4ZUXC

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
total genus 29
structure length 103
sequence length 103
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxC00
1S32A 4J8WD 5B40D 3LZ1B 1P3PD 4X23C 3KXBB 3UT9B 3AZMA 5GT0B 5DNMB 3X1VA 5B1LD 1F66B 5E5AB 3X1UD 5B2ID 1P3FA 1KX5B 1AOID 3LZ1A 2F8NB 4LD9B 1M18D 3X1VB 2F8NG 5AV6C 3W99B 5GSUA 5GT0D 4JJNA 5CPID 5BNXB 3LZ1D 4J8WB 3AZFC 1TZYB 2YFVA 3X1TB 1N1JA 3WA9C 3RELA 4ZUXC 4H9QB 1HQ3A 1M1AC 1TZYA 2YFVB 5B0ZB 3MNNC 5C3IC 1ID3C 4XUJA 5DNND 3AZNC 4KUDD 5AY8D 5KDMB 1N1JB 4H9RB 2NQBB 1P3LD 1KX5C 3LJAD 5B0YA 3AFAA 3A6NA 5AVBB 3AV1C 5KDMA 1P3PA 3WTPD 3AN2B 5B31D 5AV9D 4WU9C 3B0DC 1S32C 1H3OB 3KXBD 3UT9D 1P3PB 2NZDC 4G92B 3AZND 3TU4A 5B1MB 3AZJB 1WWIA 3MGPC 3KUYA 4J8UD 4H9SA 3C1CB 3B6FA 3REJA 1JFIA 5B33B 4Z2MG 5DNMC 3B0CT 4CAYA 5JRGC 4HGAC 4JJNC 4H9NB 1M1AD 5B32C 4E45A 3O62D 1P3BA 2HUEC 5DNNA 4KUDA 4CAYB 4QLCC 1P3KD 3AN2C 3AZGD 3A6ND 4NFTA 3LJAA 3AV1D 4G91C 5B31B 5DNNB 3TU4B 4KUDB 4J8XC 3LELD 4UUZA 3AZIC 3X1SD 1P3MC 4EO5C 3VH6A 3MGSA 3C1CA 3KWQA 1P3KC 3AZEB 2CWEA 3R45A 3LJAB 1EQZC 5C3IB 3AZHA 4NE3A 4KGCB 3WKJD 4UUZB 1BH9B 3REHB 3UTAD 3KWQC 3WA9A 3B6FD 5AV9B 3MGSC 1P34B 3REJC 2AROA 3AZED 5CPIA 3C1BB 5BNVA 5G49A 1BH9A 3W96B 2NZDA 3VH5A 3UTBA 5B2IB 4H9OB 3LZ0B 5B31A 4Z5TD 5DNMD 3W97C 3NQUA 1B6WA 2FJ7A 5G49B 3LZ0C 5B40B 4J8VD 2F8NK 3WKJC 3AV2B 5B1LC 3AZGA 3AZKB 5JA4B 1KU5A 3X1SB 4X23B 5CP6D 3MGRA 5B1LB 5AY8A 1P3GB 2CV5B 5F99A 4Z66C 3LELA 3X1SC 3AZKA 3AZGB 5B2JD 5AV8D 3LELB 3UTBB 4WU9A 3AV2D 5AVCB 3WA9D 2AROC 3AZFA 3NQUB 2HIOA 4DRAA 3WAAD 4WU9B 4NE5A 2PYOD 3C1CD 5AV8B 4YS3B 5AV6D 3AYWA 1EQZA 3AZFB 3X1SA 1P3FD 1A7WA 3B6GC 2BYKB 2HIOC 2LY8A 5F99B 1P3MA 1TAFB 3NQJB 1KX3B 5CPIC 4YS3A 3RELC 1EQZB 3REIC 4HGAB 5CPKC 5B0ZD 1F66C 5F99D 1P3MD 4AWLB 1KX4A 3AZNA 3W97A 4H9PA 5AV5A 2PYOB 3W98C 1ZLAB 1P3IA 1P3LC 1S32B 2BYMB 4CSRA 5GT3B 3MGRC 1KX3D 3WTPE 5AV8A 3WTPB 5DNMA 1U35C 3O62C 5AVBD 5B31G 1P3KB 1P3LA 4JJND 3AZLD 3WAAA 5BT1D 2YFWB 4YM6C 1P3MB 4DRBA 3B0BA 4EO5B 3MVDB 2FJ7C 5GT0C 4KHAA 3MGQA 3MGRD 2AROD 3C1CC 1P3KA 3REIB 3MNNA 1KX4B 5BS7A 5B33D 2RVQC 2HUEB 4QLCB 1P34C 3W99C 5AV5B 5AV6B 1U35D 4YS3D 4H9QA 1KX4D 5CPKD 1KX5A 1HQ3B 3MGSD 1F66D 2BYMA 1WWSA 5B0ZA 4M6BA 3WTPA 1P3BC 3TU4C 5B2IC 3UTAA 2RVQD 5AV6A 3W98A 5BO0A 4X23D 5AV5D 1P3AA 5B0ZC 4KHAB 5F99C 4Z66A 5AVBA 4J8VB 1F66A 3REHC 4ZBJB 4R8PC 5BO0B 3REIA 1P34D 3MGPA 3KUYC 1HQ3D 3AZLC 3AZGC 1M19A 1P3AB 1ZLAD 1M18A 4QLCA 5CP6B 3AZHC 4Z66B 1P3OA 1B67A 4ZUXD 4J8VA 4JJNB 3AYWC 3KWQD 2IO5C 5GXQC 5BT1C 3REKB 5CP6A 1P3OB 3B6FB 3UTAB 1M19D 4WU8C 5E5AA 5B24B 5B1MC 3AN2A 4H9SC 3AZIB 3REKA 3B0DB 1HTAA 4G91B 5B31C 4YM6B 5CPJA 4LD9D 2CV5C 5GSUB 4H9RA 3KXBC 3UT9C 3TU4D 5B1MA 5JRGA 1M19B 5E5AD 3AZKC 3KUYB 1KX4C 4Z5TC 3A6NB 4J8XD 5CPJB 3W97D 5B33A 3REKD 3RELB 3X1VC 4LD9C 5AVCC 2NQBC 2HIOD 5JRGB 4J8UB 3B6GD 4AWLC 4XUJB 3AZEA 1H3OA 3AZMD 1P3OC 3W96C 4XZQD 1P3BB 5B24A 4J8XB 2NQBA 5DNNC 3X1UA 3X1TC 3MGQC 5B32D 3AZIA 1P3GD 4KUDC 3KUYD 1TZYC 4J8UA 3REHA 3X1VD 1HQ3C 5B0YB 4R8PD 4XUJD 5AVCD 3AFAB 3WA9B 4YM6A 5B2JC 1JFIB 3UTBD 3B6GB 5CHLB 4XZQA 3AZMC 3X1UB 5BNVB 4KGCC 3AV2C 5AV8C 1AOIC 4ZBJC 5B0YD 4R8PB 3AFAD 2F8NH 2NQBD 5B32B 4H9OA 3V9RB 4XZQB 5CPKB 1P3BD 4KGCA 3AZJA 5B40A 5E5AC 3AZKD 3LELC 5B1MD 1P3FC 3REJB 5CP6C 4Z2MH 3RELD 3V9RA 5CPKA 3KSYA 5BS7C 4J8XA 3C1BA 3MGRB 4WNNA 3AV1A 5B1LA 5AY8B 1P3PC 4H9NA 5B40C 4KGCD 3AZEC 3AFAC 5B0YC 3R45B 3B6GA 3AZHD 3REJD 2L5AA 3C1BD 3MVDC 2FJ7B 4R8PA 5AV9A 5B32A 3O62A 3X1TD 5B32G 1S32D 1M1AA 4XZQC 5CPIB 1P3IC 1P3OD 1KX3C 4WZSB 5AV9C 3MGSB 2CV5A 5AV5C 3KWQB 5B2IA 2JSSA 3AZHB 3AYWB 4Z66D 4J8WC 4WNNB 4WV4B 3AV1B 1P3AD 5FUGA 3WKJB 3REID 1P34A 3NQJA 5AY8C 5AVCA 1BFMA 2AROB 3W99D 5GXQA 1ULYA 5B33C 5B24C 3LJAC 2HIOB 5JRGD 3W96A 3AYWD 2NZDB 1P3ID 5FUGB 3O62B 4QLCD 3AZNB 1KX5D 1ID3B 3AZJC 3LZ0A 1AOIB 3WKJA 1M1AB 1BH8A 3AZLA 1M19C 3WAAC 3LZ1C 5GT3D 4Z5TB 5CPJC 2BYKA 1P3GC 1ID3A 3C1BC 1TAFA 5AVBC 1AOIA 3AV2A 3MVDD 2NZDD 5JA4A 1BH8B 3AZLB 4X23A 3AZJD 1P3LB 3VH6W 3AZID 1P3GA 1ZLAC 4WU8B 3UTAC 3MGPD 5B24D 3VH6T 5CPJD 3MVDA 4J8UC 3W97B 2CV5D 3MGQB 4H9PB 1EQZD 2IO5B 5GXQB 3REHD 3REKC 2PYOA 1ZLAA 4WU8A 3MNNB 4YS3C 1R4VA 3W98D 4E44A 1TZYD 4Z5TA 5GXQD 3WAAB 3MGQD 3A6NC 3VH5W 3LZ0D 4J8VC 1P3AC 3AN2D 3W96D 3VH5T 5GSUD 5GT0A 4WU8D 3UTBC 2FJ7D 4YM6D 2PYOC 4NE6A 3W98B 1P3FB 3AZFD 1P3IB 1ID3D 4XUJC 3MNND 2F8NA 3B0CW 4CSRB 5GT3A 1KX3A 4LD9A 1U35A 4ZUXA 3W99A 5BNXA 5B2JA 3MGPB 1F1EA 2YFWA 3B6FC 4J8WA 3KXBA 3WTPC 5GT3C 3UT9A 3X1UC 3AZMB 3X1TA 1Q9CA 4G92C 1U35B 1M18B 2F8ND 4ZUXB 5GSUC 5B2JB 4WU9D 1M18C
