4ZUXC

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 29
structure length 103
sequence length 103
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxC00
3KSYA 5B31D 5DNMB 3A6NA 4ZBJC 5GT0C 3MGSC 1ID3C 1S32A 5AVBD 3X1UC 1P34D 4KUDA 4WZSB 1F66D 1P3BA 3REHA 3LELA 3AZFD 1BH8A 5DNMA 4DRBA 5E5AB 5B31B 5AV9A 3MGPC 5AV6D 3AV1D 1F1EA 1A7WA 3X1TA 3O62D 1P3IC 5AVBB 3WKJD 1F66B 5CPIC 5E5AA 1S32C 3AZFB 4YM6D 1U35C 4J8UC 3C1CD 4ZUXC 3KWQD 5BT1C 1P3BC 5B0ZB 2HIOB 2CV5D 3LELC 1ULYA 4YS3D 1KX5C 1AOID 5AVBA 5DNMC 3RELB 5AV6B 5CPKA 3MVDC 3W97C 1H3OB 4KGCD 4H9QB 1F66A 4LD9A 3O62B 3REID 3AZFA 3AFAD 2F8ND 1HQ3B 5B0ZA 2HIOA 4NE5A 4YM6B 5GT3A 3LZ1D 5BS7C 3RELA 4CSRB 5AV6A 4G91B 1M1AD 1H3OA 5BO0B 3KWQB 3AZND 5B1LD 2CV5B 5B2ID 5E5AC 1P3OD 4YS3B 3B6GD 5B31C 4J8WD 1HQ3A 5B40A 2IO5C 3REIB 4UUZB 5AVBC 1P34C 1TZYD 3AFAB 3MGRD 4CSRA 2FJ7A 4J8VD 5BO0A 3KWQA 1M19B 1F66C 5AV8A 2CV5A 4YS3A 3W96A 3AZFC 3WAAA 4H9RB 3AZNB 5B2IB 1P3PB 4QLCA 1P3OB 3REIA 3V9RB 2BYKB 4J8WB 4J8XB 5AV6C 3AV1C 3REJA 1M19A 5AVCD 3O62C 1JFIB 1TZYB 1P3GD 3TU4D 3WKJC 4J8VB 4H9RA 3AZNA 1P3PA 1P3OA 1ID3D 3V9RA 3VH5A 4YM6C 2BYKA 4J8WA 4J8XA 5GXQB 3AV2D 2AROA 3C1CC 3AZLB 2BYMB 2CV5C 1P3MD 1AOIC 5B33B 4KGCC 4J8VA 4EO5C 3AFAC 2PYOD 1P3GB 4H9PB 5GXQA 4NE6A 3AZLA 1P3BB 1KX3D 2BYMA 3AZIA 1TAFB 5B24D 1ID3B 3LZ1C 3X1UB 3AV2B 3NQJB 1M1AC 5B33A 1KU5A 5B1LC 5B2IC 2NQBD 1P3MB 2LY8A 3B6GC 4XUJD 4H9PA 3MNND 1U35D 4J8UD 4ZUXD 5GT0A 1TAFA 1ID3A 1TZYC 2PYOB 3X1UA 3AV2A 3MGRC 3NQJA 1P3AD 4J8VC 3W97D 1KX3B 1P3MA 1KX4D 1P3IB 5DNNC 3MGQD 2YFVB 2NQBB 1P3KD 5CPIB 3WA9D 3WTPD 4H9SA 4M6BA 3MNNB 1U35B 4J8UB 4ZUXB 1KX3A 5AVCC 1P3GC 1P3IA 3TU4C 2YFVA 4G92B 1P3AB 3MVDB 3W97B 1ZLAD 4CAYB 2NQBA 3KUYD 5CPIA 3VH5T 3AV2C 5CPJD 3MNNA 1U35A 4J8UA 4ZUXA 1P3KB 1P3MC 3WA9B 3WTPB 1KX5A 4Z2MH 4JJND 3MVDA 3W97A 4CAYA 5BNVB 2PYOC 2F8NK 4H9SC 4HGAC 1KX3C 1ZLAB 1EQZD 1P3KA 5B24C 3KUYB 3X1VD 2IO5B 3WA9A 3WTPA 1P34B 5CPJB 5BS7A 5B0YC 2NQBC 4XUJC 5BNVA 5B31A 3MNNC 1ZLAA 3UT9D 3UTAD 1P34A 4WU9D 5CPJA 1P3AC 4G92C 3AV1B 3LJAD 3X1VB 3C1BD 1M18D 1KX4C 3MGQC 3VH6A 3WKJB 1P3KC 3WA9C 3WTPC 5F99D 3C1CB 3AV1A 4H9QA 3X1VA 3UT9B 1AOIB 3O62A 3UTAB 4WU9B 3AZED 3LJAB 3WKJA 4KGCB 1ZLAC 3KUYC 3C1BB 4Z2MG 4XZQD 4EO5B 2F8NB 4YM6A 3B6FD 5CPJC 3C1CA 3KXBD 5JA4B 3UT9A 1AOIA 4JJNC 3LZ1B 3UTAA 4Z5TD 5DNND 4WU9A 1M1AB 3LJAA 1P3LD 4KGCA 5B1LB 5G49B 3B6GB 4UUZA 1P3FD 3AFAA 2F8NA 3AZEB 3LZ0D 5FUGB 4H9OB 1EQZC 3X1VC 5JA4A 4XZQB 4Z66D 3LZ1A 3MGRB 1M1AA 3KXBB 5B1LA 5B32G 5B2IA 5G49A 3B6GA 4Z5TB 5DNNB 5AV5D 1P3LB 5FUGA 4H9OA 3UT9C 4XZQA 3B0DC 3UTAC 3AZMC 1TZYA 3AZKD 4WU9C 1JFIA 3MGRA 3LJAC 2RVQD 5CP6C 3KXBA 3C1BC 1M18C 5GSUC 5AVCB 4Z5TA 5DNNA 5B2JD 3VH6T 3TU4B 3X1SD 3NQUB 4R8PD 3AN2D 5F99C 3W98C 5AV5B 4WNNB 5B0YD 3AYWD 5AVCA 3AZEC 4KHAB 1P3GA 3TU4A 3NQUA 2YFWB 4XZQC 3B6FC 3AZJC 3X1SB 4HGAB 5AV5A 3KXBC 5B24B 4R8PB 3UTBC 1WWIA 4Z5TC 4KHAA 1P3LC 5B0YB 3AYWB 2YFWA 1P3FC 4XUJB 2PYOA 3X1SA 4X23D 3R45B 3LZ0C 4Z66C 1BFMA 5B24A 2HUEB 5B0YA 4NFTA 1KX4B 4XUJA 3MGQB 5B32D 5AV5C 5AV9D 5C3IB 3AZKC 2L5AA 4X23B 1P3AA 2RVQC 3X1TD 1KX4A 5B2JC 3MGQA 3X1SC 1KX5B 1BH8B 4R8PC 3AN2C 1B67A 5B32B 4X23A 1B6WA 3AYWC 5AV9B 3B0CT 5CPKD 4JJNB 4LD9D 3X1TB 3W99C 1BH9B 3KUYA 3AZMD 2HUEC 5B32A 3B0BA 5B0ZD 2HIOD 3AZHC 1EQZB 5CP6D 5GT3D 1Q9CA 5GSUD 3RELD 5AY8D 4JJNA 1BH9A 3A6NC 5C3IC 5CPKB 1HQ3D 5B40D 4X23C 3W98D 4LD9B 4WV4B 1EQZA 4KUDC 3B0DB 2FJ7D 3AZMB 5AV8D 3REHC 3W96D 5CP6B 5GT3B 1M18B 5GSUB 4H9NB 5AY8B 3WAAD 3AZJD 5B32C 4QLCD 5AV9C 1HTAA 5B1MD 3UTBD 5F99B 3REJD 4E45A 3AZMA 5B40B 1M19D 3W98B 3X1TC 5BNXB 5CP6A 3C1BA 1M18A 5GSUA 4H9NA 2FJ7B 5AY8A 5AV8B 1P3PD 3W96B 2CWEA 4J8XD 2AROD 5CHLB 3AZGD 3B6FB 5F99A 3AZJB 1N1JB 3WAAB 3W98A 4QLCB 5BNXA 5B1MB 3WTPE 3UTBB 5JRGD 3REKD 5CPKC 3REJB 3AZEA 3VH6W 4WU8D 4LD9C 5GXQD 1P3FB 3AZLD 3B6FA 3AZJA 1N1JA 4DRAA 5B0ZC 2HIOC 3LZ0B 3AZID 2F8NH 5GT3C 2NZDD 3RELC 4Z66B 5B1MA 2AROB 3UTBA 5AY8C 5B33D 3AZGB 5B31G 1P3LA 5JRGB 3REKB 1P3FA 1HQ3C 5B40C 5GT0D 4WU8B 3MGSD 3LZ0A 3X1UD 4Z66A 2FJ7C 2JSSA 1WWSA 4G91C 3AZGA 3AZKB 3KWQC 4E44A 5AV8C 3AZIB 4YS3C 3W96C 3W99D 4AWLB 2NZDB 5JRGA 3REKA 3WAAC 5B2JB 4WU8A 4QLCC 4WNNA 3REIC 1R4VA 3AZHD 5B1MC 3AN2B 3MGPD 3REJC 4ZBJB 3AZKA 1M19C 5GT0B 3MGSB 4NE3A 1P3ID 2NZDA 3A6ND 3VH5W 3AZNC 5B2JA 1P3OC 1P3PC 5CPID 4J8XC 4J8WC 1S32D 3W99B 2AROC 4R8PA 3AN2A 3AZGC 4KUDD 5BT1D 3MGSA 1P3BD 3REHD 3AZHB 3LELD 1KX5D 3AYWA 5JRGC 3REKC 5DNMD 3MGPB 3MVDD 5KDMB 2F8NG 4WU8C 3R45A 3W99A 5GXQC 3A6NB 3AZLC 3AZIC 3AZHA 1S32B 4AWLC 2NZDC 5B33C 3MGPA 3B0CW 4KUDB 5KDMA 3LELB 3REHB 5E5AD
