4ZUXC

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
b'TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 29
structure length 103
sequence length 103
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxC00
3AV2A 4H9SC 5CP6A 5GXQA 1S32C 2NZDC 4LD9A 3AZND 5GXQD 3B0CT 5B2IA 5B24D 5BT1D 4J8WB 4LD9D 3A6NA 5B2ID 3AZNB 5GXQB 5DNNC 3A6ND 5B24B 3LELA 3C1BB 3LELD 3A6NB 4WV4B 3VH6W 4EO5C 4XZQB 4ZBJB 1P3LD 3REKA 4WU8A 2BYMA 4WU8D 3WKJC 1P3KB 1P3LB 3KXBC 3REJA 3RELD 4WU9A 3NQJA 3REJD 4WU9D 4DRAA 3WA9B 4Z66B 5B2JA 3RELB 3REJB 4WU9B 2CV5B 3MNNA 5B40A 3AZLC 2NQBC 1P3BA 5B31A 5B0ZD 1P3BD 5B31D 1TZYD 5B0ZB 3AFAD 3MGPA 5B31B 3MGPD 1TZYB 3LZ0A 3AFAB 3LZ0D 1P3FA 5CPID 3W99B 3AZEB 3LZ0B 1P3FD 1KX5D 1B6WA 3X1SB 5CPIB 1H3OA 1P3FB 1KX5B 4WZSB 3WTPC 5AV5A 3AN2A 5AV5D 3AN2D 5AV5B 3AN2B 4CSRA 3B0DB 3LJAB 1HQ3A 3AZFA 4ZUXA 3REIA 4M6BA 3X1TC 4ZUXD 3REID 3AZGA 4KUDC 1AOID 4YM6C 5B33C 4ZUXB 4Z2MH 3AZGD 1WWIA 1P3PB 3MGQA 3AV2C 1AOIB 3AZGB 3MGQD 1U35C 2L5AA 5CP6C 3AV1B 5E5AA 1BFMA 3B6GD 2PYOB 5BNXA 1EQZC 3MVDA 3B6FA 3MVDD 3B6GB 3B6FD 4H9SA 4KGCC 4NE6A 5BNXB 3MVDB 5AV8B 1S32A 2NZDA 1S32D 3W97A 3REKC 3TU4C 3VH5A 4WU8C 2NZDD 5DNNA 5DNND 5CPJC 4J8XB 4J8UB 5DNNB 5B2JC 3WAAC 4WNNB 3MNNC 3WKJA 4EO5B 5F99A 5B40C 3WKJD 2YFWA 3WKJB 5BS7C 3AZKC 1P3IC 3O62B 3KXBB 2YFWB 4JJNB 3MGRB 3AZLA 2NQBA 3AZLD 3W96C 2NQBD 3KWQA 4HGAC 3AZJC 4H9QA 5JA4A 5B32G 4Z5TC 1BH9A 4H9QB 1BH9B 1KX3B 4QLCC 1HQ3C 3AZFC 1WWSA 5AV9C 3WTPA 5AY8C 3WTPD 4J8VA 4J8VD 4E45A 3WTPB 4UUZA 2F8NH 5E5AC 3X1TA 3X1TD 1F66C 3V9RA 5B0YC 3C1CC 2F8NA 5KDMB 2F8ND 1BH8A 5B33A 4YM6A 4KUDD 3X1TB 5B33D 4YM6D 3AZHC 3V9RB 2LY8A 3AV2D 4KUDB 1U35A 1P3AC 5B33B 4YM6B 3MGSC 1U35D 3REHC 3AV2B 5CP6D 3W97C 3UT9C 1EQZA 5CP6B 1EQZD 4LD9B 5B2IB 4KGCA 1EQZB 1HTAA 4KGCD 3LZ1C 3LELB 3TU4A 4KGCB 1KX4A 3TU4D 3REKD 5F99C 3TU4B 3REKB 3VH6T 4WU8B 5GT0A 2BYMB 5CPJA 3NQUA 5CPJD 3WAAA 5B2JD 3NQJB 3WAAD 5JRGC 4H9PA 1M1AA 5B2JB 3MNND 3WAAB 5B40D 3KWQC 3MNNB 5BS7A 5B40B 3AZKA 1P3IA 5B1MC 1P3BB 3AZKD 1P3ID 4XUJC 3MGPB 1P34A 5DNMA 3AYWA 1M18C 3W96A 3W96D 3AZJA 3AZIC 1F1EA 3AZJD 3W96B 4R8PC 4Z5TA 4J8VC 1H3OB 4Z5TD 2CWEA 4Z5TB 1KU5A 4QLCA 1ULYA 4QLCD 1HQ3D 3AZFD 5AV9A 5CPKC 4CSRB 5AY8A 5AV9D 5AY8D 4QLCB 1HQ3B 3AZFB 3REIB 5AV9B 5AY8B 2FJ7C 2HUEC 3MGQB 5E5AD 1F66A 5B0YA 2IO5B 3C1CA 5CHLB 1F66D 5B0YD 3C1CD 3X1VA 2RVQC 5E5AB 5AVBC 3AZHA 3AZHD 1P3AA 3B6FB 3MGSA 1N1JA 1P3AD 1P3GA 2YFVA 3MGSD 3REHA 3REHD 1KX4C 3KSYA 3W97D 3UT9A 1JFIA 3UT9D 1S32B 2NZDB 4DRBA 4G92C 3W97B 5GT0C 3UT9B 3R45A 3LZ1A 4J8WC 3LZ1D 1M1AC 3R45B 3C1BC 5FUGA 5F99D 4XZQC 5FUGB 5F99B 3WTPE 3VH5W 1P3KC 5JRGA 5JRGD 4G91C 1P34C 5DNMC 3AYWC 1M19A 5JRGB 4Z66C 3KWQD 3AZLB 2CV5C 2NQBB 5B1MA 5B1MD 3KWQB 2HIOA 4XUJA 3KUYA 5B32C 4XUJD 5JA4B 1M18A 5B31G 1P3MC 1M18D 4YS3A 3AZIA 3AZID 5BNVA 3UTBA 4R8PA 4E44A 3UTBD 3B0BA 4R8PD 2BYKA 3W99C 5BNVB 1B67A 3UTAA 4R8PB 3X1SC 2BYKB 4J8VB 5CPKA 1Q9CA 5CPKD 4UUZB 3X1VC 2AROA 4X23A 1P3OC 3LJAC 2F8NB 5G49A 1BH8B 2FJ7A 1P3GC 2FJ7D 1U35B 1P3PC 2HUEB 2RVQD 5AVBA 4H9OA 5AVBD 3AV1C 5AV6A 4Z2MG 5GT3A 4NE5A 2PYOC 5AVBB 1KX4D 1ID3C 4NE3A 5GSUC 1KX4B 5AV8C 3B0CW 5GT0D 4J8WA 4G92B 4NFTA 4J8WD 5GT0B 3AZNA 5CPJB 3W98C 3NQUB 5B24A 3C1BA 1M1AD 3C1BD 4J8XC 4J8UC 1M19C 4H9PB 1M1AB 4XZQA 4XZQD 1P3KA 1P3LA 2HIOC 1P3KD 2F8NK 3KUYC 3AZKB 1P3IB 1P34D 4H9RA 5DNMD 3AYWD 4Z66A 3RELA 3WA9A 4YS3C 3O62C 4Z66D 3WA9D 4G91B 1P34B 5DNMB 2CV5A 5B1LC 3AYWB 4H9RB 4JJNC 3UTBC 2CV5D 4HGAB 3MGRC 3AZJB 5B32A 5B32D 3UTAC 5B0ZA 3AZMC 1P3MA 5B32B 1P3MD 1TZYA 3AFAA 1P3MB 1ZLAC 2JSSA 4AWLC 3W99A 3AZEA 3W99D 2AROC 4X23C 3AZED 1KX3C 3X1SA 5CPIA 3X1SD 1A7WA 1KX5A 5C3IC 5AVCC 1R4VA 1P3OA 3LJAA 3X1VD 1P3OD 3X1UC 5B0YB 3LJAD 3C1CB 1F66B 5AV6C 3X1VB 5GT3C 1P3OB 3AZHB 1P3GD 1P3AB 1P3PA 2F8NG 3MGSB 1N1JB 1P3GB 1P3PD 2YFVB 1AOIA 3REHB 3AV1A 1JFIB 3AV1D 2PYOA 2PYOD 3AZNC 5GXQC 3B6GA 5B24C 4LD9C 5BT1C 3LZ1B 5B2IC 1ID3A 5GSUA 4CAYA 3A6NC 1ID3D 5GSUD 5AV8A 3LELC 5AV8D 4ZBJC 1ID3B 5GSUB 4CAYB 1P3LC 3W98A 4H9NA 3W98D 4J8XA 4J8UA 3W98B 3WA9C 4J8XD 3RELC 4H9NB 4J8UD 1M19D 4KHAA 4WNNA 3VH5T 3REJC 4WU9C 1M19B 4KHAB 2HIOD 3KUYD 5B1MB 5BO0A 5B0ZC 1TAFA 2HIOB 4XUJB 5B31C 3O62A 3KXBA 3KUYB 1P3BC 4YS3D 3O62D 1TZYC 3KXBD 5B1LA 5BO0B 3AFAC 1M18B 4JJNA 1TAFB 5B1LD 3MGPC 3MGRA 4JJND 4YS3B 3AZIB 3MGRD 3AZEC 5B1LB 3LZ0C 3UTBB 3UTAD 3AZMA 5CPIC 1P3FC 3AZMD 1KX5C 3UTAB 3AZMB 1ZLAA 1ZLAD 5AV5C 3AN2C 3B0DC 5CPKB 2AROD 4X23D 1KX3A 1ZLAB 1KX3D 4AWLB 2AROB 5AVCA 4X23B 5AVCD 5G49B 4ZUXC 3REIC 5C3IB 2FJ7B 5AVCB 1AOIC 3AZGC 3X1UA 3X1UD 3MGQC 5AV6D 2IO5C 5KDMA 5GT3D 3X1UB 4H9OB 3B6GC 3VH6A 5AV6B 5GT3B 4KUDA 3MVDC 3B6FC