chains in the Genus database with same CATH superfamily
1S32A 4J8WD 5B40D 3LZ1B 1P3PD 4X23C 3KXBB 3UT9B 3AZMA 5GT0B 5DNMB 3X1VA 5B1LD 1F66B 5E5AB 3X1UD 2BG1A 5B2ID 1P3FA 1KX5B 1AOID 3LZ1A 2F8NB 4LD9B 3A1KA 1M18D 3X1VB 2F8NG 5AV6C 3W99B 3FDDA 5GSUA 5GT0D 4JJNA 5CPID 5BNXB 3LZ1D 4J8WB 3AZFC 1TZYB 2YFVA 3X1TB 1N1JA 1Z2CB 3WA9C 3RELA 4ZUXC 4H9QB 1HQ3A 1M1AC 1TZYA 2YFVB 5B0ZB 3MNNC 5C3IC 1ID3C 4XUJA 5DNND 3AZNC 4KUDD 5AY8D 5KDMB 1N1JB 4H9RB 2NQBB 2ZY4A 1P3LD 1KX5C 3LJAD 5B0YA 3AFAA 3A6NA 5AVBB 3AV1C 5KDMA 1P3PA 3WTPD 3AN2B 5B31D 5AV9D 4WU9C 3B0DC 1S32C 1H3OB 3KXBD 3UT9D 1P3PB 2NZDC 4G92B 3AZND 3TU4A 3EPLA 2Y2MA 5B1MB 3AZJB 1WWIA 3MGPC 3KUYA 4J8UD 4H9SA 3C1CB 3B6FA 3REJA 1JFIA 5B33B 4Z2MG 3KFUG 5DNMC 3B0CT 4CAYA 5JRGC 4WJ3C 4HGAC 4JJNC 4H9NB 3F6TA 1M1AD 5B32C 4E45A 3O62D 1P3BA 2HUEC 5DNNA 4KUDA 4CAYB 4QLCC 1P3KD 3AN2C 3AZGD 3A6ND 4NFTA 3LJAA 3AV1D 4G91C 5B31B 5DNNB 3TU4B 4KUDB 4J8XC 3LELD 4UUZA 3AZIC 3X1SD 1P3MC 4EO5C 3VH6A 3MGSA 3C1CA 3KWQA 1P3KC 3AZEB 2ZM5A 2CWEA 3R45A 3P5JB 3LJAB 1EQZC 5C3IB 3AZHA 4NE3A 4KGCB 3WKJD 4UUZB 1BH9B 3REHB 3UTAD 3KWQC 3WA9A 3B6FD 5AV9B 3MGSC 1P34B 3REJC 2ZY3A 2AROA 3AZED 3EPHA 4UPKA 5CPIA 3C1BB 5BNVA 5G49A 1BH9A 2DQNC 3W96B 2NZDA 3VH5A 3UTBA 3H0RC 5B2IB 4H9OB 3LZ0B 2Y2OA 5B31A 4Z5TD 5DNMD 3W97C 3NQUA 1B6WA 2FJ7A 5G49B 2RIQA 3LZ0C 5B40B 4J8VD 2F8NK 3WKJC 3EPKA 3AV2B 5B1LC 3AZGA 3AZKB 5JA4B 1KU5A 3X1SB 4X23B 5CP6D 3MGRA 5B1LB 5AY8A 1P3GB 2CV5B 5F99A 4Z66C 2UWXA 3LELA 3X1SC 3AZKA 3AZGB 5B2JD 5AV8D 2XD5A 3LELB 3UTBB 4WU9A 3AV2D 5AVCB 3WA9D 2AROC 3AZFA 3AL0C 3NQUB 2HIOA 2ZY5A 4DRAA 3WAAD 4WU9B 4NE5A 2PYOD 3C1CD 5AV8B 4YS3B 5AV6D 3AYWA 1EQZA 3AZFB 3X1SA 1P3FD 1A7WA 2W8SA 3B6GC 2BYKB 2HIOC 2LY8A 5F99B 1P3MA 1TAFB 3NQJB 1KX3B 5CPIC 4YS3A 3RELC 1EQZB 3REIC 4HGAB 2J8PA 5CPKC 2JCHA 5B0ZD 1F66C 5F99D 1P3MD 4AWLB 1KX4A 3AZNA 3W97A 4H9PA 5AV5A 3IP4C 2PYOB 3W98C 1ZLAB 1P3IA 1P3LC 1S32B 2BYMB 4CSRA 5GT3B 3MGRC 1KX3D 3WTPE 5AV8A 3WTPB 5DNMA 1U35C 3O62C 3H0MC 5AVBD 5B31G 1P3KB 1P3LA 4JJND 3AZLD 3WAAA 5BT1D 2YFWB 4YM6C 2DF4C 2Y2LA 1P3MB 4DRBA 3B0BA 4EO5B 3MVDB 2FJ7C 5GT0C 3EG5B 4KHAA 3MGQA 3MGRD 2AROD 3C1CC 1P3KA 3REIB 3MNNA 1KX4B 5BS7A 5B33D 3EPJA 2RVQC 2HUEB 4QLCB 1P34C 3W99C 5AV5B 5AV6B 1U35D 4YS3D 4H9QA 1KX4D 5CPKD 1KX5A 1HQ3B 3MGSD 1F66D 2BYMA 1WWSA 3A1IA 5B0ZA 4M6BA 3WTPA 1P3BC 3TU4C 5B2IC 3UTAA 2VQRA 2RVQD 5AV6A 3W98A 5BO0A 4X23D 2Y2GA 5AV5D 1P3AA 5B0ZC 4KHAB 5F99C 4Z66A 5AVBA 4J8VB 1F66A 3REHC 4ZBJB 4R8PC 5BO0B 3REIA 1P34D 3MGPA 3KUYC 1HQ3D 3AZLC 3AZGC 1M19A 1P3AB 1ZLAD 1M18A 4QLCA 5CP6B 3AZHC 4Z66B 1P3OA 1B67A 4ZUXD 4J8VA 4JJNB 3AYWC 3KWQD 2IO5C 5GXQC 5BT1C 3REKB 5CP6A 1P3OB 3B6FB 3UTAB 1M19D 4WU8C 5E5AA 5B24B 5B1MC 3AN2A 4H9SC 3AZIB 3REKA 3B0DB 1HTAA 4G91B 5B31C 4YM6B 5CPJA 4LD9D 2CV5C 5GSUB 1PZRA 4H9RA 3KXBC 3UT9C 3TU4D 5B1MA 5JRGA 1M19B 5E5AD 3AZKC 2Y2NA 3KUYB 1KX4C 4Z5TC 3A6NB 4J8XD 5CPJB 3W97D 5B33A 3REKD 3RELB 3X1VC 4LD9C 2Y2PA 5AVCC 2NQBC 2HIOD 5JRGB 1T3UA 4J8UB 3B6GD 4AWLC 4XUJB 2G5HC 3AZEA 1H3OA 3AZMD 1P3OC 3W96C 4XZQD 1P3BB 5B24A 4J8XB 2NQBA 5DNNC 3X1UA 3X1TC 3MGQC 5B32D 3AZIA 1P3GD 4KUDC 3KUYD 1TZYC 4J8UA 1W2EA 3REHA 3X1VD 1HQ3C 2Y2QA 5B0YB 4XUJD 2JE5A 5AVCD 4R8PD 4YM6A 5B2JC 3AFAB 3WA9B 1JFIB 3UTBD 3B6GB 5CHLB 4XZQA 3AZMC 3X1UB 5BNVB 4KGCC 3AV2C 5AV8C 1AOIC 4ZBJC 5B0YD 4R8PB 3AFAD 2F8NH 2NQBD 5B32B 4H9OA 2Y2JA 3V9RB 4XZQB 5CPKB 1P3BD 4KGCA 3AZJA 5B40A 5E5AC 3AZKD 3LELC 5B1MD 1P3FC 2G5IC 3REJB 5CP6C 4Z2MH 3RELD 3V9RA 5CPKA 3KSYA 5BS7C 4J8XA 3C1BA 3MGRB 4WNNA 3AV1A 5B1LA 5AY8B 1P3PC 4H9NA 5B40C 4KGCD 3AZEC 5B0YC 3R45B 3AFAC 3B6GA 4DQYB 3AZHD 3REJD 2L5AA 3C1BD 3MVDC 2FJ7B 4R8PA 5AV9A 5B32A 3O62A 3X1TD 5B32G 1S32D 1M1AA 4XZQC 5CPIB 1P3IC 1P3OD 1KX3C 3H0LC 4WZSB 5AV9C 3MGSB 2CV5A 5AV5C 3KWQB 5B2IA 2JSSA 3AZHB 3AYWB 2Y2HA 4Z66D 4J8WC 4WNNB 4WV4B 3AV1B 1P3AD 5FUGA 3WKJB 3REID 1P34A 3NQJA 5AY8C 5AVCA 1BFMA 2AROB 3W99D 5GXQA 2Y2IA 1ULYA 5B33C 5B24C 2F2AC 3LJAC 2HIOB 5JRGD 3W96A 3AYWD 2NZDB 1P3ID 5FUGB 3O62B 4QLCD 3AZNB 1KX5D 1ID3B 3AZJC 3LZ0A 1AOIB 3WKJA 1M1AB 1BH8A 3AZLA 1M19C 3WAAC 3LZ1C 5GT3D 4Z5TB 5CPJC 2BYKA 2Y2KA 1P3GC 1ID3A 3C1BC 1TAFA 5AVBC 1AOIA 3AV2A 3MVDD 2NZDD 5JA4A 1BH8B 3AZLB 4X23A 3AZJD 1P3LB 3VH6W 3AZID 1P3GA 1ZLAC 4WU8B 3UTAC 3MGPD 5B24D 3VH6T 5CPJD 3MVDA 4J8UC 3W97B 2CV5D 3MGQB 4H9PB 1EQZD 2IO5B 5GXQB 3REHD 3REKC 2PYOA 1ZLAA 4WU8A 3MNNB 4YS3C 2ZY2A 1R4VA 3W98D 4E44A 1TZYD 2XD1A 4Z5TA 5GXQD 3WAAB 3MGQD 3A6NC 3VH5W 3LZ0D 4J8VC 1P3AC 3AN2D 3W96D 3VH5T 5GSUD 5GT0A 4WU8D 2FFFB 3UTBC 2FJ7D 4YM6D 2PYOC 4NE6A 3W98B 1P3FB 3AZFD 1P3IB 1ID3D 4XUJC 3MNND 2F8NA 3B0CW 4CSRB 5GT3A 1KX3A 4LD9A 1U35A 4ZUXA 3W99A 5BNXA 5B2JA 3MGPB 1F1EA 2YFWA 3B6FC 4J8WA 3KXBA 3WTPC 5GT3C 3UT9A 3X1UC 3AZMB 3X1TA 1Q9CA 4G92C 1U35B 1M18B 2F8ND 4ZUXB 5GSUC 5B2JB 4WU9D 1M18C
