1S32C 1EQZB 5AV6D 3LZ0C 1P3BB 1M18A 4H9PA 3WTPE 3AZLA 3AFAD 1P3AC 4LD9D 3B0DB 5F99C 3W96C 3MGPA 3REJC 4R8PD 5KDMB 5GXQD 5CPIC 5AV6A 4KGCC 3MGRA 3WTPD 3UTAB 1M1AA 5B2JC 3LJAB 2Y2HA 3VH5W 4LD9A 5GSUD 4R8PA 4AWLC 3REIC 3UTBD 5B40C 2F8ND 3W98B 2Y2GA 3AV1C 5BNVA 2BYMA 3WTPA 5B24A 1TZYC 5AVBA 1S32D 5B32A 3LZ0D 5GSUA 3UTBA 4DQYB 1P3AD 2CV5C 5F99D 4KHAA 3AV2C 3W96D 3REJD 1P3LB 3WAAC 1S32A 5CPID 4E45A 1KX3C 4XUJB 3MNNA 4H9SC 3AZJA 3LZ0A 3C1CC 2LY8A 3AYWA 4KGCD 1P3AA 5BO0B 4NE5A 1HQ3B 1H3OB 5F99A 5B2JD 1P3OA 2Y2LA 3REJA 1JFIA 5B40D 4Z5TC 3REID 1P34B 3REHB 1ZLAC 2YFWB 3NQUB 3AV1D 4KGCA 2HIOD 1TZYD 3V9RB 1BH8B 5B40A 4ZUXC 3B0CT 3O62C 2CV5D 4J8WA 3B6GD 3AV2D 2HIOA 4Z2MG 4Z66B 3WAAD 5GT0C 3NQJB 4XZQC 5AV9A 5G49B 1KX3D 5AV5B 5B0YA 3C1CD 1B67A 2FJ7B 3X1TC 4J8UC 3MVDB 2CV5A 3WA9B 1BH9B 3B6GA 1ZLAD 3KWQA 4Z5TD 1P3GB 1KX5D 4WJ3C 4WU8C 4UUZB 1KX3A 4H9SA 3MGQA 3H0MC 1TAFA 3KXBB 1ZLAA 4ZUXD 4Z5TA 2IO5B 3O62D 1KX5A 4WU9C 2HUEC 5B1MC 2RIQA 1ULYA 3X1UC 4XZQD 4H9OB 4HGAC 4DRAA 3LZ1C 5B33D 3X1VC 3X1TD 4J8UD 3O62A 1ID3C 2RVQC 3AZEC 2G5HC 4YS3C 4JJNC 4WU8D 3AN2C 3KUYC 5B33A 3AZFC 3X1TA 2PYOA 4J8UA 3AZMA 4J8XC 4WNNB 1P3MB 5B31G 3AZKC 3WKJB 3TU4C 4WU9D 5CHLB 1AOIC 5B1MD 3B6FC 3X1UD 3AZHB 2Y2PA 5CPKA 3LZ1D 3X1VD 5E5AB 2Y2QA 4WU9A 1M19C 1ID3D 2RVQD 5AVCC 2F2AC 5B1MA 3UT9B 3AZED 4YS3D 5B31B 2F8NK 1F66C 4JJND 4H9NA 3W99C 5AY8C 5GT3C 5DNMB 3AZGC 1P3FB 3AN2D 3LZ1A 2BYKA 3KUYD 1N1JB 3AZFD 1EQZC 5B0ZB 3X1SB 4J8XD 1P3BC 1P3IB 1ID3A 3AZKD 3RELB 3AZIB 3AZNA 3AZEA 1B6WA 2AROB 3B0DC 3TU4D 4JJNA 5BS7A 1AOID 3AN2A 3KUYA 2NZDB 3AZFA 3B6FD 4QLCB 4CAYA 3UTAC 4J8XA 3EG5B 4G91B 5BT1C 3A6NB 3AZKA 3LJAC 5CPJA 1M19D 5AVCD 1AOIA 3W98C 3KFUG 4KUDB 1F66D 3AZGD 3W99D 5AY8D 3R45B 5GT3D 4G92B 2J8PA 2JCHA 1EQZD 1P3BD 5AVCA 1M18B 2NQBB 1P3LC 1F66A 5B32G 5AY8A 5GT3A 3AFAA 3MGPB 1EQZA 5JA4A 4XUJC 3UTAD 5BT1D 3MGRB 1R4VA 1M1AB 5GXQA 1HQ3C 3LJAD 4NE3A 5KDMA 1P34C 3REHC 3W98D 3MGSC 3FDDA 2F8NA 5B24B 1KX4B 2L5AA 5AVBB 3EPJA 5B32B 4X23B 3W97B 3W98A 5C3IB 3VH5A 5BNXA 1P3LD 3VH5T 4E44A 4Z66C 3W96A 4XUJD 2FJ7C 3MNNB 3AZJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD C;  3AYW B;  5CPI A;  1HQ3 D;  3WA9 C;  1P3L A;  1P3O B;  1P34 D;  1P3G C;  3REH D;  3MGS D;  5B2J A;  4XUJ A;  3REI A;  3AV1 A;  5BO0 A;  3KXB C;  1HQ3 A;  1H3O A;  1TZY A;  2IO5 C;  4DRB A;  2YFW A;  3MGS A;  3NQU A;  2F8N H;  5FUG B;  4J8W B;  2HIO B;  3C1B B;  3AV2 A;  5AV9 B;  2FJ7 D;  3WAA A;  5B0Y B;  5B2I B;  3MVD D;  5AV8 B;  1P3K B;  3WA9 D;  3C1C A;  1P3G D;  3B6G B;  3KWQ B;  3NQJ A;  5G49 A;  4J8V B;  4H9Q B;  1KX3 B;  3MGQ B;  3KXB D;  1P3M C;  3WA9 A;  1BH9 A;  1TAF B;  5GT0 D;  1P3G A;  3WKJ C;  1KX5 B;  4UUZ A;  4ZUX A;  3AZH C;  3KXB A;  5E5A C;  5GT0 A;  4XZQ A;  3REK B;  4WZS B;  3UT9 C;  5B31 C;  1WWI A;  5DNM C;  4H9R B;  1P3F C;  1U35 B;  3LEL B;  5B0Z C;  5B33 B;  4YM6 B;  