4ZUXC

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 103
sequence length 103
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxC00
2NQBD 4H9OA 4WV4B 1ID3A 4WU9A 5CPJC 3C1BD 1AOIC 5AV9C 2FJ7C 3C1BB 3REKC 3MVDB 1M19D 5AV8C 1EQZD 1HQ3D 3MNNB 3A6NB 3AZFD 5DNMC 3X1TA 1HQ3B 1P34B 3AZNB 3RELA 5B2IA 5AY8C 1WWIA 3VH6A 1P3LD 3KWQD 1P3LB 4Z5TB 3B6FA 4XZQD 5CPID 5B31B 5AV6A 3KWQB 4X23A 3UTBC 2IO5C 4QLCA 4XZQB 3KXBC 3UTAC 2NZDC 4YM6A 3KUYD 3R45B 2PYOB 5BNXB 3LZ1A 3AZHA 5AVCD 3VH5A 4KUDD 5AVCB 4J8WD 1P3OC 2F8NB 4H9RB 4WU8B 4HGAC 5F99C 3AZGD 5DNNC 1BH9B 3AZJD 5B0YD 5B24B 3REJB 3AFAA 3AZGB 4YS3A 1U35B 5B0YB 4WNNA 3AZED 3O62C 5B1MD 4JJNC 3W98D 1S32D 1B6WA 1TZYC 5B1MB 1M18D 3X1VD 5CPJA 5GT0A 1BH8A 5C3IB 3W97D 3X1VB 1AOIA 1KX5A 2FJ7A 3MGRB 3REKA 5B32B 3W97B 5AV8A 3REHC 3AZLC 1F66B 2BYKB 5B31G 2CWEA 5DNMA 3X1SC 3AZMB 3W96C 1P3BD 3WTPD 3B0BA 3W99D 3LZ0D 5AY8A 3LELC 3WTPB 3AZID 3X1UA 3LZ0B 1P3MD 3W99B 3MGQC 5E5AD 4ZBJB 3AZIB 5BS7C 3AN2D 1P3MB 3AN2B 3UTBA 1P3FB 4NFTA 3KXBA 3TU4D 2NZDA 4LD9C 2F8NG 4Z66D 4J8XD 3TU4B 1P3AC 1KX3C 4XUJD 4ZUXC 4J8XB 1KX4D 1H3OA 4J8UC 4H9PB 3REID 3WA9C 5AVBB 3LJAD 1KX4B 4NE6A 3REIB 3LJAB 3B6GC 3VH6T 5F99A 4J8VB 5DNNA 1P3GD 2HUEC 2CV5C 5CPKC 1P3GB 3O62A 4R8PC 5B32G 4JJNA 1TZYA 5CP6B 5B33C 1Q9CA 5GXQC 4KGCA 3UT9C 4NE3A 5JA4A 3MGPD 5GT3C 3MGSB 3WAAC 1JFIA 3MGPB 3V9RB 3AZLA 4Z2MH 5B2JA 3AV1B 1TAFB 3X1SA 5B40D 3AYWC 5G49B 1ZLAC 5B1LD 1P3PD 3LELA 5B1LB 3MGQA 1ID3D 2AROB 5BS7A 1P3KD 4H9OB 1P3KB 4H9NA 4G92B 1N1JA 4CSRB 3X1TD 1KX3A 5BO0A 4ZUXA 3C1BC 4J8UA 5B2ID 3MVDC 3WA9A 3X1TB 1P3PB 5B2IB 3AZKA 5GSUA 3MNNC 3A6NC 2NQBB 3B6GA 3B6FD 1HQ3C 1P34C 3AZNC 5AV6D 4X23D 2CV5A 4QLCD 4CAYA 5CPKA 5AV6B 3NQUA 4YM6D 4X23B 4R8PA 1P3LC 4Z5TC 4NE5A 5BT1D 3LZ1D 3VH6W 3AZHD 1M19B 5B31C 4H9SA 3KWQC 1EQZB 5GXQA 3LZ1B 3AZHB 3UT9A 4XZQC 3AZFB 4DRBA 4AWLB 2PYOC 5GT3A 3WAAA 4H9QA 2RVQD 3AV2D 3B0DB 5AVCC 3AFAD 4YS3D 3AV2B 5CPIB 3AYWA 1ZLAA 3VH5W 5KDMB 3AFAB 4WU8C 5BNVA 5AV5A 3KUYB 5B24C 3REJC 3AZGC 1U35C 5CPJD 5GT0D 5FUGA 2HIOD 1AOID 2BYMA 1KX5D 5GT0B 2FJ7D 4KUDB 3REKD 2HIOB 5B1MC 1P3IA 1AOIB 1KX5B 5AV8D 4J8WB 2FJ7B 3REKB 5C3IC 5DNMD 3X1VC 3AZJB 3MGRC 4KHAB 5B32C 3MVDA 3W97C 3AZEB 3X1UD 1F66C 3MNNA 3W98B 3A6NA 1S32B 3X1UB 2YFVA 3AZMC 1HQ3A 1P34A 3AZNA 1M18B 5CHLB 3UTBD 5AV9A 3KXBD 3KSYA 3WTPC 3W99C 3NQJB 3LZ0C 2NZDD 4ZBJC 3AZIC 4Z5TA 1P3MC 2NZDB 5B31A 3AN2C 1P3FC 1P3BB 3R45A 2PYOA 5BNXA 5F99D 4J8XC 5DNND 5E5AB 5AVBC 4E44A 1B67A 1KX4C 3UTAA 3REIC 1M1AC 3O62D 4UUZB 3LJAC 2F8NA 4H9RA 4JJND 4WU8A 3C1CD 4J8VC 1TZYD 1BH9A 3WKJD 5JRGD 5B24A 4Z66B 3REJA 3C1CB 4KGCD 1HTAA 1U35A 3WKJB 5JRGB 4KGCB 4XUJB 4E45A 5CP6C 1P3OA 5JA4B 3AZLD 5B0ZD 2YFWA 4G91B 5B2JD 3X1SD 5B0ZB 3MGSC 3MGRA 5B32A 5B2JB 3MGPC 1F66A 2BYKA 3MGQD 3AV1C 3AZMA 3MGQB 5B1LC 3WTPA 3WTPE 2AROC 3AZIA 3REHA 1P3MA 4H9NB 1KX3D 1N1JB 4ZUXD 3W96A 4J8UD 1P3KC 1P3FA 3WA9D 5B40B 4G92C 3AZKD 2L5AA 5GSUD 3B6GD 1R4VA 4WU9D 3AZKB 5GSUB 1ID3B 4H9PA 3X1TC 5AVBA 4WU9B 4EO5B 2CV5D 5CPKD 1P3PC 1KX4A 5B2IC 1M1AA 2NQBC 4LD9A 4R8PD 1KU5A 1BFMA 3NQUB 4J8VA 1P3AA 5GXQD 3UT9D 5AV6C 3RELD 5GT3D 3RELB 1M19C 5CP6A 3WAAD 1EQZC 3LZ1C 5BT1C 3AZHC 3AZFC 3B6FB 4AWLC 4DRAA 3AYWD 1ZLAD 3MGSA 4QLCB 5AV5D 4YM6B 5B33A 4M6BA 5AV5B 5CPIC 3AV2C 3AV1A 2F8NH 5G49A 3KUYC 1P3ID 2BYMB 2AROA 1P3IB 5GT0C 4KUDC 1P3KA 3MVDD 2HIOC 3B0CT 4YS3B 1KX5C 4WNNB 4J8WC 2JSSA 3MNND 3A6ND 4CSRA 3AZJC 5B0YC 1P34D 3AZND 2YFVB 5AV9D 5CPJB 3AZEC 1BH8B 1P3PA 3W98C 2NQBA 5AV9B 1S32C 1WWSA 4Z5TD 3X1UC 1M18C 5B31D 5AV8B 3C1BA 5DNMB 5AY8D 2PYOD 1M19A 5AY8B 1EQZA 3AZFA 1P3BC 3UTAD 2F8ND 3UTBB 2IO5B 4Z2MG 4WU8D 3KXBB 3UTAB 1P3LA 5E5AC 5B24D 3KWQA 3REJD 1U35D 4XZQA 3AV2A 5CPIA 5KDMA 1H3OB 3TU4C 1P3OD 3KUYA 4Z66C 3C1CC 1P3OB 3WKJC 5JRGC 5AVCA 4KGCC 4HGAB 5F99B 4XUJC 5DNNB 4KUDA 2YFWB 3MGRD 5B32D 2HIOA 4J8WA 3O62B 1F66D 4JJNB 4G91C 3AZGA 1TZYB 1P3GC 3AZJA 3AZMD 5B0YA 5B0ZC 4KHAA 1ULYA 5B2JC 3B0CW 3AZEA 5B1MA 3W98A 1S32A 3REHD 1JFIB 1M18A 3REHB 3AZLB 3X1VA 1F1EA 1P3FD 3W96D 3NQJA 3W97A 3X1SB 3LELD 3W96B 3LELB 5AVBD 5B40C 1P3BA 1M1AD 2F8NK 3LZ0A 3W99A 4LD9D 3AZKC 4J8VD 5GSUC 1M1AB 4LD9B 5E5AA 1ID3C 1P3AD 4WU9C 4EO5C 3AN2A 1P3AB 4UUZA 1KX3B 5BO0B 4ZUXB 4J8UB 3TU4A 5CP6D 3WA9B 4Z66A 3C1CA 4J8XA 4H9SC 3WKJA 5JRGA 3B6GB 4XUJA 2HUEB 3RELC 3MGSD 3REIA 2CV5B 3LJAA 4CAYB 5CPKB 3VH5T 4R8PB 5B33D 3B6FC 3AV1D 1P3GA 5B33B 5B0ZA 4X23C 5GXQB 4QLCC 3UT9B 1A7WA 4YM6C 2AROD 5GT3B 5AV5C 3WAAB 4H9QB 3MGPA 3V9RA 3AYWB 1ZLAB 3B0DC 1P3IC 5BNVB 2RVQC 4WZSB 1TAFA 2LY8A 4YS3C 3AFAC 5B40A 5FUGB 5B1LA