chains in the Genus database with same CATH topology
1S32A 4J8WD 5B40D 3LZ1B 1P3PD 4X23C 3KXBB 3UT9B 3AZMA 5GT0B 5DNMB 3X1VA 5B1LD 1F66B 5E5AB 3X1UD 2BG1A 5B2ID 1P3FA 1KX5B 1AOID 3LZ1A 2F8NB 4LD9B 3A1KA 1M18D 3X1VB 2F8NG 5AV6C 3W99B 3FDDA 5GSUA 5GT0D 4JJNA 5CPID 5BNXB 3LZ1D 4J8WB 3AZFC 1TZYB 2YFVA 3X1TB 1N1JA 1Z2CB 3WA9C 3RELA 4ZUXC 4H9QB 1HQ3A 1M1AC 1TZYA 2YFVB 5B0ZB 3MNNC 5C3IC 1ID3C 4XUJA 5DNND 3AZNC 4KUDD 5AY8D 5KDMB 1N1JB 4H9RB 2NQBB 2ZY4A 1P3LD 1KX5C 3LJAD 5B0YA 3AFAA 3A6NA 5AVBB 3AV1C 5KDMA 1P3PA 3WTPD 3AN2B 5B31D 5AV9D 4WU9C 3B0DC 1S32C 1H3OB 3KXBD 3UT9D 1P3PB 2NZDC 4G92B 3AZND 3TU4A 3EPLA 2Y2MA 5B1MB 3AZJB 1WWIA 3MGPC 3KUYA 4J8UD 4H9SA 3C1CB 3B6FA 3REJA 1JFIA 5B33B 4Z2MG 3KFUG 5DNMC 3B0CT 4CAYA 5JRGC 4WJ3C 4HGAC 4JJNC 4H9NB 3F6TA 1M1AD 5B32C 4E45A 3O62D 1P3BA 2HUEC 5DNNA 4KUDA 4CAYB 4QLCC 1P3KD 3AN2C 3AZGD 3A6ND 4NFTA 3LJAA 3AV1D 4G91C 5B31B 5DNNB 3TU4B 4KUDB 4J8XC 3LELD 4UUZA 3AZIC 3X1SD 1P3MC 4EO5C 3VH6A 3MGSA 3C1CA 3KWQA 1P3KC 3AZEB 2ZM5A 2CWEA 3R45A 3P5JB 3LJAB 1EQZC 5C3IB 3AZHA 4NE3A 4KGCB 3WKJD 4UUZB 1BH9B 3REHB 3UTAD 3KWQC 3WA9A 3B6FD 5AV9B 3MGSC 1P34B 3REJC 2ZY3A 2AROA 3AZED 3EPHA 4UPKA 5CPIA 3C1BB 5BNVA 5G49A 1BH9A 2DQNC 3W96B 2NZDA 3VH5A 3UTBA 3H0RC 5B2IB 4H9OB 3LZ0B 2Y2OA 5B31A 4Z5TD 5DNMD 3W97C 3NQUA 1B6WA 2FJ7A 5G49B 2RIQA 3LZ0C 5B40B 4J8VD 2F8NK 3WKJC 3EPKA 3AV2B 5B1LC 3AZGA 3AZKB 5JA4B 1KU5A 3X1SB 4X23B 5CP6D 3MGRA 5B1LB 5AY8A 1P3GB 2CV5B 5F99A 4Z66C 2UWXA 3LELA 3X1SC 3AZKA 3AZGB 5B2JD 5AV8D 2XD5A 3LELB 3UTBB 4WU9A 3AV2D 5AVCB 3WA9D 2AROC 3AZFA 3AL0C 3NQUB 2HIOA 2ZY5A 4DRAA 3WAAD 4WU9B 4NE5A 2PYOD 3C1CD 5AV8B 4YS3B 5AV6D 3AYWA 1EQZA 3AZFB 3X1SA 1P3FD 1A7WA 2W8SA 3B6GC 2BYKB 2HIOC 2LY8A 5F99B 1P3MA 1TAFB 3NQJB 1KX3B 5CPIC 4YS3A 3RELC 1EQZB 3REIC 4HGAB 2J8PA 5CPKC 2JCHA 5B0ZD 1F66C 5F99D 1P3MD 4AWLB 1KX4A 3AZNA 3W97A 4H9PA 5AV5A 3IP4C 2PYOB 3W98C 1ZLAB 1P3IA 1P3LC 1S32B 2BYMB 4CSRA 5GT3B 3MGRC 1KX3D 3WTPE 5AV8A 3WTPB 5DNMA 1U35C 3O62C 3H0MC 5AVBD 5B31G 1P3KB 1P3LA 4JJND 3AZLD 3WAAA 5BT1D 2YFWB 4YM6C 2DF4C 2Y2LA 1P3MB 4DRBA 3B0BA 4EO5B 3MVDB 2FJ7C 5GT0C 3EG5B 4KHAA 3MGQA 3MGRD 2AROD 3C1CC 1P3KA 3REIB 3MNNA 1KX4B 5BS7A 5B33D 3EPJA 2RVQC 2HUEB 4QLCB 1P34C 3W99C 5AV5B 5AV6B 1U35D 4YS3D 4H9QA 1KX4D 5CPKD 1KX5A 1HQ3B 3MGSD 1F66D 2BYMA 1WWSA 3A1IA 5B0ZA 4M6BA 3WTPA 1P3BC 3TU4C 5B2IC 3UTAA 2VQRA 2RVQD 5AV6A 3W98A 5BO0A 4X23D 2Y2GA 5AV5D 1P3AA 5B0ZC 4KHAB 5F99C 4Z66A 5AVBA 4J8VB 1F66A 3REHC 4ZBJB 4R8PC 5BO0B 3REIA 1P34D 3MGPA 3KUYC 1HQ3D 3AZLC 3AZGC 1M19A 1P3AB 1ZLAD 1M18A 4QLCA 5CP6B 3AZHC 4Z66B 1P3OA 1B67A 4ZUXD 4J8VA 4JJNB 3AYWC 3KWQD 2IO5C 5GXQC 5BT1C 3REKB 5CP6A 1P3OB 3B6FB 3UTAB 1M19D 4WU8C 5E5AA 5B24B 5B1MC 3AN2A 4H9SC 3AZIB 3REKA 3B0DB 1HTAA 4G91B 5B31C 4YM6B 5CPJA 4LD9D 2CV5C 5GSUB 1PZRA 4H9RA 3KXBC 3UT9C 3TU4D 5B1MA 5JRGA 1M19B 5E5AD 3AZKC 2Y2NA 3KUYB 1KX4C 4Z5TC 3A6NB 4J8XD 5CPJB 3W97D 5B33A 3REKD 3RELB 3X1VC 4LD9C 2Y2PA 5AVCC 2NQBC 2HIOD 5JRGB 1T3UA 4J8UB 3B6GD 4AWLC 4XUJB 2G5HC 3AZEA 1H3OA 3AZMD 1P3OC 3W96C 4XZQD 1P3BB 5B24A 4J8XB 2NQBA 5DNNC 3X1UA 3X1TC 3MGQC 5B32D 3AZIA 1P3GD 4KUDC 3KUYD 1TZYC 4J8UA 1W2EA 3REHA 3X1VD 1HQ3C 2Y2QA 5B0YB 4XUJD 2JE5A 5AVCD 4R8PD 4YM6A 5B2JC 3AFAB 3WA9B 1JFIB 3UTBD 3B6GB 5CHLB 4XZQA 3AZMC 3X1UB 5BNVB 4KGCC 3AV2C 5AV8C 1AOIC 4ZBJC 5B0YD 4R8PB 3AFAD 2F8NH 2NQBD 5B32B 4H9OA 2Y2JA 3V9RB 4XZQB 5CPKB 1P3BD 4KGCA 3AZJA 5B40A 5E5AC 3AZKD 3LELC 5B1MD 1P3FC 2G5IC 3REJB 5CP6C 4Z2MH 3RELD 3V9RA 5CPKA 3KSYA 5BS7C 4J8XA 3C1BA 3MGRB 4WNNA 3AV1A 5B1LA 5AY8B 1P3PC 4H9NA 5B40C 4KGCD 3AZEC 5B0YC 3R45B 3AFAC 3B6GA 4DQYB 3AZHD 3REJD 2L5AA 3C1BD 3MVDC 2FJ7B 4R8PA 5AV9A 5B32A 3O62A 3X1TD 5B32G 1S32D 1M1AA 4XZQC 5CPIB 1P3IC 1P3OD 1KX3C 3H0LC 4WZSB 5AV9C 3MGSB 2CV5A 5AV5C 3KWQB 5B2IA 2JSSA 3AZHB 3AYWB 2Y2HA 4Z66D 4J8WC 4WNNB 4WV4B 