4WU8 A;  3X1S C;  1P3I C;  3AZM B;  1P3M D;  1P3P B;  2PYO B;  3REL C;  3AZI C;  2YFV A;  2ARO C;  3WKJ D;  2NZD C;  4QLC C;  3AZH D;  1WWS A;  4G91 C;  1P3M A;  3A6N C;  5CPK B;  5E5A D;  3X1U A;  3WKJ A;  5B1L B;  3X1V A;  5B31 D;  4KUD C;  5DNM D;  5JRG B;  1P3F D;  4G92 C;  5DNN B;  4YS3 A;  5E5A A;  5B0Z D;  4CSR A;  3X1S D;  1P3I D;  5CP6 B;  1M18 C;  3REL D;  3AZI D;  2NQB C;  2ARO D;  3AZN B;  5DNM A;  3MGP C;  2NZD D;  1N1J A;  4QLC D;  3TU4 A;  5B0Z A;  3MGR C;  1M1A C;  3A6N D;  3REL A;  3AZI A;  3B6F A;  2ARO A;  5CPJ B;  2NZD A;  4QLC A;  4KUD D;  1M19 A;  4WV4 B;  4H9P B;  5B24 C;  3AZL B;  1KX4 C;  5AVB C;  5B32 C;  3AZG A;  3W99 A;  4X23 C;  3W97 C;  4EO5 B;  1M18 D;  2NQB D;  5C3I C;  4KUD A;  5AV6 B;  1P3B A;  2F8N G;  3MGP D;  3R45 A;  3AFA B;  4LD9 B;  5JA4 B;  3MNN C;  3MGR D;  4R8P B;  3AZJ C;  3AYW C;  1M1A D;  2NQB A;  5GXQ B;  3UTA A;  5BNV B;  1P3O C;  2BYM B;  3WTP B;  2JSS A;  3LJA A;  1Q9C A;  5GSU B;  3UTB B;  5B24 D;  1KX4 D;  2F8N B;  5AVB D;  5B32 D;  4KHA B;  4ZBJ B;  4X23 D;  3W97 D;  1S32 B;  5AV5 C;  4J8W C;  5BNX B;  3LZ0 B;  2HIO C;  1KX4 A;  1P3A B;  1A7W A;  3C1B C;  5AV9 C;  5F99 B;  3W96 B;  3MNN D;  3REJ B;  3W97 A;  5B0Y C;  4X23 A;  5B2I C;  3AYW D;  3AZJ D;  1JFI B;  5AV8 C;  1P3K C;  5CPI B;  3B0B A;  4KGC B;  1P3O D;  3B6G C;  3B0C W;  3KWQ C;  4J8V C;  5B2J B;  1P34 A;  3REH A;  4AWL B;  5B40 B;  3REI B;  3MGQ C;  3AV1 B;  4Z66 D;  1TZY B;  4NFT A;  3V9R A;  1BH8 A;  5AV5 D;  1KX5 C;  3MGS B;  4J8W D;  3C1B D;  2CV5 B;  5AV9 D;  4Z66 A;  3AV2 B;  5B0Y D;  3KSY A;  5B2I D;  3REK C;  3WAA B;  5AV8 D;  1P3K D;  5AV5 A;  2FJ7 A;  5FUG A;  3C1C B;  3MVD A;  3KWQ D;  4J8V D;  3C1B A;  1U35 C;  3LEL C;  1ZLA B;  4Z5T B;  5B2I A;  5B33 C;  4YM6 C;  3MGQ D;  5AV8 A;  1P3K A;  3AZM C;  1P3P C;  2PYO C;  3VH6 W;  4NE6 A;  4J8V A;  4H9Q A;  4ZUX B;  3O62 B;  5CPK C;  5B1L C;  3REK D;  4H9O A;  5GT0 B;  4XZQ B;  1BFM A;  3X1T B;  4J8U B;  5JRG C;  1U35 D;  3LEL D;  3VH6 A;  5DNN C;  3VH6 T;  4YM6 D;  3REK A;  1P3P D;  2PYO D;  3AZM D;  5CP6 C;  4WU8 B;  1HTA A;  3AZN C;  4WNN A;  2YFV B;  4H9R A;  1U35 A;  1F1E A;  3LEL A;  5BS7 C;  4YM6 A;  1P3P A;  4WU9 B;  3UT9 D;  2HUE B;  4Z2M H;  5B1M B;  3AZH A;  5CPK D;  5B1L D;  3X1U B;  4H9N B;  5CPJ C;  4HGA B;  4M6B A;  3LZ1 B;  2BYK B;  3X1V B;  5JRG D;  3AZL C;  1ID3 B;  3UT9 A;  5DNN D;  5B31 A;  3AZE B;  2CWE A;  1KU5 A;  5B1L A;  4YS3 B;  1P3F A;  4CSR B;  5CP6 D;  4JJN B;  4EO5 C;  3AN2 B;  3KUY B;  3AZN D;  3X1S A;  3AZF B;  5AV6 C;  4CAY B;  1P3I A;  4J8X B;  5JRG A;  3AFA C;  3AZK B;  5DNN A;  4LD9 C;  4R8P C;  3TU4 B;  5CP6 A;  1AOI B;  5GXQ C;  3B6F B;  3WTP C;  3A6N A;  5CPJ D;  5GSU C;  3UTB C;  3AZL D;  1M19 B;  5AVC B;  4ZBJ C;  1F66 B;  3AZG B;  3W99 B;  5AY8 B;  5GT3 B;  1S32 C;  1EQZ B;  5AV6 