chains in the Genus database with same CATH superfamily
2NQBD 4H9OA 4WV4B 1ID3A 4WU9A 5CPJC 3C1BD 1AOIC 5AV9C 2FJ7C 3C1BB 3REKC 3MVDB 1M19D 5AV8C 1EQZD 1HQ3D 3MNNB 3A6NB 3AZFD 5DNMC 3X1TA 1HQ3B 1P34B 3AZNB 3RELA 5B2IA 5AY8C 1WWIA 3VH6A 1P3LD 2UWXA 3KWQD 1P3LB 4Z5TB 3B6FA 4XZQD 5CPID 5B31B 5AV6A 3KWQB 4X23A 3UTBC 2IO5C 4QLCA 4XZQB 3KXBC 3UTAC 2NZDC 4YM6A 3KUYD 3R45B 2PYOB 5BNXB 3LZ1A 3AZHA 5AVCD 3VH5A 4KUDD 5AVCB 2F2AC 4J8WD 1P3OC 2F8NB 4H9RB 4WU8B 2W8SA 4HGAC 5F99C 3AZGD 5DNNC 1BH9B 3AZJD 5B0YD 5B24B 3REJB 3AFAA 3AZGB 4YS3A 1U35B 5B0YB 4WNNA 3AZED 3O62C 5B1MD 4JJNC 3EG5B 1T3UA 3W98D 1S32D 1B6WA 1TZYC 5B1MB 1M18D 3X1VD 5CPJA 5GT0A 1BH8A 5C3IB 3W97D 3X1VB 1AOIA 1KX5A 2FJ7A 3MGRB 3REKA 5B32B 3W97B 5AV8A 3REHC 3AZLC 1F66B 2BYKB 5B31G 2CWEA 5DNMA 3X1SC 2Y2MA 3W96C 3AZMB 1P3BD 3WTPD 3B0BA 3W99D 3LZ0D 5AY8A 3LELC 3WTPB 3AZID 3X1UA 3LZ0B 1P3MD 3W99B 3MGQC 5E5AD 4ZBJB 3AZIB 5BS7C 3AN2D 1P3MB 3AN2B 3UTBA 1P3FB 4NFTA 3KXBA 3TU4D 2NZDA 4LD9C 2F8NG 4Z66D 4J8XD 3TU4B 1P3AC 2J8PA 1KX3C 4XUJD 4ZUXC 4J8XB 1KX4D 1H3OA 4J8UC 4H9PB 3REID 3WA9C 5AVBB 3A1IA 3LJAD 1KX4B 4NE6A 3REIB 3LJAB 3B6GC 3IP4C 3VH6T 2DQNC 5F99A 4J8VB 5DNNA 1P3GD 2HUEC 2CV5C 5CPKC 1P3GB 3O62A 4R8PC 5B32G 4JJNA 1TZYA 5CP6B 5B33C 1Q9CA 5GXQC 4KGCA 3UT9C 4NE3A 5JA4A 3MGPD 5GT3C 2Y2PA 3MGSB 3WAAC 1JFIA 3MGPB 3V9RB 3AZLA 4Z2MH 2Y2GA 5B2JA 3AV1B 1TAFB 3X1SA 5B40D 3AYWC 5G49B 1ZLAC 5B1LD 1P3PD 3LELA 5B1LB 3MGQA 1ID3D 2AROB 5BS7A 1P3KD 4H9OB 1P3KB 4H9NA 4G92B 2FFFB 1N1JA 2Y2JA 4CSRB 3X1TD 1KX3A 5BO0A 4ZUXA 3C1BC 4J8UA 5B2ID 3MVDC 3WA9A 3X1TB 1P3PB 5B2IB 3AZKA 5GSUA 3MNNC 3A6NC 2NQBB 3B6GA 3B6FD 1HQ3C 1P34C 3AZNC 5AV6D 4WJ3C 4X23D 2CV5A 4QLCD 4CAYA 5CPKA 5AV6B 3NQUA 4YM6D 4X23B 4R8PA 1P3LC 4Z5TC 4NE5A 5BT1D 3LZ1D 3VH6W 3AZHD 1M19B 5B31C 4H9SA 3KWQC 1EQZB 5GXQA 3LZ1B 3AZHB 3UT9A 4XZQC 3AZFB 4DRBA 4AWLB 2PYOC 5GT3A 3WAAA 4H9QA 2RVQD 3AV2D 3B0DB 5AVCC 3AFAD 4YS3D 3H0RC 3AV2B 5CPIB 2Y2LA 2ZY4A 3AYWA 3VH5W 5KDMB 3AFAB 1ZLAA 4WU8C 5BNVA 2DF4C 5AV5A 3KUYB 5B24C 3REJC 3AZGC 1U35C 5CPJD 5GT0D 5FUGA 2HIOD 1AOID 2BYMA 1KX5D 5GT0B 2FJ7D 4KUDB 3REKD 2HIOB 5B1MC 1P3IA 1AOIB 1KX5B 5AV8D 4J8WB 2FJ7B 3REKB 5C3IC 5DNMD 3X1VC 3AZJB 3MGRC 4KHAB 5B32C 3MVDA 3W97C 3AZEB 3X1UD 1F66C 3MNNA 3W98B 3A6NA 1S32B 3FDDA 2YFVA 3X1UB 3AZMC 1HQ3A 1P34A 3AZNA 1M18B 5CHLB 3UTBD 5AV9A 3KXBD 3KSYA 3WTPC 3W99C 3NQJB 3LZ0C 2NZDD 4ZBJC 3AZIC 4Z5TA 1P3MC 2NZDB 5B31A 3AN2C 1P3FC 1P3BB 3R45A 2PYOA 5BNXA 2Y2QA 5F99D 4J8XC 5DNND 5E5AB 5AVBC 4E44A 1B67A 1KX4C 3UTAA 3REIC 1M1AC 2JE5A 3O62D 2RIQA 4UUZB 3LJAC 4H9RA 4JJND 2F8NA 4WU8A 3C1CD 4J8VC 1TZYD 1BH9A 3WKJD 5JRGD 5B24A 4Z66B 3REJA 3C1CB 4KGCD 1HTAA 1U35A 3WKJB 5JRGB 4KGCB 4XUJB 4E45A 5CP6C 1P3OA 5JA4B 2BG1A 3AZLD 5B0ZD 2YFWA 4G91B 5B2JD 3X1SD 5B0ZB 3MGSC 1W2EA 3MGRA 5B32A 5B2JB 3MGPC 2VQRA 1F66A 2BYKA 3MGQD 3AV1C 3AZMA 3MGQB 4DQYB 5B1LC 3WTPA 3WTPE 2AROC 3AZIA 3REHA 1P3MA 4H9NB 1KX3D 3AL0C 4ZUXD 1N1JB 3W96A 4J8UD 1P3KC 1P3FA 3WA9D 5B40B 4G92C 3AZKD 2L5AA 2Y2IA 5GSUD 2ZY2A 3B6GD 1R4VA 4WU9D 3AZKB 5GSUB 1ID3B 4H9PA 3X1TC 5AVBA 4WU9B 4EO5B 2CV5D 5CPKD 1P3PC 1KX4A 5B2IC 1M1AA 2NQBC 4LD9A 4R8PD 1KU5A 2Y2HA 2ZM5A 1BFMA 3NQUB 4J8VA 1P3AA 5GXQD 3UT9D 5AV6C 3RELD 3EPJA 5GT3D 3RELB 3EPHA 1M19C 5CP6A 3WAAD 1EQZC 3LZ1C 2G5HC 5BT1C 3AZHC 3AZFC 3EPLA 3B6FB 4AWLC 4DRAA 3AYWD 1ZLAD 3MGSA 4QLCB 5AV5D 4YM6B 5B33A 4M6BA 5AV5B 3F6TA 5CPIC 3AV2C 3AV1A 2F8NH 5G49A 3H0LC 3KUYC 1P3ID 2BYMB 2AROA 1P3IB 5GT0C 4KUDC 1P3KA 3MVDD 2HIOC 3B0CT 4YS3B 1KX5C 4WNNB 4J8WC 2JSSA 3MNND 3A6ND 4CSRA 3AZJC 5B0YC 1P34D 3AZND 2ZY3A 2YFVB 5AV9D 5CPJB 3AZEC 1BH8B 1P3PA 3W98C 2NQBA 5AV9B 1S32C 1WWSA 4Z5TD 3X1UC 1M18C 5B31D 2G5IC 5AV8B 2ZY5A 3A1KA 3C1BA 5DNMB 5AY8D 3KFUG 2PYOD 1M19A 5AY8B 1EQZA 3AZFA 1P3BC 3UTAD 2F8ND 3UTBB 2IO5B 2Y2KA 4Z2MG 3KXBB 3UTAB 4WU8D 1P3LA 5E5AC 5B24D 3KWQA 3REJD 1U35D 4XZQA 3AV2A 5CPIA 5KDMA 1H3OB 3TU4C 1P3OD 3KUYA 4Z66C 3C1CC 1P3OB 3WKJC 5JRGC 5AVCA 4KGCC 4HGAB 5F99B 4XUJC 5DNNB 4KUDA 2YFWB 3MGRD 5B32D 2HIOA 4J8WA 3O62B 3P5JB 1F66D 4JJNB 4G91C 3AZGA 1TZYB 1P3GC 3AZJA 3AZMD 5B0YA 5B0ZC 4KHAA 1ULYA 5B2JC 3B0CW 3AZEA 5B1MA 3W98A 1S32A 3REHD 1JFIB 1M18A 3REHB 3AZLB 3X1VA 1F1EA 1P3FD 3W96D 3NQJA 2XD1A 3W97A 3X1SB 3LELD 3W96B 4UPKA 3LELB 3EPKA 5AVBD 5B40C 1P3BA 1M1AD 2F8NK 3LZ0A 3W99A 4LD9D 3AZKC 4J8VD 5GSUC 1PZRA 1M1AB 4LD9B 5E5AA 1ID3C 1P3AD 4WU9C 4EO5C 3AN2A 1P3AB 4UUZA 1KX3B 5BO0B 4ZUXB 4J8UB 3TU4A 5CP6D 3WA9B 4Z66A 3C1CA 4J8XA 4H9SC 3WKJA 5JRGA 3B6GB 4XUJA 2HUEB 3RELC 3MGSD 3REIA 2CV5B 3LJAA 4CAYB 5CPKB 3VH5T 4R8PB 5B33D 2JCHA 3B6FC 3AV1D 1P3GA 5B33B 5B0ZA 4X23C 5GXQB 4QLCC 3UT9B 1A7WA 4YM6C 2XD5A 2AROD 5GT3B 5AV5C 3WAAB 4H9QB 2Y2OA 3MGPA 3V9RA 3AYWB 1ZLAB 3B0DC 1P3IC 5BNVB 3H0MC 2RVQC 2Y2NA 4WZSB 1TAFA 1Z2CB 2LY8A 4YS3C 3AFAC 5B40A 5FUGB 5B1LA