3AV1B 1P3AD 5FUGA 3WKJB 3REID 1P34A 3NQJA 5AY8C 5AVCA 1BFMA 2AROB 3W99D 5GXQA 2Y2IA 1ULYA 5B33C 5B24C 2F2AC 3LJAC 2HIOB 5JRGD 3W96A 3AYWD 2NZDB 1P3ID 5FUGB 3O62B 4QLCD 3AZNB 1KX5D 1ID3B 3AZJC 3LZ0A 1AOIB 3WKJA 1M1AB 1BH8A 3AZLA 1M19C 3WAAC 3LZ1C 5GT3D 4Z5TB 5CPJC 2BYKA 2Y2KA 1P3GC 1ID3A 3C1BC 1TAFA 5AVBC 1AOIA 3AV2A 3MVDD 2NZDD 5JA4A 1BH8B 3AZLB 4X23A 3AZJD 1P3LB 3VH6W 3AZID 1P3GA 1ZLAC 4WU8B 3UTAC 3MGPD 5B24D 3VH6T 5CPJD 3MVDA 4J8UC 3W97B 2CV5D 3MGQB 4H9PB 1EQZD 2IO5B 5GXQB 3REHD 3REKC 2PYOA 1ZLAA 4WU8A 3MNNB 4YS3C 2ZY2A 1R4VA 3W98D 4E44A 1TZYD 2XD1A 4Z5TA 5GXQD 3WAAB 3MGQD 3A6NC 3VH5W 3LZ0D 4J8VC 1P3AC 3AN2D 3W96D 3VH5T 5GSUD 5GT0A 4WU8D 2FFFB 3UTBC 2FJ7D 4YM6D 2PYOC 4NE6A 3W98B 1P3FB 3AZFD 1P3IB 1ID3D 4XUJC 3MNND 2F8NA 3B0CW 4CSRB 5GT3A 1KX3A 4LD9A 1U35A 4ZUXA 3W99A 5BNXA 5B2JA 3MGPB 1F1EA 2YFWA 3B6FC 4J8WA 3KXBA 3WTPC 5GT3C 3UT9A 3X1UC 3AZMB 3X1TA 1Q9CA 4G92C 1U35B 1M18B 2F8ND 4ZUXB 5GSUC 5B2JB 4WU9D 1M18C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 A;  4J8W D;  5B40 D;  3LZ1 B;  1P3P D;  4X23 C;  3KXB B;  3UT9 B;  3AZM A;  5GT0 B;  5DNM B;  3X1V A;  5B1L D;  1F66 B;  5E5A B;  3X1U D;  5B2I D;  1P3F A;  1KX5 B;  1AOI D;  3LZ1 A;  2F8N B;  4LD9 B;  1M18 D;  3X1V B;  2F8N G;  5AV6 C;  3W99 B;  5GSU A;  5GT0 D;  4JJN A;  5CPI D;  5BNX B;  3LZ1 D;  4J8W B;  3AZF C;  1TZY B;  2YFV A;  3X1T B;  1N1J A;  3WA9 C;  3REL A;  4ZUX C;  4H9Q B;  1HQ3 A;  1M1A C;  1TZY A;  2YFV B;  5B0Z B;  3MNN C;  5C3I C;  1ID3 C;  4XUJ A;  5DNN D;  3AZN C;  4KUD D;  5AY8 D;  5KDM B;  1N1J B;  4H9R B;  2NQB B;  1P3L D;  1KX5 C;  3LJA D;  5B0Y A;  3AFA A;  3A6N A;  5AVB B;  3AV1 C;  5KDM A;  1P3P A;  3WTP D;  3AN2 B;  5B31 D;  5AV9 D;  4WU9 C;  3B0D C;  1S32 C;  1H3O B;  3KXB D;  3UT9 D;  1P3P B;  2NZD C;  4G92 B;  3AZN D;  3TU4 A;  5B1M B;  3AZJ B;  1WWI A;  3MGP C;  3KUY A;  4J8U D;  4H9S A;  3C1C B;  3B6F A;  3REJ A;  1JFI A;  5B33 B;  4Z2M G;  5DNM C;  3B0C T;  4CAY A;  5JRG C;  4HGA C;  4JJN C;  4H9N B;  1M1A D;  5B32 C;  4E45 A;  3O62 D;  1P3B A;  2HUE C;  5DNN A;  4KUD A;  4CAY B;  4QLC C;  1P3K D;  3AN2 C;  3AZG D;  3A6N D;  4NFT A;  3LJA A;  3AV1 D;  4G91 C;  5B31 B;  5DNN B;  3TU4 B;  4KUD B;  4J8X C;  3LEL D;  4UUZ A;  3AZI C;  3X1S D;  1P3M C;  4EO5 C;  3VH6 A;  3MGS A;  3C1C A;  3KWQ A;  1P3K C;  3AZE B;  2CWE A;  3R45 A;  3LJA B;  1EQZ C;  5C3I B;  3AZH A;  4NE3 A;  4KGC B;  3WKJ D;  4UUZ B;  1BH9 B;  3REH B;  3UTA D;  3KWQ C;  3WA9 A;  3B6F D;  5AV9 B;  3MGS C;  1P34 B;  3REJ C;  2ARO A;  3AZE D;  5CPI A;  3C1B B;  5BNV A;  5G49 A;  1BH9 A;  3W96 B;  2NZD A;  3VH5 A;  3UTB A;  5B2I B;  4H9O B;  3LZ0 B;  5B31 A;  4Z5T D;  5DNM D;  3W97 C;  3NQU A;  1B6W A;  2FJ7 A;  5G49 B;  3LZ0 C;  5B40 B;  4J8V D;  2F8N K;  3WKJ C;  3AV2 B;  5B1L C;  3AZG A;  3AZK B;  5JA4 B;  1KU5 A;  3X1S B;  4X23 B;  5CP6 D;  3MGR A;  5B1L B;  5AY8 A;  1P3G B;  2CV5 B;  5F99 A;  4Z66 C;  3LEL A;  3X1S C;  3AZK A;  3AZG B;  5B2J D;  5AV8 D;  3LEL B;  3UTB B;  4WU9 A;  3AV2 D;  5AVC B;  3WA9 D;  2ARO C;  3AZF A;  3NQU B;  2HIO A;  4DRA A;  3WAA D;  4WU9 B;  4NE5 A;  2PYO D;  3C1C D;  5AV8 B;  4YS3 B;  5AV6 D;  3AYW A;  1EQZ A;  3AZF B;  3X1S A;  1P3F D;  1A7W A;  3B6G C;  2BYK B;  2HIO C;  2LY8 A;  5F99 B;  1P3M A;  1TAF B;  3NQJ B;  1KX3 B;  5CPI C;  4YS3 A;  3REL C;  1EQZ B;  3REI C;  4HGA B;  5CPK C;  5B0Z D;  1F66 C;  5F99 D;  1P3M D;  4AWL B;  1KX4 A;  3AZN A;  3W97 A;  4H9P A;  5AV5 A;  2PYO B;  3W98 C;  1ZLA B;  1P3I A;  1P3L C;  1S32 B;  2BYM B;  4CSR A;  5GT3 B;  3MGR C;  1KX3 D;  3WTP E;  5AV8 A;  3WTP B;  5DNM A;  1U35 C;  3O62 C;  5AVB D;  5B31 G;  1P3K B;  1P3L A;  4JJN D;  3AZL D;  3WAA A;  5BT1 D;  2YFW B;  4YM6 C;  1P3M B;  4DRB A;  3B0B A;  4EO5 B;  3MVD B;  2FJ7 C;  5GT0 C;  4KHA A;  3MGQ A;  3MGR D;  2ARO D;  3C1C C;  1P3K A;  3REI B;  3MNN A;  1KX4 B;  5BS7 A;  5B33 D;  2RVQ C;  2HUE B;  4QLC B;  1P34 C;  3W99 C;  5AV5 B;  5AV6 B;  1U35 D;  4YS3 D;  4H9Q A;  1KX4 D;  5CPK D;  1KX5 A;  1HQ3 B;  3MGS D;  1F66 D;  2BYM A;  1WWS A;  5B0Z A;  4M6B A;  3WTP A;  1P3B C;  3TU4 C;  5B2I C;  3UTA A;  2RVQ D;  5AV6 A;  3W98 A;  5BO0 A;  4X23 D;  5AV5 D;  1P3A A;  5B0Z C;  4KHA B;  5F99 C;  4Z66 A;  5AVB A;  4J8V B;  1F66 A;  3REH C;  4ZBJ B;  4R8P C;  5BO0 B;  3REI A;  1P34 D;  3MGP A;  3KUY C;  1HQ3 D;  3AZL C;  3AZG C;  1M19 