chains in the Genus database with same CATH superfamily
3KSYA 5B31D 2JCHA 5DNMB 3A6NA 2XD5A 4ZBJC 5GT0C 3MGSC 1ID3C 1S32A 5AVBD 3X1UC 1P34D 4KUDA 4WZSB 2W8SA 1F66D 2DQNC 1P3BA 3REHA 3LELA 3AZFD 1BH8A 5DNMA 3IP4C 4DRBA 5E5AB 5B31B 5AV9A 3MGPC 5AV6D 3AV1D 1F1EA 1A7WA 3X1TA 3O62D 1P3IC 5AVBB 2Y2PA 2VQRA 3WKJD 1F66B 5CPIC 5E5AA 1S32C 3AZFB 4YM6D 1U35C 4J8UC 3C1CD 4ZUXC 3AL0C 3KWQD 5BT1C 1P3BC 5B0ZB 2HIOB 2CV5D 3LELC 1ULYA 4YS3D 1KX5C 1AOID 5AVBA 5DNMC 3RELB 5AV6B 5CPKA 3MVDC 3W97C 1H3OB 4KGCD 4H9QB 1F66A 4LD9A 3O62B 3REID 3AZFA 3AFAD 2F8ND 2Y2NA 1HQ3B 5B0ZA 2HIOA 4NE5A 4YM6B 5GT3A 3LZ1D 5BS7C 3RELA 4CSRB 5AV6A 4G91B 1M1AD 1H3OA 5BO0B 3KWQB 3AZND 5B1LD 2CV5B 5B2ID 5E5AC 2J8PA 4YS3B 1P3OD 3B6GD 5B31C 2BG1A 4J8WD 1HQ3A 5B40A 2F2AC 2IO5C 3REIB 4UUZB 5AVBC 1P34C 1TZYD 3AFAB 3MGRD 4CSRA 2FJ7A 2ZM5A 4J8VD 5BO0A 3KWQA 1M19B 2Y2GA 1F66C 5AV8A 2CV5A 4YS3A 3W96A 3AZFC 3WAAA 4H9RB 3AZNB 5B2IB 1P3PB 4QLCA 1P3OB 3REIA 3V9RB 2BYKB 4J8WB 4J8XB 5AV6C 3AV1C 3REJA 1M19A 5AVCD 3O62C 1JFIB 1TZYB 1P3GD 3EG5B 3TU4D 3WKJC 4J8VB 4H9RA 3AZNA 1P3PA 1P3OA 1ID3D 3V9RA 3VH5A 4YM6C 2BYKA 4J8WA 4J8XA 5GXQB 3AV2D 2AROA 3C1CC 3AZLB 3H0MC 2BYMB 2CV5C 1P3MD 1AOIC 5B33B 2RIQA 4KGCC 4J8VA 2XD1A 4EO5C 3AFAC 2PYOD 1P3GB 4H9PB 5GXQA 4NE6A 3AZLA 1P3BB 1KX3D 2BYMA 3AZIA 1TAFB 2ZY5A 5B24D 1ID3B 3LZ1C 3X1UB 3AV2B 3NQJB 1M1AC 5B33A 1KU5A 5B1LC 5B2IC 2NQBD 1P3MB 2LY8A 3B6GC 4XUJD 4H9PA 3MNND 1U35D 4J8UD 4ZUXD 5GT0A 2Y2JA 1TAFA 1ID3A 1TZYC 2PYOB 3X1UA 3AV2A 3MGRC 3NQJA 1P3AD 4J8VC 3W97D 1KX3B 1P3MA 1KX4D 1P3IB 5DNNC 3MGQD 2YFVB 2NQBB 1P3KD 2Y2HA 5CPIB 3WA9D 3WTPD 4H9SA 4M6BA 3MNNB 1U35B 4J8UB 4ZUXB 3FDDA 1KX3A 5AVCC 1P3GC 1P3IA 3TU4C 2YFVA 4G92B 1P3AB 3MVDB 3W97B 1ZLAD 4CAYB 2NQBA 3KUYD 5CPIA 3VH5T 3AV2C 2ZY4A 5CPJD 3MNNA 2Y2OA 1U35A 4J8UA 4ZUXA 1P3KB 1P3MC 3WA9B 3WTPB 1KX5A 4Z2MH 4JJND 3MVDA 3W97A 4CAYA 5BNVB 2PYOC 2F8NK 4H9SC 4HGAC 1KX3C 1ZLAB 1EQZD 1P3KA 5B24C 3KUYB 3X1VD 2IO5B 3WA9A 3WTPA 1P34B 5CPJB 5BS7A 5B0YC 2NQBC 3H0LC 4XUJC 5BNVA 5B31A 3MNNC 2Y2IA 2FFFB 1ZLAA 3UT9D 3UTAD 1P34A 4WU9D 5CPJA 1P3AC 4G92C 3AV1B 3LJAD 3X1VB 3C1BD 1M18D 1KX4C 3MGQC 3VH6A 3WKJB 1P3KC 3WA9C 3WTPC 5F99D 3C1CB 3AV1A 4H9QA 3X1VA 3P5JB 3UT9B 1AOIB 3O62A 3UTAB 4WU9B 3AZED 3LJAB 3WKJA 4KGCB 1ZLAC 3KUYC 3C1BB 4Z2MG 4XZQD 4EO5B 2F8NB 4YM6A 3B6FD 5CPJC 3C1CA 3KXBD 5JA4B 3UT9A 2Y2KA 1AOIA 4JJNC 3LZ1B 3UTAA 4Z5TD 5DNND 4WU9A 1M1AB 3LJAA 1P3LD 4KGCA 3A1IA 5B1LB 5G49B 3B6GB 4UUZA 1P3FD 3AFAA 2F8NA 3AZEB 3LZ0D 5FUGB 4H9OB 1EQZC 3X1VC 5JA4A 4XZQB 4Z66D 3LZ1A 3MGRB 1M1AA 3KXBB 5B1LA 5B32G 5B2IA 5G49A 3B6GA 4Z5TB 5DNNB 5AV5D 1P3LB 5FUGA 4H9OA 3UT9C 4XZQA 3B0DC 3UTAC 3AZMC 1TZYA 3AZKD 4WU9C 1JFIA 3MGRA 3LJAC 2RVQD 5CP6C 3KXBA 3C1BC 1M18C 5GSUC 5AVCB 4Z5TA 5DNNA 5B2JD 3VH6T 3TU4B 3X1SD 3NQUB 4R8PD 3AN2D 5F99C 3W98C 4DQYB 2UWXA 5AV5B 4WNNB 5B0YD 3AYWD 5AVCA 3AZEC 4KHAB 1P3GA 3TU4A 3NQUA 2YFWB 4XZQC 1PZRA 3B6FC 3AZJC 3X1SB 4HGAB 5AV5A 3KXBC 5B24B 4R8PB 3UTBC 1WWIA 4Z5TC 2Y2LA 3EPHA 4KHAA 1P3LC 5B0YB 2Y2MA 3AYWB 2YFWA 1P3FC 4XUJB 2PYOA 3X1SA 4X23D 3R45B 3LZ0C 4Z66C 1BFMA 5B24A 2HUEB 5B0YA 4NFTA 1KX4B 4XUJA 3MGQB 5B32D 5AV5C 5AV9D 5C3IB 3AZKC 2L5AA 4X23B 1P3AA 2RVQC 3X1TD 3KFUG 1KX4A 5B2JC 3MGQA 3X1SC 2G5IC 4WJ3C 1KX5B 1BH8B 4R8PC 3AN2C 1B67A 5B32B 4X23A 1B6WA 3AYWC 5AV9B 3B0CT 5CPKD 1Z2CB 4JJNB 4LD9D 3X1TB 3W99C 1BH9B 3KUYA 3AZMD 2HUEC 5B32A 3B0BA 5B0ZD 2HIOD 3AZHC 1EQZB 5CP6D 5GT3D 1Q9CA 5GSUD 3RELD 5AY8D 4JJNA 1BH9A 3A6NC 5C3IC 5CPKB 1HQ3D 5B40D 4X23C 3W98D 4LD9B 4WV4B 1EQZA 4KUDC 3B0DB 3EPKA 3AZMB 2FJ7D 5AV8D 3REHC 3W96D 5CP6B 5GT3B 1M18B 5GSUB 4H9NB 5AY8B 3WAAD 3AZJD 5B32C 4QLCD 5AV9C 1HTAA 5B1MD 3UTBD 5F99B 3REJD 4E45A 3AZMA 5B40B 1M19D 3W98B 3X1TC 2Y2QA 5BNXB 5CP6A 3C1BA 1M18A 5GSUA 4H9NA 2FJ7B 5AY8A 3A1KA 5AV8B 1P3PD 3W96B 2CWEA 4J8XD 2AROD 5CHLB 3AZGD 3B6FB 5F99A 3AZJB 1N1JB 3WAAB 3W98A 4QLCB 5BNXA 5B1MB 3WTPE 3UTBB 5JRGD 3REKD 5CPKC 3REJB 3AZEA 3VH6W 4WU8D 4LD9C 5GXQD 3EPLA 1P3FB 3AZLD 3B6FA 3AZJA 1N1JA 4DRAA 5B0ZC 2HIOC 3LZ0B 3AZID 2F8NH 5GT3C 2NZDD 3RELC 4Z66B 5B1MA 2AROB 3UTBA 5AY8C 5B33D 3AZGB 1T3UA 2G5HC 5B31G 1P3LA 5JRGB 3REKB 1P3FA 1HQ3C 5B40C 5GT0D 4WU8B 3MGSD 3LZ0A 3X1UD 4Z66A 2FJ7C 2JSSA 1WWSA 4G91C 3AZGA 3F6TA 3KWQC 2ZY2A 3AZKB 2DF4C 4E44A 5AV8C 3AZIB 4YS3C 3W96C 1W2EA 3W99D 4AWLB 2NZDB 5JRGA 3REKA 3WAAC 2JE5A 5B2JB 4WU8A 4QLCC 4WNNA 3REIC 1R4VA 3AZHD 5B1MC 3AN2B 3MGPD 3REJC 4ZBJB 3AZKA 1M19C 5GT0B 3MGSB 4NE3A 3EPJA 1P3ID 2NZDA 3A6ND 3VH5W 3AZNC 5B2JA 1P3OC 1P3PC 5CPID 4J8XC 4J8WC 1S32D 3W99B 2AROC 4R8PA 3AN2A 3AZGC 4KUDD 5BT1D 3MGSA 1P3BD 3REHD 3AZHB 3LELD 1KX5D 3AYWA 5JRGC 3REKC 5DNMD 3MGPB 3MVDD 5KDMB 2F8NG 4WU8C 3R45A 3W99A 5GXQC 3H0RC 3A6NB 3AZLC 3AZIC 3AZHA 1S32B 4AWLC 2NZDC 2ZY3A 4UPKA 5B33C 3MGPA 3B0CW 4KUDB 5KDMA 3LELB 3REHB 5E5AD