chains in the Genus database with same CATH topology
2NQBD 4H9OA 4WV4B 1ID3A 4WU9A 5CPJC 3C1BD 1AOIC 5AV9C 2FJ7C 3C1BB 3REKC 3MVDB 1M19D 5AV8C 1EQZD 1HQ3D 3MNNB 3A6NB 3AZFD 5DNMC 3X1TA 1HQ3B 1P34B 3AZNB 3RELA 5B2IA 5AY8C 1WWIA 3VH6A 1P3LD 2UWXA 3KWQD 1P3LB 4Z5TB 3B6FA 4XZQD 5CPID 5B31B 5AV6A 3KWQB 4X23A 3UTBC 2IO5C 4QLCA 4XZQB 3KXBC 3UTAC 2NZDC 4YM6A 3KUYD 3R45B 2PYOB 5BNXB 3LZ1A 3AZHA 5AVCD 3VH5A 4KUDD 5AVCB 2F2AC 4J8WD 1P3OC 2F8NB 4H9RB 4WU8B 2W8SA 4HGAC 5F99C 3AZGD 5DNNC 1BH9B 3AZJD 5B0YD 5B24B 3REJB 3AFAA 3AZGB 4YS3A 1U35B 5B0YB 4WNNA 3AZED 3O62C 5B1MD 4JJNC 3EG5B 1T3UA 3W98D 1S32D 1B6WA 1TZYC 5B1MB 1M18D 3X1VD 5CPJA 5GT0A 1BH8A 5C3IB 3W97D 3X1VB 1AOIA 1KX5A 2FJ7A 3MGRB 3REKA 5B32B 3W97B 5AV8A 3REHC 3AZLC 1F66B 2BYKB 5B31G 2CWEA 5DNMA 3X1SC 2Y2MA 3W96C 3AZMB 1P3BD 3WTPD 3B0BA 3W99D 3LZ0D 5AY8A 3LELC 3WTPB 3AZID 3X1UA 3LZ0B 1P3MD 3W99B 3MGQC 5E5AD 4ZBJB 3AZIB 5BS7C 3AN2D 1P3MB 3AN2B 3UTBA 1P3FB 4NFTA 3KXBA 3TU4D 2NZDA 4LD9C 2F8NG 4Z66D 4J8XD 3TU4B 1P3AC 2J8PA 1KX3C 4XUJD 4ZUXC 4J8XB 1KX4D 1H3OA 4J8UC 4H9PB 3REID 3WA9C 5AVBB 3A1IA 3LJAD 1KX4B 4NE6A 3REIB 3LJAB 3B6GC 3IP4C 3VH6T 2DQNC 5F99A 4J8VB 5DNNA 1P3GD 2HUEC 2CV5C 5CPKC 1P3GB 3O62A 4R8PC 5B32G 4JJNA 1TZYA 5CP6B 5B33C 1Q9CA 5GXQC 4KGCA 3UT9C 4NE3A 5JA4A 3MGPD 5GT3C 2Y2PA 3MGSB 3WAAC 1JFIA 3MGPB 3V9RB 3AZLA 4Z2MH 2Y2GA 5B2JA 3AV1B 1TAFB 3X1SA 5B40D 3AYWC 5G49B 1ZLAC 5B1LD 1P3PD 3LELA 5B1LB 3MGQA 1ID3D 2AROB 5BS7A 1P3KD 4H9OB 1P3KB 4H9NA 4G92B 2FFFB 1N1JA 2Y2JA 4CSRB 3X1TD 1KX3A 5BO0A 4ZUXA 3C1BC 4J8UA 5B2ID 3MVDC 3WA9A 3X1TB 1P3PB 5B2IB 3AZKA 5GSUA 3MNNC 3A6NC 2NQBB 3B6GA 3B6FD 1HQ3C 1P34C 3AZNC 5AV6D 4WJ3C 4X23D 2CV5A 4QLCD 4CAYA 5CPKA 5AV6B 3NQUA 4YM6D 4X23B 4R8PA 1P3LC 4Z5TC 4NE5A 5BT1D 3LZ1D 3VH6W 3AZHD 1M19B 5B31C 4H9SA 3KWQC 1EQZB 5GXQA 3LZ1B 3AZHB 3UT9A 4XZQC 3AZFB 4DRBA 4AWLB 2PYOC 5GT3A 3WAAA 4H9QA 2RVQD 3AV2D 3B0DB 5AVCC 3AFAD 4YS3D 3H0RC 3AV2B 5CPIB 2Y2LA 2ZY4A 3AYWA 3VH5W 5KDMB 3AFAB 1ZLAA 4WU8C 5BNVA 2DF4C 5AV5A 3KUYB 5B24C 3REJC 3AZGC 1U35C 5CPJD 5GT0D 5FUGA 2HIOD 1AOID 2BYMA 1KX5D 5GT0B 2FJ7D 4KUDB 3REKD 2HIOB 5B1MC 1P3IA 1AOIB 1KX5B 5AV8D 4J8WB 2FJ7B 3REKB 5C3IC 5DNMD 3X1VC 3AZJB 3MGRC 4KHAB 5B32C 3MVDA 3W97C 3AZEB 3X1UD 1F66C 3MNNA 3W98B 3A6NA 1S32B 3FDDA 2YFVA 3X1UB 3AZMC 1HQ3A 1P34A 3AZNA 1M18B 5CHLB 3UTBD 5AV9A 3KXBD 3KSYA 3WTPC 3W99C 3NQJB 3LZ0C 2NZDD 4ZBJC 3AZIC 4Z5TA 1P3MC 2NZDB 5B31A 3AN2C 1P3FC 1P3BB 3R45A 2PYOA 5BNXA 2Y2QA 5F99D 4J8XC 5DNND 5E5AB 5AVBC 4E44A 1B67A 1KX4C 3UTAA 3REIC 1M1AC 2JE5A 3O62D 2RIQA 4UUZB 3LJAC 4H9RA 4JJND 2F8NA 4WU8A 3C1CD 4J8VC 1TZYD 1BH9A 3WKJD 5JRGD 5B24A 4Z66B 3REJA 3C1CB 4KGCD 1HTAA 1U35A 3WKJB 5JRGB 4KGCB 4XUJB 4E45A 5CP6C 1P3OA 5JA4B 2BG1A 3AZLD 5B0ZD 2YFWA 4G91B 5B2JD 3X1SD 5B0ZB 3MGSC 1W2EA 3MGRA 5B32A 5B2JB 3MGPC 2VQRA 1F66A 2BYKA 3MGQD 3AV1C 3AZMA 3MGQB 4DQYB 5B1LC 3WTPA 3WTPE 2AROC 3AZIA 3REHA 1P3MA 4H9NB 1KX3D 3AL0C 4ZUXD 1N1JB 3W96A 4J8UD 1P3KC 1P3FA 3WA9D 5B40B 4G92C 3AZKD 2L5AA 2Y2IA 5GSUD 2ZY2A 3B6GD 1R4VA 4WU9D 3AZKB 5GSUB 1ID3B 4H9PA 3X1TC 5AVBA 4WU9B 4EO5B 2CV5D 5CPKD 1P3PC 1KX4A 5B2IC 1M1AA 2NQBC 4LD9A 4R8PD 1KU5A 2Y2HA 2ZM5A 1BFMA 3NQUB 4J8VA 1P3AA 5GXQD 3UT9D 5AV6C 3RELD 3EPJA 5GT3D 3RELB 3EPHA 1M19C 5CP6A 3WAAD 1EQZC 3LZ1C 2G5HC 5BT1C 3AZHC 3AZFC 3EPLA 3B6FB 4AWLC 4DRAA 3AYWD 1ZLAD 3MGSA 4QLCB 5AV5D 4YM6B 5B33A 4M6BA 5AV5B 3F6TA 5CPIC 3AV2C 3AV1A 2F8NH 5G49A 3H0LC 3KUYC 1P3ID 2BYMB 2AROA 1P3IB 5GT0C 4KUDC 1P3KA 3MVDD 2HIOC 3B0CT 4YS3B 1KX5C 4WNNB 4J8WC 2JSSA 3MNND 3A6ND 4CSRA 3AZJC 5B0YC 1P34D 3AZND 2ZY3A 2YFVB 5AV9D 5CPJB 3AZEC 1BH8B 1P3PA 3W98C 2NQBA 5AV9B 1S32C 1WWSA 4Z5TD 3X1UC 1M18C 5B31D 2G5IC 5AV8B 2ZY5A 3A1KA 3C1BA 5DNMB 5AY8D 3KFUG 2PYOD 1M19A 5AY8B 1EQZA 3AZFA 1P3BC 3UTAD 2F8ND 3UTBB 2IO5B 2Y2KA 4Z2MG 3KXBB 3UTAB 4WU8D 1P3LA 5E5AC 5B24D 3KWQA 