chains in the Genus database with same CATH superfamily
3AV2A 4H9SC 3EPKA 5CP6A 5GXQA 1S32C 2NZDC 4LD9A 3AZND 5GXQD 3B0CT 5B2IA 5B24D 5BT1D 4J8WB 4LD9D 3A6NA 5B2ID 4WJ3C 3AZNB 5GXQB 5DNNC 3A6ND 5B24B 3LELA 3C1BB 3LELD 3A6NB 4WV4B 3VH6W 4EO5C 4XZQB 4ZBJB 1P3LD 3REKA 4WU8A 2BYMA 4WU8D 3WKJC 3EPJA 1P3KB 1P3LB 3KXBC 3REJA 3RELD 4WU9A 3NQJA 3REJD 4WU9D 4DRAA 3WA9B 4Z66B 5B2JA 3RELB 3REJB 4WU9B 2Y2NA 2CV5B 3MNNA 5B40A 3AZLC 2NQBC 1P3BA 5B31A 5B0ZD 1P3BD 5B31D 1TZYD 2Y2QA 5B0ZB 3AFAD 3MGPA 5B31B 3MGPD 1TZYB 3LZ0A 3AFAB 3LZ0D 1P3FA 5CPID 3W99B 3AZEB 3LZ0B 1P3FD 1KX5D 1B6WA 3X1SB 5CPIB 1H3OA 1P3FB 1KX5B 4WZSB 3WTPC 5AV5A 3AN2A 5AV5D 3AN2D 2XD5A 5AV5B 3AN2B 2RIQA 4CSRA 3B0DB 3LJAB 4DQYB 1HQ3A 3AZFA 4ZUXA 3REIA 4M6BA 3X1TC 4ZUXD 3REID 2BG1A 3AZGA 4KUDC 1AOID 4YM6C 5B33C 4ZUXB 4Z2MH 3AZGD 1WWIA 1P3PB 3MGQA 3AV2C 1AOIB 3AZGB 3MGQD 1U35C 2L5AA 5CP6C 3AV1B 5E5AA 1BFMA 3B6GD 2G5HC 2PYOB 5BNXA 1EQZC 3MVDA 3B6FA 3MVDD 3B6GB 3B6FD 4H9SA 4KGCC 4NE6A 5BNXB 3MVDB 2ZM5A 5AV8B 1S32A 3KFUG 2NZDA 1S32D 3W97A 3REKC 3TU4C 3VH5A 4WU8C 2NZDD 2J8PA 5DNNA 5DNND 5CPJC 4J8XB 4J8UB 5DNNB 5B2JC 3WAAC 4WNNB 3MNNC 3WKJA 4EO5B 5F99A 5B40C 3WKJD 2YFWA 3WKJB 5BS7C 3AZKC 1P3IC 3O62B 3KXBB 2YFWB 4JJNB 3F6TA 3MGRB 3AZLA 2NQBA 3AZLD 3W96C 2NQBD 3KWQA 4HGAC 3AZJC 4H9QA 5JA4A 5B32G 4Z5TC 1BH9A 4H9QB 2Y2LA 1BH9B 1KX3B 4QLCC 1HQ3C 3AZFC 1WWSA 5AV9C 3WTPA 5AY8C 3WTPD 4J8VA 4J8VD 4E45A 3WTPB 2ZY4A 2ZY2A 4UUZA 2F8NH 5E5AC 3X1TA 3X1TD 1F66C 3V9RA 5B0YC 3C1CC 2F8NA 5KDMB 2F8ND 1BH8A 5B33A 4YM6A 4KUDD 3X1TB 5B33D 4YM6D 3AZHC 1W2EA 3V9RB 2LY8A 3AV2D 4KUDB 1U35A 1P3AC 2JCHA 5B33B 4YM6B 3MGSC 1U35D 3REHC 3AV2B 5CP6D 3W97C 3EPLA 2F2AC 3UT9C 1EQZA 5CP6B 1EQZD 4LD9B 2W8SA 5B2IB 4KGCA 1EQZB 1HTAA 4KGCD 3LZ1C 3LELB 3TU4A 4KGCB 1KX4A 3TU4D 3REKD 5F99C 3TU4B 3REKB 3VH6T 4WU8B 5GT0A 2BYMB 5CPJA 3NQUA 5CPJD 3WAAA 5B2JD 3NQJB 3WAAD 5JRGC 4H9PA 1M1AA 5B2JB 3MNND 3WAAB 5B40D 3AL0C 3KWQC 3MNNB 5BS7A 5B40B 3AZKA 1P3IA 5B1MC 1P3BB 3AZKD 1P3ID 4XUJC 3MGPB 1P34A 5DNMA 3AYWA 1M18C 3W96A 3W96D 3AZJA 3AZIC 1F1EA 3AZJD 3W96B 4R8PC 4Z5TA 4J8VC 1H3OB 4Z5TD 2CWEA 4Z5TB 1KU5A 4QLCA 1ULYA 4QLCD 1HQ3D 3AZFD 5AV9A 5CPKC 4CSRB 5AY8A 5AV9D 5AY8D 4QLCB 1HQ3B 3AZFB 3REIB 5AV9B 5AY8B 2FJ7C 2HUEC 2Y2KA 3MGQB 5E5AD 1F66A 5B0YA 2IO5B 2Y2OA 5CHLB 3C1CA 1F66D 5B0YD 3C1CD 3X1VA 2RVQC 5E5AB 5AVBC 3AZHA 2FFFB 3AZHD 1P3AA 3B6FB 3MGSA 1N1JA 1P3AD 1P3GA 2YFVA 2DF4C 3MGSD 3REHA 3REHD 1KX4C 3KSYA 3W97D 3UT9A 3H0LC 1JFIA 3UT9D 1S32B 2NZDB 4DRBA 4G92C 3W97B 5GT0C 3UT9B 3R45A 3LZ1A 4J8WC 3LZ1D 1M1AC 3R45B 3C1BC 5FUGA 5F99D 4XZQC 5FUGB 5F99B 3WTPE 3VH5W 1P3KC 5JRGA 2XD1A 5JRGD 4G91C 1P34C 5DNMC 3AYWC 1M19A 5JRGB 4Z66C 3KWQD 3AZLB 2CV5C 2NQBB 5B1MA 5B1MD 2Y2HA 3KWQB 2HIOA 4XUJA 3KUYA 5B32C 4XUJD 3P5JB 1Z2CB 3H0RC 5JA4B 1M18A 5B31G 1P3MC 1M18D 4YS3A 3AZIA 3AZID 5BNVA 3UTBA 4R8PA 4E44A 3UTBD 3B0BA 4R8PD 2BYKA 3W99C 5BNVB 1B67A 3UTAA 4R8PB 3X1SC 2BYKB 4J8VB 5CPKA 1Q9CA 5CPKD 4UUZB 3X1VC 2AROA 4X23A 1P3OC 3LJAC 2F8NB 5G49A 1BH8B 2FJ7A 1P3GC 2FJ7D 1U35B 1P3PC 2HUEB 2RVQD 5AVBA 4H9OA 5AVBD 3AV1C 5AV6A 4Z2MG 5GT3A 4NE5A 2PYOC 5AVBB 1KX4D 1ID3C 2Y2GA 4NE3A 5GSUC 1KX4B 5AV8C 3B0CW 5GT0D 4J8WA 4G92B 2DQNC 4NFTA 4J8WD 5GT0B 3AZNA 5CPJB 3W98C 3NQUB 5B24A 3C1BA 1M1AD 3C1BD 2ZY5A 4J8XC 4J8UC 1M19C 4H9PB 1M1AB 4XZQA 4XZQD 3EG5B 1P3KA 1P3LA 2HIOC 1P3KD 2F8NK 3KUYC 3AZKB 1P3IB 1P34D 4H9RA 5DNMD 3AYWD 4Z66A 3RELA 3WA9A 4YS3C 3O62C 4UPKA 4Z66D 3WA9D 4G91B 1P34B 5DNMB 2CV5A 5B1LC 3AYWB 4H9RB 4JJNC 3UTBC 2CV5D 4HGAB 3MGRC 3AZJB 5B32A 2ZY3A 5B32D 3UTAC 5B0ZA 3AZMC 1P3MA 5B32B 1P3MD 1TZYA 3AFAA 1T3UA 1P3MB 1ZLAC 2JSSA 4AWLC 3W99A 3AZEA 3W99D 2AROC 4X23C 3AZED 1KX3C 3X1SA 5CPIA 3X1SD 1A7WA 1KX5A 5C3IC 5AVCC 1R4VA 1P3OA 3LJAA 3X1VD 1P3OD 3X1UC 5B0YB 3LJAD 3C1CB 1F66B 5AV6C 3X1VB 5GT3C 1P3OB 3AZHB 1P3GD 1P3AB 1P3PA 2F8NG 3MGSB 1N1JB 1P3GB 1P3PD 2YFVB 1AOIA 3REHB 2Y2JA 3AV1A 3H0MC 1JFIB 2Y2PA 3AV1D 3A1IA 3FDDA 2PYOA 2PYOD 3AZNC 5GXQC 3B6GA 5B24C 4LD9C 5BT1C 3LZ1B 5B2IC 1ID3A 5GSUA 2G5IC 4CAYA 3A6NC 1ID3D 5GSUD 5AV8A 3LELC 3EPHA 5AV8D 4ZBJC 1ID3B 5GSUB 4CAYB 3IP4C 1P3LC 3W98A 4H9NA 3W98D 4J8XA 4J8UA 3W98B 2Y2MA 4J8XD 3RELC 4H9NB 4J8UD 1M19D 3WA9C 4KHAA 4WNNA 3VH5T 3REJC 4WU9C 2UWXA 1M19B 4KHAB 2HIOD 3KUYD 5B1MB 2Y2IA 5BO0A 5B0ZC 1TAFA 2HIOB 4XUJB 5B31C 3O62A 3KXBA 3KUYB 1P3BC 4YS3D 3O62D 1TZYC 3KXBD 5B1LA 5BO0B 3AFAC 1M18B 4JJNA 1TAFB 5B1LD 3MGPC 3MGRA 4JJND 4YS3B 3AZIB 3MGRD 1PZRA 3AZEC 5B1LB 3LZ0C 3UTBB 3UTAD 3AZMA 5CPIC 1P3FC 3AZMD 3A1KA 1KX5C 3UTAB 2JE5A 3AZMB 1ZLAA 1ZLAD 5AV5C 3AN2C 3B0DC 5CPKB 2AROD 4X23D 1KX3A 1ZLAB 1KX3D 4AWLB 2AROB 5AVCA 4X23B 5AVCD 5G49B 4ZUXC 3REIC 5C3IB 2FJ7B 5AVCB 1AOIC 3AZGC 3X1UA 2VQRA 3X1UD 3MGQC 5AV6D 2IO5C 5KDMA 5GT3D 3X1UB 4H9OB 3B6GC 3VH6A 5AV6B 5GT3B 4KUDA 3MVDC 3B6FC
