4ZUXC

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 29
structure length 103
sequence length 103
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxC00
5AV9A 4J8XB 1M1AC 1F66A 3AV2A 2LY8A 5GSUB 3RELA 3W98C 5B2JC 5GT0D 3X1VC 4KGCA 3AFAB 3C1CD 5BNVA 5DNMC 3LZ1B 3B6GD 5B24D 5B32G 3WTPC 4QLCB 5B31B 3C1BC 3AZKD 5CPKB 1HQ3D 4X23A 3MVDD 1KX5C 1JFIB 3REJB 4R8PB 4WNNA 4YM6A 3MNND 1P34D 5B33B 4ZBJC 3REKA 3AN2C 4JJND 1EQZA 3AZMC 4Z66C 3MGQB 5KDMB 4WU9C 3REHB 1Q9CA 3UT9B 5B0ZC 1P3FC 4H9NB 3TU4B 4J8XD 1B67A 2HUEC 3VH5W 2PYOA 1TAFB 4ZUXD 3UTAD 4J8VC 2NZDA 5GSUD 3X1SD 4H9RA 3REID 1P3PB 2AROB 5AV9B 3UTBC 1H3OA 1M19D 3X1TB 1F66B 3LJAB 3R45A 5AY8C 3AV2B 3RELB 4QLCD 5B32A 5B31D 3LZ0C 5CPKD 1P3MC 4KGCB 3AZEB 5BNVB 5CPID 4XZQA 3KUYC 5CPJA 3KWQA 1WWIA 4YS3D 3KXBC 4J8UC 3AZHD 1ZLAA 1KU5A 4X23B 3AZJC 1P3BB 5AV8A 5AVCA 4AWLC 1P3IA 3REHD 4WNNB 4YM6B 3WAAC 3REKB 3B6FB 1EQZB 3AZIC 4LD9D 5GT0A 4G91B 1P3KC 5F99D 3B6GA 5B24A 5B31G 3X1TD 2PYOB 3LJAD 2NZDB 3AZKA 5E5AC 1AOID 1HQ3A 4H9RB 3MVDA 3AZED 1H3OB 3W96B 3WKJC 3W97B 3MNNA 5AV6C 3R45B 1P34A 5B32B 4JJNA 1P3LD 1KX3D 3VH5A 2BYMA 4X23D 4XZQB 1P3BD 3X1UD 5CPJB 3KWQB 1ID3C 2IO5B 2FJ7D 3B0CW 4NE3A 5CP6B 4XUJB 3WA9D 3REKD 1ZLAB 5B1MC 3B6FD 2JSSA 4J8XA 5AV8B 4ZUXA 5AVCB 3UTAA 4EO5B 1P3IB 3X1SA 5GSUA 2CWEA 3REIA 4J8WC 1M19A 3AZNC 3B0DC 4QLCA 5GT0B 5AV5B 1M18D 5CPIA 2CV5D 3AZFC 5B24B 3B6GB 3W96D 2RVQD 4G92B 1KX4C 3W97D 4YS3A 3AZKB 3AV1D 3AZHA 3AZLA 1HQ3B 3MVDB 4WU8C 2NQBD 3AYWD 3MGSC 3REHA 3MNNB 5B0YC 1P34B 5FUGB 4CAYA 4KUDD 1P3AC 4XUJD 4UUZB 5CP6D 4JJNB 2F8ND 1ZLAD 2BYMB 3LELC 1TAFA 5JA4A 5AV8D 5AVCD 4LD9A 2YFWA 2F8NK 3VH6W 5B2IC 3C1CC 5AVBA 3MGPD 5F99A 3X1TA 3UTAB 4ZUXB 3LJAA 3X1SB 3B0BA 3O62A 1AOIA 3REIB 3MGRC 5AV5D 4H9OA 3AZEA 5GT3C 5JRGD 1M19B 4Z5TD 2HIOC 1U35C 1P3LA 1KX3A 5CPIB 4CSRA 1P3BA 4H9SA 3X1UA 5GXQC 2FJ7A 2F8NG 4YS3B 1P3OB 3AZHB 3WA9A 3AZLB 1F1EA 3B6FA 1BFMA 4J8XC 4Z66B 1HTAA 4CAYB 3NQJA 3AFAC 4KHAA 3LZ1C 1M1AD 4J8VB 5JA4B 4QLCC 4LD9B 2YFWB 5B31C 5B2JD 3KSYA 5CPKC 3X1VD 1M18A 5AVBB 1R4VA 2CV5A 5F99B 5DNMD 3REJC 4R8PC 3W96A 3W97A 3W99A 3AV1A 5B33C 3C1BD 1AOIB 3O62B 4H9OB 1KX5D 2NQBA 3MGQC 3AYWA 5DNNC 3VH6A 3REHC 3UT9C 4KUDA 1P3OD 4XUJA 5BS7A 5CP6A 1P3LB 1KX3B 2F8NA 3AZLD 3TU4C 3AZMD 4CSRB 4Z66D 3X1UB 4WU9D 1S32A 2FJ7B 5B0ZD 1P3FD 1P3PC 3WA9B 4M6BA 5B1LA 2AROC 5AV9C 5C3IB 3MGPA 3V9RA 1F66C 4H9PA 3AV2C 4J8VD 3RELC 5AV5A 5CHLB 3AZEC 3NQJB 4KGCC 4KHAB 5AVBD 5JRGA 3UTBD 4Z5TA 3A6NA 5AY8D 3AZGA 4Z2MH 3O62D 3LZ0D 1P3MD 1M18B 4X23C 2CV5B 1TZYA 3KUYD 5AV6B 4YM6C 3W99B 5FUGA 3AV1B 3KXBD 3REKC 4J8UD 4UUZA 3B6FC 1EQZC 4E44A 2NQBB 3AYWB 3AZJD 3WAAD 4KUDB 5B1MB 2F8NB 4G91C 1B6WA 1M1AA 2PYOC 3AZID 2NZDC 5B2JA 1S32B 3X1VA 2BYKB 5B1LB 3MGPB 4J8WB 3V9RB 5DNMA 1P3KD 5BT1C 3W96C 2RVQC 4H9PB 3C1BA 5B32C 5E5AD 1KX5A 4XZQC 5JRGB 3AZFB 3KWQC 5CPJC 4Z5TB 2IO5C 3A6NB 3WKJD 5AV6D 3W99D 1N1JA 1P3OA 5CP6C 3AZGB 1P3GB 1ZLAC 3AZMA 4Z66A 5AV8C 1TZYB 4DRAA 5AVCC 4WU9A 2YFVA 4EO5C 1P3IC 1ID3D 1BH9B 5B0YB 5B0ZA 1P3FA 4HGAC 5B1MD 5B40B 4J8VA 5GT0C 1S32D 3WTPE 5B1LD 3UTBA 4J8WD 1M1AB 5B24C 3B6GC 4NFTA 5AY8A 4G92C 3W98B 3AZKC 3VH5T 5B2JB 3X1VB 3LZ0A 1HQ3C 1P3MA 3MGRB 3MVDC 1ULYA 4DRBA 3KUYA 5DNMB 3AZFD 3A6ND 3WTPB 3MNNC 1KX4D 1P34C 3KXBA 3C1BB 4J8UA 1P3GD 3AZGD 4JJNC 1KX5B 3AZJA 1TZYD 3MGSD 3WAAA 5B0YD 3NQUA 1N1JB 4ZBJB 3AN2B 3AZMB 5B40D 4ZUXC 3LELD 3UTAC 3AZIA 2YFVB 4WU9B 5GSUC 3X1SC 5B2ID 5B0ZB 1P3FB 3REIC 1P3KA 1M19C 2HUEB 3W98D 5E5AA 3MGRD 5CPIC 5GT3D 3UTBB 3WKJA 5AV6A 4WZSB 3WTPD 5BO0B 5AY8B 4YS3C 1P3OC 2HIOD 3AZHC 3AZLC 3LZ0B 1U35D 1P3MB 5DNNB 3KUYB 1ID3A 2F8NH 4WV4B 5GXQD 3KXBB 4J8UB 3AN2D 5B1MA 4E45A 3AZJB 4AWLB 4LD9C 3WAAB 3NQUB 2BYKA 5AVBC 3AFAD 3B0CT 4J8WA 5G49A 5F99C 3LZ1D 3AZNA 3X1TC 3LJAC 3AZIB 1AOIC 3O62C 4Z2MG 1P3KB 3AZFA 3REJD 4R8PD 1KX4A 5B33D 1P3GA 5E5AB 1P3LC 1KX3C 4WU8A 3MGQD 1P3BC 4H9SC 1BH8A 5DNND 3X1UC 3MGSA 3WKJB 1BH9A 2FJ7C 5B0YA 3UT9D 1P3AA 3WA9C 2L5AA 5C3IC 3TU4D 5B40A 3LELA 5BNXA 1ID3B 5B2IA 3C1CA 1P3PD 2AROD 5AV9D 4H9QA 1F66D 1WWSA 3AV2D 3W98A 3RELD 3MGRA 1M18C 4KGCD 3VH6T 2CV5C 5GT3A 5G49B 3AZNB 3B0DB 3WTPA 3W99C 3W97C 3AV1C 2HIOA 1U35A 2NQBC 3AYWC 5GXQA 4YM6D 1KX4B 4KUDC 5BS7C 4XUJC 3AN2A 1EQZD 4WU8B 1BH8B 3MGSB 1S32C 4NE5A 1P3AB 3AFAA 4HGAB 5B1LC 3MGPC 3LZ1A 3LELB 2PYOD 5BNXB 2NZDD 5B31A 5B2IB 5CPKA 4NE6A 5AV5C 3C1CB 5JRGC 1JFIA 4H9QB 3REJA 4Z5TC 5BT1D 4R8PA 3A6NC 3AZND 5BO0A 5B33A 5B32D 3AZGC 1P3GC 3MGQA 5KDMA 4XZQD 5GT3B 5DNNA 1TZYC 5CPJD 3KWQD 3UT9A 1A7WA 2HIOB 1U35B 4H9NA 3TU4A 4WU8D 5B40C 1P3ID 5GXQB 1P3PA 1P3AD 2AROA