3REJD 1U35D 4XZQA 3AV2A 5CPIA 5KDMA 1H3OB 3TU4C 1P3OD 3KUYA 4Z66C 3C1CC 1P3OB 3WKJC 5JRGC 5AVCA 4KGCC 4HGAB 5F99B 4XUJC 5DNNB 4KUDA 2YFWB 3MGRD 5B32D 2HIOA 4J8WA 3O62B 3P5JB 1F66D 4JJNB 4G91C 3AZGA 1TZYB 1P3GC 3AZJA 3AZMD 5B0YA 5B0ZC 4KHAA 1ULYA 5B2JC 3B0CW 3AZEA 5B1MA 3W98A 1S32A 3REHD 1JFIB 1M18A 3REHB 3AZLB 3X1VA 1F1EA 1P3FD 3W96D 3NQJA 2XD1A 3W97A 3X1SB 3LELD 3W96B 4UPKA 3LELB 3EPKA 5AVBD 5B40C 1P3BA 1M1AD 2F8NK 3LZ0A 3W99A 4LD9D 3AZKC 4J8VD 5GSUC 1PZRA 1M1AB 4LD9B 5E5AA 1ID3C 1P3AD 4WU9C 4EO5C 3AN2A 1P3AB 4UUZA 1KX3B 5BO0B 4ZUXB 4J8UB 3TU4A 5CP6D 3WA9B 4Z66A 3C1CA 4J8XA 4H9SC 3WKJA 5JRGA 3B6GB 4XUJA 2HUEB 3RELC 3MGSD 3REIA 2CV5B 3LJAA 4CAYB 5CPKB 3VH5T 4R8PB 5B33D 2JCHA 3B6FC 3AV1D 1P3GA 5B33B 5B0ZA 4X23C 5GXQB 4QLCC 3UT9B 1A7WA 4YM6C 2XD5A 2AROD 5GT3B 5AV5C 3WAAB 4H9QB 2Y2OA 3MGPA 3V9RA 3AYWB 1ZLAB 3B0DC 1P3IC 5BNVB 3H0MC 2RVQC 2Y2NA 4WZSB 1TAFA 1Z2CB 2LY8A 4YS3C 3AFAC 5B40A 5FUGB 5B1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB D;  4H9O A;  4WV4 B;  1ID3 A;  4WU9 A;  5CPJ C;  3C1B D;  1AOI C;  5AV9 C;  2FJ7 C;  3C1B B;  3REK C;  3MVD B;  1M19 D;  5AV8 C;  1EQZ D;  1HQ3 D;  3MNN B;  3A6N B;  3AZF D;  5DNM C;  3X1T A;  1HQ3 B;  1P34 B;  3AZN B;  3REL A;  5B2I A;  5AY8 C;  1WWI A;  3VH6 A;  1P3L D;  3KWQ D;  1P3L B;  4Z5T B;  3B6F A;  4XZQ D;  5CPI D;  5B31 B;  5AV6 A;  3KWQ B;  4X23 A;  3UTB C;  2IO5 C;  4QLC A;  4XZQ B;  3KXB C;  3UTA C;  2NZD C;  4YM6 A;  3KUY D;  3R45 B;  2PYO B;  5BNX B;  3LZ1 A;  3AZH A;  5AVC D;  3VH5 A;  4KUD D;  5AVC B;  4J8W D;  1P3O C;  2F8N B;  4H9R B;  4WU8 B;  4HGA C;  5F99 C;  3AZG D;  5DNN C;  1BH9 B;  3AZJ D;  5B0Y D;  5B24 B;  3REJ B;  3AFA A;  3AZG B;  4YS3 A;  1U35 B;  5B0Y B;  4WNN A;  3AZE D;  3O62 C;  5B1M D;  4JJN C;  3W98 D;  1S32 D;  1B6W A;  1TZY C;  5B1M B;  1M18 D;  3X1V D;  5CPJ A;  5GT0 A;  1BH8 A;  5C3I B;  3W97 D;  3X1V B;  1AOI A;  1KX5 A;  2FJ7 A;  3MGR B;  3REK A;  5B32 B;  3W97 B;  5AV8 A;  3REH C;  3AZL C;  1F66 B;  2BYK B;  5B31 G;  2CWE A;  5DNM A;  3X1S C;  3AZM B;  3W96 C;  1P3B D;  3WTP D;  3B0B A;  3W99 D;  3LZ0 D;  5AY8 A;  3LEL C;  3WTP B;  3AZI D;  3X1U A;  3LZ0 B;  1P3M D;  3W99 B;  3MGQ C;  5E5A D;  4ZBJ B;  3AZI B;  5BS7 C;  3AN2 D;  1P3M B;  3AN2 B;  3UTB A;  1P3F B;  4NFT A;  3KXB A;  3TU4 D;  2NZD A;  4LD9 C;  2F8N G;  4Z66 D;  4J8X D;  3TU4 B;  1P3A C;  1KX3 C;  4XUJ D;  4ZUX C;  4J8X B;  1KX4 D;  1H3O A;  4J8U C;  4H9P B;  3REI D;  3WA9 C;  5AVB B;  3LJA D;  1KX4 B;  4NE6 A;  3REI B;  3LJA B;  3B6G C;  3VH6 T;  5F99 A;  4J8V B;  5DNN A;  1P3G D;  2HUE C;  2CV5 C;  5CPK C;  1P3G B;  3O62 A;  4R8P C;  5B32 G;  4JJN A;  1TZY A;  5CP6 B;  5B33 C;  1Q9C A;  5GXQ C;  4KGC A;  3UT9 C;  4NE3 A;  5JA4 A;  3MGP D;  5GT3 C;  3MGS B;  3WAA C;  1JFI A;  3MGP B;  3V9R B;  3AZL A;  4Z2M H;  5B2J A;  3AV1 B;  1TAF B;  3X1S A;  5B40 D;  3AYW C;  5G49 B;  1ZLA C;  5B1L D;  1P3P D;  3LEL A;  5B1L B;  3MGQ A;  1ID3 D;  2ARO B;  5BS7 A;  1P3K D;  4H9O B;  1P3K B;  4H9N A;  4G92 B;  1N1J A;  4CSR B;  3X1T D;  1KX3 A;  5BO0 A;  4ZUX A;  3C1B C;  4J8U A;  5B2I D;  3MVD C;  3WA9 A;  3X1T B;  1P3P B;  5B2I B;  3AZK A;  5GSU A;  3MNN C;  3A6N C;  2NQB B;  3B6G A;  3B6F D;  1HQ3 C;  1P34 C;  3AZN C;  5AV6 D;  4X23 D;  2CV5 A;  4QLC D;  4CAY A;  5CPK A;  5AV6 B;  3NQU A;  4YM6 D;  4X23 B;  4R8P A;  1P3L C;  4Z5T C;  4NE5 A;  5BT1 D;  3LZ1 D;  3VH6 W;  3AZH D;  1M19 B;  5B31 C;  4H9S A;  3KWQ C;  1EQZ B;  5GXQ A;  3LZ1 B;  3AZH B;  3UT9 A;  4XZQ C;  3AZF B;  4DRB A;  4AWL B;  2PYO C;  5GT3 A;  3WAA A;  4H9Q A;  2RVQ D;  3AV2 D;  3B0D B;  5AVC C;  3AFA D;  4YS3 D;  3AV2 B;  5CPI B;  3AYW A;  1ZLA A;  3VH5 W;  5KDM B;  3AFA B;  4WU8 C;  5BNV A;  5AV5 A;  3KUY B;  5B24 C;  3REJ C;  3AZG C;  1U35 C;  5CPJ D;  5GT0 D;  5FUG A;  2HIO D;  1AOI D;  2BYM A;  1KX5 D;  5GT0 B;  2FJ7 D;  4KUD B;  3REK D;  2HIO B;  5B1M C;  1P3I A;  1AOI B;  1KX5 B;  5AV8 D;  4J8W B;  2FJ7 B;  3REK B;  5C3I C;  5DNM D;  3X1V C;  3AZJ B;  3MGR C;  4KHA B;  5B32 C;  3MVD A;  3W97 C;  3AZE B;  3X1U D;  1F66 C;  3MNN A;  3W98 B;  3A6N A;  1S32 B;  3X1U B;  2YFV A;  3AZM C;  1HQ3 A;  1P34 A;  3AZN A;  1M18 B;  5CHL B;  3UTB D;  5AV9 A;  3KXB D;  3KSY A;  3WTP C;  3W99 C;  3NQJ B;  3LZ0 C;  2NZD D;  4ZBJ C;  3AZI C;  4Z5T A;  1P3M C;  2NZD B;  5B31 A;  3AN2 C;  1P3F C;  1P3B B;  