D;  3LZ0 C;  1P3B B;  1M18 A;  4H9P A;  3WTP E;  3AZL A;  3AFA D;  1P3A C;  4LD9 D;  3B0D B;  5F99 C;  3W96 C;  3MGP A;  3REJ C;  4R8P D;  5KDM B;  5GXQ D;  5CPI C;  5AV6 A;  4KGC C;  3MGR A;  3WTP D;  3UTA B;  1M1A A;  5B2J C;  3LJA B;  3VH5 W;  4LD9 A;  5GSU D;  4R8P A;  4AWL C;  3REI C;  3UTB D;  5B40 C;  2F8N D;  3W98 B;  3AV1 C;  5BNV A;  3WTP A;  2BYM A;  5B24 A;  1TZY C;  5AVB A;  1S32 D;  5B32 A;  3LZ0 D;  5GSU A;  3UTB A;  1P3A D;  2CV5 C;  5F99 D;  4KHA A;  3AV2 C;  3W96 D;  3REJ D;  1P3L B;  3WAA C;  1S32 A;  5CPI D;  4E45 A;  1KX3 C;  4XUJ B;  3MNN A;  4H9S C;  3AZJ A;  3LZ0 A;  3C1C C;  2LY8 A;  3AYW A;  4KGC D;  1P3A A;  5BO0 B;  4NE5 A;  1HQ3 B;  1H3O B;  5F99 A;  5B2J D;  1P3O A;  1ZLA C;  3REJ A;  1JFI A;  5B40 D;  4Z5T C;  3REI D;  1P34 B;  3REH B;  2YFW B;  3NQU B;  3AV1 D;  4KGC A;  2HIO D;  1TZY D;  3V9R B;  1BH8 B;  5B40 A;  4ZUX C;  3B0C T;  3O62 C;  2CV5 D;  4J8W A;  3B6G D;  3AV2 D;  2HIO A;  4Z2M G;  4Z66 B;  3WAA D;  5GT0 C;  3NQJ B;  4XZQ C;  5AV9 A;  5G49 B;  1KX3 D;  5AV5 B;  5B0Y A;  3C1C D;  1B67 A;  2FJ7 B;  3X1T C;  4J8U C;  3MVD B;  2CV5 A;  3WA9 B;  1BH9 B;  3B6G A;  1ZLA D;  3KWQ A;  4Z5T D;  1P3G B;  1KX5 D;  4WU8 C;  4UUZ B;  1KX3 A;  4H9S A;  3MGQ A;  1TAF A;  3KXB B;  1ZLA A;  4ZUX D;  4Z5T A;  2IO5 B;  3O62 D;  1KX5 A;  4WU9 C;  2HUE C;  5B1M C;  1ULY A;  3X1U C;  4XZQ D;  4H9O B;  4HGA C;  4DRA A;  3LZ1 C;  5B33 D;  3X1V C;  3X1T D;  4J8U D;  3O62 A;  1ID3 C;  2RVQ C;  3AZE C;  4YS3 C;  4JJN C;  4WU8 D;  3AN2 C;  3KUY C;  5B33 A;  3AZF C;  3X1T A;  2PYO A;  4J8U A;  3AZM A;  4J8X C;  4WNN B;  1P3M B;  5B31 G;  3AZK C;  3WKJ B;  3TU4 C;  4WU9 D;  5CHL B;  1AOI C;  5B1M D;  3B6F C;  3X1U D;  3AZH B;  5CPK A;  3LZ1 D;  3X1V D;  5E5A B;  4WU9 A;  1M19 C;  1ID3 D;  2RVQ D;  5AVC C;  5B1M A;  3UT9 B;  3AZE D;  4YS3 D;  5B31 B;  2F8N K;  1F66 C;  4JJN D;  4H9N A;  3W99 C;  5AY8 C;  5GT3 C;  5DNM B;  3AZG C;  1P3F B;  3AN2 D;  3LZ1 A;  2BYK A;  3KUY D;  1N1J B;  3AZF D;  1EQZ C;  5B0Z B;  3X1S B;  4J8X D;  1P3B C;  1P3I B;  1ID3 A;  3AZK D;  3REL B;  3AZI B;  3AZN A;  3AZE A;  3B0D C;  1B6W A;  2ARO B;  3TU4 D;  4JJN A;  5BS7 A;  1AOI D;  3AN2 A;  3KUY A;  2NZD B;  3AZF A;  3B6F D;  4QLC B;  4CAY A;  3UTA C;  4J8X A;  4G91 B;  5BT1 C;  3A6N B;  3AZK A;  3LJA C;  5CPJ A;  1M19 D;  5AVC D;  1AOI A;  3W98 C;  4KUD B;  1F66 D;  3AZG D;  3W99 D;  5AY8 D;  3R45 B;  5GT3 D;  4G92 B;  1EQZ D;  1P3B D;  5AVC A;  1M18 B;  2NQB B;  1P3L C;  1F66 A;  5B32 G;  5AY8 A;  5GT3 A;  3AFA A;  3MGP B;  1EQZ A;  5JA4 A;  4XUJ C;  3UTA D;  5BT1 D;  3MGR B;  1R4V A;  1M1A B;  5GXQ A;  1HQ3 C;  3LJA D;  4NE3 A;  5KDM A;  1P34 C;  3REH C;  3W98 D;  3MGS C;  2F8N A;  5B24 B;  1KX4 B;  2L5A A;  5AVB B;  5B32 B;  4X23 B;  3W97 B;  3W98 A;  5C3I B;  3VH5 A;  5BNX A;  1P3L D;  3VH5 T;  4E44 A;  4Z66 C;  3W96 A;  4XUJ D;  2FJ7 C;  3MNN B;  3AZJ B; 