chains in the Genus database with same CATH topology
3KSYA 5B31D 2JCHA 5DNMB 3A6NA 2XD5A 4ZBJC 5GT0C 3MGSC 1ID3C 1S32A 5AVBD 3X1UC 1P34D 4KUDA 4WZSB 2W8SA 1F66D 2DQNC 1P3BA 3REHA 3LELA 3AZFD 1BH8A 5DNMA 3IP4C 4DRBA 5E5AB 5B31B 5AV9A 3MGPC 5AV6D 3AV1D 1F1EA 1A7WA 3X1TA 3O62D 1P3IC 5AVBB 2Y2PA 2VQRA 3WKJD 1F66B 5CPIC 5E5AA 1S32C 3AZFB 4YM6D 1U35C 4J8UC 3C1CD 4ZUXC 3AL0C 3KWQD 5BT1C 1P3BC 5B0ZB 2HIOB 2CV5D 3LELC 1ULYA 4YS3D 1KX5C 1AOID 5AVBA 5DNMC 3RELB 5AV6B 5CPKA 3MVDC 3W97C 1H3OB 4KGCD 4H9QB 1F66A 4LD9A 3O62B 3REID 3AZFA 3AFAD 2F8ND 2Y2NA 1HQ3B 5B0ZA 2HIOA 4NE5A 4YM6B 5GT3A 3LZ1D 5BS7C 3RELA 4CSRB 5AV6A 4G91B 1M1AD 1H3OA 5BO0B 3KWQB 3AZND 5B1LD 2CV5B 5B2ID 5E5AC 2J8PA 4YS3B 1P3OD 3B6GD 5B31C 2BG1A 4J8WD 1HQ3A 5B40A 2F2AC 2IO5C 3REIB 4UUZB 5AVBC 1P34C 1TZYD 3AFAB 3MGRD 4CSRA 2FJ7A 2ZM5A 4J8VD 5BO0A 3KWQA 1M19B 2Y2GA 1F66C 5AV8A 2CV5A 4YS3A 3W96A 3AZFC 3WAAA 4H9RB 3AZNB 5B2IB 1P3PB 4QLCA 1P3OB 3REIA 3V9RB 2BYKB 4J8WB 4J8XB 5AV6C 3AV1C 3REJA 1M19A 5AVCD 3O62C 1JFIB 1TZYB 1P3GD 3EG5B 3TU4D 3WKJC 4J8VB 4H9RA 3AZNA 1P3PA 1P3OA 1ID3D 3V9RA 3VH5A 4YM6C 2BYKA 4J8WA 4J8XA 5GXQB 3AV2D 2AROA 3C1CC 3AZLB 3H0MC 2BYMB 2CV5C 1P3MD 1AOIC 5B33B 2RIQA 4KGCC 4J8VA 2XD1A 4EO5C 3AFAC 2PYOD 1P3GB 4H9PB 5GXQA 4NE6A 3AZLA 1P3BB 1KX3D 2BYMA 3AZIA 1TAFB 2ZY5A 5B24D 1ID3B 3LZ1C 3X1UB 3AV2B 3NQJB 1M1AC 5B33A 1KU5A 5B1LC 5B2IC 2NQBD 1P3MB 2LY8A 3B6GC 4XUJD 4H9PA 3MNND 1U35D 4J8UD 4ZUXD 5GT0A 2Y2JA 1TAFA 1ID3A 1TZYC 2PYOB 3X1UA 3AV2A 3MGRC 3NQJA 1P3AD 4J8VC 3W97D 1KX3B 1P3MA 1KX4D 1P3IB 5DNNC 3MGQD 2YFVB 2NQBB 1P3KD 2Y2HA 5CPIB 3WA9D 3WTPD 4H9SA 4M6BA 3MNNB 1U35B 4J8UB 4ZUXB 3FDDA 1KX3A 5AVCC 1P3GC 1P3IA 3TU4C 2YFVA 4G92B 1P3AB 3MVDB 3W97B 1ZLAD 4CAYB 2NQBA 3KUYD 5CPIA 3VH5T 3AV2C 2ZY4A 5CPJD 3MNNA 2Y2OA 1U35A 4J8UA 4ZUXA 1P3KB 1P3MC 3WA9B 3WTPB 1KX5A 4Z2MH 4JJND 3MVDA 3W97A 4CAYA 5BNVB 2PYOC 2F8NK 4H9SC 4HGAC 1KX3C 1ZLAB 1EQZD 1P3KA 5B24C 3KUYB 3X1VD 2IO5B 3WA9A 3WTPA 1P34B 5CPJB 5BS7A 5B0YC 2NQBC 3H0LC 4XUJC 5BNVA 5B31A 3MNNC 2Y2IA 2FFFB 1ZLAA 3UT9D 3UTAD 1P34A 4WU9D 5CPJA 1P3AC 4G92C 3AV1B 3LJAD 3X1VB 3C1BD 1M18D 1KX4C 3MGQC 3VH6A 3WKJB 1P3KC 3WA9C 3WTPC 5F99D 3C1CB 3AV1A 4H9QA 3X1VA 3P5JB 3UT9B 1AOIB 3O62A 3UTAB 4WU9B 3AZED 3LJAB 3WKJA 4KGCB 1ZLAC 3KUYC 3C1BB 4Z2MG 4XZQD 4EO5B 2F8NB 4YM6A 3B6FD 5CPJC 3C1CA 3KXBD 5JA4B 3UT9A 2Y2KA 1AOIA 4JJNC 3LZ1B 3UTAA 4Z5TD 5DNND 4WU9A 1M1AB 3LJAA 1P3LD 4KGCA 3A1IA 5B1LB 5G49B 3B6GB 4UUZA 1P3FD 3AFAA 2F8NA 3AZEB 3LZ0D 5FUGB 4H9OB 1EQZC 3X1VC 5JA4A 4XZQB 4Z66D 3LZ1A 3MGRB 1M1AA 3KXBB 5B1LA 5B32G 5B2IA 5G49A 3B6GA 4Z5TB 5DNNB 5AV5D 1P3LB 5FUGA 4H9OA 3UT9C 4XZQA 3B0DC 3UTAC 3AZMC 1TZYA 3AZKD 4WU9C 1JFIA 3MGRA 3LJAC 2RVQD 5CP6C 3KXBA 3C1BC 1M18C 5GSUC 5AVCB 4Z5TA 5DNNA 5B2JD 3VH6T 3TU4B 3X1SD 3NQUB 4R8PD 3AN2D 5F99C 3W98C 4DQYB 2UWXA 5AV5B 4WNNB 5B0YD 3AYWD 5AVCA 3AZEC 4KHAB 1P3GA 3TU4A 3NQUA 2YFWB 4XZQC 1PZRA 3B6FC 3AZJC 3X1SB 4HGAB 5AV5A 3KXBC 5B24B 4R8PB 3UTBC 1WWIA 4Z5TC 2Y2LA 3EPHA 4KHAA 1P3LC 5B0YB 2Y2MA 3AYWB 2YFWA 1P3FC 4XUJB 2PYOA 3X1SA 4X23D 3R45B 3LZ0C 4Z66C 1BFMA 5B24A 2HUEB 5B0YA 4NFTA 1KX4B 4XUJA 3MGQB 5B32D 5AV5C 5AV9D 5C3IB 3AZKC 2L5AA 4X23B 1P3AA 2RVQC 3X1TD 3KFUG 1KX4A 5B2JC 3MGQA 3X1SC 2G5IC 4WJ3C 1KX5B 1BH8B 4R8PC 3AN2C 1B67A 5B32B 4X23A 1B6WA 3AYWC 5AV9B 3B0CT 5CPKD 1Z2CB 4JJNB 4LD9D 3X1TB 3W99C 1BH9B 3KUYA 3AZMD 2HUEC 5B32A 3B0BA 5B0ZD 2HIOD 3AZHC 1EQZB 5CP6D 5GT3D 1Q9CA 5GSUD 3RELD 5AY8D 4JJNA 1BH9A 3A6NC 5C3IC 5CPKB 1HQ3D 5B40D 4X23C 3W98D 4LD9B 4WV4B 1EQZA 4KUDC 3B0DB 3EPKA 3AZMB 2FJ7D 5AV8D 3REHC 3W96D 5CP6B 5GT3B 1M18B 5GSUB 4H9NB 5AY8B 3WAAD 3AZJD 5B32C 4QLCD 5AV9C 1HTAA 5B1MD 3UTBD 5F99B 3REJD 4E45A 3AZMA 5B40B 1M19D 3W98B 3X1TC 2Y2QA 5BNXB 5CP6A 3C1BA 1M18A 5GSUA 4H9NA 2FJ7B 5AY8A 3A1KA 5AV8B 1P3PD 3W96B 2CWEA 4J8XD 2AROD 5CHLB 3AZGD 