3R45 A;  2PYO A;  5BNX A;  5F99 D;  4J8X C;  5DNN D;  5E5A B;  5AVB C;  4E44 A;  1B67 A;  1KX4 C;  3UTA A;  3REI C;  1M1A C;  3O62 D;  4UUZ B;  3LJA C;  2F8N A;  4H9R A;  4JJN D;  4WU8 A;  3C1C D;  4J8V C;  1TZY D;  1BH9 A;  3WKJ D;  5JRG D;  5B24 A;  4Z66 B;  3REJ A;  3C1C B;  4KGC D;  1HTA A;  1U35 A;  3WKJ B;  5JRG B;  4KGC B;  4XUJ B;  4E45 A;  5CP6 C;  1P3O A;  5JA4 B;  3AZL D;  5B0Z D;  2YFW A;  4G91 B;  5B2J D;  3X1S D;  5B0Z B;  3MGS C;  3MGR A;  5B32 A;  5B2J B;  3MGP C;  1F66 A;  2BYK A;  3MGQ D;  3AV1 C;  3AZM A;  3MGQ B;  5B1L C;  3WTP A;  3WTP E;  2ARO C;  3AZI A;  3REH A;  1P3M A;  4H9N B;  1KX3 D;  1N1J B;  4ZUX D;  3W96 A;  4J8U D;  1P3K C;  1P3F A;  3WA9 D;  5B40 B;  4G92 C;  3AZK D;  2L5A A;  5GSU D;  3B6G D;  1R4V A;  4WU9 D;  3AZK B;  5GSU B;  1ID3 B;  4H9P A;  3X1T C;  5AVB A;  4WU9 B;  4EO5 B;  2CV5 D;  5CPK D;  1P3P C;  1KX4 A;  5B2I C;  1M1A A;  2NQB C;  4LD9 A;  4R8P D;  1KU5 A;  1BFM A;  3NQU B;  4J8V A;  1P3A A;  5GXQ D;  3UT9 D;  5AV6 C;  3REL D;  5GT3 D;  3REL B;  1M19 C;  5CP6 A;  3WAA D;  1EQZ C;  3LZ1 C;  5BT1 C;  3AZH C;  3AZF C;  3B6F B;  4AWL C;  4DRA A;  3AYW D;  1ZLA D;  3MGS A;  4QLC B;  5AV5 D;  4YM6 B;  5B33 A;  4M6B A;  5AV5 B;  5CPI C;  3AV2 C;  3AV1 A;  2F8N H;  5G49 A;  3KUY C;  1P3I D;  2BYM B;  2ARO A;  1P3I B;  5GT0 C;  4KUD C;  1P3K A;  3MVD D;  2HIO C;  3B0C T;  4YS3 B;  1KX5 C;  4WNN B;  4J8W C;  2JSS A;  3MNN D;  3A6N D;  4CSR A;  3AZJ C;  5B0Y C;  1P34 D;  3AZN D;  2YFV B;  5AV9 D;  5CPJ B;  3AZE C;  1BH8 B;  1P3P A;  3W98 C;  2NQB A;  5AV9 B;  1S32 C;  1WWS A;  4Z5T D;  3X1U C;  1M18 C;  5B31 D;  5AV8 B;  3C1B A;  5DNM B;  5AY8 D;  2PYO D;  1M19 A;  5AY8 B;  1EQZ A;  3AZF A;  1P3B C;  3UTA D;  2F8N D;  3UTB B;  2IO5 B;  4Z2M G;  4WU8 D;  3KXB B;  3UTA B;  1P3L A;  5E5A C;  5B24 D;  3KWQ A;  3REJ D;  1U35 D;  4XZQ A;  3AV2 A;  5CPI A;  5KDM A;  1H3O B;  3TU4 C;  1P3O D;  3KUY A;  4Z66 C;  3C1C C;  1P3O B;  3WKJ C;  5JRG C;  5AVC A;  4KGC C;  4HGA B;  5F99 B;  4XUJ C;  5DNN B;  4KUD A;  2YFW B;  3MGR D;  5B32 D;  2HIO A;  4J8W A;  3O62 B;  1F66 D;  4JJN B;  4G91 C;  3AZG A;  1TZY B;  1P3G C;  3AZJ A;  3AZM D;  5B0Y A;  5B0Z C;  4KHA A;  1ULY A;  5B2J C;  3B0C W;  3AZE A;  5B1M A;  3W98 A;  1S32 A;  3REH D;  1JFI B;  1M18 A;  3REH B;  3AZL B;  3X1V A;  1F1E A;  1P3F D;  3W96 D;  3NQJ A;  3W97 A;  3X1S B;  3LEL D;  3W96 B;  3LEL B;  5AVB D;  5B40 C;  1P3B A;  1M1A D;  2F8N K;  3LZ0 A;  3W99 A;  4LD9 D;  3AZK C;  4J8V D;  5GSU C;  1M1A B;  4LD9 B;  5E5A A;  1ID3 C;  1P3A D;  4WU9 C;  4EO5 C;  3AN2 A;  1P3A B;  4UUZ A;  1KX3 B;  5BO0 B;  4ZUX B;  4J8U B;  3TU4 A;  5CP6 D;  3WA9 B;  4Z66 A;  3C1C A;  4J8X A;  4H9S C;  3WKJ A;  5JRG A;  3B6G B;  4XUJ A;  2HUE B;  3REL C;  3MGS D;  3REI A;  2CV5 B;  3LJA A;  4CAY B;  5CPK B;  3VH5 T;  4R8P B;  5B33 D;  3B6F C;  3AV1 D;  1P3G A;  5B33 B;  5B0Z A;  4X23 C;  5GXQ B;  4QLC C;  3UT9 B;  1A7W A;  4YM6 C;  2ARO D;  5GT3 B;  5AV5 C;  3WAA B;  4H9Q B;  3MGP A;  3V9R A;  3AYW B;  1ZLA B;  3B0D C;  1P3I C;  5BNV B;  2RVQ C;  4WZS B;  1TAF A;  2LY8 A;  4YS3 C;  3AFA C;  5B40 A;  5FUG B;  5B1L A; 
#chains in the Genus database with same CATH topology
 2NQB D;  4H9O A;  4WV4 B;  1ID3 A;  4WU9 A;  5CPJ C;  3C1B D;  1AOI C;  5AV9 C;  2FJ7 C;  3C1B B;  3REK C;  3MVD B;  1M19 D;  5AV8 C;  1EQZ D;  1HQ3 D;  3MNN B;  3A6N B;  3AZF D;  5DNM C;  3X1T A;  1HQ3 B;  1P34 B;  3AZN B;  3REL A;  5B2I A;  5AY8 C;  1WWI A;  3VH6 A;  1P3L D;  2UWX A;  3KWQ D;  1P3L B;  4Z5T B;  3B6F A;  4XZQ D;  5CPI D;  5B31 B;  5AV6 A;  3KWQ B;  4X23 A;  3UTB C;  2IO5 C;  4QLC A;  4XZQ B;  3KXB C;  3UTA C;  2NZD C;  4YM6 A;  3KUY D;  3R45 B;  2PYO B;  5BNX B;  3LZ1 A;  3AZH A;  5AVC D;  3VH5 A;  4KUD D;  5AVC B;  2F2A C;  4J8W D;  1P3O C;  2F8N B;  4H9R B;  4WU8 B;  2W8S A;  4HGA C;  5F99 C;  3AZG D;  5DNN C;  1BH9 B;  3AZJ D;  5B0Y D;  5B24 B;  3REJ B;  3AFA A;  3AZG B;  4YS3 A;  1U35 B;  5B0Y B;  4WNN A;  3AZE D;  3O62 C;  5B1M D;  4JJN C;  3EG5 B;  1T3U A;  3W98 D;  1S32 D;  1B6W A;  1TZY C;  5B1M B;  1M18 D;  3X1V D;  5CPJ A;  5GT0 A;  1BH8 A;  5C3I B;  3W97 D;  3X1V B;  1AOI A;  1KX5 A;  2FJ7 A;  3MGR B;  3REK A;  5B32 B;  3W97 B;  5AV8 A;  3REH C;  3AZL C;  1F66 B;  2BYK B;  5B31 G;  2CWE A;  5DNM A;  3X1S C;  2Y2M A;  3W96 C;  3AZM B;  1P3B