chains in the Genus database with same CATH topology
3AV2A 4H9SC 3EPKA 5CP6A 5GXQA 1S32C 2NZDC 4LD9A 3AZND 5GXQD 3B0CT 5B2IA 5B24D 5BT1D 4J8WB 4LD9D 3A6NA 5B2ID 4WJ3C 3AZNB 5GXQB 5DNNC 3A6ND 5B24B 3LELA 3C1BB 3LELD 3A6NB 4WV4B 3VH6W 4EO5C 4XZQB 4ZBJB 1P3LD 3REKA 4WU8A 2BYMA 4WU8D 3WKJC 3EPJA 1P3KB 1P3LB 3KXBC 3REJA 3RELD 4WU9A 3NQJA 3REJD 4WU9D 4DRAA 3WA9B 4Z66B 5B2JA 3RELB 3REJB 4WU9B 2Y2NA 2CV5B 3MNNA 5B40A 3AZLC 2NQBC 1P3BA 5B31A 5B0ZD 1P3BD 5B31D 1TZYD 2Y2QA 5B0ZB 3AFAD 3MGPA 5B31B 3MGPD 1TZYB 3LZ0A 3AFAB 3LZ0D 1P3FA 5CPID 3W99B 3AZEB 3LZ0B 1P3FD 1KX5D 1B6WA 3X1SB 5CPIB 1H3OA 1P3FB 1KX5B 4WZSB 3WTPC 5AV5A 3AN2A 5AV5D 3AN2D 2XD5A 5AV5B 3AN2B 2RIQA 4CSRA 3B0DB 3LJAB 4DQYB 1HQ3A 3AZFA 4ZUXA 3REIA 4M6BA 3X1TC 4ZUXD 3REID 2BG1A 3AZGA 4KUDC 1AOID 4YM6C 5B33C 4ZUXB 4Z2MH 3AZGD 1WWIA 1P3PB 3MGQA 3AV2C 1AOIB 3AZGB 3MGQD 1U35C 2L5AA 5CP6C 3AV1B 5E5AA 1BFMA 3B6GD 2G5HC 2PYOB 5BNXA 1EQZC 3MVDA 3B6FA 3MVDD 3B6GB 3B6FD 4H9SA 4KGCC 4NE6A 5BNXB 3MVDB 2ZM5A 5AV8B 1S32A 3KFUG 2NZDA 1S32D 3W97A 3REKC 3TU4C 3VH5A 4WU8C 2NZDD 2J8PA 5DNNA 5DNND 5CPJC 4J8XB 4J8UB 5DNNB 5B2JC 3WAAC 4WNNB 3MNNC 3WKJA 4EO5B 5F99A 5B40C 3WKJD 2YFWA 3WKJB 5BS7C 3AZKC 1P3IC 3O62B 3KXBB 2YFWB 4JJNB 3F6TA 3MGRB 3AZLA 2NQBA 3AZLD 3W96C 2NQBD 3KWQA 4HGAC 3AZJC 4H9QA 5JA4A 5B32G 4Z5TC 1BH9A 4H9QB 2Y2LA 1BH9B 1KX3B 4QLCC 1HQ3C 3AZFC 1WWSA 5AV9C 3WTPA 5AY8C 3WTPD 4J8VA 4J8VD 4E45A 3WTPB 2ZY4A 2ZY2A 4UUZA 2F8NH 5E5AC 3X1TA 3X1TD 1F66C 3V9RA 5B0YC 3C1CC 2F8NA 5KDMB 2F8ND 1BH8A 5B33A 4YM6A 4KUDD 3X1TB 5B33D 4YM6D 3AZHC 1W2EA 3V9RB 2LY8A 3AV2D 4KUDB 1U35A 1P3AC 2JCHA 5B33B 4YM6B 3MGSC 1U35D 3REHC 3AV2B 5CP6D 3W97C 3EPLA 2F2AC 3UT9C 1EQZA 5CP6B 1EQZD 4LD9B 2W8SA 5B2IB 4KGCA 1EQZB 1HTAA 4KGCD 3LZ1C 3LELB 3TU4A 4KGCB 1KX4A 3TU4D 3REKD 5F99C 3TU4B 3REKB 3VH6T 4WU8B 5GT0A 2BYMB 5CPJA 3NQUA 5CPJD 3WAAA 5B2JD 3NQJB 3WAAD 5JRGC 4H9PA 1M1AA 5B2JB 3MNND 3WAAB 5B40D 3AL0C 3KWQC 3MNNB 5BS7A 5B40B 3AZKA 1P3IA 5B1MC 1P3BB 3AZKD 1P3ID 4XUJC 3MGPB 1P34A 5DNMA 3AYWA 1M18C 3W96A 3W96D 3AZJA 3AZIC 1F1EA 3AZJD 3W96B 4R8PC 4Z5TA 4J8VC 1H3OB 4Z5TD 2CWEA 4Z5TB 1KU5A 4QLCA 1ULYA 4QLCD 1HQ3D 3AZFD 5AV9A 5CPKC 4CSRB 5AY8A 5AV9D 5AY8D 4QLCB 1HQ3B 3AZFB 3REIB 5AV9B 5AY8B 2FJ7C 2HUEC 2Y2KA 3MGQB 5E5AD 1F66A 5B0YA 2IO5B 2Y2OA 5CHLB 3C1CA 1F66D 5B0YD 3C1CD 3X1VA 2RVQC 5E5AB 5AVBC 3AZHA 2FFFB 3AZHD 1P3AA 3B6FB 3MGSA 1N1JA 1P3AD 1P3GA 2YFVA 2DF4C 3MGSD 3REHA 3REHD 1KX4C 3KSYA 3W97D 3UT9A 3H0LC 1JFIA 3UT9D 1S32B 2NZDB 4DRBA 4G92C 3W97B 5GT0C 3UT9B 3R45A 3LZ1A 4J8WC 3LZ1D 1M1AC 3R45B 3C1BC 5FUGA 5F99D 4XZQC 5FUGB 5F99B 3WTPE 3VH5W 1P3KC 5JRGA 2XD1A 5JRGD 4G91C 1P34C 5DNMC 3AYWC 1M19A 5JRGB 4Z66C 3KWQD 3AZLB 2CV5C 2NQBB 5B1MA 5B1MD 2Y2HA 3KWQB 2HIOA 4XUJA 3KUYA 5B32C 4XUJD 3P5JB 1Z2CB 3H0RC 5JA4B 1M18A 5B31G 1P3MC 1M18D 4YS3A 3AZIA 3AZID 5BNVA 3UTBA 4R8PA 4E44A 3UTBD 3B0BA 4R8PD 2BYKA 3W99C 5BNVB 1B67A 3UTAA 4R8PB 3X1SC 2BYKB 4J8VB 5CPKA 1Q9CA 5CPKD 4UUZB 3X1VC 2AROA 4X23A 1P3OC 3LJAC 2F8NB 5G49A 1BH8B 2FJ7A 1P3GC 2FJ7D 1U35B 1P3PC 2HUEB 2RVQD 5AVBA 4H9OA 5AVBD 3AV1C 5AV6A 4Z2MG 5GT3A 4NE5A 2PYOC 5AVBB 1KX4D 1ID3C 2Y2GA 4NE3A 5GSUC 1KX4B 5AV8C 3B0CW 5GT0D 4J8WA 4G92B 2DQNC 4NFTA 4J8WD 5GT0B 3AZNA 5CPJB 3W98C 3NQUB 5B24A 3C1BA 1M1AD 3C1BD 2ZY5A 4J8XC 4J8UC 1M19C 4H9PB 1M1AB 4XZQA 4XZQD 3EG5B 1P3KA 1P3LA 2HIOC 1P3KD 2F8NK 3KUYC 3AZKB 1P3IB 1P34D 4H9RA 5DNMD 3AYWD 4Z66A 3RELA 3WA9A 4YS3C 3O62C 4UPKA 4Z66D 3WA9D 4G91B 1P34B 5DNMB 2CV5A 5B1LC 3AYWB 4H9RB 4JJNC 3UTBC 2CV5D 4HGAB 3MGRC 3AZJB 5B32A 2ZY3A 5B32D 3UTAC 5B0ZA 3AZMC 1P3MA 5B32B 1P3MD 1TZYA 3AFAA 1T3UA 1P3MB 1ZLAC 2JSSA 4AWLC 3W99A 3AZEA 3W99D 2AROC 4X23C 3AZED 1KX3C 3X1SA 5CPIA 3X1SD 1A7WA 1KX5A 5C3IC 5AVCC 1R4VA 1P3OA 3LJAA 3X1VD 1P3OD 3X1UC 5B0YB 3LJAD 3C1CB 1F66B 5AV6C 