A;  1P3A B;  1ZLA D;  1M18 A;  4QLC A;  5CP6 B;  3AZH C;  4Z66 B;  1P3O A;  1B67 A;  4ZUX D;  4J8V A;  4JJN B;  3AYW C;  3KWQ D;  2IO5 C;  5GXQ C;  5BT1 C;  3REK B;  5CP6 A;  1P3O B;  3B6F B;  3UTA B;  1M19 D;  4WU8 C;  5E5A A;  5B24 B;  5B1M C;  3AN2 A;  4H9S C;  3AZI B;  3REK A;  3B0D B;  1HTA A;  4G91 B;  5B31 C;  4YM6 B;  5CPJ A;  4LD9 D;  2CV5 C;  5GSU B;  4H9R A;  3KXB C;  3UT9 C;  3TU4 D;  5B1M A;  5JRG A;  1M19 B;  5E5A D;  3AZK C;  3KUY B;  1KX4 C;  4Z5T C;  3A6N B;  4J8X D;  5CPJ B;  3W97 D;  5B33 A;  3REK D;  3REL B;  3X1V C;  4LD9 C;  5AVC C;  2NQB C;  2HIO D;  5JRG B;  4J8U B;  3B6G D;  4AWL C;  4XUJ B;  3AZE A;  1H3O A;  3AZM D;  1P3O C;  3W96 C;  4XZQ D;  1P3B B;  5B24 A;  4J8X B;  2NQB A;  5DNN C;  3X1U A;  3X1T C;  3MGQ C;  5B32 D;  3AZI A;  1P3G D;  4KUD C;  3KUY D;  1TZY C;  4J8U A;  3REH A;  3X1V D;  1HQ3 C;  5B0Y B;  4R8P D;  4XUJ D;  5AVC D;  3AFA B;  3WA9 B;  4YM6 A;  5B2J C;  1JFI B;  3UTB D;  3B6G B;  5CHL B;  4XZQ A;  3AZM C;  3X1U B;  5BNV B;  4KGC C;  3AV2 C;  5AV8 C;  1AOI C;  4ZBJ C;  5B0Y D;  4R8P B;  3AFA D;  2F8N H;  2NQB D;  5B32 B;  4H9O A;  3V9R B;  4XZQ B;  5CPK B;  1P3B D;  4KGC A;  3AZJ A;  5B40 A;  5E5A C;  3AZK D;  3LEL C;  5B1M D;  1P3F C;  3REJ B;  5CP6 C;  4Z2M H;  3REL D;  3V9R A;  5CPK A;  3KSY A;  5BS7 C;  4J8X A;  3C1B A;  3MGR B;  4WNN A;  3AV1 A;  5B1L A;  5AY8 B;  1P3P C;  4H9N A;  5B40 C;  4KGC D;  3AZE C;  3AFA C;  5B0Y C;  3R45 B;  3B6G A;  3AZH D;  3REJ D;  2L5A A;  3C1B D;  3MVD C;  2FJ7 B;  4R8P A;  5AV9 A;  5B32 A;  3O62 A;  3X1T D;  5B32 G;  1S32 D;  1M1A A;  4XZQ C;  5CPI B;  1P3I C;  1P3O D;  1KX3 C;  4WZS B;  5AV9 C;  3MGS B;  2CV5 A;  5AV5 C;  3KWQ B;  5B2I A;  2JSS A;  3AZH B;  3AYW B;  4Z66 D;  4J8W C;  4WNN B;  4WV4 B;  3AV1 B;  1P3A D;  5FUG A;  3WKJ B;  3REI D;  1P34 A;  3NQJ A;  5AY8 C;  5AVC A;  1BFM A;  2ARO B;  3W99 D;  5GXQ A;  1ULY A;  5B33 C;  5B24 C;  3LJA C;  2HIO B;  5JRG D;  3W96 A;  3AYW D;  2NZD B;  1P3I D;  5FUG B;  3O62 B;  4QLC D;  3AZN B;  1KX5 D;  1ID3 B;  3AZJ C;  3LZ0 A;  1AOI B;  3WKJ A;  1M1A B;  1BH8 A;  3AZL A;  1M19 C;  3WAA C;  3LZ1 C;  5GT3 D;  4Z5T B;  5CPJ C;  2BYK A;  1P3G C;  1ID3 A;  3C1B C;  1TAF A;  5AVB C;  1AOI A;  3AV2 A;  3MVD D;  2NZD D;  5JA4 A;  1BH8 B;  3AZL B;  4X23 A;  3AZJ D;  1P3L B;  3VH6 W;  3AZI D;  1P3G A;  1ZLA C;  4WU8 B;  3UTA C;  3MGP D;  5B24 D;  3VH6 T;  5CPJ D;  3MVD A;  4J8U C;  3W97 B;  2CV5 D;  3MGQ B;  4H9P B;  1EQZ D;  2IO5 B;  5GXQ B;  3REH D;  3REK C;  2PYO A;  1ZLA A;  4WU8 A;  3MNN B;  4YS3 C;  1R4V A;  3W98 D;  4E44 A;  1TZY D;  4Z5T A;  5GXQ D;  3WAA B;  3MGQ D;  3A6N C;  3VH5 W;  3LZ0 D;  4J8V C;  1P3A C;  3AN2 D;  3W96 D;  3VH5 T;  5GSU D;  5GT0 A;  4WU8 D;  3UTB C;  2FJ7 D;  4YM6 D;  2PYO C;  4NE6 A;  3W98 B;  1P3F B;  3AZF D;  1P3I B;  1ID3 D;  4XUJ C;  3MNN D;  2F8N A;  3B0C W;  4CSR B;  5GT3 A;  1KX3 A;  4LD9 A;  1U35 A;  4ZUX A;  3W99 A;  5BNX A;  5B2J A;  3MGP B;  1F1E A;  2YFW A;  3B6F C;  4J8W A;  3KXB A;  3WTP C;  5GT3 C;  3UT9 A;  3X1U C;  3AZM B;  3X1T A;  1Q9C A;  4G92 C;  1U35 B;  1M18 B;  2F8N D;  4ZUX B;  5GSU C;  5B2J B;  4WU9 D;  1M18 C; 
#chains in the Genus database with same CATH topology
 1S32 A;  4J8W D;  5B40 D;  3LZ1 B;  1P3P D;  4X23 C;  3KXB B;  3UT9 B;  3AZM A;  5GT0 B;  5DNM B;  3X1V A;  5B1L D;  1F66 B;  5E5A B;  3X1U D;  2BG1 A;  5B2I D;  1P3F A;  1KX5 B;  1AOI D;  3LZ1 A;  2F8N B;  4LD9 B;  3A1K A;  1M18 D;  3X1V B;  2F8N G;  5AV6 C;  3W99 B;  3FDD A;  5GSU A;  5GT0 D;  4JJN A;  5CPI D;  5BNX B;  3LZ1 D;  4J8W B;  3AZF C;  1TZY B;  2YFV A;  3X1T B;  1N1J A;  1Z2C B;  3WA9 C;  3REL A;  4ZUX C;  4H9Q B;  1HQ3 A;  1M1A C;  1TZY A;  2YFV B;  5B0Z B;  3MNN C;  5C3I C;  1ID3 C;  4XUJ A;  5DNN D;  3AZN C;  4KUD D;  5AY8 D;  5KDM B;  1N1J B;  4H9R B;  2NQB B;  2ZY4 A;  1P3L D;  1KX5 C;  3LJA D;  5B0Y A;  3AFA A;  3A6N A;  5AVB B;  3AV1 C;  5KDM A;  1P3P A;  3WTP D;  3AN2 B;  5B31 D;  5AV9 D;  4WU9 C;  3B0D C;  1S32 C;  1H3O B;  3KXB D;  3UT9 D;  1P3P B;  2NZD C;  4G92 B;  3AZN D;  3TU4 A;  3EPL A;  2Y2M A;  5B1M B;  3AZJ B;  1WWI A;  3MGP C;  3KUY A;  4J8U D;  4H9S A;  3C1C B;  3B6F A;  3REJ A;  1JFI A;  5B33 B;  4Z2M G;  3KFU G;  5DNM C;  3B0C T;  4CAY A;  5JRG C;  4WJ3 C;  4HGA C;  4JJN C;  4H9N B;  3F6T A;  1M1A D;  5B32 C;  4E45 A;  3O62 