D;  3WTP D;  3B0B A;  3W99 D;  3LZ0 D;  5AY8 A;  3LEL C;  3WTP B;  3AZI D;  3X1U A;  3LZ0 B;  1P3M D;  3W99 B;  3MGQ C;  5E5A D;  4ZBJ B;  3AZI B;  5BS7 C;  3AN2 D;  1P3M B;  3AN2 B;  3UTB A;  1P3F B;  4NFT A;  3KXB A;  3TU4 D;  2NZD A;  4LD9 C;  2F8N G;  4Z66 D;  4J8X D;  3TU4 B;  1P3A C;  2J8P A;  1KX3 C;  4XUJ D;  4ZUX C;  4J8X B;  1KX4 D;  1H3O A;  4J8U C;  4H9P B;  3REI D;  3WA9 C;  5AVB B;  3A1I A;  3LJA D;  1KX4 B;  4NE6 A;  3REI B;  3LJA B;  3B6G C;  3IP4 C;  3VH6 T;  2DQN C;  5F99 A;  4J8V B;  5DNN A;  1P3G D;  2HUE C;  2CV5 C;  5CPK C;  1P3G B;  3O62 A;  4R8P C;  5B32 G;  4JJN A;  1TZY A;  5CP6 B;  5B33 C;  1Q9C A;  5GXQ C;  4KGC A;  3UT9 C;  4NE3 A;  5JA4 A;  3MGP D;  5GT3 C;  2Y2P A;  3MGS B;  3WAA C;  1JFI A;  3MGP B;  3V9R B;  3AZL A;  4Z2M H;  2Y2G A;  5B2J A;  3AV1 B;  1TAF B;  3X1S A;  5B40 D;  3AYW C;  5G49 B;  1ZLA C;  5B1L D;  1P3P D;  3LEL A;  5B1L B;  3MGQ A;  1ID3 D;  2ARO B;  5BS7 A;  1P3K D;  4H9O B;  1P3K B;  4H9N A;  4G92 B;  2FFF B;  1N1J A;  2Y2J A;  4CSR B;  3X1T D;  1KX3 A;  5BO0 A;  4ZUX A;  3C1B C;  4J8U A;  5B2I D;  3MVD C;  3WA9 A;  3X1T B;  1P3P B;  5B2I B;  3AZK A;  5GSU A;  3MNN C;  3A6N C;  2NQB B;  3B6G A;  3B6F D;  1HQ3 C;  1P34 C;  3AZN C;  5AV6 D;  4WJ3 C;  4X23 D;  2CV5 A;  4QLC D;  4CAY A;  5CPK A;  5AV6 B;  3NQU A;  4YM6 D;  4X23 B;  4R8P A;  1P3L C;  4Z5T C;  4NE5 A;  5BT1 D;  3LZ1 D;  3VH6 W;  3AZH D;  1M19 B;  5B31 C;  4H9S A;  3KWQ C;  1EQZ B;  5GXQ A;  3LZ1 B;  3AZH B;  3UT9 A;  4XZQ C;  3AZF B;  4DRB A;  4AWL B;  2PYO C;  5GT3 A;  3WAA A;  4H9Q A;  2RVQ D;  3AV2 D;  3B0D B;  5AVC C;  3AFA D;  4YS3 D;  3H0R C;  3AV2 B;  5CPI B;  2Y2L A;  2ZY4 A;  3AYW A;  3VH5 W;  5KDM B;  3AFA B;  1ZLA A;  4WU8 C;  5BNV A;  2DF4 C;  5AV5 A;  3KUY B;  5B24 C;  3REJ C;  3AZG C;  1U35 C;  5CPJ D;  5GT0 D;  5FUG A;  2HIO D;  1AOI D;  2BYM A;  1KX5 D;  5GT0 B;  2FJ7 D;  4KUD B;  3REK D;  2HIO B;  5B1M C;  1P3I A;  1AOI B;  1KX5 B;  5AV8 D;  4J8W B;  2FJ7 B;  3REK B;  5C3I C;  5DNM D;  3X1V C;  3AZJ B;  3MGR C;  4KHA B;  5B32 C;  3MVD A;  3W97 C;  3AZE B;  3X1U D;  1F66 C;  3MNN A;  3W98 B;  3A6N A;  1S32 B;  3FDD A;  2YFV A;  3X1U B;  3AZM C;  1HQ3 A;  1P34 A;  3AZN A;  1M18 B;  5CHL B;  3UTB D;  5AV9 A;  3KXB D;  3KSY A;  3WTP C;  3W99 C;  3NQJ B;  3LZ0 C;  2NZD D;  4ZBJ C;  3AZI C;  4Z5T A;  1P3M C;  2NZD B;  5B31 A;  3AN2 C;  1P3F C;  1P3B B;  3R45 A;  2PYO A;  5BNX A;  2Y2Q A;  5F99 D;  4J8X C;  5DNN D;  5E5A B;  5AVB C;  4E44 A;  1B67 A;  1KX4 C;  3UTA A;  3REI C;  1M1A C;  2JE5 A;  3O62 D;  2RIQ A;  4UUZ B;  3LJA C;  4H9R A;  4JJN D;  2F8N A;  4WU8 A;  3C1C D;  4J8V C;  1TZY D;  1BH9 A;  3WKJ D;  5JRG D;  5B24 A;  4Z66 B;  3REJ A;  3C1C B;  4KGC D;  1HTA A;  1U35 A;  3WKJ B;  5JRG B;  4KGC B;  4XUJ B;  4E45 A;  5CP6 C;  1P3O A;  5JA4 B;  2BG1 A;  3AZL D;  5B0Z D;  2YFW A;  4G91 B;  5B2J D;  3X1S D;  5B0Z B;  3MGS C;  1W2E A;  3MGR A;  5B32 A;  5B2J B;  3MGP C;  2VQR A;  1F66 A;  2BYK A;  3MGQ D;  3AV1 C;  3AZM A;  3MGQ B;  4DQY B;  5B1L C;  3WTP A;  3WTP E;  2ARO C;  3AZI A;  3REH A;  1P3M A;  4H9N B;  1KX3 D;  3AL0 C;  4ZUX D;  1N1J B;  3W96 A;  4J8U D;  1P3K C;  1P3F A;  3WA9 D;  5B40 B;  4G92 C;  3AZK D;  2L5A A;  2Y2I A;  5GSU D;  2ZY2 A;  3B6G D;  1R4V A;  4WU9 D;  3AZK B;  5GSU B;  1ID3 B;  4H9P A;  3X1T C;  5AVB A;  4WU9 B;  4EO5 B;  2CV5 D;  5CPK D;  1P3P C;  1KX4 A;  5B2I C;  1M1A A;  2NQB C;  4LD9 A;  4R8P D;  1KU5 A;  2Y2H A;  2ZM5 A;  1BFM A;  3NQU B;  4J8V A;  1P3A A;  5GXQ D;  3UT9 D;  5AV6 C;  3REL D;  3EPJ A;  5GT3 D;  3REL B;  3EPH A;  1M19 C;  5CP6 A;  3WAA D;  1EQZ C;  3LZ1 C;  2G5H C;  5BT1 C;  3AZH C;  3AZF C;  3EPL A;  3B6F B;  4AWL C;  4DRA A;  3AYW D;  1ZLA D;  3MGS A;  4QLC B;  5AV5 D;  4YM6 B;  5B33 A;  4M6B A;  5AV5 B;  3F6T A;  5CPI C;  3AV2 C;  3AV1 A;  2F8N H;  5G49 A;  3H0L C;  3KUY C;  1P3I D;  2BYM B;  2ARO A;  1P3I B;  5GT0 C;  4KUD C;  1P3K A;  3MVD D;  2HIO C;  3B0C T;  4YS3 B;  1KX5 C;  4WNN B;  4J8W C;  2JSS A;  3MNN D;  3A6N D;  4CSR A;  3AZJ C;  5B0Y C;  1P34 D;  3AZN D;  2ZY3 A;  2YFV B;  5AV9 D;  5CPJ B;  3AZE C;  1BH8 B;  1P3P A;  3W98 C;  2NQB A;  5AV9 B;  1S32 C;  1WWS A;  4Z5T D;  3X1U C;  1M18 C;  5B31 D;  2G5I C;  5AV8 B;  2ZY5 A;  3A1K A;  3C1B A;  5DNM B;  5AY8 D;  3KFU G;  2PYO D;  1M19 A;  5AY8 B;  1EQZ A;  3AZF