chains in the Genus database with same CATH superfamily
5AV9A 4J8XB 1M1AC 1F66A 3AV2A 2LY8A 5GSUB 3RELA 3W98C 5B2JC 5GT0D 3X1VC 4KGCA 3AFAB 3C1CD 5BNVA 5DNMC 3LZ1B 3B6GD 5B24D 5B32G 3WTPC 2ZM5A 4QLCB 5B31B 3C1BC 3AZKD 5CPKB 1HQ3D 4X23A 3MVDD 1KX5C 1JFIB 3REJB 4R8PB 4WNNA 4YM6A 3MNND 1P34D 5B33B 4ZBJC 3REKA 3AN2C 4JJND 1EQZA 3AZMC 4Z66C 3MGQB 5KDMB 4WU9C 3REHB 1Q9CA 3UT9B 5B0ZC 1P3FC 4H9NB 3TU4B 4J8XD 1B67A 2HUEC 3VH5W 2PYOA 1TAFB 4ZUXD 3UTAD 4J8VC 2JCHA 2NZDA 5GSUD 3X1SD 4H9RA 3REID 1P3PB 2AROB 5AV9B 3UTBC 1H3OA 1M19D 3X1TB 1F66B 3LJAB 3R45A 5AY8C 3AV2B 3RELB 4QLCD 5B32A 5B31D 3LZ0C 5CPKD 1P3MC 4KGCB 3AZEB 5BNVB 5CPID 4XZQA 3KUYC 5CPJA 3KWQA 1WWIA 3KFUG 4YS3D 3KXBC 4J8UC 3AZHD 1ZLAA 1KU5A 4X23B 3AZJC 1P3BB 5AV8A 5AVCA 2Y2GA 4AWLC 1P3IA 1Z2CB 4WNNB 4YM6B 3REHD 3WAAC 3REKB 3B6FB 1EQZB 3A1KA 3EPJA 3AZIC 4LD9D 5GT0A 2ZY2A 2Y2NA 2J8PA 4G91B 1P3KC 5F99D 3B6GA 5B24A 5B31G 3X1TD 2PYOB 3LJAD 2NZDB 3AZKA 5E5AC 1AOID 1HQ3A 4H9RB 3MVDA 3AZED 1H3OB 3W96B 3WKJC 3W97B 3MNNA 5AV6C 3R45B 1P34A 5B32B 4JJNA 1P3LD 1KX3D 3VH5A 2BYMA 4X23D 4XZQB 1P3BD 3X1UD 5CPJB 3KWQB 1ID3C 2IO5B 2FJ7D 3B0CW 4NE3A 5CP6B 4XUJB 3WA9D 3REKD 1ZLAB 5B1MC 3B6FD 2JSSA 4J8XA 5AV8B 4ZUXA 5AVCB 3UTAA 4EO5B 1P3IB 3X1SA 5GSUA 2CWEA 3REIA 4J8WC 1M19A 3AZNC 3B0DC 2Y2OA 4QLCA 5GT0B 5AV5B 1M18D 5CPIA 2CV5D 3AZFC 5B24B 3B6GB 3W96D 2RVQD 4G92B 1KX4C 3W97D 4YS3A 3AZKB 3AV1D 3AZHA 3AZLA 1HQ3B 3MVDB 4WU8C 2NQBD 3AYWD 3MGSC 3REHA 3MNNB 5B0YC 1P34B 5FUGB 4CAYA 4KUDD 1P3AC 4XUJD 4UUZB 5CP6D 4JJNB 2F8ND 1ZLAD 2BYMB 3LELC 1TAFA 5JA4A 5AV8D 5AVCD 4LD9A 2YFWA 2F8NK 3VH6W 5B2IC 3C1CC 5AVBA 3MGPD 5F99A 3X1TA 3UTAB 4ZUXB 3LJAA 3X1SB 3B0BA 3O62A 1AOIA 3REIB 3MGRC 5AV5D 4H9OA 3AZEA 5GT3C 5JRGD 1M19B 4UPKA 4Z5TD 2HIOC 1U35C 1P3LA 1KX3A 5CPIB 4CSRA 1P3BA 4H9SA 3X1UA 5GXQC 2FJ7A 2F8NG 4YS3B 1P3OB 3EG5B 3AZHB 3WA9A 3AZLB 1F1EA 3B6FA 1BFMA 4J8XC 2ZY4A 4Z66B 3F6TA 1HTAA 4CAYB 3NQJA 3AFAC 4KHAA 3EPHA 3LZ1C 4DQYB 1M1AD 4J8VB 5JA4B 4QLCC 4LD9B 2YFWB 5B31C 5B2JD 3KSYA 5CPKC 3X1VD 1M18A 5AVBB 1R4VA 2CV5A 5F99B 5DNMD 3REJC 4R8PC 3W96A 3W97A 3W99A 3AV1A 5B33C 3C1BD 1AOIB 3O62B 4H9OB 1KX5D 2NQBA 3MGQC 3AYWA 3H0RC 5DNNC 3VH6A 3REHC 3UT9C 4KUDA 1P3OD 4XUJA 5BS7A 5CP6A 1P3LB 1KX3B 2F8NA 3AZLD 3TU4C 3AZMD 4CSRB 4Z66D 3X1UB 4WU9D 1S32A 2FJ7B 2Y2PA 5B0ZD 1P3FD 1P3PC 3WA9B 4M6BA 5B1LA 2AROC 5AV9C 5C3IB 3MGPA 3V9RA 1F66C 2Y2QA 4H9PA 3AV2C 4J8VD 3RELC 5AV5A 5CHLB 3AZEC 3NQJB 4KGCC 4KHAB 5AVBD 5JRGA 3UTBD 4Z5TA 3A6NA 5AY8D 3AZGA 4Z2MH 3O62D 3LZ0D 1P3MD 1M18B 4X23C 2CV5B 1TZYA 3KUYD 5AV6B 4YM6C 3W99B 5FUGA 3AV1B 3KXBD 3REKC 4J8UD 4UUZA 3B6FC 1EQZC 4E44A 2NQBB 3AYWB 3AZJD 3WAAD 4KUDB 1PZRA 2VQRA 3H0MC 4G91C 5B1MB 2F8NB 3AL0C 1B6WA 1M1AA 2PYOC 3AZID 2NZDC 3EPKA 2Y2IA 5B2JA 1S32B 3X1VA 2BYKB 5B1LB 3MGPB 4J8WB 3V9RB 5DNMA 1P3KD 5BT1C 3W96C 2RVQC 4H9PB 3C1BA 5B32C 5E5AD 1KX5A 4XZQC 5JRGB 2W8SA 3AZFB 3KWQC 5CPJC 4Z5TB 2IO5C 3A6NB 3WKJD 5AV6D 2XD5A 3W99D 1N1JA 1P3OA 5CP6C 2UWXA 3AZGB 1P3GB 1ZLAC 3AZMA 4Z66A 1T3UA 5AV8C 1TZYB 4DRAA 5AVCC 4WU9A 2YFVA 4EO5C 1P3IC 1ID3D 1BH9B 5B0YB 5B0ZA 1P3FA 3IP4C 4HGAC 5B1MD 5B40B 4J8VA 5GT0C 1S32D 3WTPE 5B1LD 3UTBA 4J8WD 1M1AB 5B24C 3B6GC 4NFTA 5AY8A 4G92C 3W98B 3AZKC 3VH5T 5B2JB 3X1VB 3LZ0A 1HQ3C 1P3MA 3MGRB 3MVDC 1ULYA 4DRBA 3KUYA 5DNMB 3AZFD 3A6ND 3WTPB 3MNNC 1KX4D 1P34C 3KXBA 3C1BB 4J8UA 1P3GD 2JE5A 4JJNC 3AZGD 1KX5B 3AZJA 1TZYD 3MGSD 3WAAA 5B0YD 3NQUA 1N1JB 3P5JB 4ZBJB 3AN2B 2Y2MA 3AZMB 5B40D 4ZUXC 3LELD 3UTAC 3AZIA 2YFVB 4WU9B 2G5HC 5GSUC 3X1SC 5B2ID 5B0ZB 1P3FB 3REIC 1P3KA 1M19C 2HUEB 3W98D 5E5AA 3MGRD 5CPIC 5GT3D 3UTBB 3WKJA 5AV6A 4WZSB 5BO0B 3A1IA 5AY8B 3WTPD 4YS3C 1P3OC 2HIOD 3AZHC 3AZLC 3LZ0B 1U35D 1P3MB 4WJ3C 5DNNB 3KUYB 1ID3A 2F8NH 4WV4B 5GXQD 3KXBB 4J8UB 3AN2D 3H0LC 5B1MA 4E45A 3AZJB 4AWLB 4LD9C 3WAAB 3NQUB 2BYKA 5AVBC 3AFAD 3B0CT 4J8WA 5G49A 5F99C 3LZ1D 3AZNA 3X1TC 3LJAC 3AZIB 3FDDA 2DQNC 1AOIC 3O62C 4Z2MG 2F2AC 1P3KB 3AZFA 3REJD 2FFFB 4R8PD 1KX4A 5B33D 1P3GA 5E5AB 1P3LC 1KX3C 4WU8A 3MGQD 1P3BC 4H9SC 1BH8A 5DNND 3X1UC 3MGSA 3WKJB 1BH9A 2FJ7C 5B0YA 3UT9D 2ZY5A 1P3AA 3WA9C 2L5AA 5C3IC 3TU4D 2BG1A 2RIQA 5B40A 3LELA 5BNXA 1ID3B 5B2IA 3C1CA 1P3PD 2AROD 5AV9D 4H9QA 1F66D 1WWSA 3AV2D 3W98A 3RELD 2ZY3A 3MGRA 1M18C 4KGCD 3VH6T 2CV5C 5GT3A 2DF4C 5G49B 3AZNB 2Y2JA 3B0DB 3WTPA 3W99C 3W97C 3AV1C 2HIOA 1U35A 2Y2HA 2NQBC 3AYWC 5GXQA 4YM6D 1KX4B 4KUDC 2XD1A 5BS7C 4XUJC 3AN2A 1EQZD 2G5IC 4WU8B 1BH8B 3MGSB 1S32C 4NE5A 1P3AB 3AFAA 4HGAB 5B1LC 3MGPC 3LZ1A 3LELB 2PYOD 5BNXB 2NZDD 5B31A 5B2IB 5CPKA 4NE6A 5AV5C 3C1CB 5JRGC 3EPLA 1JFIA 4H9QB 3REJA 4Z5TC 5BT1D 4R8PA 3A6NC 3AZND 5BO0A 5B33A 5B32D 3AZGC 1P3GC 2Y2KA 3MGQA 1W2EA 5KDMA 4XZQD 5GT3B 5DNNA 1TZYC 5CPJD 3KWQD 3UT9A 1A7WA 2HIOB 1U35B 4H9NA 3TU4A 4WU8D 5B40C 2Y2LA 1P3ID 5GXQB 1P3PA 1P3AD 2AROA