D;  1P3B A;  2HUE C;  5DNN A;  4KUD A;  4CAY B;  4QLC C;  1P3K D;  3AN2 C;  3AZG D;  3A6N D;  4NFT A;  3LJA A;  3AV1 D;  4G91 C;  5B31 B;  5DNN B;  3TU4 B;  4KUD B;  4J8X C;  3LEL D;  4UUZ A;  3AZI C;  3X1S D;  1P3M C;  4EO5 C;  3VH6 A;  3MGS A;  3C1C A;  3KWQ A;  1P3K C;  3AZE B;  2ZM5 A;  2CWE A;  3R45 A;  3P5J B;  3LJA B;  1EQZ C;  5C3I B;  3AZH A;  4NE3 A;  4KGC B;  3WKJ D;  4UUZ B;  1BH9 B;  3REH B;  3UTA D;  3KWQ C;  3WA9 A;  3B6F D;  5AV9 B;  3MGS C;  1P34 B;  3REJ C;  2ZY3 A;  2ARO A;  3AZE D;  3EPH A;  4UPK A;  5CPI A;  3C1B B;  5BNV A;  5G49 A;  1BH9 A;  2DQN C;  3W96 B;  2NZD A;  3VH5 A;  3UTB A;  3H0R C;  5B2I B;  4H9O B;  3LZ0 B;  2Y2O A;  5B31 A;  4Z5T D;  5DNM D;  3W97 C;  3NQU A;  1B6W A;  2FJ7 A;  5G49 B;  2RIQ A;  3LZ0 C;  5B40 B;  4J8V D;  2F8N K;  3WKJ C;  3EPK A;  3AV2 B;  5B1L C;  3AZG A;  3AZK B;  5JA4 B;  1KU5 A;  3X1S B;  4X23 B;  5CP6 D;  3MGR A;  5B1L B;  5AY8 A;  1P3G B;  2CV5 B;  5F99 A;  4Z66 C;  2UWX A;  3LEL A;  3X1S C;  3AZK A;  3AZG B;  5B2J D;  5AV8 D;  2XD5 A;  3LEL B;  3UTB B;  4WU9 A;  3AV2 D;  5AVC B;  3WA9 D;  2ARO C;  3AZF A;  3AL0 C;  3NQU B;  2HIO A;  2ZY5 A;  4DRA A;  3WAA D;  4WU9 B;  4NE5 A;  2PYO D;  3C1C D;  5AV8 B;  4YS3 B;  5AV6 D;  3AYW A;  1EQZ A;  3AZF B;  3X1S A;  1P3F D;  1A7W A;  2W8S A;  3B6G C;  2BYK B;  2HIO C;  2LY8 A;  5F99 B;  1P3M A;  1TAF B;  3NQJ B;  1KX3 B;  5CPI C;  4YS3 A;  3REL C;  1EQZ B;  3REI C;  4HGA B;  2J8P A;  5CPK C;  2JCH A;  5B0Z D;  1F66 C;  5F99 D;  1P3M D;  4AWL B;  1KX4 A;  3AZN A;  3W97 A;  4H9P A;  5AV5 A;  3IP4 C;  2PYO B;  3W98 C;  1ZLA B;  1P3I A;  1P3L C;  1S32 B;  2BYM B;  4CSR A;  5GT3 B;  3MGR C;  1KX3 D;  3WTP E;  5AV8 A;  3WTP B;  5DNM A;  1U35 C;  3O62 C;  3H0M C;  5AVB D;  5B31 G;  1P3K B;  1P3L A;  4JJN D;  3AZL D;  3WAA A;  5BT1 D;  2YFW B;  4YM6 C;  2DF4 C;  2Y2L A;  1P3M B;  4DRB A;  3B0B A;  4EO5 B;  3MVD B;  2FJ7 C;  5GT0 C;  3EG5 B;  4KHA A;  3MGQ A;  3MGR D;  2ARO D;  3C1C C;  1P3K A;  3REI B;  3MNN A;  1KX4 B;  5BS7 A;  5B33 D;  3EPJ A;  2RVQ C;  2HUE B;  4QLC B;  1P34 C;  3W99 C;  5AV5 B;  5AV6 B;  1U35 D;  4YS3 D;  4H9Q A;  1KX4 D;  5CPK D;  1KX5 A;  1HQ3 B;  3MGS D;  1F66 D;  2BYM A;  1WWS A;  3A1I A;  5B0Z A;  4M6B A;  3WTP A;  1P3B C;  3TU4 C;  5B2I C;  3UTA A;  2VQR A;  2RVQ D;  5AV6 A;  3W98 A;  5BO0 A;  4X23 D;  2Y2G A;  5AV5 D;  1P3A A;  5B0Z C;  4KHA B;  5F99 C;  4Z66 A;  5AVB A;  4J8V B;  1F66 A;  3REH C;  4ZBJ B;  4R8P C;  5BO0 B;  3REI A;  1P34 D;  3MGP A;  3KUY C;  1HQ3 D;  3AZL C;  3AZG C;  1M19 A;  1P3A B;  1ZLA D;  1M18 A;  4QLC A;  5CP6 B;  3AZH C;  4Z66 B;  1P3O A;  1B67 A;  4ZUX D;  4J8V A;  4JJN B;  3AYW C;  3KWQ D;  2IO5 C;  5GXQ C;  5BT1 C;  3REK B;  5CP6 A;  1P3O B;  3B6F B;  3UTA B;  1M19 D;  4WU8 C;  5E5A A;  5B24 B;  5B1M C;  3AN2 A;  4H9S C;  3AZI B;  3REK A;  3B0D B;  1HTA A;  4G91 B;  5B31 C;  4YM6 B;  5CPJ A;  4LD9 D;  2CV5 C;  5GSU B;  1PZR A;  4H9R A;  3KXB C;  3UT9 C;  3TU4 D;  5B1M A;  5JRG A;  1M19 B;  5E5A D;  3AZK C;  2Y2N A;  3KUY B;  1KX4 C;  4Z5T C;  3A6N B;  4J8X D;  5CPJ B;  3W97 D;  5B33 A;  3REK D;  3REL B;  3X1V C;  4LD9 C;  2Y2P A;  5AVC C;  2NQB C;  2HIO D;  5JRG B;  1T3U A;  4J8U B;  3B6G D;  4AWL C;  4XUJ B;  2G5H C;  3AZE A;  1H3O A;  3AZM D;  1P3O C;  3W96 C;  4XZQ D;  1P3B B;  5B24 A;  4J8X B;  2NQB A;  5DNN C;  3X1U A;  3X1T C;  3MGQ C;  5B32 D;  3AZI A;  1P3G D;  4KUD C;  3KUY D;  1TZY C;  4J8U A;  1W2E A;  3REH A;  3X1V D;  1HQ3 C;  2Y2Q A;  5B0Y B;  4XUJ D;  2JE5 A;  5AVC D;  4R8P D;  4YM6 A;  5B2J C;  3AFA B;  3WA9 B;  1JFI B;  3UTB D;  3B6G B;  5CHL B;  4XZQ A;  3AZM C;  3X1U B;  5BNV B;  4KGC C;  3AV2 C;  5AV8 C;  1AOI C;  4ZBJ C;  5B0Y D;  4R8P B;  3AFA D;  2F8N H;  2NQB D;  5B32 B;  4H9O A;  2Y2J A;  3V9R B;  4XZQ B;  5CPK B;  1P3B D;  4KGC A;  3AZJ A;  5B40 A;  5E5A C;  3AZK D;  3LEL C;  5B1M D;  1P3F C;  2G5I C;  3REJ B;  5CP6 C;  4Z2M H;  3REL D;  3V9R A;  5CPK A;  3KSY A;  5BS7 C;  4J8X A;  3C1B A;  3MGR B;  4WNN A;  3AV1 A;  5B1L A;  5AY8 B;  1P3P C;  4H9N A;  5B40 C;  4KGC D;  3AZE C;  5B0Y C;  3R45 B;  3AFA C;  3B6G A;  4DQY B;  3AZH D;  3REJ D;  2L5A A;  3C1B D;  3MVD C;  2FJ7 B;  4R8P A;  5AV9 A;  5B32 A;  3O62 A;  3X1T D;  5B32 G;  1S32 D;  1M1A A;  4XZQ C;  5CPI B;  1P3I C;  1P3O D;  1KX3 C;  3H0L C;  4WZS B;  5AV9 C;  3MGS