#chains in the Genus database with same CATH topology
 3MVD C;  3AYW B;  5CPI A;  1HQ3 D;  3WA9 C;  1P3L A;  1P3O B;  1P34 D;  1P3G C;  3REH D;  3MGS D;  5B2J A;  4XUJ A;  3REI A;  3EPK A;  3AV1 A;  5BO0 A;  3KXB C;  1HQ3 A;  1H3O A;  1TZY A;  2UWX A;  2IO5 C;  4DRB A;  2YFW A;  3MGS A;  3NQU A;  2F8N H;  5FUG B;  4J8W B;  2HIO B;  2BG1 A;  3C1B B;  3AV2 A;  5AV9 B;  2FJ7 D;  3WAA A;  5B0Y B;  5B2I B;  3MVD D;  5AV8 B;  1P3K B;  3WA9 D;  3AL0 C;  3C1C A;  2XD5 A;  1P3G D;  3B6G B;  3KWQ B;  3NQJ A;  5G49 A;  4J8V B;  4H9Q B;  1KX3 B;  3MGQ B;  3KXB D;  1P3M C;  3WA9 A;  1BH9 A;  1TAF B;  5GT0 D;  1P3G A;  3WKJ C;  1KX5 B;  4UUZ A;  4ZUX A;  2ZM5 A;  3AZH C;  4UPK A;  3KXB A;  2Y2N A;  5E5A C;  5GT0 A;  4XZQ A;  3REK B;  4WZS B;  3UT9 C;  5B31 C;  1WWI A;  5DNM C;  1T3U A;  3IP4 C;  4H9R B;  1U35 B;  2VQR A;  1P3F C;  3LEL B;  2FFF B;  5B33 B;  5B0Z C;  4YM6 B;  4WU8 A;  3X1S C;  1P3I C;  3AZM B;  1P3M D;  1P3P B;  2PYO B;  2Y2K A;  3REL C;  3AZI C;  2YFV A;  2ARO C;  2ZY3 A;  3WKJ D;  3A1I A;  2NZD C;  4QLC C;  3AZH D;  1WWS A;  4G91 C;  1P3M A;  3A6N C;  5CPK B;  5E5A D;  3X1U A;  3WKJ A;  5B1L B;  3X1V A;  5B31 D;  4KUD C;  5DNM D;  5JRG B;  1P3F D;  4G92 C;  5DNN B;  4YS3 A;  5E5A A;  5B0Z D;  4CSR A;  3X1S D;  1P3I D;  5CP6 B;  1M18 C;  3REL D;  3AZI D;  3EPH A;  2NQB C;  2ARO D;  3AZN B;  5DNM A;  3MGP C;  2NZD D;  1N1J A;  2W8S A;  4QLC D;  3TU4 A;  5B0Z A;  3MGR C;  1M1A C;  3A6N D;  3REL A;  3AZI A;  3B6F A;  2ARO A;  5CPJ B;  2G5I C;  2NZD A;  4QLC A;  4KUD D;  1M19 A;  4WV4 B;  4H9P B;  5B24 C;  3AZL B;  1KX4 C;  2Y2O A;  5AVB C;  5B32 C;  3AZG A;  3W99 A;  4X23 C;  3W97 C;  4EO5 B;  1M18 D;  2NQB D;  5C3I C;  4KUD A;  5AV6 B;  1P3B A;  2F8N G;  3MGP D;  3R45 A;  3AFA B;  2XD1 A;  4LD9 B;  5JA4 B;  3MNN C;  3MGR D;  4R8P B;  3H0R C;  3AZJ C;  3AYW C;  1M1A D;  2NQB A;  5GXQ B;  3UTA A;  5BNV B;  1P3O C;  2BYM B;  3WTP B;  2JSS A;  3LJA A;  1Q9C A;  5GSU B;  3UTB B;  5B24 D;  1KX4 D;  2F8N B;  5AVB D;  5B32 D;  4KHA B;  2Y2I A;  4ZBJ B;  4X23 D;  3W97 D;  1S32 B;  5AV5 C;  4J8W C;  5BNX B;  3LZ0 B;  2DQN C;  2HIO C;  1KX4 A;  1P3A B;  1A7W A;  3C1B C;  5AV9 C;  5F99 B;  3W96 B;  3MNN D;  3REJ B;  3W97 A;  5B0Y C;  4X23 A;  5B2I C;  3AYW D;  3AZJ D;  1JFI B;  5AV8 C;  1P3K C;  5CPI B;  3B0B A;  4KGC B;  1P3O D;  2Y2M A;  3B6G C;  3B0C W;  3KWQ C;  2ZY2 A;  4J8V C;  5B2J B;  1P34 A;  3REH A;  4AWL B;  5B40 B;  3REI B;  3MGQ C;  3AV1 B;  4Z66 D;  1W2E A;  3F6T A;  1TZY B;  4NFT A;  2DF4 C;  3V9R A;  1BH8 A;  5AV5 D;  1KX5 C;  3MGS B;  4J8W D;  3C1B D;  2CV5 B;  5AV9 D;  4Z66 A;  3AV2 B;  5B0Y D;  3KSY A;  5B2I D;  3REK C;  3WAA B;  5AV8 D;  1P3K D;  5AV5 A;  2FJ7 A;  5FUG A;  3C1C B;  3MVD A;  3KWQ D;  4J8V D;  3C1B A;  1U35 C;  3LEL