chains in the Genus database with same CATH topology
5AV9A 4J8XB 1M1AC 1F66A 3AV2A 2LY8A 5GSUB 3RELA 3W98C 5B2JC 5GT0D 3X1VC 4KGCA 3AFAB 3C1CD 5BNVA 5DNMC 3LZ1B 3B6GD 5B24D 5B32G 3WTPC 2ZM5A 4QLCB 5B31B 3C1BC 3AZKD 5CPKB 1HQ3D 4X23A 3MVDD 1KX5C 1JFIB 3REJB 4R8PB 4WNNA 4YM6A 3MNND 1P34D 5B33B 4ZBJC 3REKA 3AN2C 4JJND 1EQZA 3AZMC 4Z66C 3MGQB 5KDMB 4WU9C 3REHB 1Q9CA 3UT9B 5B0ZC 1P3FC 4H9NB 3TU4B 4J8XD 1B67A 2HUEC 3VH5W 2PYOA 1TAFB 4ZUXD 3UTAD 4J8VC 2JCHA 2NZDA 5GSUD 3X1SD 4H9RA 3REID 1P3PB 2AROB 5AV9B 3UTBC 1H3OA 1M19D 3X1TB 1F66B 3LJAB 3R45A 5AY8C 3AV2B 3RELB 4QLCD 5B32A 5B31D 3LZ0C 5CPKD 1P3MC 4KGCB 3AZEB 5BNVB 5CPID 4XZQA 3KUYC 5CPJA 3KWQA 1WWIA 3KFUG 4YS3D 3KXBC 4J8UC 3AZHD 1ZLAA 1KU5A 4X23B 3AZJC 1P3BB 5AV8A 5AVCA 2Y2GA 4AWLC 1P3IA 1Z2CB 4WNNB 4YM6B 3REHD 3WAAC 3REKB 3B6FB 1EQZB 3A1KA 3EPJA 3AZIC 4LD9D 5GT0A 2ZY2A 2Y2NA 2J8PA 4G91B 1P3KC 5F99D 3B6GA 5B24A 5B31G 3X1TD 2PYOB 3LJAD 2NZDB 3AZKA 5E5AC 1AOID 1HQ3A 4H9RB 3MVDA 3AZED 1H3OB 3W96B 3WKJC 3W97B 3MNNA 5AV6C 3R45B 1P34A 5B32B 4JJNA 1P3LD 1KX3D 3VH5A 2BYMA 4X23D 4XZQB 1P3BD 3X1UD 5CPJB 3KWQB 1ID3C 2IO5B 2FJ7D 3B0CW 4NE3A 5CP6B 4XUJB 3WA9D 3REKD 1ZLAB 5B1MC 3B6FD 2JSSA 4J8XA 5AV8B 4ZUXA 5AVCB 3UTAA 4EO5B 1P3IB 3X1SA 5GSUA 2CWEA 3REIA 4J8WC 1M19A 3AZNC 3B0DC 2Y2OA 4QLCA 5GT0B 5AV5B 1M18D 5CPIA 2CV5D 3AZFC 5B24B 3B6GB 3W96D 2RVQD 4G92B 1KX4C 3W97D 4YS3A 3AZKB 3AV1D 3AZHA 3AZLA 1HQ3B 3MVDB 4WU8C 2NQBD 3AYWD 3MGSC 3REHA 3MNNB 5B0YC 1P34B 5FUGB 4CAYA 4KUDD 1P3AC 4XUJD 4UUZB 5CP6D 4JJNB 2F8ND 1ZLAD 2BYMB 3LELC 1TAFA 5JA4A 5AV8D 5AVCD 4LD9A 2YFWA 2F8NK 3VH6W 5B2IC 3C1CC 5AVBA 3MGPD 5F99A 3X1TA 3UTAB 4ZUXB 3LJAA 3X1SB 3B0BA 3O62A 1AOIA 3REIB 3MGRC 5AV5D 4H9OA 3AZEA 5GT3C 5JRGD 1M19B 4UPKA 4Z5TD 2HIOC 1U35C 1P3LA 1KX3A 5CPIB 4CSRA 1P3BA 4H9SA 3X1UA 5GXQC 2FJ7A 2F8NG 4YS3B 1P3OB 3EG5B 3AZHB 3WA9A 3AZLB 1F1EA 3B6FA 1BFMA 4J8XC 2ZY4A 4Z66B 3F6TA 1HTAA 4CAYB 3NQJA 3AFAC 4KHAA 3EPHA 3LZ1C 4DQYB 1M1AD 4J8VB 5JA4B 4QLCC 4LD9B 2YFWB 5B31C 5B2JD 3KSYA 5CPKC 3X1VD 1M18A 5AVBB 1R4VA 2CV5A 5F99B 5DNMD 3REJC 4R8PC 3W96A 3W97A 3W99A 3AV1A 5B33C 3C1BD 1AOIB 3O62B 4H9OB 1KX5D 2NQBA 3MGQC 3AYWA 3H0RC 5DNNC 3VH6A 3REHC 3UT9C 4KUDA 1P3OD 4XUJA 5BS7A 5CP6A 1P3LB 1KX3B 2F8NA 3AZLD 3TU4C 3AZMD 4CSRB 4Z66D 3X1UB 4WU9D 1S32A 2FJ7B 2Y2PA 5B0ZD 1P3FD 1P3PC 3WA9B 4M6BA 5B1LA 2AROC 5AV9C 5C3IB 3MGPA 3V9RA 1F66C 2Y2QA 4H9PA 3AV2C 4J8VD 3RELC 5AV5A 5CHLB 3AZEC 3NQJB 4KGCC 4KHAB 5AVBD 5JRGA 3UTBD 4Z5TA 3A6NA 5AY8D 3AZGA 4Z2MH 3O62D 3LZ0D 1P3MD 1M18B 4X23C 2CV5B 1TZYA 3KUYD 5AV6B 4YM6C 3W99B 5FUGA 3AV1B 3KXBD 3REKC 4J8UD 4UUZA 3B6FC 1EQZC 4E44A 2NQBB 3AYWB 3AZJD 3WAAD 4KUDB 1PZRA 2VQRA 3H0MC 4G91C 5B1MB 2F8NB 3AL0C 1B6WA 1M1AA 2PYOC 3AZID 2NZDC 3EPKA 2Y2IA 5B2JA 1S32B 3X1VA 2BYKB 5B1LB 3MGPB 4J8WB 3V9RB 5DNMA 1P3KD 5BT1C 3W96C 2RVQC 4H9PB 3C1BA 5B32C 5E5AD 1KX5A 4XZQC 5JRGB 2W8SA 3AZFB 3KWQC 5CPJC 4Z5TB 2IO5C 3A6NB 3WKJD 5AV6D 2XD5A 3W99D 1N1JA 1P3OA 5CP6C 2UWXA 3AZGB 1P3GB 1ZLAC 3AZMA 4Z66A 1T3UA 5AV8C 1TZYB 4DRAA 5AVCC 4WU9A 2YFVA 4EO5C 1P3IC 1ID3D 1BH9B 5B0YB 5B0ZA 1P3FA 3IP4C 4HGAC 5B1MD 5B40B 4J8VA 5GT0C 1S32D 3WTPE 5B1LD 3UTBA 4J8WD 1M1AB 5B24C 3B6GC 4NFTA 5AY8A 4G92C 3W98B 3AZKC 3VH5T 5B2JB 3X1VB 3LZ0A 1HQ3C 1P3MA 3MGRB 3MVDC 1ULYA 4DRBA 3KUYA 5DNMB 3AZFD 3A6ND 3WTPB 3MNNC 1KX4D 1P34C 3KXBA 3C1BB 4J8UA 1P3GD 2JE5A 4JJNC 3AZGD 1KX5B 3AZJA 1TZYD 3MGSD 3WAAA 5B0YD 3NQUA 1N1JB 3P5JB 4ZBJB 3AN2B 2Y2MA 3AZMB 5B40D 4ZUXC 3LELD 3UTAC 3AZIA 2YFVB 4WU9B 2G5HC 5GSUC 3X1SC 5B2ID 5B0ZB 1P3FB 3REIC 1P3KA 1M19C 2HUEB 3W98D 5E5AA 3MGRD 5CPIC 5GT3D 3UTBB 3WKJA 5AV6A 4WZSB 5BO0B 3A1IA 5AY8B 3WTPD 4YS3C 1P3OC 2HIOD 3AZHC 3AZLC 3LZ0B 1U35D 1P3MB 4WJ3C 5DNNB 3KUYB 1ID3A 2F8NH 4WV4B 5GXQD 3KXBB 4J8UB 3AN2D 3H0LC 5B1MA 4E45A 3AZJB 4AWLB 4LD9C 3WAAB 3NQUB 2BYKA 5AVBC 3AFAD 