B;  2CV5 A;  5AV5 C;  3KWQ B;  5B2I A;  2JSS A;  3AZH B;  3AYW B;  2Y2H A;  4Z66 D;  4J8W C;  4WNN B;  4WV4 B;  3AV1 B;  1P3A D;  5FUG A;  3WKJ B;  3REI D;  1P34 A;  3NQJ A;  5AY8 C;  5AVC A;  1BFM A;  2ARO B;  3W99 D;  5GXQ A;  2Y2I A;  1ULY A;  5B33 C;  5B24 C;  2F2A C;  3LJA C;  2HIO B;  5JRG D;  3W96 A;  3AYW D;  2NZD B;  1P3I D;  5FUG B;  3O62 B;  4QLC D;  3AZN B;  1KX5 D;  1ID3 B;  3AZJ C;  3LZ0 A;  1AOI B;  3WKJ A;  1M1A B;  1BH8 A;  3AZL A;  1M19 C;  3WAA C;  3LZ1 C;  5GT3 D;  4Z5T B;  5CPJ C;  2BYK A;  2Y2K A;  1P3G C;  1ID3 A;  3C1B C;  1TAF A;  5AVB C;  1AOI A;  3AV2 A;  3MVD D;  2NZD D;  5JA4 A;  1BH8 B;  3AZL B;  4X23 A;  3AZJ D;  1P3L B;  3VH6 W;  3AZI D;  1P3G A;  1ZLA C;  4WU8 B;  3UTA C;  3MGP D;  5B24 D;  3VH6 T;  5CPJ D;  3MVD A;  4J8U C;  3W97 B;  2CV5 D;  3MGQ B;  4H9P B;  1EQZ D;  2IO5 B;  5GXQ B;  3REH D;  3REK C;  2PYO A;  1ZLA A;  4WU8 A;  3MNN B;  4YS3 C;  2ZY2 A;  1R4V A;  3W98 D;  4E44 A;  1TZY D;  2XD1 A;  4Z5T A;  5GXQ D;  3WAA B;  3MGQ D;  3A6N C;  3VH5 W;  3LZ0 D;  4J8V C;  1P3A C;  3AN2 D;  3W96 D;  3VH5 T;  5GSU D;  5GT0 A;  4WU8 D;  2FFF B;  3UTB C;  2FJ7 D;  4YM6 D;  2PYO C;  4NE6 A;  3W98 B;  1P3F B;  3AZF D;  1P3I B;  1ID3 D;  4XUJ C;  3MNN D;  2F8N A;  3B0C W;  4CSR B;  5GT3 A;  1KX3 A;  4LD9 A;  1U35 A;  4ZUX A;  3W99 A;  5BNX A;  5B2J A;  3MGP B;  1F1E A;  2YFW A;  3B6F C;  4J8W A;  3KXB A;  3WTP C;  5GT3 C;  3UT9 A;  3X1U C;  3AZM B;  3X1T A;  1Q9C A;  4G92 C;  1U35 B;  1M18 B;  2F8N D;  4ZUX B;  5GSU C;  5B2J B;  4WU9 D;  1M18 C; 
#chains in the Genus database with same CATH homology
 1S32 A;  4J8W D;  5B40 D;  3LZ1 B;  1P3P D;  4X23 C;  3KXB B;  3UT9 B;  3AZM A;  5GT0 B;  5DNM B;  3X1V A;  5B1L D;  1F66 B;  5E5A B;  3X1U D;  2BG1 A;  5B2I D;  1P3F A;  1KX5 B;  1AOI D;  3LZ1 A;  2F8N B;  4LD9 B;  3A1K A;  1M18 D;  3X1V B;  2F8N G;  5AV6 C;  3W99 B;  3FDD A;  5GSU A;  5GT0 D;  4JJN A;  5CPI D;  5BNX B;  3LZ1 D;  4J8W B;  3AZF C;  1TZY B;  2YFV A;  3X1T B;  1N1J A;  1Z2C B;  3WA9 C;  3REL A;  4ZUX C;  4H9Q B;  1HQ3 A;  1M1A C;  1TZY A;  2YFV B;  5B0Z B;  3MNN C;  5C3I C;  1ID3 C;  4XUJ A;  5DNN D;  3AZN C;  4KUD D;  5AY8 D;  5KDM B;  1N1J B;  4H9R B;  2NQB B;  2ZY4 A;  1P3L D;  1KX5 C;  3LJA D;  5B0Y A;  3AFA A;  3A6N A;  5AVB B;  3AV1 C;  5KDM A;  1P3P A;  3WTP D;  3AN2 B;  5B31 D;  5AV9 D;  4WU9 C;  3B0D C;  1S32 C;  1H3O B;  3KXB D;  3UT9 D;  1P3P B;  2NZD C;  4G92 B;  3AZN D;  3TU4 A;  3EPL A;  2Y2M A;  5B1M B;  3AZJ B;  1WWI A;  3MGP C;  3KUY A;  4J8U D;  4H9S A;  3C1C B;  3B6F A;  3REJ A;  1JFI A;  5B33 B;  4Z2M G;  3KFU G;  5DNM C;  3B0C T;  4CAY A;  5JRG C;  4WJ3 C;  4HGA C;  4JJN C;  4H9N B;  3F6T A;  1M1A D;  5B32 C;  4E45 A;  3O62 D;  1P3B A;  2HUE C;  5DNN A;  4KUD A;  4CAY B;  4QLC C;  1P3K D;  3AN2 C;  3AZG D;  3A6N D;  4NFT A;  3LJA A;  3AV1 D;  4G91 C;  5B31 B;  5DNN B;  3TU4 B;  4KUD B;  4J8X C;  3LEL D;  4UUZ A;  3AZI C;  3X1S D;  1P3M C;  4EO5 C;  3VH6 A;  3MGS A;  3C1C A;  3KWQ A;  1P3K C;  3AZE B;  2ZM5 A;  2CWE A;  3R45 A;  3P5J B;  3LJA B;  1EQZ C;  5C3I B;  3AZH A;  4NE3 A;  4KGC B;  3WKJ D;  4UUZ B;  1BH9 B;  3REH B;  3UTA D;  3KWQ C;  3WA9 A;  3B6F D;  5AV9 B;  3MGS C;  1P34 B;  3REJ C;  2ZY3 A;  2ARO A;  3AZE D;  3EPH A;  4UPK A;  5CPI A;  3C1B B;  5BNV A;  5G49 A;  1BH9 A;  2DQN C;  3W96 B;  2NZD A;  3VH5 A;  3UTB A;  3H0R C;  5B2I B;  4H9O B;  3LZ0 B;  2Y2O A;  5B31 A;  4Z5T D;  5DNM D;  3W97 C;  3NQU A;  1B6W A;  2FJ7 A;  5G49 B;  2RIQ A;  3LZ0 C;  5B40 B;  4J8V D;  2F8N K;  3WKJ C;  3EPK A;  3AV2 B;  5B1L C;  3AZG A;  3AZK B;  5JA4 B;  1KU5 A;  3X1S B;  4X23 B;  5CP6 D;  3MGR A;  5B1L B;  5AY8 A;  1P3G B;  2CV5 B;  5F99 A;  4Z66 C;  2UWX A;  3LEL A;  3X1S C;  3AZK A;  3AZG B;  5B2J D;  5AV8 D;  2XD5 A;  3LEL B;  3UTB B;  4WU9 A;  3AV2 D;  5AVC B;  3WA9 D;  2ARO C;  3AZF A;  3AL0 C;  3NQU B;  2HIO A;  2ZY5 A;  4DRA A;  3WAA D;  4WU9 B;  4NE5 A;  2PYO D;  3C1C D;  5AV8 B;  4YS3 B;  5AV6 D;  3AYW A;  1EQZ A;  3AZF B;  3X1S A;  1P3F D;  1A7W A;  2W8S A;  3B6G C;  2BYK B;  2HIO C;  2LY8 A;  5F99 B;  1P3M A;  1TAF B;  3NQJ B;  1KX3 B;  5CPI C;  4YS3 A;  3REL C;  1EQZ B;  3REI C;  4HGA B;  2J8P A;  5CPK C;  2JCH A;  5B0Z D;  1F66 C;  5F99 D;  1P3M D;  4AWL B;  1KX4 A;  3AZN A;  3W97 A;  4H9P A;  5AV5 A;  3IP4 C;  2PYO B;  3W98 C;  1ZLA