A;  1P3B C;  3UTA D;  2F8N D;  3UTB B;  2IO5 B;  2Y2K A;  4Z2M G;  3KXB B;  3UTA B;  4WU8 D;  1P3L A;  5E5A C;  5B24 D;  3KWQ A;  3REJ D;  1U35 D;  4XZQ A;  3AV2 A;  5CPI A;  5KDM A;  1H3O B;  3TU4 C;  1P3O D;  3KUY A;  4Z66 C;  3C1C C;  1P3O B;  3WKJ C;  5JRG C;  5AVC A;  4KGC C;  4HGA B;  5F99 B;  4XUJ C;  5DNN B;  4KUD A;  2YFW B;  3MGR D;  5B32 D;  2HIO A;  4J8W A;  3O62 B;  3P5J B;  1F66 D;  4JJN B;  4G91 C;  3AZG A;  1TZY B;  1P3G C;  3AZJ A;  3AZM D;  5B0Y A;  5B0Z C;  4KHA A;  1ULY A;  5B2J C;  3B0C W;  3AZE A;  5B1M A;  3W98 A;  1S32 A;  3REH D;  1JFI B;  1M18 A;  3REH B;  3AZL B;  3X1V A;  1F1E A;  1P3F D;  3W96 D;  3NQJ A;  2XD1 A;  3W97 A;  3X1S B;  3LEL D;  3W96 B;  4UPK A;  3LEL B;  3EPK A;  5AVB D;  5B40 C;  1P3B A;  1M1A D;  2F8N K;  3LZ0 A;  3W99 A;  4LD9 D;  3AZK C;  4J8V D;  5GSU C;  1PZR A;  1M1A B;  4LD9 B;  5E5A A;  1ID3 C;  1P3A D;  4WU9 C;  4EO5 C;  3AN2 A;  1P3A B;  4UUZ A;  1KX3 B;  5BO0 B;  4ZUX B;  4J8U B;  3TU4 A;  5CP6 D;  3WA9 B;  4Z66 A;  3C1C A;  4J8X A;  4H9S C;  3WKJ A;  5JRG A;  3B6G B;  4XUJ A;  2HUE B;  3REL C;  3MGS D;  3REI A;  2CV5 B;  3LJA A;  4CAY B;  5CPK B;  3VH5 T;  4R8P B;  5B33 D;  2JCH A;  3B6F C;  3AV1 D;  1P3G A;  5B33 B;  5B0Z A;  4X23 C;  5GXQ B;  4QLC C;  3UT9 B;  1A7W A;  4YM6 C;  2XD5 A;  2ARO D;  5GT3 B;  5AV5 C;  3WAA B;  4H9Q B;  2Y2O A;  3MGP A;  3V9R A;  3AYW B;  1ZLA B;  3B0D C;  1P3I C;  5BNV B;  3H0M C;  2RVQ C;  2Y2N A;  4WZS B;  1TAF A;  1Z2C B;  2LY8 A;  4YS3 C;  3AFA C;  5B40 A;  5FUG B;  5B1L A; 
#chains in the Genus database with same CATH homology
 2NQB D;  4H9O A;  4WV4 B;  1ID3 A;  4WU9 A;  5CPJ C;  3C1B D;  1AOI C;  5AV9 C;  2FJ7 C;  3C1B B;  3REK C;  3MVD B;  1M19 D;  5AV8 C;  1EQZ D;  1HQ3 D;  3MNN B;  3A6N B;  3AZF D;  5DNM C;  3X1T A;  1HQ3 B;  1P34 B;  3AZN B;  3REL A;  5B2I A;  5AY8 C;  1WWI A;  3VH6 A;  1P3L D;  2UWX A;  3KWQ D;  1P3L B;  4Z5T B;  3B6F A;  4XZQ D;  5CPI D;  5B31 B;  5AV6 A;  3KWQ B;  4X23 A;  3UTB C;  2IO5 C;  4QLC A;  4XZQ B;  3KXB C;  3UTA C;  2NZD C;  4YM6 A;  3KUY D;  3R45 B;  2PYO B;  5BNX B;  3LZ1 A;  3AZH A;  5AVC D;  3VH5 A;  4KUD D;  5AVC B;  2F2A C;  4J8W D;  1P3O C;  2F8N B;  4H9R B;  4WU8 B;  2W8S A;  4HGA C;  5F99 C;  3AZG D;  5DNN C;  1BH9 B;  3AZJ D;  5B0Y D;  5B24 B;  3REJ B;  3AFA A;  3AZG B;  4YS3 A;  1U35 B;  5B0Y B;  4WNN A;  3AZE D;  3O62 C;  5B1M D;  4JJN C;  3EG5 B;  1T3U A;  3W98 D;  1S32 D;  1B6W A;  1TZY C;  5B1M B;  1M18 D;  3X1V D;  5CPJ A;  5GT0 A;  1BH8 A;  5C3I B;  3W97 D;  3X1V B;  1AOI A;  1KX5 A;  2FJ7 A;  3MGR B;  3REK A;  5B32 B;  3W97 B;  5AV8 A;  3REH C;  3AZL C;  1F66 B;  2BYK B;  5B31 G;  2CWE A;  5DNM A;  3X1S C;  2Y2M A;  3W96 C;  3AZM B;  1P3B D;  3WTP D;  3B0B A;  3W99 D;  3LZ0 D;  5AY8 A;  3LEL C;  3WTP B;  3AZI D;  3X1U A;  3LZ0 B;  1P3M D;  3W99 B;  3MGQ C;  5E5A D;  4ZBJ B;  3AZI B;  5BS7 C;  3AN2 D;  1P3M B;  3AN2 B;  3UTB A;  1P3F B;  4NFT A;  3KXB A;  3TU4 D;  2NZD A;  4LD9 C;  2F8N G;  4Z66 D;  4J8X D;  3TU4 B;  1P3A C;  2J8P A;  1KX3 C;  4XUJ D;  4ZUX C;  4J8X B;  1KX4 D;  1H3O A;  4J8U C;  4H9P B;  3REI D;  3WA9 C;  5AVB B;  3A1I A;  3LJA D;  1KX4 B;  4NE6 A;  3REI B;  3LJA B;  3B6G C;  3IP4 C;  3VH6 T;  2DQN C;  5F99 A;  4J8V B;  5DNN A;  1P3G D;  2HUE C;  2CV5 C;  5CPK C;  1P3G B;  3O62 A;  4R8P C;  5B32 G;  4JJN A;  1TZY A;  5CP6 B;  5B33 C;  1Q9C A;  5GXQ C;  4KGC A;  3UT9 C;  4NE3 A;  5JA4 A;  3MGP D;  5GT3 C;  2Y2P A;  3MGS B;  3WAA C;  1JFI A;  3MGP B;  3V9R B;  3AZL A;  4Z2M H;  2Y2G A;  5B2J A;  3AV1 B;  1TAF B;  3X1S A;  5B40 D;  3AYW C;  5G49 B;  1ZLA C;  5B1L D;  1P3P D;  3LEL A;  5B1L B;  3MGQ A;  1ID3 D;  2ARO B;  5BS7 A;  1P3K D;  4H9O B;  1P3K B;  4H9N A;  4G92 B;  2FFF B;  1N1J A;  2Y2J A;  4CSR B;  3X1T D;  1KX3 A;  5BO0 A;  4ZUX A;  3C1B C;  4J8U A;  5B2I D;  3MVD C;  3WA9 A;  3X1T B;  1P3P B;  5B2I B;  3AZK A;  5GSU A;  3MNN C;  3A6N C;  2NQB B;  3B6G A;  3B6F D;  1HQ3 C;  1P34 C;  3AZN C;  5AV6 D;  4WJ3 C;  4X23 D;  2CV5 A;  4QLC D;  4CAY A;  5CPK A;  5AV6 B;  3NQU A;  4YM6 D;  4X23 B;  4R8P A;  1P3L C;  4Z5T C;  4NE5 A;  5BT1 D;  3LZ1 D;  3VH6 W;  3AZH D;  1M19 B;  5B31 C;  4H9S A;  3KWQ C;  1EQZ B;  5GXQ A;  3LZ1 B;  3AZH B;  3UT9 A;  4XZQ C;  3AZF B;  4DRB A;  4AWL B;  2PYO C;  5GT3 A;  3WAA A;  4H9Q A;  2RVQ D;  3AV2 D;  