3B0CT 4J8WA 5G49A 5F99C 3LZ1D 3AZNA 3X1TC 3LJAC 3AZIB 3FDDA 2DQNC 1AOIC 3O62C 4Z2MG 2F2AC 1P3KB 3AZFA 3REJD 2FFFB 4R8PD 1KX4A 5B33D 1P3GA 5E5AB 1P3LC 1KX3C 4WU8A 3MGQD 1P3BC 4H9SC 1BH8A 5DNND 3X1UC 3MGSA 3WKJB 1BH9A 2FJ7C 5B0YA 3UT9D 2ZY5A 1P3AA 3WA9C 2L5AA 5C3IC 3TU4D 2BG1A 2RIQA 5B40A 3LELA 5BNXA 1ID3B 5B2IA 3C1CA 1P3PD 2AROD 5AV9D 4H9QA 1F66D 1WWSA 3AV2D 3W98A 3RELD 2ZY3A 3MGRA 1M18C 4KGCD 3VH6T 2CV5C 5GT3A 2DF4C 5G49B 3AZNB 2Y2JA 3B0DB 3WTPA 3W99C 3W97C 3AV1C 2HIOA 1U35A 2Y2HA 2NQBC 3AYWC 5GXQA 4YM6D 1KX4B 4KUDC 2XD1A 5BS7C 4XUJC 3AN2A 1EQZD 2G5IC 4WU8B 1BH8B 3MGSB 1S32C 4NE5A 1P3AB 3AFAA 4HGAB 5B1LC 3MGPC 3LZ1A 3LELB 2PYOD 5BNXB 2NZDD 5B31A 5B2IB 5CPKA 4NE6A 5AV5C 3C1CB 5JRGC 3EPLA 1JFIA 4H9QB 3REJA 4Z5TC 5BT1D 4R8PA 3A6NC 3AZND 5BO0A 5B33A 5B32D 3AZGC 1P3GC 2Y2KA 3MGQA 1W2EA 5KDMA 4XZQD 5GT3B 5DNNA 1TZYC 5CPJD 3KWQD 3UT9A 1A7WA 2HIOB 1U35B 4H9NA 3TU4A 4WU8D 5B40C 2Y2LA 1P3ID 5GXQB 1P3PA 1P3AD 2AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 A;  4J8X B;  1M1A C;  1F66 A;  3AV2 A;  2LY8 A;  5GSU B;  3REL A;  3W98 C;  5B2J C;  5GT0 D;  3X1V C;  4KGC A;  3AFA B;  3C1C D;  5BNV A;  5DNM C;  3LZ1 B;  3B6G D;  5B24 D;  5B32 G;  3WTP C;  4QLC B;  5B31 B;  3C1B C;  3AZK D;  5CPK B;  1HQ3 D;  4X23 A;  3MVD D;  1KX5 C;  1JFI B;  3REJ B;  4R8P B;  4WNN A;  4YM6 A;  3MNN D;  1P34 D;  5B33 B;  4ZBJ C;  3REK A;  3AN2 C;  4JJN D;  1EQZ A;  3AZM C;  4Z66 C;  3MGQ B;  5KDM B;  4WU9 C;  3REH B;  1Q9C A;  3UT9 B;  5B0Z C;  1P3F C;  4H9N B;  3TU4 B;  4J8X D;  1B67 A;  2HUE C;  3VH5 W;  2PYO A;  1TAF B;  4ZUX D;  3UTA D;  4J8V C;  2NZD A;  5GSU D;  3X1S D;  4H9R A;  3REI D;  1P3P B;  2ARO B;  5AV9 B;  3UTB C;  1H3O A;  1M19 D;  3X1T B;  1F66 B;  3LJA B;  3R45 A;  5AY8 C;  3AV2 B;  3REL B;  4QLC D;  5B32 A;  5B31 D;  3LZ0 C;  5CPK D;  1P3M C;  4KGC B;  3AZE B;  5BNV B;  5CPI D;  4XZQ A;  3KUY C;  5CPJ A;  3KWQ A;  1WWI A;  4YS3 D;  3KXB C;  4J8U C;  3AZH D;  1ZLA A;  1KU5 A;  4X23 B;  3AZJ C;  1P3B B;  5AV8 A;  5AVC A;  4AWL C;  1P3I A;  3REH D;  4WNN B;  4YM6 B;  3WAA C;  3REK B;  3B6F B;  1EQZ B;  3AZI C;  4LD9 D;  5GT0 A;  4G91 B;  1P3K C;  5F99 D;  3B6G A;  5B24 A;  5B31 G;  3X1T D;  2PYO B;  3LJA D;  2NZD B;  3AZK A;  5E5A C;  1AOI D;  1HQ3 A;  4H9R B;  3MVD A;  3AZE D;  1H3O B;  3W96 B;  3WKJ C;  3W97 B;  3MNN A;  5AV6 C;  3R45 B;  1P34 A;  5B32 B;  4JJN A;  1P3L D;  1KX3 D;  3VH5 A;  2BYM A;  4X23 D;  4XZQ B;  1P3B D;  3X1U D;  5CPJ B;  3KWQ B;  1ID3 C;  2IO5 B;  2FJ7 D;  3B0C W;  4NE3 A;  5CP6 B;  4XUJ B;  3WA9 D;  3REK D;  1ZLA B;  5B1M C;  3B6F D;  2JSS A;  4J8X A;  5AV8 B;  4ZUX A;  5AVC B;  3UTA A;  4EO5 B;  1P3I B;  3X1S A;  5GSU A;  2CWE A;  3REI A;  4J8W C;  1M19 A;  3AZN C;  3B0D C;  4QLC A;  5GT0 B;  5AV5 B;  1M18 D;  5CPI A;  2CV5 D;  3AZF C;  5B24 B;  3B6G B;  3W96 D;  2RVQ D;  4G92 B;  1KX4 C;  3W97 D;  4YS3 A;  3AZK B;  3AV1 D;  3AZH A;  3AZL A;  1HQ3 B;  3MVD B;  4WU8 C;  2NQB D;  3AYW D;  3MGS C;  3REH A;  3MNN B;  5B0Y C;  1P34 B;  5FUG B;  4CAY A;  4KUD D;  1P3A C;  4XUJ D;  4UUZ B;  5CP6 D;  4JJN B;  2F8N D;  1ZLA D;  2BYM B;  3LEL C;  1TAF A;  5JA4 A;  5AV8 D;  5AVC D;  4LD9 A;  2YFW A;  2F8N K;  3VH6 W;  5B2I C;  3C1C C;  5AVB A;  3MGP D;  5F99 A;  3X1T A;  3UTA B;  4ZUX B;  3LJA A;  3X1S B;  3B0B A;  3O62 A;  1AOI A;  3REI B;  3MGR C;  5AV5 D;  4H9O A;  3AZE A;  5GT3 C;  5JRG D;  1M19 B;  4Z5T D;  2HIO C;  1U35 C;  1P3L A;  1KX3 A;  5CPI B;  4CSR A;  1P3B A;  4H9S A;  3X1U A;  5GXQ C;  2FJ7 A;  2F8N G;  4YS3 B;  1P3O B;  3AZH B;  3WA9 A;  3AZL B;  1F1E A;  3B6F A;  1BFM A;  4J8X C;  4Z66 B;  1HTA A;  4CAY B;  3NQJ A;  3AFA C;  4KHA A;  3LZ1 C;  1M1A D;  4J8V B;  5JA4 B;  4QLC C;  4LD9 B;  2YFW B;  5B31 C;  5B2J D;  3KSY A;  5CPK C;  3X1V D;  1M18 A;  5AVB B;  1R4V A;  2CV5 A;  5F99 B;  5DNM D;  3REJ C;  4R8P C;  3W96 A;  3W97 A;  3W99 A;  3AV1 A;  5B33 C;  3C1B D;  1AOI B;  3O62 B;  4H9O B;  1KX5 D;  2NQB A;  3MGQ C;  3AYW A;  5DNN C;  3VH6 A;  3REH C;  3UT9 C;  4KUD A;  1P3O D;  4XUJ A;  5BS7 A;  5CP6 A;  1P3L B;  1KX3 B;  2F8N A;  3AZL D;  3TU4 C;  3AZM D;  4CSR B;  4Z66 D;  3X1U B;  4WU9 D;  1S32 A;  2FJ7 B;  5B0Z D;  1P3F D;  1P3P C;  3WA9 B;  4M6B A;  5B1L A;  2ARO C;  5AV9 C;  5C3I B;  3MGP A;  3V9R A;  1F66 C;  4H9P A;  3AV2 C;  4J8V D;  3REL C;  5AV5 A;  5CHL B;  3AZE C;  