3B6FB 5F99A 3AZJB 1N1JB 3WAAB 3W98A 4QLCB 5BNXA 5B1MB 3WTPE 3UTBB 5JRGD 3REKD 5CPKC 3REJB 3AZEA 3VH6W 4WU8D 4LD9C 5GXQD 3EPLA 1P3FB 3AZLD 3B6FA 3AZJA 1N1JA 4DRAA 5B0ZC 2HIOC 3LZ0B 3AZID 2F8NH 5GT3C 2NZDD 3RELC 4Z66B 5B1MA 2AROB 3UTBA 5AY8C 5B33D 3AZGB 1T3UA 2G5HC 5B31G 1P3LA 5JRGB 3REKB 1P3FA 1HQ3C 5B40C 5GT0D 4WU8B 3MGSD 3LZ0A 3X1UD 4Z66A 2FJ7C 2JSSA 1WWSA 4G91C 3AZGA 3F6TA 3KWQC 2ZY2A 3AZKB 2DF4C 4E44A 5AV8C 3AZIB 4YS3C 3W96C 1W2EA 3W99D 4AWLB 2NZDB 5JRGA 3REKA 3WAAC 2JE5A 5B2JB 4WU8A 4QLCC 4WNNA 3REIC 1R4VA 3AZHD 5B1MC 3AN2B 3MGPD 3REJC 4ZBJB 3AZKA 1M19C 5GT0B 3MGSB 4NE3A 3EPJA 1P3ID 2NZDA 3A6ND 3VH5W 3AZNC 5B2JA 1P3OC 1P3PC 5CPID 4J8XC 4J8WC 1S32D 3W99B 2AROC 4R8PA 3AN2A 3AZGC 4KUDD 5BT1D 3MGSA 1P3BD 3REHD 3AZHB 3LELD 1KX5D 3AYWA 5JRGC 3REKC 5DNMD 3MGPB 3MVDD 5KDMB 2F8NG 4WU8C 3R45A 3W99A 5GXQC 3H0RC 3A6NB 3AZLC 3AZIC 3AZHA 1S32B 4AWLC 2NZDC 2ZY3A 4UPKA 5B33C 3MGPA 3B0CW 4KUDB 5KDMA 3LELB 3REHB 5E5AD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  5B31 D;  5DNM B;  3A6N A;  4ZBJ C;  5GT0 C;  3MGS C;  1ID3 C;  1S32 A;  5AVB D;  3X1U C;  1P34 D;  4KUD A;  4WZS B;  1F66 D;  1P3B A;  3REH A;  3LEL A;  3AZF D;  1BH8 A;  5DNM A;  4DRB A;  5E5A B;  5B31 B;  5AV9 A;  3MGP C;  5AV6 D;  3AV1 D;  1F1E A;  1A7W A;  3X1T A;  3O62 D;  1P3I C;  5AVB B;  3WKJ D;  1F66 B;  5CPI C;  5E5A A;  1S32 C;  3AZF B;  4YM6 D;  1U35 C;  4J8U C;  3C1C D;  4ZUX C;  3KWQ D;  5BT1 C;  1P3B C;  5B0Z B;  2HIO B;  2CV5 D;  3LEL C;  1ULY A;  4YS3 D;  1KX5 C;  1AOI D;  5AVB A;  5DNM C;  3REL B;  5AV6 B;  5CPK A;  3MVD C;  3W97 C;  1H3O B;  4KGC D;  4H9Q B;  1F66 A;  4LD9 A;  3O62 B;  3REI D;  3AZF A;  3AFA D;  2F8N D;  1HQ3 B;  5B0Z A;  2HIO A;  4NE5 A;  4YM6 B;  5GT3 A;  3LZ1 D;  5BS7 C;  3REL A;  4CSR B;  5AV6 A;  4G91 B;  1M1A D;  1H3O A;  5BO0 B;  3KWQ B;  3AZN D;  5B1L D;  2CV5 B;  5B2I D;  5E5A C;  1P3O D;  4YS3 B;  3B6G D;  5B31 C;  4J8W D;  1HQ3 A;  5B40 A;  2IO5 C;  3REI B;  4UUZ B;  5AVB C;  1P34 C;  1TZY D;  3AFA B;  3MGR D;  4CSR A;  2FJ7 A;  4J8V D;  5BO0 A;  3KWQ A;  1M19 B;  1F66 C;  5AV8 A;  2CV5 A;  4YS3 A;  3W96 A;  3AZF C;  3WAA A;  4H9R B;  3AZN B;  5B2I B;  1P3P B;  4QLC A;  1P3O B;  3REI A;  3V9R B;  2BYK B;  4J8W B;  4J8X B;  5AV6 C;  3AV1 C;  3REJ A;  1M19 A;  5AVC D;  3O62 C;  1JFI B;  1TZY B;  1P3G D;  3TU4 D;  3WKJ C;  4J8V B;  4H9R A;  3AZN A;  1P3P A;  1P3O A;  1ID3 D;  3V9R A;  3VH5 A;  4YM6 C;  2BYK A;  4J8W A;  4J8X A;  5GXQ B;  3AV2 D;  2ARO A;  3C1C C;  3AZL B;  2BYM B;  2CV5 C;  1P3M D;  1AOI C;  5B33 B;  4KGC C;  4J8V A;  4EO5 C;  3AFA C;  2PYO D;  1P3G B;  4H9P B;  5GXQ A;  4NE6 A;  3AZL A;  1P3B B;  1KX3 D;  2BYM A;  3AZI A;  1TAF B;  5B24 D;  1ID3 B;  3LZ1 C;  3X1U B;  3AV2 B;  3NQJ B;  1M1A C;  5B33 A;  1KU5 A;  5B1L C;  5B2I C;  2NQB D;  1P3M B;  2LY8 A;  3B6G C;  4XUJ D;  4H9P A;  3MNN D;  1U35 D;  4J8U D;  4ZUX D;  5GT0 A;  1TAF A;  1ID3 A;  1TZY C;  2PYO B;  3X1U A;  3AV2 A;  3MGR C;  3NQJ A;  1P3A D;  4J8V C;  3W97 D;  1KX3 B;  1P3M A;  1KX4 D;  1P3I B;  5DNN C;  3MGQ D;  2YFV B;  2NQB B;  1P3K D;  5CPI B;  3WA9 D;  3WTP D;  4H9S A;  4M6B A;  3MNN B;  1U35 B;  4J8U B;  4ZUX B;  1KX3 A;  5AVC C;  1P3G C;  1P3I A;  3TU4 C;  2YFV A;  4G92 B;  1P3A B;  3MVD B;  3W97 B;  1ZLA D;  4CAY B;  2NQB A;  3KUY D;  5CPI A;  3VH5 T;  3AV2 C;  5CPJ D;  3MNN A;  1U35 A;  4J8U A;  4ZUX A;  1P3K B;  1P3M C;  3WA9 B;  3WTP B;  1KX5 A;  4Z2M H;  4JJN D;  3MVD A;  3W97 A;  4CAY A;  5BNV B;  2PYO C;  2F8N K;  4H9S C;  4HGA C;  1KX3 C;  1ZLA B;  1EQZ D;  1P3K A;  5B24 C;  3KUY B;  3X1V D;  2IO5 B;  3WA9 A;  3WTP A;  1P34 B;  5CPJ B;  5BS7 A;  5B0Y C;  2NQB C;  4XUJ C;  5BNV A;  5B31 A;  3MNN C;  1ZLA A;  3UT9 D;  3UTA D;  1P34 A;  4WU9 D;  5CPJ A;  1P3A C;  4G92 C;  3AV1 B;  3LJA D;  3X1V B;  3C1B D;  1M18 D;  1KX4 C;  3MGQ C;  3VH6 A;  3WKJ B;  1P3K C;  3WA9 C;  3WTP C;  5F99 D;  3C1C B;  3AV1 A;  4H9Q A;  3X1V A;  3UT9 B;  1AOI B;  3O62 A;  3UTA B;  4WU9 B;  3AZE D;  3LJA B;  3WKJ A;  4KGC B;  1ZLA C;  3KUY C;  3C1B B;  4Z2M G;  4XZQ D;  4EO5 B;  2F8N B;  4YM6 A;  3B6F D;  5CPJ C;  3C1C A;  3KXB D;  5JA4 B;  3UT9 A;  1AOI A;  4JJN C;  3LZ1 B;  3UTA A;  4Z5T D;  5DNN D;  4WU9 A;  1M1A B;  3LJA A;  1P3L D;  4KGC A;  5B1L B;  5G49 B;  3B6G B;  4UUZ A;  1P3F D;  3AFA A;  2F8N A;  3AZE B;  3LZ0 D;  5FUG B;  