3X1VB 5GT3C 1P3OB 3AZHB 1P3GD 1P3AB 1P3PA 2F8NG 3MGSB 1N1JB 1P3GB 1P3PD 2YFVB 1AOIA 3REHB 2Y2JA 3AV1A 3H0MC 1JFIB 2Y2PA 3AV1D 3A1IA 3FDDA 2PYOA 2PYOD 3AZNC 5GXQC 3B6GA 5B24C 4LD9C 5BT1C 3LZ1B 5B2IC 1ID3A 5GSUA 2G5IC 4CAYA 3A6NC 1ID3D 5GSUD 5AV8A 3LELC 3EPHA 5AV8D 4ZBJC 1ID3B 5GSUB 4CAYB 3IP4C 1P3LC 3W98A 4H9NA 3W98D 4J8XA 4J8UA 3W98B 2Y2MA 4J8XD 3RELC 4H9NB 4J8UD 1M19D 3WA9C 4KHAA 4WNNA 3VH5T 3REJC 4WU9C 2UWXA 1M19B 4KHAB 2HIOD 3KUYD 5B1MB 2Y2IA 5BO0A 5B0ZC 1TAFA 2HIOB 4XUJB 5B31C 3O62A 3KXBA 3KUYB 1P3BC 4YS3D 3O62D 1TZYC 3KXBD 5B1LA 5BO0B 3AFAC 1M18B 4JJNA 1TAFB 5B1LD 3MGPC 3MGRA 4JJND 4YS3B 3AZIB 3MGRD 1PZRA 3AZEC 5B1LB 3LZ0C 3UTBB 3UTAD 3AZMA 5CPIC 1P3FC 3AZMD 3A1KA 1KX5C 3UTAB 2JE5A 3AZMB 1ZLAA 1ZLAD 5AV5C 3AN2C 3B0DC 5CPKB 2AROD 4X23D 1KX3A 1ZLAB 1KX3D 4AWLB 2AROB 5AVCA 4X23B 5AVCD 5G49B 4ZUXC 3REIC 5C3IB 2FJ7B 5AVCB 1AOIC 3AZGC 3X1UA 2VQRA 3X1UD 3MGQC 5AV6D 2IO5C 5KDMA 5GT3D 3X1UB 4H9OB 3B6GC 3VH6A 5AV6B 5GT3B 4KUDA 3MVDC 3B6FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 A;  4H9S C;  5CP6 A;  5GXQ A;  1S32 C;  2NZD C;  4LD9 A;  3AZN D;  5GXQ D;  3B0C T;  5B2I A;  5B24 D;  5BT1 D;  4J8W B;  4LD9 D;  3A6N A;  5B2I D;  3AZN B;  5GXQ B;  5DNN C;  3A6N D;  5B24 B;  3LEL A;  3C1B B;  3LEL D;  3A6N B;  4WV4 B;  3VH6 W;  4EO5 C;  4XZQ B;  4ZBJ B;  1P3L D;  3REK A;  4WU8 A;  2BYM A;  4WU8 D;  3WKJ C;  1P3K B;  1P3L B;  3KXB C;  3REJ A;  3REL D;  4WU9 A;  3NQJ A;  3REJ D;  4WU9 D;  4DRA A;  3WA9 B;  4Z66 B;  5B2J A;  3REL B;  3REJ B;  4WU9 B;  2CV5 B;  3MNN A;  5B40 A;  3AZL C;  2NQB C;  1P3B A;  5B31 A;  5B0Z D;  1P3B D;  5B31 D;  1TZY D;  5B0Z B;  3AFA D;  3MGP A;  5B31 B;  3MGP D;  1TZY B;  3LZ0 A;  3AFA B;  3LZ0 D;  1P3F A;  5CPI D;  3W99 B;  3AZE B;  3LZ0 B;  1P3F D;  1KX5 D;  1B6W A;  3X1S B;  5CPI B;  1H3O A;  1P3F B;  1KX5 B;  4WZS B;  3WTP C;  5AV5 A;  3AN2 A;  5AV5 D;  3AN2 D;  5AV5 B;  3AN2 B;  4CSR A;  3B0D B;  3LJA B;  1HQ3 A;  3AZF A;  4ZUX A;  3REI A;  4M6B A;  3X1T C;  4ZUX D;  3REI D;  3AZG A;  4KUD C;  1AOI D;  4YM6 C;  5B33 C;  4ZUX B;  4Z2M H;  3AZG D;  1WWI A;  1P3P B;  3MGQ A;  3AV2 C;  1AOI B;  3AZG B;  3MGQ D;  1U35 C;  2L5A A;  5CP6 C;  3AV1 B;  5E5A A;  1BFM A;  3B6G D;  2PYO B;  5BNX A;  1EQZ C;  3MVD A;  3B6F A;  3MVD D;  3B6G B;  3B6F D;  4H9S A;  4KGC C;  4NE6 A;  5BNX B;  3MVD B;  5AV8 B;  1S32 A;  2NZD A;  1S32 D;  3W97 A;  3REK C;  3TU4 C;  3VH5 A;  4WU8 C;  2NZD D;  5DNN A;  5DNN D;  5CPJ C;  4J8X B;  4J8U B;  5DNN B;  5B2J C;  3WAA C;  4WNN B;  3MNN C;  3WKJ A;  4EO5 B;  5F99 A;  5B40 C;  3WKJ D;  2YFW A;  3WKJ B;  5BS7 C;  3AZK C;  1P3I C;  3O62 B;  3KXB B;  2YFW B;  4JJN B;  3MGR B;  3AZL A;  2NQB A;  3AZL D;  3W96 C;  2NQB D;  3KWQ A;  4HGA C;  3AZJ C;  4H9Q A;  5JA4 A;  5B32 G;  4Z5T C;  1BH9 A;  4H9Q B;  1BH9 B;  1KX3 B;  4QLC C;  1HQ3 C;  3AZF C;  1WWS A;  5AV9 C;  3WTP A;  5AY8 C;  3WTP D;  4J8V A;  4J8V D;  4E45 A;  3WTP B;  4UUZ A;  2F8N H;  5E5A C;  3X1T A;  3X1T D;  1F66 C;  3V9R A;  5B0Y C;  3C1C C;  2F8N A;  5KDM B;  2F8N D;  1BH8 A;  5B33 A;  4YM6 A;  4KUD D;  3X1T B;  5B33 D;  4YM6 D;  3AZH C;  3V9R B;  2LY8 A;  3AV2 D;  4KUD B;  1U35 A;  1P3A C;  5B33 B;  4YM6 B;  3MGS C;  1U35 D;  3REH C;  3AV2 B;  5CP6 D;  3W97 C;  3UT9 C;  1EQZ A;  5CP6 B;  1EQZ D;  4LD9 B;  5B2I B;  4KGC A;  1EQZ B;  1HTA A;  4KGC D;  3LZ1 C;  3LEL B;  3TU4 A;  4KGC B;  1KX4 A;  3TU4 D;  3REK D;  5F99 C;  3TU4 B;  3REK B;  3VH6 T;  4WU8 B;  5GT0 A;  2BYM B;  5CPJ A;  3NQU A;  5CPJ D;  3WAA A;  5B2J D;  3NQJ B;  3WAA D;  5JRG C;  4H9P A;  1M1A A;  5B2J B;  3MNN D;  3WAA B;  5B40 D;  3KWQ C;  3MNN B;  5BS7 A;  5B40 B;  3AZK A;  1P3I A;  5B1M C;  1P3B B;  3AZK D;  1P3I D;  4XUJ C;  3MGP B;  1P34 A;  5DNM A;  3AYW A;  1M18 C;  3W96 A;  3W96 D;  3AZJ A;  3AZI C;  1F1E A;  3AZJ D;  3W96 B;  4R8P C;  4Z5T A;  4J8V C;  1H3O B;  4Z5T D;  2CWE A;  4Z5T B;  1KU5 A;  4QLC A;  1ULY A;  4QLC D;  1HQ3 D;  3AZF D;  5AV9 A;  5CPK C;  4CSR B;  5AY8 A;  5AV9 D;  5AY8 D;  4QLC B;  1HQ3 B;  3AZF B;  3REI B;  5AV9 B;  5AY8 B;  2FJ7 C;  2HUE C;  3MGQ B;  5E5A D;  1F66 A;  5B0Y A;  2IO5 B;  3C1C A;  5CHL B;  1F66 D;  5B0Y D;  3C1C D;  3X1V A;  2RVQ C;  5E5A B;  5AVB C;  3AZH A;  3AZH D;  1P3A A;  3B6F B;  3MGS A;  1N1J A;  1P3A D;  1P3G A;  2YFV A;  3MGS D;  3REH A;  3REH D;  1KX4 C;  3KSY A;  3W97 D;  