3NQJ B;  4KGC C;  4KHA B;  5AVB D;  5JRG A;  3UTB D;  4Z5T A;  3A6N A;  5AY8 D;  3AZG A;  4Z2M H;  3O62 D;  3LZ0 D;  1P3M D;  1M18 B;  4X23 C;  2CV5 B;  1TZY A;  3KUY D;  5AV6 B;  4YM6 C;  3W99 B;  5FUG A;  3AV1 B;  3KXB D;  3REK C;  4J8U D;  4UUZ A;  3B6F C;  1EQZ C;  4E44 A;  2NQB B;  3AYW B;  3AZJ D;  3WAA D;  4KUD B;  5B1M B;  2F8N B;  4G91 C;  1B6W A;  1M1A A;  2PYO C;  3AZI D;  2NZD C;  5B2J A;  1S32 B;  3X1V A;  2BYK B;  5B1L B;  3MGP B;  4J8W B;  3V9R B;  5DNM A;  1P3K D;  5BT1 C;  3W96 C;  2RVQ C;  4H9P B;  3C1B A;  5B32 C;  5E5A D;  1KX5 A;  4XZQ C;  5JRG B;  3AZF B;  3KWQ C;  5CPJ C;  4Z5T B;  2IO5 C;  3A6N B;  3WKJ D;  5AV6 D;  3W99 D;  1N1J A;  1P3O A;  5CP6 C;  3AZG B;  1P3G B;  1ZLA C;  3AZM A;  4Z66 A;  5AV8 C;  1TZY B;  4DRA A;  5AVC C;  4WU9 A;  2YFV A;  4EO5 C;  1P3I C;  1ID3 D;  1BH9 B;  5B0Y B;  5B0Z A;  1P3F A;  4HGA C;  5B1M D;  5B40 B;  4J8V A;  5GT0 C;  1S32 D;  3WTP E;  5B1L D;  3UTB A;  4J8W D;  1M1A B;  5B24 C;  3B6G C;  4NFT A;  5AY8 A;  4G92 C;  3W98 B;  3AZK C;  3VH5 T;  5B2J B;  3X1V B;  3LZ0 A;  1HQ3 C;  1P3M A;  3MGR B;  3MVD C;  1ULY A;  4DRB A;  3KUY A;  5DNM B;  3AZF D;  3A6N D;  3WTP B;  3MNN C;  1KX4 D;  1P34 C;  3KXB A;  3C1B B;  4J8U A;  1P3G D;  3AZG D;  4JJN C;  1KX5 B;  3AZJ A;  1TZY D;  3MGS D;  3WAA A;  5B0Y D;  3NQU A;  1N1J B;  4ZBJ B;  3AN2 B;  3AZM B;  5B40 D;  4ZUX C;  3LEL D;  3UTA C;  3AZI A;  2YFV B;  4WU9 B;  5GSU C;  3X1S C;  5B2I D;  5B0Z B;  1P3F B;  3REI C;  1P3K A;  1M19 C;  2HUE B;  3W98 D;  5E5A A;  3MGR D;  5CPI C;  5GT3 D;  3UTB B;  3WKJ A;  5AV6 A;  4WZS B;  3WTP D;  5BO0 B;  5AY8 B;  4YS3 C;  1P3O C;  2HIO D;  3AZH C;  3AZL C;  3LZ0 B;  1U35 D;  1P3M B;  5DNN B;  3KUY B;  1ID3 A;  2F8N H;  4WV4 B;  5GXQ D;  3KXB B;  4J8U B;  3AN2 D;  5B1M A;  4E45 A;  3AZJ B;  4AWL B;  4LD9 C;  3WAA B;  3NQU B;  2BYK A;  5AVB C;  3AFA D;  3B0C T;  4J8W A;  5G49 A;  5F99 C;  3LZ1 D;  3AZN A;  3X1T C;  3LJA C;  3AZI B;  1AOI C;  3O62 C;  4Z2M G;  1P3K B;  3AZF A;  3REJ D;  4R8P D;  1KX4 A;  5B33 D;  1P3G A;  5E5A B;  1P3L C;  1KX3 C;  4WU8 A;  3MGQ D;  1P3B C;  4H9S C;  1BH8 A;  5DNN D;  3X1U C;  3MGS A;  3WKJ B;  1BH9 A;  2FJ7 C;  5B0Y A;  3UT9 D;  1P3A A;  3WA9 C;  2L5A A;  5C3I C;  3TU4 D;  5B40 A;  3LEL A;  5BNX A;  1ID3 B;  5B2I A;  3C1C A;  1P3P D;  2ARO D;  5AV9 D;  4H9Q A;  1F66 D;  1WWS A;  3AV2 D;  3W98 A;  3REL D;  3MGR A;  1M18 C;  4KGC D;  3VH6 T;  2CV5 C;  5GT3 A;  5G49 B;  3AZN B;  3B0D B;  3WTP A;  3W99 C;  3W97 C;  3AV1 C;  2HIO A;  1U35 A;  2NQB C;  3AYW C;  5GXQ A;  4YM6 D;  1KX4 B;  4KUD C;  5BS7 C;  4XUJ C;  3AN2 A;  1EQZ D;  4WU8 B;  1BH8 B;  3MGS B;  1S32 C;  4NE5 A;  1P3A B;  3AFA A;  4HGA B;  5B1L C;  3MGP C;  3LZ1 A;  3LEL B;  2PYO D;  5BNX B;  2NZD D;  5B31 A;  5B2I B;  5CPK A;  4NE6 A;  5AV5 C;  3C1C B;  5JRG C;  1JFI A;  4H9Q B;  3REJ A;  4Z5T C;  5BT1 D;  4R8P A;  3A6N C;  3AZN D;  5BO0 A;  5B33 A;  5B32 D;  3AZG C;  1P3G C;  3MGQ A;  5KDM A;  4XZQ D;  5GT3 B;  5DNN A;  1TZY C;  5CPJ D;  3KWQ D;  3UT9 A;  1A7W A;  2HIO B;  1U35 B;  4H9N A;  3TU4 A;  4WU8 D;  5B40 C;  1P3I D;  5GXQ B;  1P3P A;  1P3A D;  2ARO A; 
#chains in the Genus database with same CATH topology
 5AV9 A;  4J8X B;  1M1A C;  1F66 A;  3AV2 A;  2LY8 A;  5GSU B;  3REL A;  3W98 C;  5B2J C;  5GT0 D;  3X1V C;  4KGC A;  3AFA B;  3C1C D;  5BNV A;  5DNM C;  3LZ1 B;  3B6G D;  5B24 D;  5B32 G;  3WTP C;  2ZM5 A;  4QLC B;  5B31 B;  3C1B C;  3AZK D;  5CPK B;  1HQ3 D;  4X23 A;  3MVD D;  1KX5 C;  1JFI B;  3REJ B;  4R8P B;  4WNN A;  4YM6 A;  3MNN D;  1P34 D;  5B33 B;  4ZBJ C;  3REK A;  3AN2 C;  4JJN D;  1EQZ A;  3AZM C;  4Z66 C;  3MGQ B;  5KDM B;  4WU9 C;  3REH B;  1Q9C A;  3UT9 B;  5B0Z C;  1P3F C;  4H9N B;  3TU4 B;  4J8X D;  1B67 A;  2HUE C;  3VH5 W;  2PYO A;  1TAF B;  4ZUX D;  3UTA D;  4J8V C;  2JCH A;  2NZD A;  5GSU D;  3X1S D;  4H9R A;  3REI D;  1P3P B;  2ARO B;  5AV9 B;  3UTB C;  1H3O A;  1M19 D;  3X1T B;  1F66 B;  3LJA B;  3R45 A;  5AY8 C;  3AV2 B;  3REL B;  4QLC D;  5B32 A;  5B31 D;  3LZ0 C;  5CPK D;  1P3M C;  4KGC B;  3AZE B;  5BNV B;  5CPI D;  4XZQ A;  3KUY C;  5CPJ A;  3KWQ A;  1WWI A;  3KFU G;  4YS3 D;  3KXB C;  4J8U C;  3AZH D;  1ZLA A;  1KU5 A;  4X23 B;  3AZJ C;  1P3B B;  5AV8 A;  5AVC A;  2Y2G A;  4AWL C;  1P3I A;  1Z2C B;  4WNN B;  4YM6 B;  3REH D;  3WAA