4H9O B;  1EQZ C;  3X1V C;  5JA4 A;  4XZQ B;  4Z66 D;  3LZ1 A;  3MGR B;  1M1A A;  3KXB B;  5B1L A;  5B32 G;  5B2I A;  5G49 A;  3B6G A;  4Z5T B;  5DNN B;  5AV5 D;  1P3L B;  5FUG A;  4H9O A;  3UT9 C;  4XZQ A;  3B0D C;  3UTA C;  3AZM C;  1TZY A;  3AZK D;  4WU9 C;  1JFI A;  3MGR A;  3LJA C;  2RVQ D;  5CP6 C;  3KXB A;  3C1B C;  1M18 C;  5GSU C;  5AVC B;  4Z5T A;  5DNN A;  5B2J D;  3VH6 T;  3TU4 B;  3X1S D;  3NQU B;  4R8P D;  3AN2 D;  5F99 C;  3W98 C;  5AV5 B;  4WNN B;  5B0Y D;  3AYW D;  5AVC A;  3AZE C;  4KHA B;  1P3G A;  3TU4 A;  3NQU A;  2YFW B;  4XZQ C;  3B6F C;  3AZJ C;  3X1S B;  4HGA B;  5AV5 A;  3KXB C;  5B24 B;  4R8P B;  3UTB C;  1WWI A;  4Z5T C;  4KHA A;  1P3L C;  5B0Y B;  3AYW B;  2YFW A;  1P3F C;  4XUJ B;  2PYO A;  3X1S A;  4X23 D;  3R45 B;  3LZ0 C;  4Z66 C;  1BFM A;  5B24 A;  2HUE B;  5B0Y A;  4NFT A;  1KX4 B;  4XUJ A;  3MGQ B;  5B32 D;  5AV5 C;  5AV9 D;  5C3I B;  3AZK C;  2L5A A;  4X23 B;  1P3A A;  2RVQ C;  3X1T D;  1KX4 A;  5B2J C;  3MGQ A;  3X1S C;  1KX5 B;  1BH8 B;  4R8P C;  3AN2 C;  1B67 A;  5B32 B;  4X23 A;  1B6W A;  3AYW C;  5AV9 B;  3B0C T;  5CPK D;  4JJN B;  4LD9 D;  3X1T B;  3W99 C;  1BH9 B;  3KUY A;  3AZM D;  2HUE C;  5B32 A;  3B0B A;  5B0Z D;  2HIO D;  3AZH C;  1EQZ B;  5CP6 D;  5GT3 D;  1Q9C A;  5GSU D;  3REL D;  5AY8 D;  4JJN A;  1BH9 A;  3A6N C;  5C3I C;  5CPK B;  1HQ3 D;  5B40 D;  4X23 C;  3W98 D;  4LD9 B;  4WV4 B;  1EQZ A;  4KUD C;  3B0D B;  2FJ7 D;  3AZM B;  5AV8 D;  3REH C;  3W96 D;  5CP6 B;  5GT3 B;  1M18 B;  5GSU B;  4H9N B;  5AY8 B;  3WAA D;  3AZJ D;  5B32 C;  4QLC D;  5AV9 C;  1HTA A;  5B1M D;  3UTB D;  5F99 B;  3REJ D;  4E45 A;  3AZM A;  5B40 B;  1M19 D;  3W98 B;  3X1T C;  5BNX B;  5CP6 A;  3C1B A;  1M18 A;  5GSU A;  4H9N A;  2FJ7 B;  5AY8 A;  5AV8 B;  1P3P D;  3W96 B;  2CWE A;  4J8X D;  2ARO D;  5CHL B;  3AZG D;  3B6F B;  5F99 A;  3AZJ B;  1N1J B;  3WAA B;  3W98 A;  4QLC B;  5BNX A;  5B1M B;  3WTP E;  3UTB B;  5JRG D;  3REK D;  5CPK C;  3REJ B;  3AZE A;  3VH6 W;  4WU8 D;  4LD9 C;  5GXQ D;  1P3F B;  3AZL D;  3B6F A;  3AZJ A;  1N1J A;  4DRA A;  5B0Z C;  2HIO C;  3LZ0 B;  3AZI D;  2F8N H;  5GT3 C;  2NZD D;  3REL C;  4Z66 B;  5B1M A;  2ARO B;  3UTB A;  5AY8 C;  5B33 D;  3AZG B;  5B31 G;  1P3L A;  5JRG B;  3REK B;  1P3F A;  1HQ3 C;  5B40 C;  5GT0 D;  4WU8 B;  3MGS D;  3LZ0 A;  3X1U D;  4Z66 A;  2FJ7 C;  2JSS A;  1WWS A;  4G91 C;  3AZG A;  3AZK B;  3KWQ C;  4E44 A;  5AV8 C;  3AZI B;  4YS3 C;  3W96 C;  3W99 D;  4AWL B;  2NZD B;  5JRG A;  3REK A;  3WAA C;  5B2J B;  4WU8 A;  4QLC C;  4WNN A;  3REI C;  1R4V A;  3AZH D;  5B1M C;  3AN2 B;  3MGP D;  3REJ C;  4ZBJ B;  3AZK A;  1M19 C;  5GT0 B;  3MGS B;  4NE3 A;  1P3I D;  2NZD A;  3A6N D;  3VH5 W;  3AZN C;  5B2J A;  1P3O C;  1P3P C;  5CPI D;  4J8X C;  4J8W C;  1S32 D;  3W99 B;  2ARO C;  4R8P A;  3AN2 A;  3AZG C;  4KUD D;  5BT1 D;  3MGS A;  1P3B D;  3REH D;  3AZH B;  3LEL D;  1KX5 D;  3AYW A;  5JRG C;  3REK C;  5DNM D;  3MGP B;  3MVD D;  5KDM B;  2F8N G;  4WU8 C;  3R45 A;  3W99 A;  5GXQ C;  3A6N B;  3AZL C;  3AZI C;  3AZH A;  1S32 B;  4AWL C;  2NZD C;  5B33 C;  3MGP A;  3B0C W;  4KUD B;  5KDM A;  3LEL B;  3REH B;  5E5A D; 
#chains in the Genus database with same CATH topology
 3KSY A;  5B31 D;  2JCH A;  5DNM B;  3A6N A;  2XD5 A;  4ZBJ C;  5GT0 C;  3MGS C;  1ID3 C;  1S32 A;  5AVB D;  3X1U C;  1P34 D;  4KUD A;  4WZS B;  2W8S A;  1F66 D;  2DQN C;  1P3B A;  3REH A;  3LEL A;  3AZF D;  1BH8 A;  5DNM A;  3IP4 C;  4DRB A;  5E5A B;  5B31 B;  5AV9 A;  3MGP C;  5AV6 D;  3AV1 D;  1F1E A;  1A7W A;  3X1T A;  3O62 D;  1P3I C;  5AVB B;  2Y2P A;  2VQR A;  3WKJ D;  1F66 B;  5CPI C;  5E5A A;  1S32 C;  3AZF B;  4YM6 D;  1U35 C;  4J8U C;  3C1C D;  4ZUX C;  3AL0 C;  3KWQ D;  5BT1 C;  1P3B C;  5B0Z B;  2HIO B;  2CV5 D;  3LEL C;  1ULY A;  4YS3 D;  1KX5 C;  1AOI D;  5AVB A;  5DNM C;  3REL B;  5AV6 B;  5CPK A;  3MVD C;  3W97 C;  1H3O B;  4KGC D;  4H9Q B;  1F66 A;  4LD9 A;  3O62 B;  3REI D;  3AZF A;  3AFA D;  2F8N D;  2Y2N A;  1HQ3 B;  5B0Z A;  2HIO A;  4NE5 A;  4YM6 B;  5GT3 A;  3LZ1 D;  5BS7 C;  3REL A;  4CSR B;  5AV6 A;  4G91 B;  1M1A D;  1H3O A;  5BO0 B;  3KWQ B;  3AZN D;  5B1L D;  2CV5 B;  5B2I D;  5E5A C;  2J8P A;  4YS3 B;  1P3O D;  3B6G D;  5B31 C;  2BG1 A;  4J8W D;  1HQ3 A;  5B40 A;  2F2A C;  2IO5 C;  3REI B;  4UUZ B;  5AVB C;  1P34 C;  1TZY D;  3AFA B;  