3UT9 A;  1JFI A;  3UT9 D;  1S32 B;  2NZD B;  4DRB A;  4G92 C;  3W97 B;  5GT0 C;  3UT9 B;  3R45 A;  3LZ1 A;  4J8W C;  3LZ1 D;  1M1A C;  3R45 B;  3C1B C;  5FUG A;  5F99 D;  4XZQ C;  5FUG B;  5F99 B;  3WTP E;  3VH5 W;  1P3K C;  5JRG A;  5JRG D;  4G91 C;  1P34 C;  5DNM C;  3AYW C;  1M19 A;  5JRG B;  4Z66 C;  3KWQ D;  3AZL B;  2CV5 C;  2NQB B;  5B1M A;  5B1M D;  3KWQ B;  2HIO A;  4XUJ A;  3KUY A;  5B32 C;  4XUJ D;  5JA4 B;  1M18 A;  5B31 G;  1P3M C;  1M18 D;  4YS3 A;  3AZI A;  3AZI D;  5BNV A;  3UTB A;  4R8P A;  4E44 A;  3UTB D;  3B0B A;  4R8P D;  2BYK A;  3W99 C;  5BNV B;  1B67 A;  3UTA A;  4R8P B;  3X1S C;  2BYK B;  4J8V B;  5CPK A;  1Q9C A;  5CPK D;  4UUZ B;  3X1V C;  2ARO A;  4X23 A;  1P3O C;  3LJA C;  2F8N B;  5G49 A;  1BH8 B;  2FJ7 A;  1P3G C;  2FJ7 D;  1U35 B;  1P3P C;  2HUE B;  2RVQ D;  5AVB A;  4H9O A;  5AVB D;  3AV1 C;  5AV6 A;  4Z2M G;  5GT3 A;  4NE5 A;  2PYO C;  5AVB B;  1KX4 D;  1ID3 C;  4NE3 A;  5GSU C;  1KX4 B;  5AV8 C;  3B0C W;  5GT0 D;  4J8W A;  4G92 B;  4NFT A;  4J8W D;  5GT0 B;  3AZN A;  5CPJ B;  3W98 C;  3NQU B;  5B24 A;  3C1B A;  1M1A D;  3C1B D;  4J8X C;  4J8U C;  1M19 C;  4H9P B;  1M1A B;  4XZQ A;  4XZQ D;  1P3K A;  1P3L A;  2HIO C;  1P3K D;  2F8N K;  3KUY C;  3AZK B;  1P3I B;  1P34 D;  4H9R A;  5DNM D;  3AYW D;  4Z66 A;  3REL A;  3WA9 A;  4YS3 C;  3O62 C;  4Z66 D;  3WA9 D;  4G91 B;  1P34 B;  5DNM B;  2CV5 A;  5B1L C;  3AYW B;  4H9R B;  4JJN C;  3UTB C;  2CV5 D;  4HGA B;  3MGR C;  3AZJ B;  5B32 A;  5B32 D;  3UTA C;  5B0Z A;  3AZM C;  1P3M A;  5B32 B;  1P3M D;  1TZY A;  3AFA A;  1P3M B;  1ZLA C;  2JSS A;  4AWL C;  3W99 A;  3AZE A;  3W99 D;  2ARO C;  4X23 C;  3AZE D;  1KX3 C;  3X1S A;  5CPI A;  3X1S D;  1A7W A;  1KX5 A;  5C3I C;  5AVC C;  1R4V A;  1P3O A;  3LJA A;  3X1V D;  1P3O D;  3X1U C;  5B0Y B;  3LJA D;  3C1C B;  1F66 B;  5AV6 C;  3X1V B;  5GT3 C;  1P3O B;  3AZH B;  1P3G D;  1P3A B;  1P3P A;  2F8N G;  3MGS B;  1N1J B;  1P3G B;  1P3P D;  2YFV B;  1AOI A;  3REH B;  3AV1 A;  1JFI B;  3AV1 D;  2PYO A;  2PYO D;  3AZN C;  5GXQ C;  3B6G A;  5B24 C;  4LD9 C;  5BT1 C;  3LZ1 B;  5B2I C;  1ID3 A;  5GSU A;  4CAY A;  3A6N C;  1ID3 D;  5GSU D;  5AV8 A;  3LEL C;  5AV8 D;  4ZBJ C;  1ID3 B;  5GSU B;  4CAY B;  1P3L C;  3W98 A;  4H9N A;  3W98 D;  4J8X A;  4J8U A;  3W98 B;  3WA9 C;  4J8X D;  3REL C;  4H9N B;  4J8U D;  1M19 D;  4KHA A;  4WNN A;  3VH5 T;  3REJ C;  4WU9 C;  1M19 B;  4KHA B;  2HIO D;  3KUY D;  5B1M B;  5BO0 A;  5B0Z C;  1TAF A;  2HIO B;  4XUJ B;  5B31 C;  3O62 A;  3KXB A;  3KUY B;  1P3B C;  4YS3 D;  3O62 D;  1TZY C;  3KXB D;  5B1L A;  5BO0 B;  3AFA C;  1M18 B;  4JJN A;  1TAF B;  5B1L D;  3MGP C;  3MGR A;  4JJN D;  4YS3 B;  3AZI B;  3MGR D;  3AZE C;  5B1L B;  3LZ0 C;  3UTB B;  3UTA D;  3AZM A;  5CPI C;  1P3F C;  3AZM D;  1KX5 C;  3UTA B;  3AZM B;  1ZLA A;  1ZLA D;  5AV5 C;  3AN2 C;  3B0D C;  5CPK B;  2ARO D;  4X23 D;  1KX3 A;  1ZLA B;  1KX3 D;  4AWL B;  2ARO B;  5AVC A;  4X23 B;  5AVC D;  5G49 B;  4ZUX C;  3REI C;  5C3I B;  2FJ7 B;  5AVC B;  1AOI C;  3AZG C;  3X1U A;  3X1U D;  3MGQ C;  5AV6 D;  2IO5 C;  5KDM A;  5GT3 D;  3X1U B;  4H9O B;  3B6G C;  3VH6 A;  5AV6 B;  5GT3 B;  4KUD A;  3MVD C;  3B6F C; 
#chains in the Genus database with same CATH topology
 3AV2 A;  4H9S C;  3EPK A;  5CP6 A;  5GXQ A;  1S32 C;  2NZD C;  4LD9 A;  3AZN D;  5GXQ D;  3B0C T;  5B2I A;  5B24 D;  5BT1 D;  4J8W B;  4LD9 D;  3A6N A;  5B2I D;  4WJ3 C;  3AZN B;  5GXQ B;  5DNN C;  3A6N D;  5B24 B;  3LEL A;  3C1B B;  3LEL D;  3A6N B;  4WV4 B;  3VH6 W;  4EO5 C;  4XZQ B;  4ZBJ B;  1P3L D;  3REK A;  4WU8 A;  2BYM A;  4WU8 D;  3WKJ C;  3EPJ A;  1P3K B;  1P3L B;  3KXB C;  3REJ A;  3REL D;  4WU9 A;  3NQJ A;  3REJ D;  4WU9 D;  4DRA A;  3WA9 B;  4Z66 B;  5B2J A;  3REL B;  3REJ B;  4WU9 B;  2Y2N A;  2CV5 B;  3MNN A;  5B40 A;  3AZL C;  2NQB C;  1P3B A;  5B31 A;  5B0Z D;  1P3B D;  5B31 D;  1TZY D;  2Y2Q A;  5B0Z B;  3AFA D;  3MGP A;  5B31 B;  3MGP D;  1TZY B;  3LZ0 A;  3AFA B;  3LZ0 D;  1P3F A;  5CPI D;  3W99 B;  3AZE B;  3LZ0 B;  1P3F D;  1KX5 D;  1B6W A;  3X1S B;  5CPI B;  1H3O A;  1P3F B;  1KX5 B;  4WZS B;  3WTP C;  5AV5 A;  3AN2 A;  5AV5 D;  3AN2 D;  2XD5 A;  5AV5 B;  3AN2 B;  2RIQ A;  4CSR A;  3B0D B;  3LJA B;  4DQY B;  1HQ3 A;  3AZF A;  4ZUX A;  3REI A;  4M6B A;  3X1T C;  4ZUX D;  3REI D;  2BG1 A;  3AZG A;  4KUD C;  1AOI D;  4YM6 