C;  3REK B;  3B6F B;  1EQZ B;  3A1K A;  3EPJ A;  3AZI C;  4LD9 D;  5GT0 A;  2ZY2 A;  2Y2N A;  2J8P A;  4G91 B;  1P3K C;  5F99 D;  3B6G A;  5B24 A;  5B31 G;  3X1T D;  2PYO B;  3LJA D;  2NZD B;  3AZK A;  5E5A C;  1AOI D;  1HQ3 A;  4H9R B;  3MVD A;  3AZE D;  1H3O B;  3W96 B;  3WKJ C;  3W97 B;  3MNN A;  5AV6 C;  3R45 B;  1P34 A;  5B32 B;  4JJN A;  1P3L D;  1KX3 D;  3VH5 A;  2BYM A;  4X23 D;  4XZQ B;  1P3B D;  3X1U D;  5CPJ B;  3KWQ B;  1ID3 C;  2IO5 B;  2FJ7 D;  3B0C W;  4NE3 A;  5CP6 B;  4XUJ B;  3WA9 D;  3REK D;  1ZLA B;  5B1M C;  3B6F D;  2JSS A;  4J8X A;  5AV8 B;  4ZUX A;  5AVC B;  3UTA A;  4EO5 B;  1P3I B;  3X1S A;  5GSU A;  2CWE A;  3REI A;  4J8W C;  1M19 A;  3AZN C;  3B0D C;  2Y2O A;  4QLC A;  5GT0 B;  5AV5 B;  1M18 D;  5CPI A;  2CV5 D;  3AZF C;  5B24 B;  3B6G B;  3W96 D;  2RVQ D;  4G92 B;  1KX4 C;  3W97 D;  4YS3 A;  3AZK B;  3AV1 D;  3AZH A;  3AZL A;  1HQ3 B;  3MVD B;  4WU8 C;  2NQB D;  3AYW D;  3MGS C;  3REH A;  3MNN B;  5B0Y C;  1P34 B;  5FUG B;  4CAY A;  4KUD D;  1P3A C;  4XUJ D;  4UUZ B;  5CP6 D;  4JJN B;  2F8N D;  1ZLA D;  2BYM B;  3LEL C;  1TAF A;  5JA4 A;  5AV8 D;  5AVC D;  4LD9 A;  2YFW A;  2F8N K;  3VH6 W;  5B2I C;  3C1C C;  5AVB A;  3MGP D;  5F99 A;  3X1T A;  3UTA B;  4ZUX B;  3LJA A;  3X1S B;  3B0B A;  3O62 A;  1AOI A;  3REI B;  3MGR C;  5AV5 D;  4H9O A;  3AZE A;  5GT3 C;  5JRG D;  1M19 B;  4UPK A;  4Z5T D;  2HIO C;  1U35 C;  1P3L A;  1KX3 A;  5CPI B;  4CSR A;  1P3B A;  4H9S A;  3X1U A;  5GXQ C;  2FJ7 A;  2F8N G;  4YS3 B;  1P3O B;  3EG5 B;  3AZH B;  3WA9 A;  3AZL B;  1F1E A;  3B6F A;  1BFM A;  4J8X C;  2ZY4 A;  4Z66 B;  3F6T A;  1HTA A;  4CAY B;  3NQJ A;  3AFA C;  4KHA A;  3EPH A;  3LZ1 C;  4DQY B;  1M1A D;  4J8V B;  5JA4 B;  4QLC C;  4LD9 B;  2YFW B;  5B31 C;  5B2J D;  3KSY A;  5CPK C;  3X1V D;  1M18 A;  5AVB B;  1R4V A;  2CV5 A;  5F99 B;  5DNM D;  3REJ C;  4R8P C;  3W96 A;  3W97 A;  3W99 A;  3AV1 A;  5B33 C;  3C1B D;  1AOI B;  3O62 B;  4H9O B;  1KX5 D;  2NQB A;  3MGQ C;  3AYW A;  3H0R C;  5DNN C;  3VH6 A;  3REH C;  3UT9 C;  4KUD A;  1P3O D;  4XUJ A;  5BS7 A;  5CP6 A;  1P3L B;  1KX3 B;  2F8N A;  3AZL D;  3TU4 C;  3AZM D;  4CSR B;  4Z66 D;  3X1U B;  4WU9 D;  1S32 A;  2FJ7 B;  2Y2P A;  5B0Z D;  1P3F D;  1P3P C;  3WA9 B;  4M6B A;  5B1L A;  2ARO C;  5AV9 C;  5C3I B;  3MGP A;  3V9R A;  1F66 C;  2Y2Q A;  4H9P A;  3AV2 C;  4J8V D;  3REL C;  5AV5 A;  5CHL B;  3AZE C;  3NQJ B;  4KGC C;  4KHA B;  5AVB D;  5JRG A;  3UTB D;  4Z5T A;  3A6N A;  5AY8 D;  3AZG A;  4Z2M H;  3O62 D;  3LZ0 D;  1P3M D;  1M18 B;  4X23 C;  2CV5 B;  1TZY A;  3KUY D;  5AV6 B;  4YM6 C;  3W99 B;  5FUG A;  3AV1 B;  3KXB D;  3REK C;  4J8U D;  4UUZ A;  3B6F C;  1EQZ C;  4E44 A;  2NQB B;  3AYW B;  3AZJ D;  3WAA D;  4KUD B;  1PZR A;  2VQR A;  3H0M C;  4G91 C;  5B1M B;  2F8N B;  3AL0 C;  1B6W A;  1M1A A;  2PYO C;  3AZI D;  2NZD C;  3EPK A;  2Y2I A;  5B2J A;  1S32 B;  3X1V A;  2BYK B;  5B1L B;  3MGP B;  4J8W B;  3V9R B;  5DNM A;  1P3K D;  5BT1 C;  3W96 C;  2RVQ C;  4H9P B;  3C1B A;  5B32 C;  5E5A D;  1KX5 A;  4XZQ C;  5JRG B;  2W8S A;  3AZF B;  3KWQ C;  5CPJ C;  4Z5T B;  2IO5 C;  3A6N B;  3WKJ D;  5AV6 D;  2XD5 A;  3W99 D;  1N1J A;  1P3O A;  5CP6 C;  2UWX A;  3AZG B;  1P3G B;  1ZLA C;  3AZM A;  4Z66 A;  1T3U A;  5AV8 C;  1TZY B;  4DRA A;  5AVC C;  4WU9 A;  2YFV A;  4EO5 C;  1P3I C;  1ID3 D;  1BH9 B;  5B0Y B;  5B0Z A;  1P3F A;  3IP4 C;  4HGA C;  5B1M D;  5B40 B;  4J8V A;  5GT0 C;  1S32 D;  3WTP E;  5B1L D;  3UTB A;  4J8W D;  1M1A B;  5B24 C;  3B6G C;  4NFT A;  5AY8 A;  4G92 C;  3W98 B;  3AZK C;  3VH5 T;  5B2J B;  3X1V B;  3LZ0 A;  1HQ3 C;  1P3M A;  3MGR B;  3MVD C;  1ULY A;  4DRB A;  3KUY A;  5DNM B;  3AZF D;  3A6N D;  3WTP B;  3MNN C;  1KX4 D;  1P34 C;  3KXB A;  3C1B B;  4J8U A;  1P3G D;  2JE5 A;  4JJN C;  3AZG D;  1KX5 B;  3AZJ A;  1TZY D;  3MGS D;  3WAA A;  5B0Y D;  3NQU A;  1N1J B;  3P5J B;  4ZBJ B;  3AN2 B;  2Y2M A;  3AZM B;  5B40 D;  4ZUX C;  3LEL D;  3UTA C;  3AZI A;  2YFV B;  4WU9 B;  2G5H C;  5GSU C;  3X1S C;  5B2I D;  5B0Z B;  1P3F B;  3REI C;  1P3K A;  1M19 C;  2HUE B;  3W98 D;  5E5A A;  3MGR D;  5CPI C;  5GT3 D;  3UTB B;  3WKJ A;  5AV6 A;  4WZS B;  5BO0 B;  3A1I A;  5AY8 B;  3WTP D;  4YS3 C;  1P3O C;  2HIO D;  3AZH C;  3AZL C;  3LZ0 B;  1U35 D;  1P3M B;  4WJ3 C;  5DNN B;  3KUY B;  1ID3 A;  2F8N H;  4WV4 B;  5GXQ D;  3KXB