3MGR D;  4CSR A;  2FJ7 A;  2ZM5 A;  4J8V D;  5BO0 A;  3KWQ A;  1M19 B;  2Y2G A;  1F66 C;  5AV8 A;  2CV5 A;  4YS3 A;  3W96 A;  3AZF C;  3WAA A;  4H9R B;  3AZN B;  5B2I B;  1P3P B;  4QLC A;  1P3O B;  3REI A;  3V9R B;  2BYK B;  4J8W B;  4J8X B;  5AV6 C;  3AV1 C;  3REJ A;  1M19 A;  5AVC D;  3O62 C;  1JFI B;  1TZY B;  1P3G D;  3EG5 B;  3TU4 D;  3WKJ C;  4J8V B;  4H9R A;  3AZN A;  1P3P A;  1P3O A;  1ID3 D;  3V9R A;  3VH5 A;  4YM6 C;  2BYK A;  4J8W A;  4J8X A;  5GXQ B;  3AV2 D;  2ARO A;  3C1C C;  3AZL B;  3H0M C;  2BYM B;  2CV5 C;  1P3M D;  1AOI C;  5B33 B;  2RIQ A;  4KGC C;  4J8V A;  2XD1 A;  4EO5 C;  3AFA C;  2PYO D;  1P3G B;  4H9P B;  5GXQ A;  4NE6 A;  3AZL A;  1P3B B;  1KX3 D;  2BYM A;  3AZI A;  1TAF B;  2ZY5 A;  5B24 D;  1ID3 B;  3LZ1 C;  3X1U B;  3AV2 B;  3NQJ B;  1M1A C;  5B33 A;  1KU5 A;  5B1L C;  5B2I C;  2NQB D;  1P3M B;  2LY8 A;  3B6G C;  4XUJ D;  4H9P A;  3MNN D;  1U35 D;  4J8U D;  4ZUX D;  5GT0 A;  2Y2J A;  1TAF A;  1ID3 A;  1TZY C;  2PYO B;  3X1U A;  3AV2 A;  3MGR C;  3NQJ A;  1P3A D;  4J8V C;  3W97 D;  1KX3 B;  1P3M A;  1KX4 D;  1P3I B;  5DNN C;  3MGQ D;  2YFV B;  2NQB B;  1P3K D;  2Y2H A;  5CPI B;  3WA9 D;  3WTP D;  4H9S A;  4M6B A;  3MNN B;  1U35 B;  4J8U B;  4ZUX B;  3FDD A;  1KX3 A;  5AVC C;  1P3G C;  1P3I A;  3TU4 C;  2YFV A;  4G92 B;  1P3A B;  3MVD B;  3W97 B;  1ZLA D;  4CAY B;  2NQB A;  3KUY D;  5CPI A;  3VH5 T;  3AV2 C;  2ZY4 A;  5CPJ D;  3MNN A;  2Y2O A;  1U35 A;  4J8U A;  4ZUX A;  1P3K B;  1P3M C;  3WA9 B;  3WTP B;  1KX5 A;  4Z2M H;  4JJN D;  3MVD A;  3W97 A;  4CAY A;  5BNV B;  2PYO C;  2F8N K;  4H9S C;  4HGA C;  1KX3 C;  1ZLA B;  1EQZ D;  1P3K A;  5B24 C;  3KUY B;  3X1V D;  2IO5 B;  3WA9 A;  3WTP A;  1P34 B;  5CPJ B;  5BS7 A;  5B0Y C;  2NQB C;  3H0L C;  4XUJ C;  5BNV A;  5B31 A;  3MNN C;  2Y2I A;  2FFF B;  1ZLA A;  3UT9 D;  3UTA D;  1P34 A;  4WU9 D;  5CPJ A;  1P3A C;  4G92 C;  3AV1 B;  3LJA D;  3X1V B;  3C1B D;  1M18 D;  1KX4 C;  3MGQ C;  3VH6 A;  3WKJ B;  1P3K C;  3WA9 C;  3WTP C;  5F99 D;  3C1C B;  3AV1 A;  4H9Q A;  3X1V A;  3P5J B;  3UT9 B;  1AOI B;  3O62 A;  3UTA B;  4WU9 B;  3AZE D;  3LJA B;  3WKJ A;  4KGC B;  1ZLA C;  3KUY C;  3C1B B;  4Z2M G;  4XZQ D;  4EO5 B;  2F8N B;  4YM6 A;  3B6F D;  5CPJ C;  3C1C A;  3KXB D;  5JA4 B;  3UT9 A;  2Y2K A;  1AOI A;  4JJN C;  3LZ1 B;  3UTA A;  4Z5T D;  5DNN D;  4WU9 A;  1M1A B;  3LJA A;  1P3L D;  4KGC A;  3A1I A;  5B1L B;  5G49 B;  3B6G B;  4UUZ A;  1P3F D;  3AFA A;  2F8N A;  3AZE B;  3LZ0 D;  5FUG B;  4H9O B;  1EQZ C;  3X1V C;  5JA4 A;  4XZQ B;  4Z66 D;  3LZ1 A;  3MGR B;  1M1A A;  3KXB B;  5B1L A;  5B32 G;  5B2I A;  5G49 A;  3B6G A;  4Z5T B;  5DNN B;  5AV5 D;  1P3L B;  5FUG A;  4H9O A;  3UT9 C;  4XZQ A;  3B0D C;  3UTA C;  3AZM C;  1TZY A;  3AZK D;  4WU9 C;  1JFI A;  3MGR A;  3LJA C;  2RVQ D;  5CP6 C;  3KXB A;  3C1B C;  1M18 C;  5GSU C;  5AVC B;  4Z5T A;  5DNN A;  5B2J D;  3VH6 T;  3TU4 B;  3X1S D;  3NQU B;  4R8P D;  3AN2 D;  5F99 C;  3W98 C;  4DQY B;  2UWX A;  5AV5 B;  4WNN B;  5B0Y D;  3AYW D;  5AVC A;  3AZE C;  4KHA B;  1P3G A;  3TU4 A;  3NQU A;  2YFW B;  4XZQ C;  1PZR A;  3B6F C;  3AZJ C;  3X1S B;  4HGA B;  5AV5 A;  3KXB C;  5B24 B;  4R8P B;  3UTB C;  1WWI A;  4Z5T C;  2Y2L A;  3EPH A;  4KHA A;  1P3L C;  5B0Y B;  2Y2M A;  3AYW B;  2YFW A;  1P3F C;  4XUJ B;  2PYO A;  3X1S A;  4X23 D;  3R45 B;  3LZ0 C;  4Z66 C;  1BFM A;  5B24 A;  2HUE B;  5B0Y A;  4NFT A;  1KX4 B;  4XUJ A;  3MGQ B;  5B32 D;  5AV5 C;  5AV9 D;  5C3I B;  3AZK C;  2L5A A;  4X23 B;  1P3A A;  2RVQ C;  3X1T D;  3KFU G;  1KX4 A;  5B2J C;  3MGQ A;  3X1S C;  2G5I C;  4WJ3 C;  1KX5 B;  1BH8 B;  4R8P C;  3AN2 C;  1B67 A;  5B32 B;  4X23 A;  1B6W A;  3AYW C;  5AV9 B;  3B0C T;  5CPK D;  1Z2C B;  4JJN B;  4LD9 D;  3X1T B;  3W99 C;  1BH9 B;  3KUY A;  3AZM D;  2HUE C;  5B32 A;  3B0B A;  5B0Z D;  2HIO D;  3AZH C;  1EQZ B;  5CP6 D;  5GT3 D;  1Q9C A;  5GSU D;  3REL D;  5AY8 D;  4JJN A;  1BH9 A;  3A6N C;  5C3I C;  5CPK B;  1HQ3 D;  5B40 D;  4X23 C;  3W98 D;  4LD9 B;  4WV4 B;  1EQZ A;  4KUD C;  3B0D B;  3EPK A;  3AZM B;  2FJ7 D;  5AV8 D;  3REH C;  3W96 D;  5CP6 B;  5GT3 B;  1M18 B;  5GSU B;  4H9N B;  5AY8 B;  3WAA D;  3AZJ D;  5B32 C;  4QLC D;  5AV9 C;  1HTA A;  5B1M D;  3UTB D;  5F99 B;  3REJ D;  4E45 A;  3AZM A;  5B40 B;  1M19 D;  3W98 B;  3X1T C;  2Y2Q A;  5BNX B;  5CP6 A;  3C1B A;  1M18 A;  