C;  5B33 C;  4ZUX B;  4Z2M H;  3AZG D;  1WWI A;  1P3P B;  3MGQ A;  3AV2 C;  1AOI B;  3AZG B;  3MGQ D;  1U35 C;  2L5A A;  5CP6 C;  3AV1 B;  5E5A A;  1BFM A;  3B6G D;  2G5H C;  2PYO B;  5BNX A;  1EQZ C;  3MVD A;  3B6F A;  3MVD D;  3B6G B;  3B6F D;  4H9S A;  4KGC C;  4NE6 A;  5BNX B;  3MVD B;  2ZM5 A;  5AV8 B;  1S32 A;  3KFU G;  2NZD A;  1S32 D;  3W97 A;  3REK C;  3TU4 C;  3VH5 A;  4WU8 C;  2NZD D;  2J8P A;  5DNN A;  5DNN D;  5CPJ C;  4J8X B;  4J8U B;  5DNN B;  5B2J C;  3WAA C;  4WNN B;  3MNN C;  3WKJ A;  4EO5 B;  5F99 A;  5B40 C;  3WKJ D;  2YFW A;  3WKJ B;  5BS7 C;  3AZK C;  1P3I C;  3O62 B;  3KXB B;  2YFW B;  4JJN B;  3F6T A;  3MGR B;  3AZL A;  2NQB A;  3AZL D;  3W96 C;  2NQB D;  3KWQ A;  4HGA C;  3AZJ C;  4H9Q A;  5JA4 A;  5B32 G;  4Z5T C;  1BH9 A;  4H9Q B;  2Y2L A;  1BH9 B;  1KX3 B;  4QLC C;  1HQ3 C;  3AZF C;  1WWS A;  5AV9 C;  3WTP A;  5AY8 C;  3WTP D;  4J8V A;  4J8V D;  4E45 A;  3WTP B;  2ZY4 A;  2ZY2 A;  4UUZ A;  2F8N H;  5E5A C;  3X1T A;  3X1T D;  1F66 C;  3V9R A;  5B0Y C;  3C1C C;  2F8N A;  5KDM B;  2F8N D;  1BH8 A;  5B33 A;  4YM6 A;  4KUD D;  3X1T B;  5B33 D;  4YM6 D;  3AZH C;  1W2E A;  3V9R B;  2LY8 A;  3AV2 D;  4KUD B;  1U35 A;  1P3A C;  2JCH A;  5B33 B;  4YM6 B;  3MGS C;  1U35 D;  3REH C;  3AV2 B;  5CP6 D;  3W97 C;  3EPL A;  2F2A C;  3UT9 C;  1EQZ A;  5CP6 B;  1EQZ D;  4LD9 B;  2W8S A;  5B2I B;  4KGC A;  1EQZ B;  1HTA A;  4KGC D;  3LZ1 C;  3LEL B;  3TU4 A;  4KGC B;  1KX4 A;  3TU4 D;  3REK D;  5F99 C;  3TU4 B;  3REK B;  3VH6 T;  4WU8 B;  5GT0 A;  2BYM B;  5CPJ A;  3NQU A;  5CPJ D;  3WAA A;  5B2J D;  3NQJ B;  3WAA D;  5JRG C;  4H9P A;  1M1A A;  5B2J B;  3MNN D;  3WAA B;  5B40 D;  3AL0 C;  3KWQ C;  3MNN B;  5BS7 A;  5B40 B;  3AZK A;  1P3I A;  5B1M C;  1P3B B;  3AZK D;  1P3I D;  4XUJ C;  3MGP B;  1P34 A;  5DNM A;  3AYW A;  1M18 C;  3W96 A;  3W96 D;  3AZJ A;  3AZI C;  1F1E A;  3AZJ D;  3W96 B;  4R8P C;  4Z5T A;  4J8V C;  1H3O B;  4Z5T D;  2CWE A;  4Z5T B;  1KU5 A;  4QLC A;  1ULY A;  4QLC D;  1HQ3 D;  3AZF D;  5AV9 A;  5CPK C;  4CSR B;  5AY8 A;  5AV9 D;  5AY8 D;  4QLC B;  1HQ3 B;  3AZF B;  3REI B;  5AV9 B;  5AY8 B;  2FJ7 C;  2HUE C;  2Y2K A;  3MGQ B;  5E5A D;  1F66 A;  5B0Y A;  2IO5 B;  2Y2O A;  5CHL B;  3C1C A;  1F66 D;  5B0Y D;  3C1C D;  3X1V A;  2RVQ C;  5E5A B;  5AVB C;  3AZH A;  2FFF B;  3AZH D;  1P3A A;  3B6F B;  3MGS A;  1N1J A;  1P3A D;  1P3G A;  2YFV A;  2DF4 C;  3MGS D;  3REH A;  3REH D;  1KX4 C;  3KSY A;  3W97 D;  3UT9 A;  3H0L C;  1JFI A;  3UT9 D;  1S32 B;  2NZD B;  4DRB A;  4G92 C;  3W97 B;  5GT0 C;  3UT9 B;  3R45 A;  3LZ1 A;  4J8W C;  3LZ1 D;  1M1A C;  3R45 B;  3C1B C;  5FUG A;  5F99 D;  4XZQ C;  5FUG B;  5F99 B;  3WTP E;  3VH5 W;  1P3K C;  5JRG A;  2XD1 A;  5JRG D;  4G91 C;  1P34 C;  5DNM C;  3AYW C;  1M19 A;  5JRG B;  4Z66 C;  3KWQ D;  3AZL B;  2CV5 C;  2NQB B;  5B1M A;  5B1M D;  2Y2H A;  3KWQ B;  2HIO A;  4XUJ A;  3KUY A;  5B32 C;  4XUJ D;  3P5J B;  1Z2C B;  3H0R C;  5JA4 B;  1M18 A;  5B31 G;  1P3M C;  1M18 D;  4YS3 A;  3AZI A;  3AZI D;  5BNV A;  3UTB A;  4R8P A;  4E44 A;  3UTB D;  3B0B A;  4R8P D;  2BYK A;  3W99 C;  5BNV B;  1B67 A;  3UTA A;  4R8P B;  3X1S C;  2BYK B;  4J8V B;  5CPK A;  1Q9C A;  5CPK D;  4UUZ B;  3X1V C;  2ARO A;  4X23 A;  1P3O C;  3LJA C;  2F8N B;  5G49 A;  1BH8 B;  2FJ7 A;  1P3G C;  2FJ7 D;  1U35 B;  1P3P C;  2HUE B;  2RVQ D;  5AVB A;  4H9O A;  5AVB D;  3AV1 C;  5AV6 A;  4Z2M G;  5GT3 A;  4NE5 A;  2PYO C;  5AVB B;  1KX4 D;  1ID3 C;  2Y2G A;  4NE3 A;  5GSU C;  1KX4 B;  5AV8 C;  3B0C W;  5GT0 D;  4J8W A;  4G92 B;  2DQN C;  4NFT A;  4J8W D;  5GT0 B;  3AZN A;  5CPJ B;  3W98 C;  3NQU B;  5B24 A;  3C1B A;  1M1A D;  3C1B D;  2ZY5 A;  4J8X C;  4J8U C;  1M19 C;  4H9P B;  1M1A B;  4XZQ A;  4XZQ D;  3EG5 B;  1P3K A;  1P3L A;  2HIO C;  1P3K D;  2F8N K;  3KUY C;  3AZK B;  1P3I B;  1P34 D;  4H9R A;  5DNM D;  3AYW D;  4Z66 A;  3REL A;  3WA9 A;  4YS3 C;  3O62 C;  4UPK A;  4Z66 D;  3WA9 D;  4G91 B;  1P34 B;  5DNM B;  2CV5 A;  5B1L C;  3AYW B;  4H9R B;  4JJN C;  3UTB C;  2CV5 D;  4HGA B;  3MGR C;  3AZJ B;  5B32 A;  2ZY3 A;  5B32 D;  3UTA C;  5B0Z A;  3AZM C;  1P3M A;  5B32 B;  1P3M D;  1TZY A;  3AFA A;  1T3U A;  1P3M B;  1ZLA C;  2JSS A;  4AWL C;  3W99 A;  3AZE A;  3W99 D;  2ARO C;  4X23 C;  3AZE D;  1KX3 C;  3X1S A;  5CPI A;  3X1S D;  1A7W A;  1KX5 A;  5C3I C;  5AVC C;  1R4V A;  