B;  4J8U B;  3AN2 D;  3H0L C;  5B1M A;  4E45 A;  3AZJ B;  4AWL B;  4LD9 C;  3WAA B;  3NQU B;  2BYK A;  5AVB C;  3AFA D;  3B0C T;  4J8W A;  5G49 A;  5F99 C;  3LZ1 D;  3AZN A;  3X1T C;  3LJA C;  3AZI B;  3FDD A;  2DQN C;  1AOI C;  3O62 C;  4Z2M G;  2F2A C;  1P3K B;  3AZF A;  3REJ D;  2FFF B;  4R8P D;  1KX4 A;  5B33 D;  1P3G A;  5E5A B;  1P3L C;  1KX3 C;  4WU8 A;  3MGQ D;  1P3B C;  4H9S C;  1BH8 A;  5DNN D;  3X1U C;  3MGS A;  3WKJ B;  1BH9 A;  2FJ7 C;  5B0Y A;  3UT9 D;  2ZY5 A;  1P3A A;  3WA9 C;  2L5A A;  5C3I C;  3TU4 D;  2BG1 A;  2RIQ A;  5B40 A;  3LEL A;  5BNX A;  1ID3 B;  5B2I A;  3C1C A;  1P3P D;  2ARO D;  5AV9 D;  4H9Q A;  1F66 D;  1WWS A;  3AV2 D;  3W98 A;  3REL D;  2ZY3 A;  3MGR A;  1M18 C;  4KGC D;  3VH6 T;  2CV5 C;  5GT3 A;  2DF4 C;  5G49 B;  3AZN B;  2Y2J A;  3B0D B;  3WTP A;  3W99 C;  3W97 C;  3AV1 C;  2HIO A;  1U35 A;  2Y2H A;  2NQB C;  3AYW C;  5GXQ A;  4YM6 D;  1KX4 B;  4KUD C;  2XD1 A;  5BS7 C;  4XUJ C;  3AN2 A;  1EQZ D;  2G5I C;  4WU8 B;  1BH8 B;  3MGS B;  1S32 C;  4NE5 A;  1P3A B;  3AFA A;  4HGA B;  5B1L C;  3MGP C;  3LZ1 A;  3LEL B;  2PYO D;  5BNX B;  2NZD D;  5B31 A;  5B2I B;  5CPK A;  4NE6 A;  5AV5 C;  3C1C B;  5JRG C;  3EPL A;  1JFI A;  4H9Q B;  3REJ A;  4Z5T C;  5BT1 D;  4R8P A;  3A6N C;  3AZN D;  5BO0 A;  5B33 A;  5B32 D;  3AZG C;  1P3G C;  2Y2K A;  3MGQ A;  1W2E A;  5KDM A;  4XZQ D;  5GT3 B;  5DNN A;  1TZY C;  5CPJ D;  3KWQ D;  3UT9 A;  1A7W A;  2HIO B;  1U35 B;  4H9N A;  3TU4 A;  4WU8 D;  5B40 C;  2Y2L A;  1P3I D;  5GXQ B;  1P3P A;  1P3A D;  2ARO A; 
#chains in the Genus database with same CATH homology
 5AV9 A;  4J8X B;  1M1A C;  1F66 A;  3AV2 A;  2LY8 A;  5GSU B;  3REL A;  3W98 C;  5B2J C;  5GT0 D;  3X1V C;  4KGC A;  3AFA B;  3C1C D;  5BNV A;  5DNM C;  3LZ1 B;  3B6G D;  5B24 D;  5B32 G;  3WTP C;  2ZM5 A;  4QLC B;  5B31 B;  3C1B C;  3AZK D;  5CPK B;  1HQ3 D;  4X23 A;  3MVD D;  1KX5 C;  1JFI B;  3REJ B;  4R8P B;  4WNN A;  4YM6 A;  3MNN D;  1P34 D;  5B33 B;  4ZBJ C;  3REK A;  3AN2 C;  4JJN D;  1EQZ A;  3AZM C;  4Z66 C;  3MGQ B;  5KDM B;  4WU9 C;  3REH B;  1Q9C A;  3UT9 B;  5B0Z C;  1P3F C;  4H9N B;  3TU4 B;  4J8X D;  1B67 A;  2HUE C;  3VH5 W;  2PYO A;  1TAF B;  4ZUX D;  3UTA D;  4J8V C;  2JCH A;  2NZD A;  5GSU D;  3X1S D;  4H9R A;  3REI D;  1P3P B;  2ARO B;  5AV9 B;  3UTB C;  1H3O A;  1M19 D;  3X1T B;  1F66 B;  3LJA B;  3R45 A;  5AY8 C;  3AV2 B;  3REL B;  4QLC D;  5B32 A;  5B31 D;  3LZ0 C;  5CPK D;  1P3M C;  4KGC B;  3AZE B;  5BNV B;  5CPI D;  4XZQ A;  3KUY C;  5CPJ A;  3KWQ A;  1WWI A;  3KFU G;  4YS3 D;  3KXB C;  4J8U C;  3AZH D;  1ZLA A;  1KU5 A;  4X23 B;  3AZJ C;  1P3B B;  5AV8 A;  5AVC A;  2Y2G A;  4AWL C;  1P3I A;  1Z2C B;  4WNN B;  4YM6 B;  3REH D;  3WAA C;  3REK B;  3B6F B;  1EQZ B;  3A1K A;  3EPJ A;  3AZI C;  4LD9 D;  5GT0 A;  2ZY2 A;  2Y2N A;  2J8P A;  4G91 B;  1P3K C;  5F99 D;  3B6G A;  5B24 A;  5B31 G;  3X1T D;  2PYO B;  3LJA D;  2NZD B;  3AZK A;  5E5A C;  1AOI D;  1HQ3 A;  4H9R B;  3MVD A;  3AZE D;  1H3O B;  3W96 B;  3WKJ C;  3W97 B;  3MNN A;  5AV6 C;  3R45 B;  1P34 A;  5B32 B;  4JJN A;  1P3L D;  1KX3 D;  3VH5 A;  2BYM A;  4X23 D;  4XZQ B;  1P3B D;  3X1U D;  5CPJ B;  3KWQ B;  1ID3 C;  2IO5 B;  2FJ7 D;  3B0C W;  4NE3 A;  5CP6 B;  4XUJ B;  3WA9 D;  3REK D;  1ZLA B;  5B1M C;  3B6F D;  2JSS A;  4J8X A;  5AV8 B;  4ZUX A;  5AVC B;  3UTA A;  4EO5 B;  1P3I B;  3X1S A;  5GSU A;  2CWE A;  3REI A;  4J8W C;  1M19 A;  3AZN C;  3B0D C;  2Y2O A;  4QLC A;  5GT0 B;  5AV5 B;  1M18 D;  5CPI A;  2CV5 D;  3AZF C;  5B24 B;  3B6G B;  3W96 D;  2RVQ D;  4G92 B;  1KX4 C;  3W97 D;  4YS3 A;  3AZK B;  3AV1 D;  3AZH A;  3AZL A;  1HQ3 B;  3MVD B;  4WU8 C;  2NQB D;  3AYW D;  3MGS C;  3REH A;  3MNN B;  5B0Y C;  1P34 B;  5FUG B;  4CAY A;  4KUD D;  1P3A C;  4XUJ D;  4UUZ B;  5CP6 D;  4JJN B;  2F8N D;  1ZLA D;  2BYM B;  3LEL C;  1TAF A;  5JA4 A;  5AV8 D;  5AVC D;  4LD9 A;  2YFW A;  2F8N K;  3VH6 W;  5B2I C;  3C1C C;  5AVB A;  3MGP D;  5F99 A;  3X1T A;  3UTA B;  4ZUX B;  3LJA A;  3X1S B;  3B0B A;  3O62 A;  1AOI A;  3REI B;  3MGR C;  5AV5 D;  4H9O A;  3AZE A;  5GT3 C;  5JRG D;  1M19 B;  4UPK A;  4Z5T D;  2HIO C;  1U35 C;  1P3L A;  1KX3 A;  5CPI B;  4CSR A;  1P3B A;  4H9S A;  3X1U A;  5GXQ C;  2FJ7 A;  2F8N G;  4YS3 B;  1P3O B;  3EG5 B;  3AZH B;  3WA9 A;  3AZL B;  1F1E A;  3B6F A;  1BFM A;  4J8X C;  2ZY4 