5GSU A;  4H9N A;  2FJ7 B;  5AY8 A;  3A1K A;  5AV8 B;  1P3P D;  3W96 B;  2CWE A;  4J8X D;  2ARO D;  5CHL B;  3AZG D;  3B6F B;  5F99 A;  3AZJ B;  1N1J B;  3WAA B;  3W98 A;  4QLC B;  5BNX A;  5B1M B;  3WTP E;  3UTB B;  5JRG D;  3REK D;  5CPK C;  3REJ B;  3AZE A;  3VH6 W;  4WU8 D;  4LD9 C;  5GXQ D;  3EPL A;  1P3F B;  3AZL D;  3B6F A;  3AZJ A;  1N1J A;  4DRA A;  5B0Z C;  2HIO C;  3LZ0 B;  3AZI D;  2F8N H;  5GT3 C;  2NZD D;  3REL C;  4Z66 B;  5B1M A;  2ARO B;  3UTB A;  5AY8 C;  5B33 D;  3AZG B;  1T3U A;  2G5H C;  5B31 G;  1P3L A;  5JRG B;  3REK B;  1P3F A;  1HQ3 C;  5B40 C;  5GT0 D;  4WU8 B;  3MGS D;  3LZ0 A;  3X1U D;  4Z66 A;  2FJ7 C;  2JSS A;  1WWS A;  4G91 C;  3AZG A;  3F6T A;  3KWQ C;  2ZY2 A;  3AZK B;  2DF4 C;  4E44 A;  5AV8 C;  3AZI B;  4YS3 C;  3W96 C;  1W2E A;  3W99 D;  4AWL B;  2NZD B;  5JRG A;  3REK A;  3WAA C;  2JE5 A;  5B2J B;  4WU8 A;  4QLC C;  4WNN A;  3REI C;  1R4V A;  3AZH D;  5B1M C;  3AN2 B;  3MGP D;  3REJ C;  4ZBJ B;  3AZK A;  1M19 C;  5GT0 B;  3MGS B;  4NE3 A;  3EPJ A;  1P3I D;  2NZD A;  3A6N D;  3VH5 W;  3AZN C;  5B2J A;  1P3O C;  1P3P C;  5CPI D;  4J8X C;  4J8W C;  1S32 D;  3W99 B;  2ARO C;  4R8P A;  3AN2 A;  3AZG C;  4KUD D;  5BT1 D;  3MGS A;  1P3B D;  3REH D;  3AZH B;  3LEL D;  1KX5 D;  3AYW A;  5JRG C;  3REK C;  5DNM D;  3MGP B;  3MVD D;  5KDM B;  2F8N G;  4WU8 C;  3R45 A;  3W99 A;  5GXQ C;  3H0R C;  3A6N B;  3AZL C;  3AZI C;  3AZH A;  1S32 B;  4AWL C;  2NZD C;  2ZY3 A;  4UPK A;  5B33 C;  3MGP A;  3B0C W;  4KUD B;  5KDM A;  3LEL B;  3REH B;  5E5A D; 
#chains in the Genus database with same CATH homology
 3KSY A;  5B31 D;  2JCH A;  5DNM B;  3A6N A;  2XD5 A;  4ZBJ C;  5GT0 C;  3MGS C;  1ID3 C;  1S32 A;  5AVB D;  3X1U C;  1P34 D;  4KUD A;  4WZS B;  2W8S A;  1F66 D;  2DQN C;  1P3B A;  3REH A;  3LEL A;  3AZF D;  1BH8 A;  5DNM A;  3IP4 C;  4DRB A;  5E5A B;  5B31 B;  5AV9 A;  3MGP C;  5AV6 D;  3AV1 D;  1F1E A;  1A7W A;  3X1T A;  3O62 D;  1P3I C;  5AVB B;  2Y2P A;  2VQR A;  3WKJ D;  1F66 B;  5CPI C;  5E5A A;  1S32 C;  3AZF B;  4YM6 D;  1U35 C;  4J8U C;  3C1C D;  4ZUX C;  3AL0 C;  3KWQ D;  5BT1 C;  1P3B C;  5B0Z B;  2HIO B;  2CV5 D;  3LEL C;  1ULY A;  4YS3 D;  1KX5 C;  1AOI D;  5AVB A;  5DNM C;  3REL B;  5AV6 B;  5CPK A;  3MVD C;  3W97 C;  1H3O B;  4KGC D;  4H9Q B;  1F66 A;  4LD9 A;  3O62 B;  3REI D;  3AZF A;  3AFA D;  2F8N D;  2Y2N A;  1HQ3 B;  5B0Z A;  2HIO A;  4NE5 A;  4YM6 B;  5GT3 A;  3LZ1 D;  5BS7 C;  3REL A;  4CSR B;  5AV6 A;  4G91 B;  1M1A D;  1H3O A;  5BO0 B;  3KWQ B;  3AZN D;  5B1L D;  2CV5 B;  5B2I D;  5E5A C;  2J8P A;  4YS3 B;  1P3O D;  3B6G D;  5B31 C;  2BG1 A;  4J8W D;  1HQ3 A;  5B40 A;  2F2A C;  2IO5 C;  3REI B;  4UUZ B;  5AVB C;  1P34 C;  1TZY D;  3AFA B;  3MGR D;  4CSR A;  2FJ7 A;  2ZM5 A;  4J8V D;  5BO0 A;  3KWQ A;  1M19 B;  2Y2G A;  1F66 C;  5AV8 A;  2CV5 A;  4YS3 A;  3W96 A;  3AZF C;  3WAA A;  4H9R B;  3AZN B;  5B2I B;  1P3P B;  4QLC A;  1P3O B;  3REI A;  3V9R B;  2BYK B;  4J8W B;  4J8X B;  5AV6 C;  3AV1 C;  3REJ A;  1M19 A;  5AVC D;  3O62 C;  1JFI B;  1TZY B;  1P3G D;  3EG5 B;  3TU4 D;  3WKJ C;  4J8V B;  4H9R A;  3AZN A;  1P3P A;  1P3O A;  1ID3 D;  3V9R A;  3VH5 A;  4YM6 C;  2BYK A;  4J8W A;  4J8X A;  5GXQ B;  3AV2 D;  2ARO A;  3C1C C;  3AZL B;  3H0M C;  2BYM B;  2CV5 C;  1P3M D;  1AOI C;  5B33 B;  2RIQ A;  4KGC C;  4J8V A;  2XD1 A;  4EO5 C;  3AFA C;  2PYO D;  1P3G B;  4H9P B;  5GXQ A;  4NE6 A;  3AZL A;  1P3B B;  1KX3 D;  2BYM A;  3AZI A;  1TAF B;  2ZY5 A;  5B24 D;  1ID3 B;  3LZ1 C;  3X1U B;  3AV2 B;  3NQJ B;  1M1A C;  5B33 A;  1KU5 A;  5B1L C;  5B2I C;  2NQB D;  1P3M B;  2LY8 A;  3B6G C;  4XUJ D;  4H9P A;  3MNN D;  1U35 D;  4J8U D;  4ZUX D;  5GT0 A;  2Y2J A;  1TAF A;  1ID3 A;  1TZY C;  2PYO B;  3X1U A;  3AV2 A;  3MGR C;  3NQJ A;  1P3A D;  4J8V C;  3W97 D;  1KX3 B;  1P3M A;  1KX4 D;  1P3I B;  5DNN C;  3MGQ D;  2YFV B;  2NQB B;  1P3K D;  2Y2H A;  5CPI B;  3WA9 D;  3WTP D;  4H9S A;  4M6B A;  3MNN B;  1U35 B;  4J8U B;  4ZUX B;  3FDD A;  1KX3 A;  5AVC C;  1P3G C;  1P3I A;  3TU4 C;  2YFV A;  4G92 B;  1P3A B;  3MVD B;  3W97 B;  1ZLA D;  4CAY B;  2NQB A;  3KUY D;  5CPI A;  3VH5 T;  3AV2 C;  2ZY4 A;  5CPJ D;  3MNN A;  2Y2O A;  1U35 A;  4J8U A;  4ZUX A;  1P3K B;  1P3M C;  3WA9 B;  3WTP B;  1KX5 A;  4Z2M H;  4JJN D;  3MVD A;  3W97 A;  4CAY A;  5BNV B;  2PYO C;  2F8N K;  4H9S C;  