1P3O A;  3LJA A;  3X1V D;  1P3O D;  3X1U C;  5B0Y B;  3LJA D;  3C1C B;  1F66 B;  5AV6 C;  3X1V B;  5GT3 C;  1P3O B;  3AZH B;  1P3G D;  1P3A B;  1P3P A;  2F8N G;  3MGS B;  1N1J B;  1P3G B;  1P3P D;  2YFV B;  1AOI A;  3REH B;  2Y2J A;  3AV1 A;  3H0M C;  1JFI B;  2Y2P A;  3AV1 D;  3A1I A;  3FDD A;  2PYO A;  2PYO D;  3AZN C;  5GXQ C;  3B6G A;  5B24 C;  4LD9 C;  5BT1 C;  3LZ1 B;  5B2I C;  1ID3 A;  5GSU A;  2G5I C;  4CAY A;  3A6N C;  1ID3 D;  5GSU D;  5AV8 A;  3LEL C;  3EPH A;  5AV8 D;  4ZBJ C;  1ID3 B;  5GSU B;  4CAY B;  3IP4 C;  1P3L C;  3W98 A;  4H9N A;  3W98 D;  4J8X A;  4J8U A;  3W98 B;  2Y2M A;  4J8X D;  3REL C;  4H9N B;  4J8U D;  1M19 D;  3WA9 C;  4KHA A;  4WNN A;  3VH5 T;  3REJ C;  4WU9 C;  2UWX A;  1M19 B;  4KHA B;  2HIO D;  3KUY D;  5B1M B;  2Y2I A;  5BO0 A;  5B0Z C;  1TAF A;  2HIO B;  4XUJ B;  5B31 C;  3O62 A;  3KXB A;  3KUY B;  1P3B C;  4YS3 D;  3O62 D;  1TZY C;  3KXB D;  5B1L A;  5BO0 B;  3AFA C;  1M18 B;  4JJN A;  1TAF B;  5B1L D;  3MGP C;  3MGR A;  4JJN D;  4YS3 B;  3AZI B;  3MGR D;  1PZR A;  3AZE C;  5B1L B;  3LZ0 C;  3UTB B;  3UTA D;  3AZM A;  5CPI C;  1P3F C;  3AZM D;  3A1K A;  1KX5 C;  3UTA B;  2JE5 A;  3AZM B;  1ZLA A;  1ZLA D;  5AV5 C;  3AN2 C;  3B0D C;  5CPK B;  2ARO D;  4X23 D;  1KX3 A;  1ZLA B;  1KX3 D;  4AWL B;  2ARO B;  5AVC A;  4X23 B;  5AVC D;  5G49 B;  4ZUX C;  3REI C;  5C3I B;  2FJ7 B;  5AVC B;  1AOI C;  3AZG C;  3X1U A;  2VQR A;  3X1U D;  3MGQ C;  5AV6 D;  2IO5 C;  5KDM A;  5GT3 D;  3X1U B;  4H9O B;  3B6G C;  3VH6 A;  5AV6 B;  5GT3 B;  4KUD A;  3MVD C;  3B6F C; 
#chains in the Genus database with same CATH homology
 3AV2 A;  4H9S C;  3EPK A;  5CP6 A;  5GXQ A;  1S32 C;  2NZD C;  4LD9 A;  3AZN D;  5GXQ D;  3B0C T;  5B2I A;  5B24 D;  5BT1 D;  4J8W B;  4LD9 D;  3A6N A;  5B2I D;  4WJ3 C;  3AZN B;  5GXQ B;  5DNN C;  3A6N D;  5B24 B;  3LEL A;  3C1B B;  3LEL D;  3A6N B;  4WV4 B;  3VH6 W;  4EO5 C;  4XZQ B;  4ZBJ B;  1P3L D;  3REK A;  4WU8 A;  2BYM A;  4WU8 D;  3WKJ C;  3EPJ A;  1P3K B;  1P3L B;  3KXB C;  3REJ A;  3REL D;  4WU9 A;  3NQJ A;  3REJ D;  4WU9 D;  4DRA A;  3WA9 B;  4Z66 B;  5B2J A;  3REL B;  3REJ B;  4WU9 B;  2Y2N A;  2CV5 B;  3MNN A;  5B40 A;  3AZL C;  2NQB C;  1P3B A;  5B31 A;  5B0Z D;  1P3B D;  5B31 D;  1TZY D;  2Y2Q A;  5B0Z B;  3AFA D;  3MGP A;  5B31 B;  3MGP D;  1TZY B;  3LZ0 A;  3AFA B;  3LZ0 D;  1P3F A;  5CPI D;  3W99 B;  3AZE B;  3LZ0 B;  1P3F D;  1KX5 D;  1B6W A;  3X1S B;  5CPI B;  1H3O A;  1P3F B;  1KX5 B;  4WZS B;  3WTP C;  5AV5 A;  3AN2 A;  5AV5 D;  3AN2 D;  2XD5 A;  5AV5 B;  3AN2 B;  2RIQ A;  4CSR A;  3B0D B;  3LJA B;  4DQY B;  1HQ3 A;  3AZF A;  4ZUX A;  3REI A;  4M6B A;  3X1T C;  4ZUX D;  3REI D;  2BG1 A;  3AZG A;  4KUD C;  1AOI D;  4YM6 C;  5B33 C;  4ZUX B;  4Z2M H;  3AZG D;  1WWI A;  1P3P B;  3MGQ A;  3AV2 C;  1AOI B;  3AZG B;  3MGQ D;  1U35 C;  2L5A A;  5CP6 C;  3AV1 B;  5E5A A;  1BFM A;  3B6G D;  2G5H C;  2PYO B;  5BNX A;  1EQZ C;  3MVD A;  3B6F A;  3MVD D;  3B6G B;  3B6F D;  4H9S A;  4KGC C;  4NE6 A;  5BNX B;  3MVD B;  2ZM5 A;  5AV8 B;  1S32 A;  3KFU G;  2NZD A;  1S32 D;  3W97 A;  3REK C;  3TU4 C;  3VH5 A;  4WU8 C;  2NZD D;  2J8P A;  5DNN A;  5DNN D;  5CPJ C;  4J8X B;  4J8U B;  5DNN B;  5B2J C;  3WAA C;  4WNN B;  3MNN C;  3WKJ A;  4EO5 B;  5F99 A;  5B40 C;  3WKJ D;  2YFW A;  3WKJ B;  5BS7 C;  3AZK C;  1P3I C;  3O62 B;  3KXB B;  2YFW B;  4JJN B;  3F6T A;  3MGR B;  3AZL A;  2NQB A;  3AZL D;  3W96 C;  2NQB D;  3KWQ A;  4HGA C;  3AZJ C;  4H9Q A;  5JA4 A;  5B32 G;  4Z5T C;  1BH9 A;  4H9Q B;  2Y2L A;  1BH9 B;  1KX3 B;  4QLC C;  1HQ3 C;  3AZF C;  1WWS A;  5AV9 C;  3WTP A;  5AY8 C;  3WTP D;  4J8V A;  4J8V D;  4E45 A;  3WTP B;  2ZY4 A;  2ZY2 A;  4UUZ A;  2F8N H;  5E5A C;  3X1T A;  3X1T D;  1F66 C;  3V9R A;  5B0Y C;  3C1C C;  2F8N A;  5KDM B;  2F8N D;  1BH8 A;  5B33 A;  4YM6 A;  4KUD D;  3X1T B;  5B33 D;  4YM6 D;  3AZH C;  1W2E A;  3V9R B;  2LY8 A;  3AV2 D;  4KUD B;  1U35 A;  1P3A C;  2JCH A;  5B33 B;  4YM6 B;  3MGS C;  1U35 D;  3REH C;  3AV2 B;  5CP6 D;  3W97 C;  3EPL A;  2F2A C;  3UT9 C;  1EQZ A;  5CP6 B;  1EQZ D;  4LD9 B;  2W8S A;  5B2I B;  4KGC A;  1EQZ B;  1HTA A;  4KGC D;  3LZ1 C;  3LEL B;  3TU4 A;  4KGC B;  1KX4 A;  3TU4 D;  3REK D;  5F99 C;  3TU4 B;  3REK B;  3VH6 T;  4WU8 B;  5GT0 A;  2BYM B;  5CPJ A;  3NQU A;  5CPJ D;  3WAA A;  5B2J D;  3NQJ B;  3WAA D;  5JRG C;  