A;  4Z66 B;  3F6T A;  1HTA A;  4CAY B;  3NQJ A;  3AFA C;  4KHA A;  3EPH A;  3LZ1 C;  4DQY B;  1M1A D;  4J8V B;  5JA4 B;  4QLC C;  4LD9 B;  2YFW B;  5B31 C;  5B2J D;  3KSY A;  5CPK C;  3X1V D;  1M18 A;  5AVB B;  1R4V A;  2CV5 A;  5F99 B;  5DNM D;  3REJ C;  4R8P C;  3W96 A;  3W97 A;  3W99 A;  3AV1 A;  5B33 C;  3C1B D;  1AOI B;  3O62 B;  4H9O B;  1KX5 D;  2NQB A;  3MGQ C;  3AYW A;  3H0R C;  5DNN C;  3VH6 A;  3REH C;  3UT9 C;  4KUD A;  1P3O D;  4XUJ A;  5BS7 A;  5CP6 A;  1P3L B;  1KX3 B;  2F8N A;  3AZL D;  3TU4 C;  3AZM D;  4CSR B;  4Z66 D;  3X1U B;  4WU9 D;  1S32 A;  2FJ7 B;  2Y2P A;  5B0Z D;  1P3F D;  1P3P C;  3WA9 B;  4M6B A;  5B1L A;  2ARO C;  5AV9 C;  5C3I B;  3MGP A;  3V9R A;  1F66 C;  2Y2Q A;  4H9P A;  3AV2 C;  4J8V D;  3REL C;  5AV5 A;  5CHL B;  3AZE C;  3NQJ B;  4KGC C;  4KHA B;  5AVB D;  5JRG A;  3UTB D;  4Z5T A;  3A6N A;  5AY8 D;  3AZG A;  4Z2M H;  3O62 D;  3LZ0 D;  1P3M D;  1M18 B;  4X23 C;  2CV5 B;  1TZY A;  3KUY D;  5AV6 B;  4YM6 C;  3W99 B;  5FUG A;  3AV1 B;  3KXB D;  3REK C;  4J8U D;  4UUZ A;  3B6F C;  1EQZ C;  4E44 A;  2NQB B;  3AYW B;  3AZJ D;  3WAA D;  4KUD B;  1PZR A;  2VQR A;  3H0M C;  4G91 C;  5B1M B;  2F8N B;  3AL0 C;  1B6W A;  1M1A A;  2PYO C;  3AZI D;  2NZD C;  3EPK A;  2Y2I A;  5B2J A;  1S32 B;  3X1V A;  2BYK B;  5B1L B;  3MGP B;  4J8W B;  3V9R B;  5DNM A;  1P3K D;  5BT1 C;  3W96 C;  2RVQ C;  4H9P B;  3C1B A;  5B32 C;  5E5A D;  1KX5 A;  4XZQ C;  5JRG B;  2W8S A;  3AZF B;  3KWQ C;  5CPJ C;  4Z5T B;  2IO5 C;  3A6N B;  3WKJ D;  5AV6 D;  2XD5 A;  3W99 D;  1N1J A;  1P3O A;  5CP6 C;  2UWX A;  3AZG B;  1P3G B;  1ZLA C;  3AZM A;  4Z66 A;  1T3U A;  5AV8 C;  1TZY B;  4DRA A;  5AVC C;  4WU9 A;  2YFV A;  4EO5 C;  1P3I C;  1ID3 D;  1BH9 B;  5B0Y B;  5B0Z A;  1P3F A;  3IP4 C;  4HGA C;  5B1M D;  5B40 B;  4J8V A;  5GT0 C;  1S32 D;  3WTP E;  5B1L D;  3UTB A;  4J8W D;  1M1A B;  5B24 C;  3B6G C;  4NFT A;  5AY8 A;  4G92 C;  3W98 B;  3AZK C;  3VH5 T;  5B2J B;  3X1V B;  3LZ0 A;  1HQ3 C;  1P3M A;  3MGR B;  3MVD C;  1ULY A;  4DRB A;  3KUY A;  5DNM B;  3AZF D;  3A6N D;  3WTP B;  3MNN C;  1KX4 D;  1P34 C;  3KXB A;  3C1B B;  4J8U A;  1P3G D;  2JE5 A;  4JJN C;  3AZG D;  1KX5 B;  3AZJ A;  1TZY D;  3MGS D;  3WAA A;  5B0Y D;  3NQU A;  1N1J B;  3P5J B;  4ZBJ B;  3AN2 B;  2Y2M A;  3AZM B;  5B40 D;  4ZUX C;  3LEL D;  3UTA C;  3AZI A;  2YFV B;  4WU9 B;  2G5H C;  5GSU C;  3X1S C;  5B2I D;  5B0Z B;  1P3F B;  3REI C;  1P3K A;  1M19 C;  2HUE B;  3W98 D;  5E5A A;  3MGR D;  5CPI C;  5GT3 D;  3UTB B;  3WKJ A;  5AV6 A;  4WZS B;  5BO0 B;  3A1I A;  5AY8 B;  3WTP D;  4YS3 C;  1P3O C;  2HIO D;  3AZH C;  3AZL C;  3LZ0 B;  1U35 D;  1P3M B;  4WJ3 C;  5DNN B;  3KUY B;  1ID3 A;  2F8N H;  4WV4 B;  5GXQ D;  3KXB B;  4J8U B;  3AN2 D;  3H0L C;  5B1M A;  4E45 A;  3AZJ B;  4AWL B;  4LD9 C;  3WAA B;  3NQU B;  2BYK A;  5AVB C;  3AFA D;  3B0C T;  4J8W A;  5G49 A;  5F99 C;  3LZ1 D;  3AZN A;  3X1T C;  3LJA C;  3AZI B;  3FDD A;  2DQN C;  1AOI C;  3O62 C;  4Z2M G;  2F2A C;  1P3K B;  3AZF A;  3REJ D;  2FFF B;  4R8P D;  1KX4 A;  5B33 D;  1P3G A;  5E5A B;  1P3L C;  1KX3 C;  4WU8 A;  3MGQ D;  1P3B C;  4H9S C;  1BH8 A;  5DNN D;  3X1U C;  3MGS A;  3WKJ B;  1BH9 A;  2FJ7 C;  5B0Y A;  3UT9 D;  2ZY5 A;  1P3A A;  3WA9 C;  2L5A A;  5C3I C;  3TU4 D;  2BG1 A;  2RIQ A;  5B40 A;  3LEL A;  5BNX A;  1ID3 B;  5B2I A;  3C1C A;  1P3P D;  2ARO D;  5AV9 D;  4H9Q A;  1F66 D;  1WWS A;  3AV2 D;  3W98 A;  3REL D;  2ZY3 A;  3MGR A;  1M18 C;  4KGC D;  3VH6 T;  2CV5 C;  5GT3 A;  2DF4 C;  5G49 B;  3AZN B;  2Y2J A;  3B0D B;  3WTP A;  3W99 C;  3W97 C;  3AV1 C;  2HIO A;  1U35 A;  2Y2H A;  2NQB C;  3AYW C;  5GXQ A;  4YM6 D;  1KX4 B;  4KUD C;  2XD1 A;  5BS7 C;  4XUJ C;  3AN2 A;  1EQZ D;  2G5I C;  4WU8 B;  1BH8 B;  3MGS B;  1S32 C;  4NE5 A;  1P3A B;  3AFA A;  4HGA B;  5B1L C;  3MGP C;  3LZ1 A;  3LEL B;  2PYO D;  5BNX B;  2NZD D;  5B31 A;  5B2I B;  5CPK A;  4NE6 A;  5AV5 C;  3C1C B;  5JRG C;  3EPL A;  1JFI A;  4H9Q B;  3REJ A;  4Z5T C;  5BT1 D;  4R8P A;  3A6N C;  3AZN D;  5BO0 A;  5B33 A;  5B32 D;  3AZG C;  1P3G C;  2Y2K A;  3MGQ A;  1W2E A;  5KDM A;  4XZQ D;  5GT3 B;  5DNN A;  1TZY C;  5CPJ D;  3KWQ D;  3UT9 A;  1A7W A;  2HIO B;  1U35 B;  4H9N A;  3TU4 A;  4WU8 D;  5B40 C;  2Y2L A;  1P3I D;  5GXQ B;  1P3P A;  1P3A D;  2ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...