4HGA C;  1KX3 C;  1ZLA B;  1EQZ D;  1P3K A;  5B24 C;  3KUY B;  3X1V D;  2IO5 B;  3WA9 A;  3WTP A;  1P34 B;  5CPJ B;  5BS7 A;  5B0Y C;  2NQB C;  3H0L C;  4XUJ C;  5BNV A;  5B31 A;  3MNN C;  2Y2I A;  2FFF B;  1ZLA A;  3UT9 D;  3UTA D;  1P34 A;  4WU9 D;  5CPJ A;  1P3A C;  4G92 C;  3AV1 B;  3LJA D;  3X1V B;  3C1B D;  1M18 D;  1KX4 C;  3MGQ C;  3VH6 A;  3WKJ B;  1P3K C;  3WA9 C;  3WTP C;  5F99 D;  3C1C B;  3AV1 A;  4H9Q A;  3X1V A;  3P5J B;  3UT9 B;  1AOI B;  3O62 A;  3UTA B;  4WU9 B;  3AZE D;  3LJA B;  3WKJ A;  4KGC B;  1ZLA C;  3KUY C;  3C1B B;  4Z2M G;  4XZQ D;  4EO5 B;  2F8N B;  4YM6 A;  3B6F D;  5CPJ C;  3C1C A;  3KXB D;  5JA4 B;  3UT9 A;  2Y2K A;  1AOI A;  4JJN C;  3LZ1 B;  3UTA A;  4Z5T D;  5DNN D;  4WU9 A;  1M1A B;  3LJA A;  1P3L D;  4KGC A;  3A1I A;  5B1L B;  5G49 B;  3B6G B;  4UUZ A;  1P3F D;  3AFA A;  2F8N A;  3AZE B;  3LZ0 D;  5FUG B;  4H9O B;  1EQZ C;  3X1V C;  5JA4 A;  4XZQ B;  4Z66 D;  3LZ1 A;  3MGR B;  1M1A A;  3KXB B;  5B1L A;  5B32 G;  5B2I A;  5G49 A;  3B6G A;  4Z5T B;  5DNN B;  5AV5 D;  1P3L B;  5FUG A;  4H9O A;  3UT9 C;  4XZQ A;  3B0D C;  3UTA C;  3AZM C;  1TZY A;  3AZK D;  4WU9 C;  1JFI A;  3MGR A;  3LJA C;  2RVQ D;  5CP6 C;  3KXB A;  3C1B C;  1M18 C;  5GSU C;  5AVC B;  4Z5T A;  5DNN A;  5B2J D;  3VH6 T;  3TU4 B;  3X1S D;  3NQU B;  4R8P D;  3AN2 D;  5F99 C;  3W98 C;  4DQY B;  2UWX A;  5AV5 B;  4WNN B;  5B0Y D;  3AYW D;  5AVC A;  3AZE C;  4KHA B;  1P3G A;  3TU4 A;  3NQU A;  2YFW B;  4XZQ C;  1PZR A;  3B6F C;  3AZJ C;  3X1S B;  4HGA B;  5AV5 A;  3KXB C;  5B24 B;  4R8P B;  3UTB C;  1WWI A;  4Z5T C;  2Y2L A;  3EPH A;  4KHA A;  1P3L C;  5B0Y B;  2Y2M A;  3AYW B;  2YFW A;  1P3F C;  4XUJ B;  2PYO A;  3X1S A;  4X23 D;  3R45 B;  3LZ0 C;  4Z66 C;  1BFM A;  5B24 A;  2HUE B;  5B0Y A;  4NFT A;  1KX4 B;  4XUJ A;  3MGQ B;  5B32 D;  5AV5 C;  5AV9 D;  5C3I B;  3AZK C;  2L5A A;  4X23 B;  1P3A A;  2RVQ C;  3X1T D;  3KFU G;  1KX4 A;  5B2J C;  3MGQ A;  3X1S C;  2G5I C;  4WJ3 C;  1KX5 B;  1BH8 B;  4R8P C;  3AN2 C;  1B67 A;  5B32 B;  4X23 A;  1B6W A;  3AYW C;  5AV9 B;  3B0C T;  5CPK D;  1Z2C B;  4JJN B;  4LD9 D;  3X1T B;  3W99 C;  1BH9 B;  3KUY A;  3AZM D;  2HUE C;  5B32 A;  3B0B A;  5B0Z D;  2HIO D;  3AZH C;  1EQZ B;  5CP6 D;  5GT3 D;  1Q9C A;  5GSU D;  3REL D;  5AY8 D;  4JJN A;  1BH9 A;  3A6N C;  5C3I C;  5CPK B;  1HQ3 D;  5B40 D;  4X23 C;  3W98 D;  4LD9 B;  4WV4 B;  1EQZ A;  4KUD C;  3B0D B;  3EPK A;  3AZM B;  2FJ7 D;  5AV8 D;  3REH C;  3W96 D;  5CP6 B;  5GT3 B;  1M18 B;  5GSU B;  4H9N B;  5AY8 B;  3WAA D;  3AZJ D;  5B32 C;  4QLC D;  5AV9 C;  1HTA A;  5B1M D;  3UTB D;  5F99 B;  3REJ D;  4E45 A;  3AZM A;  5B40 B;  1M19 D;  3W98 B;  3X1T C;  2Y2Q A;  5BNX B;  5CP6 A;  3C1B A;  1M18 A;  5GSU A;  4H9N A;  2FJ7 B;  5AY8 A;  3A1K A;  5AV8 B;  1P3P D;  3W96 B;  2CWE A;  4J8X D;  2ARO D;  5CHL B;  3AZG D;  3B6F B;  5F99 A;  3AZJ B;  1N1J B;  3WAA B;  3W98 A;  4QLC B;  5BNX A;  5B1M B;  3WTP E;  3UTB B;  5JRG D;  3REK D;  5CPK C;  3REJ B;  3AZE A;  3VH6 W;  4WU8 D;  4LD9 C;  5GXQ D;  3EPL A;  1P3F B;  3AZL D;  3B6F A;  3AZJ A;  1N1J A;  4DRA A;  5B0Z C;  2HIO C;  3LZ0 B;  3AZI D;  2F8N H;  5GT3 C;  2NZD D;  3REL C;  4Z66 B;  5B1M A;  2ARO B;  3UTB A;  5AY8 C;  5B33 D;  3AZG B;  1T3U A;  2G5H C;  5B31 G;  1P3L A;  5JRG B;  3REK B;  1P3F A;  1HQ3 C;  5B40 C;  5GT0 D;  4WU8 B;  3MGS D;  3LZ0 A;  3X1U D;  4Z66 A;  2FJ7 C;  2JSS A;  1WWS A;  4G91 C;  3AZG A;  3F6T A;  3KWQ C;  2ZY2 A;  3AZK B;  2DF4 C;  4E44 A;  5AV8 C;  3AZI B;  4YS3 C;  3W96 C;  1W2E A;  3W99 D;  4AWL B;  2NZD B;  5JRG A;  3REK A;  3WAA C;  2JE5 A;  5B2J B;  4WU8 A;  4QLC C;  4WNN A;  3REI C;  1R4V A;  3AZH D;  5B1M C;  3AN2 B;  3MGP D;  3REJ C;  4ZBJ B;  3AZK A;  1M19 C;  5GT0 B;  3MGS B;  4NE3 A;  3EPJ A;  1P3I D;  2NZD A;  3A6N D;  3VH5 W;  3AZN C;  5B2J A;  1P3O C;  1P3P C;  5CPI D;  4J8X C;  4J8W C;  1S32 D;  3W99 B;  2ARO C;  4R8P A;  3AN2 A;  3AZG C;  4KUD D;  5BT1 D;  3MGS A;  1P3B D;  3REH D;  3AZH B;  3LEL D;  1KX5 D;  3AYW A;  5JRG C;  3REK C;  5DNM D;  3MGP B;  3MVD D;  5KDM B;  2F8N G;  4WU8 C;  3R45 A;  3W99 A;  5GXQ C;  3H0R C;  3A6N B;  3AZL C;  3AZI C;  3AZH A;  1S32 B;  4AWL C;  2NZD C;  2ZY3 A;  4UPK A;  5B33 C;  3MGP A;  3B0C W;  4KUD B;  5KDM A;  3LEL B;  3REH B;  5E5A D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...