C;  1ZLA B;  4Z5T B;  5B2I A;  5B33 C;  4YM6 C;  3MGQ D;  5AV8 A;  1P3K A;  3AZM C;  1P3P C;  2PYO C;  3VH6 W;  4NE6 A;  3A1K A;  4J8V A;  3P5J B;  4H9Q A;  4ZUX B;  3O62 B;  5CPK C;  5B1L C;  3REK D;  4H9O A;  5GT0 B;  4XZQ B;  1BFM A;  3EPL A;  3X1T B;  4J8U B;  5JRG C;  1U35 D;  3LEL D;  3VH6 A;  5DNN C;  3VH6 T;  4YM6 D;  3REK A;  1P3P D;  2PYO D;  3AZM D;  5CP6 C;  4WU8 B;  1HTA A;  3AZN C;  3H0L C;  4WNN A;  2YFV B;  4H9R A;  1U35 A;  1F1E A;  3LEL A;  5BS7 C;  4YM6 A;  1P3P A;  4WU9 B;  3UT9 D;  1PZR A;  2HUE B;  4Z2M H;  5B1M B;  3AZH A;  5CPK D;  5B1L D;  3X1U B;  4H9N B;  5CPJ C;  4HGA B;  4M6B A;  3LZ1 B;  2BYK B;  3X1V B;  2ZY5 A;  5JRG D;  3AZL C;  1ID3 B;  3UT9 A;  5DNN D;  5B31 A;  1Z2C B;  3AZE B;  2CWE A;  1KU5 A;  5B1L A;  4YS3 B;  1P3F A;  2ZY4 A;  4CSR B;  5CP6 D;  4JJN B;  4EO5 C;  3AN2 B;  3KUY B;  3AZN D;  3X1S A;  3AZF B;  5AV6 C;  4CAY B;  1P3I A;  4J8X B;  5JRG A;  3AFA C;  3AZK B;  5DNN A;  2JE5 A;  4LD9 C;  4R8P C;  3TU4 B;  5CP6 A;  1AOI B;  5GXQ C;  3B6F B;  2Y2J A;  3WTP C;  3A6N A;  5CPJ D;  5GSU C;  3UTB C;  3AZL D;  1M19 B;  5AVC B;  4ZBJ C;  1F66 B;  3AZG B;  3W99 B;  5AY8 B;  5GT3 B;  1S32 C;  1EQZ B;  5AV6 D;  3LZ0 C;  1P3B B;  1M18 A;  4H9P A;  3WTP E;  3AZL A;  3AFA D;  1P3A C;  4LD9 D;  3B0D B;  5F99 C;  3W96 C;  3MGP A;  3REJ C;  4R8P D;  5KDM B;  5GXQ D;  5CPI C;  5AV6 A;  4KGC C;  3MGR A;  3WTP D;  3UTA B;  1M1A A;  5B2J C;  3LJA B;  2Y2H A;  3VH5 W;  4LD9 A;  5GSU D;  4R8P A;  4AWL C;  3REI C;  3UTB D;  5B40 C;  2F8N D;  3W98 B;  2Y2G A;  3AV1 C;  5BNV A;  2BYM A;  3WTP A;  5B24 A;  1TZY C;  5AVB A;  1S32 D;  5B32 A;  3LZ0 D;  5GSU A;  3UTB A;  4DQY B;  1P3A D;  2CV5 C;  5F99 D;  4KHA A;  3AV2 C;  3W96 D;  3REJ D;  1P3L B;  3WAA C;  1S32 A;  5CPI D;  4E45 A;  1KX3 C;  4XUJ B;  3MNN A;  4H9S C;  3AZJ A;  3LZ0 A;  3C1C C;  2LY8 A;  3AYW A;  4KGC D;  1P3A A;  5BO0 B;  4NE5 A;  1HQ3 B;  1H3O B;  5F99 A;  5B2J D;  1P3O A;  2Y2L A;  3REJ A;  1JFI A;  5B40 D;  4Z5T C;  3REI D;  1P34 B;  3REH B;  1ZLA C;  2YFW B;  3NQU B;  3AV1 D;  4KGC A;  2HIO D;  1TZY D;  3V9R B;  1BH8 B;  5B40 A;  4ZUX C;  3B0C T;  3O62 C;  2CV5 D;  4J8W A;  3B6G D;  3AV2 D;  2HIO A;  4Z2M G;  4Z66 B;  3WAA D;  5GT0 C;  3NQJ B;  4XZQ C;  5AV9 A;  5G49 B;  1KX3 D;  5AV5 B;  5B0Y A;  3C1C D;  1B67 A;  2FJ7 B;  3X1T C;  4J8U C;  3MVD B;  2CV5 A;  3WA9 B;  1BH9 B;  3B6G A;  1ZLA D;  3KWQ A;  4Z5T D;  1P3G B;  1KX5 D;  4WJ3 C;  4WU8 C;  4UUZ B;  1KX3 A;  4H9S A;  3MGQ A;  3H0M C;  1TAF A;  3KXB B;  1ZLA A;  4ZUX D;  4Z5T A;  2IO5 B;  3O62 D;  1KX5 A;  4WU9 C;  2HUE C;  5B1M C;  2RIQ A;  1ULY A;  3X1U C;  4XZQ D;  4H9O B;  4HGA C;  4DRA A;  3LZ1 C;  5B33 D;  3X1V C;  3X1T D;  4J8U D;  3O62 A;  1ID3 C;  2RVQ C;  3AZE C;  2G5H C;  4YS3 C;  4JJN C;  4WU8 D;  3AN2 C;  3KUY C;  5B33 A;  3AZF C;  