3B0D B;  5AVC C;  3AFA D;  4YS3 D;  3H0R C;  3AV2 B;  5CPI B;  2Y2L A;  2ZY4 A;  3AYW A;  3VH5 W;  5KDM B;  3AFA B;  1ZLA A;  4WU8 C;  5BNV A;  2DF4 C;  5AV5 A;  3KUY B;  5B24 C;  3REJ C;  3AZG C;  1U35 C;  5CPJ D;  5GT0 D;  5FUG A;  2HIO D;  1AOI D;  2BYM A;  1KX5 D;  5GT0 B;  2FJ7 D;  4KUD B;  3REK D;  2HIO B;  5B1M C;  1P3I A;  1AOI B;  1KX5 B;  5AV8 D;  4J8W B;  2FJ7 B;  3REK B;  5C3I C;  5DNM D;  3X1V C;  3AZJ B;  3MGR C;  4KHA B;  5B32 C;  3MVD A;  3W97 C;  3AZE B;  3X1U D;  1F66 C;  3MNN A;  3W98 B;  3A6N A;  1S32 B;  3FDD A;  2YFV A;  3X1U B;  3AZM C;  1HQ3 A;  1P34 A;  3AZN A;  1M18 B;  5CHL B;  3UTB D;  5AV9 A;  3KXB D;  3KSY A;  3WTP C;  3W99 C;  3NQJ B;  3LZ0 C;  2NZD D;  4ZBJ C;  3AZI C;  4Z5T A;  1P3M C;  2NZD B;  5B31 A;  3AN2 C;  1P3F C;  1P3B B;  3R45 A;  2PYO A;  5BNX A;  2Y2Q A;  5F99 D;  4J8X C;  5DNN D;  5E5A B;  5AVB C;  4E44 A;  1B67 A;  1KX4 C;  3UTA A;  3REI C;  1M1A C;  2JE5 A;  3O62 D;  2RIQ A;  4UUZ B;  3LJA C;  4H9R A;  4JJN D;  2F8N A;  4WU8 A;  3C1C D;  4J8V C;  1TZY D;  1BH9 A;  3WKJ D;  5JRG D;  5B24 A;  4Z66 B;  3REJ A;  3C1C B;  4KGC D;  1HTA A;  1U35 A;  3WKJ B;  5JRG B;  4KGC B;  4XUJ B;  4E45 A;  5CP6 C;  1P3O A;  5JA4 B;  2BG1 A;  3AZL D;  5B0Z D;  2YFW A;  4G91 B;  5B2J D;  3X1S D;  5B0Z B;  3MGS C;  1W2E A;  3MGR A;  5B32 A;  5B2J B;  3MGP C;  2VQR A;  1F66 A;  2BYK A;  3MGQ D;  3AV1 C;  3AZM A;  3MGQ B;  4DQY B;  5B1L C;  3WTP A;  3WTP E;  2ARO C;  3AZI A;  3REH A;  1P3M A;  4H9N B;  1KX3 D;  3AL0 C;  4ZUX D;  1N1J B;  3W96 A;  4J8U D;  1P3K C;  1P3F A;  3WA9 D;  5B40 B;  4G92 C;  3AZK D;  2L5A A;  2Y2I A;  5GSU D;  2ZY2 A;  3B6G D;  1R4V A;  4WU9 D;  3AZK B;  5GSU B;  1ID3 B;  4H9P A;  3X1T C;  5AVB A;  4WU9 B;  4EO5 B;  2CV5 D;  5CPK D;  1P3P C;  1KX4 A;  5B2I C;  1M1A A;  2NQB C;  4LD9 A;  4R8P D;  1KU5 A;  2Y2H A;  2ZM5 A;  1BFM A;  3NQU B;  4J8V A;  1P3A A;  5GXQ D;  3UT9 D;  5AV6 C;  3REL D;  3EPJ A;  5GT3 D;  3REL B;  3EPH A;  1M19 C;  5CP6 A;  3WAA D;  1EQZ C;  3LZ1 C;  2G5H C;  5BT1 C;  3AZH C;  3AZF C;  3EPL A;  3B6F B;  4AWL C;  4DRA A;  3AYW D;  1ZLA D;  3MGS A;  4QLC B;  5AV5 D;  4YM6 B;  5B33 A;  4M6B A;  5AV5 B;  3F6T A;  5CPI C;  3AV2 C;  3AV1 A;  2F8N H;  5G49 A;  3H0L C;  3KUY C;  1P3I D;  2BYM B;  2ARO A;  1P3I B;  5GT0 C;  4KUD C;  1P3K A;  3MVD D;  2HIO C;  3B0C T;  4YS3 B;  1KX5 C;  4WNN B;  4J8W C;  2JSS A;  3MNN D;  3A6N D;  4CSR A;  3AZJ C;  5B0Y C;  1P34 D;  3AZN D;  2ZY3 A;  2YFV B;  5AV9 D;  5CPJ B;  3AZE C;  1BH8 B;  1P3P A;  3W98 C;  2NQB A;  5AV9 B;  1S32 C;  1WWS A;  4Z5T D;  3X1U C;  1M18 C;  5B31 D;  2G5I C;  5AV8 B;  2ZY5 A;  3A1K A;  3C1B A;  5DNM B;  5AY8 D;  3KFU G;  2PYO D;  1M19 A;  5AY8 B;  1EQZ A;  3AZF A;  1P3B C;  3UTA D;  2F8N D;  3UTB B;  2IO5 B;  2Y2K A;  4Z2M G;  3KXB B;  3UTA B;  4WU8 D;  1P3L A;  5E5A C;  5B24 D;  3KWQ A;  3REJ D;  1U35 D;  4XZQ A;  3AV2 A;  5CPI A;  5KDM A;  1H3O B;  3TU4 C;  1P3O D;  3KUY A;  4Z66 C;  3C1C C;  1P3O B;  3WKJ C;  5JRG C;  5AVC A;  4KGC C;  4HGA B;  5F99 B;  4XUJ C;  5DNN B;  4KUD A;  2YFW B;  3MGR D;  5B32 D;  2HIO A;  4J8W A;  3O62 B;  3P5J B;  1F66 D;  4JJN B;  4G91 C;  3AZG A;  1TZY B;  1P3G C;  3AZJ A;  3AZM D;  5B0Y A;  5B0Z C;  4KHA A;  1ULY A;  5B2J C;  3B0C W;  3AZE A;  5B1M A;  3W98 A;  1S32 A;  3REH D;  1JFI B;  1M18 A;  3REH B;  3AZL B;  3X1V A;  1F1E A;  1P3F D;  3W96 D;  3NQJ A;  2XD1 A;  3W97 A;  3X1S B;  3LEL D;  3W96 B;  4UPK A;  3LEL B;  3EPK A;  5AVB D;  5B40 C;  1P3B A;  1M1A D;  2F8N K;  3LZ0 A;  3W99 A;  4LD9 D;  3AZK C;  4J8V D;  5GSU C;  1PZR A;  1M1A B;  4LD9 B;  5E5A A;  1ID3 C;  1P3A D;  4WU9 C;  4EO5 C;  3AN2 A;  1P3A B;  4UUZ A;  1KX3 B;  5BO0 B;  4ZUX B;  4J8U B;  3TU4 A;  5CP6 D;  3WA9 B;  4Z66 A;  3C1C A;  4J8X A;  4H9S C;  3WKJ A;  5JRG A;  3B6G B;  4XUJ A;  2HUE B;  3REL C;  3MGS D;  3REI A;  2CV5 B;  3LJA A;  4CAY B;  5CPK B;  3VH5 T;  4R8P B;  5B33 D;  2JCH A;  3B6F C;  3AV1 D;  1P3G A;  5B33 B;  5B0Z A;  4X23 C;  5GXQ B;  4QLC C;  3UT9 B;  1A7W A;  4YM6 C;  2XD5 A;  2ARO D;  5GT3 B;  5AV5 C;  3WAA B;  4H9Q B;  2Y2O A;  3MGP A;  3V9R A;  3AYW B;  1ZLA B;  3B0D C;  1P3I C;  5BNV B;  3H0M C;  2RVQ C;  2Y2N A;  4WZS B;  1TAF A;  1Z2C B;  2LY8 A;  4YS3 C;  3AFA C;  5B40 A;  5FUG B;  5B1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...