B;  1P3I A;  1P3L C;  1S32 B;  2BYM B;  4CSR A;  5GT3 B;  3MGR C;  1KX3 D;  3WTP E;  5AV8 A;  3WTP B;  5DNM A;  1U35 C;  3O62 C;  3H0M C;  5AVB D;  5B31 G;  1P3K B;  1P3L A;  4JJN D;  3AZL D;  3WAA A;  5BT1 D;  2YFW B;  4YM6 C;  2DF4 C;  2Y2L A;  1P3M B;  4DRB A;  3B0B A;  4EO5 B;  3MVD B;  2FJ7 C;  5GT0 C;  3EG5 B;  4KHA A;  3MGQ A;  3MGR D;  2ARO D;  3C1C C;  1P3K A;  3REI B;  3MNN A;  1KX4 B;  5BS7 A;  5B33 D;  3EPJ A;  2RVQ C;  2HUE B;  4QLC B;  1P34 C;  3W99 C;  5AV5 B;  5AV6 B;  1U35 D;  4YS3 D;  4H9Q A;  1KX4 D;  5CPK D;  1KX5 A;  1HQ3 B;  3MGS D;  1F66 D;  2BYM A;  1WWS A;  3A1I A;  5B0Z A;  4M6B A;  3WTP A;  1P3B C;  3TU4 C;  5B2I C;  3UTA A;  2VQR A;  2RVQ D;  5AV6 A;  3W98 A;  5BO0 A;  4X23 D;  2Y2G A;  5AV5 D;  1P3A A;  5B0Z C;  4KHA B;  5F99 C;  4Z66 A;  5AVB A;  4J8V B;  1F66 A;  3REH C;  4ZBJ B;  4R8P C;  5BO0 B;  3REI A;  1P34 D;  3MGP A;  3KUY C;  1HQ3 D;  3AZL C;  3AZG C;  1M19 A;  1P3A B;  1ZLA D;  1M18 A;  4QLC A;  5CP6 B;  3AZH C;  4Z66 B;  1P3O A;  1B67 A;  4ZUX D;  4J8V A;  4JJN B;  3AYW C;  3KWQ D;  2IO5 C;  5GXQ C;  5BT1 C;  3REK B;  5CP6 A;  1P3O B;  3B6F B;  3UTA B;  1M19 D;  4WU8 C;  5E5A A;  5B24 B;  5B1M C;  3AN2 A;  4H9S C;  3AZI B;  3REK A;  3B0D B;  1HTA A;  4G91 B;  5B31 C;  4YM6 B;  5CPJ A;  4LD9 D;  2CV5 C;  5GSU B;  1PZR A;  4H9R A;  3KXB C;  3UT9 C;  3TU4 D;  5B1M A;  5JRG A;  1M19 B;  5E5A D;  3AZK C;  2Y2N A;  3KUY B;  1KX4 C;  4Z5T C;  3A6N B;  4J8X D;  5CPJ B;  3W97 D;  5B33 A;  3REK D;  3REL B;  3X1V C;  4LD9 C;  2Y2P A;  5AVC C;  2NQB C;  2HIO D;  5JRG B;  1T3U A;  4J8U B;  3B6G D;  4AWL C;  4XUJ B;  2G5H C;  3AZE A;  1H3O A;  3AZM D;  1P3O C;  3W96 C;  4XZQ D;  1P3B B;  5B24 A;  4J8X B;  2NQB A;  5DNN C;  3X1U A;  3X1T C;  3MGQ C;  5B32 D;  3AZI A;  1P3G D;  4KUD C;  3KUY D;  1TZY C;  4J8U A;  1W2E A;  3REH A;  3X1V D;  1HQ3 C;  2Y2Q A;  5B0Y B;  4XUJ D;  2JE5 A;  5AVC D;  4R8P D;  4YM6 A;  5B2J C;  3AFA B;  3WA9 B;  1JFI B;  3UTB D;  3B6G B;  5CHL B;  4XZQ A;  3AZM C;  3X1U B;  5BNV B;  4KGC C;  3AV2 C;  5AV8 C;  1AOI C;  4ZBJ C;  5B0Y D;  4R8P B;  3AFA D;  2F8N H;  2NQB D;  5B32 B;  4H9O A;  2Y2J A;  3V9R B;  4XZQ B;  5CPK B;  1P3B D;  4KGC A;  3AZJ A;  5B40 A;  5E5A C;  3AZK D;  3LEL C;  5B1M D;  1P3F C;  2G5I C;  3REJ B;  5CP6 C;  4Z2M H;  3REL D;  3V9R A;  5CPK A;  3KSY A;  5BS7 C;  4J8X A;  3C1B A;  3MGR B;  4WNN A;  3AV1 A;  5B1L A;  5AY8 B;  1P3P C;  4H9N A;  5B40 C;  4KGC D;  3AZE C;  5B0Y C;  3R45 B;  3AFA C;  3B6G A;  4DQY B;  3AZH D;  3REJ D;  2L5A A;  3C1B D;  3MVD C;  2FJ7 B;  4R8P A;  5AV9 A;  5B32 A;  3O62 A;  3X1T D;  5B32 G;  1S32 D;  1M1A A;  4XZQ C;  5CPI B;  1P3I C;  1P3O D;  1KX3 C;  3H0L C;  4WZS B;  5AV9 C;  3MGS B;  2CV5 A;  5AV5 C;  3KWQ B;  5B2I A;  2JSS A;  3AZH B;  3AYW B;  2Y2H A;  4Z66 D;  4J8W C;  4WNN B;  4WV4 B;  3AV1 B;  1P3A D;  5FUG A;  3WKJ B;  3REI D;  1P34 A;  3NQJ A;  5AY8 C;  5AVC A;  1BFM A;  2ARO B;  3W99 D;  5GXQ A;  2Y2I A;  1ULY A;  5B33 C;  5B24 C;  2F2A C;  3LJA C;  2HIO B;  5JRG D;  3W96 A;  3AYW D;  2NZD B;  1P3I D;  5FUG B;  3O62 B;  4QLC D;  3AZN B;  1KX5 D;  1ID3 B;  3AZJ C;  3LZ0 A;  1AOI B;  3WKJ A;  1M1A B;  1BH8 A;  3AZL A;  1M19 C;  3WAA C;  3LZ1 C;  5GT3 D;  4Z5T B;  5CPJ C;  2BYK A;  2Y2K A;  1P3G C;  1ID3 A;  3C1B C;  1TAF A;  5AVB C;  1AOI A;  3AV2 A;  3MVD D;  2NZD D;  5JA4 A;  1BH8 B;  3AZL B;  4X23 A;  3AZJ D;  1P3L B;  3VH6 W;  3AZI D;  1P3G A;  1ZLA C;  4WU8 B;  3UTA C;  3MGP D;  5B24 D;  3VH6 T;  5CPJ D;  3MVD A;  4J8U C;  3W97 B;  2CV5 D;  3MGQ B;  4H9P B;  1EQZ D;  2IO5 B;  5GXQ B;  3REH D;  3REK C;  2PYO A;  1ZLA A;  4WU8 A;  3MNN B;  4YS3 C;  2ZY2 A;  1R4V A;  3W98 D;  4E44 A;  1TZY D;  2XD1 A;  4Z5T A;  5GXQ D;  3WAA B;  3MGQ D;  3A6N C;  3VH5 W;  3LZ0 D;  4J8V C;  1P3A C;  3AN2 D;  3W96 D;  3VH5 T;  5GSU D;  5GT0 A;  4WU8 D;  2FFF B;  3UTB C;  2FJ7 D;  4YM6 D;  2PYO C;  4NE6 A;  3W98 B;  1P3F B;  3AZF D;  1P3I B;  1ID3 D;  4XUJ C;  3MNN D;  2F8N A;  3B0C W;  4CSR B;  5GT3 A;  1KX3 A;  4LD9 A;  1U35 A;  4ZUX A;  3W99 A;  5BNX A;  5B2J A;  3MGP B;  1F1E A;  2YFW A;  3B6F C;  4J8W A;  3KXB A;  3WTP C;  5GT3 C;  3UT9 A;  3X1U C;  3AZM B;  3X1T A;  1Q9C A;  4G92 C;  1U35 B;  1M18 B;  2F8N D;  4ZUX B;  5GSU C;  5B2J B;  4WU9 D;  1M18 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...