3X1T A;  2PYO A;  4J8U A;  3AZM A;  4J8X C;  4WNN B;  1P3M B;  5B31 G;  3AZK C;  3WKJ B;  3TU4 C;  4WU9 D;  5CHL B;  1AOI C;  5B1M D;  3B6F C;  3X1U D;  3AZH B;  2Y2P A;  5CPK A;  3LZ1 D;  3X1V D;  5E5A B;  2Y2Q A;  4WU9 A;  1M19 C;  1ID3 D;  2RVQ D;  5AVC C;  2F2A C;  5B1M A;  3UT9 B;  3AZE D;  4YS3 D;  5B31 B;  2F8N K;  1F66 C;  4JJN D;  4H9N A;  3W99 C;  5AY8 C;  5GT3 C;  5DNM B;  3AZG C;  1P3F B;  3AN2 D;  3LZ1 A;  2BYK A;  3KUY D;  1N1J B;  3AZF D;  1EQZ C;  5B0Z B;  3X1S B;  4J8X D;  1P3B C;  1P3I B;  1ID3 A;  3AZK D;  3REL B;  3AZI B;  3AZN A;  3AZE A;  1B6W A;  2ARO B;  3B0D C;  3TU4 D;  4JJN A;  5BS7 A;  1AOI D;  3AN2 A;  3KUY A;  2NZD B;  3AZF A;  3B6F D;  4QLC B;  4CAY A;  3UTA C;  4J8X A;  3EG5 B;  4G91 B;  5BT1 C;  3A6N B;  3AZK A;  3LJA C;  5CPJ A;  1M19 D;  5AVC D;  1AOI A;  3W98 C;  3KFU G;  4KUD B;  1F66 D;  3AZG D;  3W99 D;  5AY8 D;  3R45 B;  5GT3 D;  4G92 B;  2J8P A;  2JCH A;  1EQZ D;  1P3B D;  5AVC A;  1M18 B;  2NQB B;  1P3L C;  1F66 A;  5B32 G;  5AY8 A;  5GT3 A;  3AFA A;  3MGP B;  1EQZ A;  5JA4 A;  4XUJ C;  3UTA D;  5BT1 D;  3MGR B;  1R4V A;  1M1A B;  5GXQ A;  1HQ3 C;  3LJA D;  4NE3 A;  5KDM A;  1P34 C;  3REH C;  3W98 D;  3MGS C;  3FDD A;  2F8N A;  5B24 B;  1KX4 B;  2L5A A;  5AVB B;  3EPJ A;  5B32 B;  4X23 B;  3W97 B;  3W98 A;  5C3I B;  3VH5 A;  5BNX A;  1P3L D;  3VH5 T;  4E44 A;  4Z66 C;  3W96 A;  4XUJ D;  2FJ7 C;  3MNN B;  3AZJ B; 
#chains in the Genus database with same CATH homology
 3MVD C;  3AYW B;  5CPI A;  1HQ3 D;  3WA9 C;  1P3L A;  1P3O B;  1P34 D;  1P3G C;  3REH D;  3MGS D;  5B2J A;  4XUJ A;  3REI A;  3EPK A;  3AV1 A;  5BO0 A;  3KXB C;  1HQ3 A;  1H3O A;  1TZY A;  2UWX A;  2IO5 C;  4DRB A;  2YFW A;  3MGS A;  3NQU A;  2F8N H;  5FUG B;  4J8W B;  2HIO B;  2BG1 A;  3C1B B;  3AV2 A;  5AV9 B;  2FJ7 D;  3WAA A;  5B0Y B;  5B2I B;  3MVD D;  5AV8 B;  1P3K B;  3WA9 D;  3AL0 C;  3C1C A;  2XD5 A;  1P3G D;  3B6G B;  3KWQ B;  3NQJ A;  5G49 A;  4J8V B;  4H9Q B;  1KX3 B;  3MGQ B;  3KXB D;  1P3M C;  3WA9 A;  1BH9 A;  1TAF B;  5GT0 D;  1P3G A;  3WKJ C;  1KX5 B;  4UUZ A;  4ZUX A;  2ZM5 A;  3AZH C;  4UPK A;  3KXB A;  2Y2N A;  5E5A C;  5GT0 A;  4XZQ A;  3REK B;  4WZS B;  3UT9 C;  5B31 C;  1WWI A;  5DNM C;  1T3U A;  3IP4 C;  4H9R B;  1U35 B;  2VQR A;  1P3F C;  3LEL B;  2FFF B;  5B33 B;  5B0Z C;  4YM6 B;  4WU8 A;  3X1S C;  1P3I C;  3AZM B;  1P3M D;  1P3P B;  2PYO B;  2Y2K A;  3REL C;  3AZI C;  2YFV A;  2ARO C;  2ZY3 A;  3WKJ D;  3A1I A;  2NZD C;  4QLC C;  3AZH D;  1WWS A;  4G91 C;  1P3M A;  3A6N C;  5CPK B;  5E5A D;  3X1U A;  3WKJ A;  5B1L B;  3X1V A;  5B31 D;  4KUD C;  5DNM D;  5JRG B;  1P3F D;  4G92 C;  5DNN B;  4YS3 A;  5E5A A;  5B0Z D;  4CSR A;  3X1S D;  1P3I D;  5CP6 B;  1M18 C;  3REL D;  3AZI D;  3EPH A;  2NQB C;  2ARO D;  3AZN B;  5DNM A;  3MGP C;  2NZD D;  1N1J A;  2W8S A;  4QLC D;  