4H9P A;  1M1A A;  5B2J B;  3MNN D;  3WAA B;  5B40 D;  3AL0 C;  3KWQ C;  3MNN B;  5BS7 A;  5B40 B;  3AZK A;  1P3I A;  5B1M C;  1P3B B;  3AZK D;  1P3I D;  4XUJ C;  3MGP B;  1P34 A;  5DNM A;  3AYW A;  1M18 C;  3W96 A;  3W96 D;  3AZJ A;  3AZI C;  1F1E A;  3AZJ D;  3W96 B;  4R8P C;  4Z5T A;  4J8V C;  1H3O B;  4Z5T D;  2CWE A;  4Z5T B;  1KU5 A;  4QLC A;  1ULY A;  4QLC D;  1HQ3 D;  3AZF D;  5AV9 A;  5CPK C;  4CSR B;  5AY8 A;  5AV9 D;  5AY8 D;  4QLC B;  1HQ3 B;  3AZF B;  3REI B;  5AV9 B;  5AY8 B;  2FJ7 C;  2HUE C;  2Y2K A;  3MGQ B;  5E5A D;  1F66 A;  5B0Y A;  2IO5 B;  2Y2O A;  5CHL B;  3C1C A;  1F66 D;  5B0Y D;  3C1C D;  3X1V A;  2RVQ C;  5E5A B;  5AVB C;  3AZH A;  2FFF B;  3AZH D;  1P3A A;  3B6F B;  3MGS A;  1N1J A;  1P3A D;  1P3G A;  2YFV A;  2DF4 C;  3MGS D;  3REH A;  3REH D;  1KX4 C;  3KSY A;  3W97 D;  3UT9 A;  3H0L C;  1JFI A;  3UT9 D;  1S32 B;  2NZD B;  4DRB A;  4G92 C;  3W97 B;  5GT0 C;  3UT9 B;  3R45 A;  3LZ1 A;  4J8W C;  3LZ1 D;  1M1A C;  3R45 B;  3C1B C;  5FUG A;  5F99 D;  4XZQ C;  5FUG B;  5F99 B;  3WTP E;  3VH5 W;  1P3K C;  5JRG A;  2XD1 A;  5JRG D;  4G91 C;  1P34 C;  5DNM C;  3AYW C;  1M19 A;  5JRG B;  4Z66 C;  3KWQ D;  3AZL B;  2CV5 C;  2NQB B;  5B1M A;  5B1M D;  2Y2H A;  3KWQ B;  2HIO A;  4XUJ A;  3KUY A;  5B32 C;  4XUJ D;  3P5J B;  1Z2C B;  3H0R C;  5JA4 B;  1M18 A;  5B31 G;  1P3M C;  1M18 D;  4YS3 A;  3AZI A;  3AZI D;  5BNV A;  3UTB A;  4R8P A;  4E44 A;  3UTB D;  3B0B A;  4R8P D;  2BYK A;  3W99 C;  5BNV B;  1B67 A;  3UTA A;  4R8P B;  3X1S C;  2BYK B;  4J8V B;  5CPK A;  1Q9C A;  5CPK D;  4UUZ B;  3X1V C;  2ARO A;  4X23 A;  1P3O C;  3LJA C;  2F8N B;  5G49 A;  1BH8 B;  2FJ7 A;  1P3G C;  2FJ7 D;  1U35 B;  1P3P C;  2HUE B;  2RVQ D;  5AVB A;  4H9O A;  5AVB D;  3AV1 C;  5AV6 A;  4Z2M G;  5GT3 A;  4NE5 A;  2PYO C;  5AVB B;  1KX4 D;  1ID3 C;  2Y2G A;  4NE3 A;  5GSU C;  1KX4 B;  5AV8 C;  3B0C W;  5GT0 D;  4J8W A;  4G92 B;  2DQN C;  4NFT A;  4J8W D;  5GT0 B;  3AZN A;  5CPJ B;  3W98 C;  3NQU B;  5B24 A;  3C1B A;  1M1A D;  3C1B D;  2ZY5 A;  4J8X C;  4J8U C;  1M19 C;  4H9P B;  1M1A B;  4XZQ A;  4XZQ D;  3EG5 B;  1P3K A;  1P3L A;  2HIO C;  1P3K D;  2F8N K;  3KUY C;  3AZK B;  1P3I B;  1P34 D;  4H9R A;  5DNM D;  3AYW D;  4Z66 A;  3REL A;  3WA9 A;  4YS3 C;  3O62 C;  4UPK A;  4Z66 D;  3WA9 D;  4G91 B;  1P34 B;  5DNM B;  2CV5 A;  5B1L C;  3AYW B;  4H9R B;  4JJN C;  3UTB C;  2CV5 D;  4HGA B;  3MGR C;  3AZJ B;  5B32 A;  2ZY3 A;  5B32 D;  3UTA C;  5B0Z A;  3AZM C;  1P3M A;  5B32 B;  1P3M D;  1TZY A;  3AFA A;  1T3U A;  1P3M B;  1ZLA C;  2JSS A;  4AWL C;  3W99 A;  3AZE A;  3W99 D;  2ARO C;  4X23 C;  3AZE D;  1KX3 C;  3X1S A;  5CPI A;  3X1S D;  1A7W A;  1KX5 A;  5C3I C;  5AVC C;  1R4V A;  1P3O A;  3LJA A;  3X1V D;  1P3O D;  3X1U C;  5B0Y B;  3LJA D;  3C1C B;  1F66 B;  5AV6 C;  3X1V B;  5GT3 C;  1P3O B;  3AZH B;  1P3G D;  1P3A B;  1P3P A;  2F8N G;  3MGS B;  1N1J B;  1P3G B;  1P3P D;  2YFV B;  1AOI A;  3REH B;  2Y2J A;  3AV1 A;  3H0M C;  1JFI B;  2Y2P A;  3AV1 D;  3A1I A;  3FDD A;  2PYO A;  2PYO D;  3AZN C;  5GXQ C;  3B6G A;  5B24 C;  4LD9 C;  5BT1 C;  3LZ1 B;  5B2I C;  1ID3 A;  5GSU A;  2G5I C;  4CAY A;  3A6N C;  1ID3 D;  5GSU D;  5AV8 A;  3LEL C;  3EPH A;  5AV8 D;  4ZBJ C;  1ID3 B;  5GSU B;  4CAY B;  3IP4 C;  1P3L C;  3W98 A;  4H9N A;  3W98 D;  4J8X A;  4J8U A;  3W98 B;  2Y2M A;  4J8X D;  3REL C;  4H9N B;  4J8U D;  1M19 D;  3WA9 C;  4KHA A;  4WNN A;  3VH5 T;  3REJ C;  4WU9 C;  2UWX A;  1M19 B;  4KHA B;  2HIO D;  3KUY D;  5B1M B;  2Y2I A;  5BO0 A;  5B0Z C;  1TAF A;  2HIO B;  4XUJ B;  5B31 C;  3O62 A;  3KXB A;  3KUY B;  1P3B C;  4YS3 D;  3O62 D;  1TZY C;  3KXB D;  5B1L A;  5BO0 B;  3AFA C;  1M18 B;  4JJN A;  1TAF B;  5B1L D;  3MGP C;  3MGR A;  4JJN D;  4YS3 B;  3AZI B;  3MGR D;  1PZR A;  3AZE C;  5B1L B;  3LZ0 C;  3UTB B;  3UTA D;  3AZM A;  5CPI C;  1P3F C;  3AZM D;  3A1K A;  1KX5 C;  3UTA B;  2JE5 A;  3AZM B;  1ZLA A;  1ZLA D;  5AV5 C;  3AN2 C;  3B0D C;  5CPK B;  2ARO D;  4X23 D;  1KX3 A;  1ZLA B;  1KX3 D;  4AWL B;  2ARO B;  5AVC A;  4X23 B;  5AVC D;  5G49 B;  4ZUX C;  3REI C;  5C3I B;  2FJ7 B;  5AVC B;  1AOI C;  3AZG C;  3X1U A;  2VQR A;  3X1U D;  3MGQ C;  5AV6 D;  2IO5 C;  5KDM A;  5GT3 D;  3X1U B;  4H9O B;  3B6G C;  3VH6 A;  5AV6 B;  5GT3 B;  4KUD A;  3MVD C;  3B6F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...