3TU4 A;  5B0Z A;  3MGR C;  1M1A C;  3A6N D;  3REL A;  3AZI A;  3B6F A;  2ARO A;  5CPJ B;  2G5I C;  2NZD A;  4QLC A;  4KUD D;  1M19 A;  4WV4 B;  4H9P B;  5B24 C;  3AZL B;  1KX4 C;  2Y2O A;  5AVB C;  5B32 C;  3AZG A;  3W99 A;  4X23 C;  3W97 C;  4EO5 B;  1M18 D;  2NQB D;  5C3I C;  4KUD A;  5AV6 B;  1P3B A;  2F8N G;  3MGP D;  3R45 A;  3AFA B;  2XD1 A;  4LD9 B;  5JA4 B;  3MNN C;  3MGR D;  4R8P B;  3H0R C;  3AZJ C;  3AYW C;  1M1A D;  2NQB A;  5GXQ B;  3UTA A;  5BNV B;  1P3O C;  2BYM B;  3WTP B;  2JSS A;  3LJA A;  1Q9C A;  5GSU B;  3UTB B;  5B24 D;  1KX4 D;  2F8N B;  5AVB D;  5B32 D;  4KHA B;  2Y2I A;  4ZBJ B;  4X23 D;  3W97 D;  1S32 B;  5AV5 C;  4J8W C;  5BNX B;  3LZ0 B;  2DQN C;  2HIO C;  1KX4 A;  1P3A B;  1A7W A;  3C1B C;  5AV9 C;  5F99 B;  3W96 B;  3MNN D;  3REJ B;  3W97 A;  5B0Y C;  4X23 A;  5B2I C;  3AYW D;  3AZJ D;  1JFI B;  5AV8 C;  1P3K C;  5CPI B;  3B0B A;  4KGC B;  1P3O D;  2Y2M A;  3B6G C;  3B0C W;  3KWQ C;  2ZY2 A;  4J8V C;  5B2J B;  1P34 A;  3REH A;  4AWL B;  5B40 B;  3REI B;  3MGQ C;  3AV1 B;  4Z66 D;  1W2E A;  3F6T A;  1TZY B;  4NFT A;  2DF4 C;  3V9R A;  1BH8 A;  5AV5 D;  1KX5 C;  3MGS B;  4J8W D;  3C1B D;  2CV5 B;  5AV9 D;  4Z66 A;  3AV2 B;  5B0Y D;  3KSY A;  5B2I D;  3REK C;  3WAA B;  5AV8 D;  1P3K D;  5AV5 A;  2FJ7 A;  5FUG A;  3C1C B;  3MVD A;  3KWQ D;  4J8V D;  3C1B A;  1U35 C;  3LEL C;  1ZLA B;  4Z5T B;  5B2I A;  5B33 C;  4YM6 C;  3MGQ D;  5AV8 A;  1P3K A;  3AZM C;  1P3P C;  2PYO C;  3VH6 W;  4NE6 A;  3A1K A;  4J8V A;  3P5J B;  4H9Q A;  4ZUX B;  3O62 B;  5CPK C;  5B1L C;  3REK D;  4H9O A;  5GT0 B;  4XZQ B;  1BFM A;  3EPL A;  3X1T B;  4J8U B;  5JRG C;  1U35 D;  3LEL D;  3VH6 A;  5DNN C;  3VH6 T;  4YM6 D;  3REK A;  1P3P D;  2PYO D;  3AZM D;  5CP6 C;  4WU8 B;  1HTA A;  3AZN C;  3H0L C;  4WNN A;  2YFV B;  4H9R A;  1U35 A;  1F1E A;  3LEL A;  5BS7 C;  4YM6 A;  1P3P A;  4WU9 B;  3UT9 D;  1PZR A;  2HUE B;  4Z2M H;  5B1M B;  3AZH A;  5CPK D;  5B1L D;  3X1U B;  4H9N B;  5CPJ C;  4HGA B;  4M6B A;  3LZ1 B;  2BYK B;  3X1V B;  2ZY5 A;  5JRG D;  3AZL C;  1ID3 B;  3UT9 A;  5DNN D;  5B31 A;  1Z2C B;  3AZE B;  2CWE A;  1KU5 A;  5B1L A;  4YS3 B;  1P3F A;  2ZY4 A;  4CSR B;  5CP6 D;  4JJN B;  4EO5 C;  3AN2 B;  3KUY B;  3AZN D;  3X1S A;  3AZF B;  5AV6 C;  4CAY B;  1P3I A;  4J8X B;  5JRG A;  3AFA C;  3AZK B;  5DNN A;  2JE5 A;  4LD9 C;  4R8P C;  3TU4 B;  5CP6 A;  1AOI B;  5GXQ C;  3B6F B;  2Y2J A;  3WTP C;  3A6N A;  5CPJ D;  5GSU C;  3UTB C;  3AZL D;  1M19 B;  5AVC B;  4ZBJ C;  1F66 B;  3AZG B;  3W99 B;  5AY8 B;  5GT3 B;  1S32 C;  1EQZ B;  5AV6 D;  3LZ0 C;  1P3B B;  1M18 A;  4H9P A;  3WTP E;  3AZL A;  3AFA D;  1P3A C;  4LD9 D;  3B0D B;  5F99 C;  3W96 C;  3MGP A;  3REJ C;  4R8P D;  5KDM B;  5GXQ D;  5CPI C;  5AV6 A;  4KGC C;  3MGR A;  3WTP D;  3UTA B;  1M1A A;  5B2J C;  3LJA B;  2Y2H A;  3VH5 W;  4LD9 A;  5GSU D;  4R8P A;  4AWL C;  3REI C;  3UTB D;  5B40 C;  2F8N D;  3W98 B;  2Y2G A;  3AV1 C;  5BNV A;  2BYM A;  3WTP A;  5B24 A;  1TZY C;  5AVB A;  1S32 D;  5B32 A;  3LZ0 D;  5GSU A;  3UTB A;  4DQY B;  1P3A D;  2CV5 C;  5F99 D;  4KHA A;  3AV2 C;  3W96 D;  3REJ D;  1P3L B;  3WAA C;  1S32 A;  5CPI D;  4E45 A;  1KX3 C;  4XUJ B;  3MNN A;  4H9S C;  3AZJ A;  3LZ0 A;  3C1C C;  2LY8 A;  3AYW A;  4KGC D;  1P3A A;  5BO0 B;  4NE5 A;  1HQ3 B;  1H3O B;  5F99 A;  5B2J D;  1P3O A;  2Y2L A;  3REJ A;  1JFI A;  5B40 D;  4Z5T C;  3REI D;  1P34 B;  3REH B;  1ZLA C;  2YFW B;  3NQU B;  3AV1 D;  4KGC A;  2HIO D;  1TZY D;  3V9R B;  1BH8 B;  5B40 A;  4ZUX C;  3B0C T;  3O62 C;  2CV5 D;  4J8W A;  3B6G D;  3AV2 D;  2HIO A;  4Z2M G;  4Z66 B;  3WAA D;  5GT0 C;  3NQJ B;  4XZQ C;  5AV9 A;  5G49 B;  1KX3 D;  5AV5 B;  5B0Y A;  3C1C D;  1B67 A;  2FJ7 B;  3X1T C;  4J8U C;  3MVD B;  2CV5 A;  3WA9 B;  1BH9 B;  3B6G A;  1ZLA D;  3KWQ A;  4Z5T D;  1P3G B;  1KX5 D;  4WJ3 C;  4WU8 C;  4UUZ B;  1KX3 A;  4H9S A;  3MGQ A;  3H0M C;  1TAF A;  3KXB B;  1ZLA A;  4ZUX D;  4Z5T A;  2IO5 B;  3O62 D;  1KX5 A;  4WU9 C;  2HUE C;  5B1M C;  2RIQ A;  1ULY A;  3X1U C;  4XZQ D;  4H9O B;  4HGA C;  4DRA A;  3LZ1 C;  5B33 D;  3X1V C;  3X1T D;  4J8U D;  3O62 A;  1ID3 C;  2RVQ C;  3AZE C;  2G5H C;  4YS3 C;  4JJN C;  4WU8 D;  3AN2 C;  3KUY C;  5B33 A;  3AZF C;  3X1T A;  2PYO A;  4J8U A;  3AZM A;  4J8X C;  4WNN B;  1P3M B;  5B31 G;  3AZK C;  3WKJ B;  3TU4 C;  4WU9 D;  5CHL B;  1AOI C;  5B1M D;  3B6F C;  3X1U D;  3AZH B;  2Y2P A;  5CPK A;  3LZ1 D;  3X1V D;  5E5A B;  2Y2Q A;  4WU9 A;  1M19 C;  1ID3 D;  2RVQ D;  5AVC C;  2F2A C;  5B1M A;  3UT9 B;  3AZE D;  4YS3 D;  5B31 B;  2F8N K;  1F66 C;  4JJN D;  4H9N A;  3W99 C;  5AY8 C;  5GT3 C;  5DNM B;  3AZG C;  1P3F B;  3AN2 D;  3LZ1 A;  2BYK A;  3KUY D;  1N1J B;  3AZF D;  1EQZ C;  5B0Z B;  3X1S B;  4J8X D;  1P3B C;  1P3I B;  1ID3 A;  3AZK D;  3REL B;  3AZI B;  3AZN A;  3AZE A;  1B6W A;  2ARO B;  3B0D C;  3TU4 D;  4JJN A;  5BS7 A;  1AOI D;  3AN2 A;  3KUY A;  2NZD B;  3AZF A;  3B6F D;  4QLC B;  4CAY A;  3UTA C;  4J8X A;  3EG5 B;  4G91 B;  5BT1 C;  3A6N B;  3AZK A;  3LJA C;  5CPJ A;  1M19 D;  5AVC D;  1AOI A;  3W98 C;  3KFU G;  4KUD B;  1F66 D;  3AZG D;  3W99 D;  5AY8 D;  3R45 B;  5GT3 D;  4G92 B;  2J8P A;  2JCH A;  1EQZ D;  1P3B D;  5AVC A;  1M18 B;  2NQB B;  1P3L C;  1F66 A;  5B32 G;  5AY8 A;  5GT3 A;  3AFA A;  3MGP B;  1EQZ A;  5JA4 A;  4XUJ C;  3UTA D;  5BT1 D;  3MGR B;  1R4V A;  1M1A B;  5GXQ A;  1HQ3 C;  3LJA D;  4NE3 A;  5KDM A;  1P34 C;  3REH C;  3W98 D;  3MGS C;  3FDD A;  2F8N A;  5B24 B;  1KX4 B;  2L5A A;  5AVB B;  3EPJ A;  5B32 B;  4X23 B;  3W97 B;  3W98 A;  5C3I B;  3VH5 A;  5BNX A;  1P3L D;  3VH5 T;  4E44 A;  4Z66 C;  3W96 A;  4XUJ D;  2FJ7 C;  3MNN B;  3AZJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...