1ID3B

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3B00
5B24B 3KWQD 4KGCC 2AROB 1BH9A 3LZ0A 3MNNB 4H9OB 2BYMB 4X23D 2LY8A 4Z66D 5B33B 1HQ3C 3MGSB 3AZFA 4YS3D 1P3KB 5B0ZC 5B1LC 5AV8B 3AV1A 3A6ND 4H9QA 4KHAA 4R8PD 2HIOC 1P3FC 2RVQC 2PYOA 5BO0B 5DNMD 3B6GA 3B6FA 1P3AD 1KX5B 4J8UC 3MGRD 3REJB 5B31D 3V9RA 3REHA 5GT0A 5DNNC 3X1UB 3AN2C 3AZGC 3WTPD 1TZYD 3MGPB 4XZQD 3LELD 4YS3C 5CP6B 5CPJB 5B0YA 4H9SA 3KXBA 3AZFD 5GXQD 3LJAD 3AZHA 1P3PB 2YFVA 4R8PC 5AV9D 5C3IB 3REIB 1HTAA 4H9NA 2CV5D 5F99C 3B0BA 4EO5C 1P3MC 2HUEC 4J8VB 3AV2A 1TAFB 1S32A 1KX3A 1ZLAA 4XUJA 5B32A 4HGAB 1U35B 3REHD 3X1TA 5AVCD 5AVBA 3LZ0C 4J8XA 5GT0D 3AYWD 1EQZA 5B40B 3AZFC 3W99A 3AZND 3AV1C 4WU8A 1JFIB 3AFAB 3WA9B 1P3IB 5B24A 2AROA 3MVDB 2PYOC 3MNNA 3RELB 1P3GB 4H9OA 2BYMA 3B6FC 3VH5A 5B2IB 3B6GC 5B33A 4WU9D 4ZUXB 2BYKB 3MGSA 1P3KA 3WTPE 5AV8A 2NQBD 5AV5B 3X1SD 3REHC 1KX3D 1ZLAD 4XUJD 1P34B 4M6BA 4QLCB 3UT9B 3X1TD 5GT0C 4AWLB 5BO0A 4DRBA 3AZJD 3C1CD 5GT3B 5B0YC 4H9SC 3KXBC 3TU4D 1KX5A 4WV4B 3REJA 5KDMB 3AZHC 3AZLB 3X1UA 2HIOD 4G92B 4ZBJC 3MGPA 1WWSA 5CP6A 3AV2C 5CPJA 3W97B 1KX3C 3MGSD 1ZLAC 4XUJC 2FJ7A 1AOIB 5B32C 1N1JB 1P3PA 2L5AA 3AZKB 3X1TC 1HQ3D 5AVBC 5GSUB 3REIA 3AZEB 1P3OB 4Z5TD 5B0ZD 3AZJC 4J8XC 3C1CC 3UTBB 1EQZC 4J8VA 1F66B 1TAFA 1P3LB 2RVQD 4WU8C 5CPKB 1U35A 2NZDB 3WAAB 5B24C 4Z2MG 3UTAB 3MNNC 5CPIB 3X1VB 5B33C 5B1MB 5B40A 3MGSC 1P3KC 5JRGB 2YFWB 5DNND 3AN2D 3AZGD 3REKB 1JFIA 4LD9B 3AFAA 3WA9A 4E44A 3MGQB 1P3IA 4Z5TC 4J8WB 3O62B 4CSRB 3MVDA 3RELA 1P3GA 5CHLB 1WWIA 5B2IA 4ZUXA 2BYKA 1KX5C 5AV5A 4E45A 5F99D 1P34A 2F8NG 1P3MD 4QLCA 3UT9A 3X1UC 4H9RB 3W98D 2F8NK 4KGCB 3MGPC 1H3OB 5CP6C 5GT3A 3LZ1B 5CPJC 3LZ0D 1ID3B 5B40D 5KDMA 1P3PC 5C3IC 3REIC 3AZLA 2FJ7B 3AV1D 5B2ID 4J8VC 4NFTA 3W97A 4ZUXD 3KUYB 2PYOD 4JJNB 1AOIA 5AV5D 1N1JA 4HGAC 3AZMB 1U35C 3B6GD 3B6FD 3AZKA 3AZEA 5GSUA 1P3BA 3B0DB 4UUZB 1P3OA 3W98C 3KWQB 2IO5C 3UTBA 1F1EA 5E5AB 4X23B 5B40C 4Z66B 1F66A 5B31G 1P3LA 1B6WA 5CPKA 1A7WA 3WA9C 2CWEA 1P3IC 3A6NB 2NZDA 3WAAA 5B0YD 3KXBD 4NE6A 3MVDC 3UTAA 3RELC 3AZIB 5CPIA 3AZHD 3X1VA 5B2JB 5B2IC 4ZUXC 5B1MA 5DNMB 5JRGA 2YFWA 5AV5C 3W97D 1M1AB 4LD9A 3REKA 1P3AB 1P34C 3MGRB 5B31B 1AOID 3MGQA 3AV2D 4QLCC 3UT9C 4J8WA 3AZKD 3VH6T 1S32D 3O62A 4CSRA 5GSUD 5BT1C 4AWLC 1P3OD 4YM6B 5B32D 1BH8B 3WTPB 5GT3C 5AVBD 1TZYB 4XZQB 3LELB 1F66D 4J8XD 1P3LD 5GXQB 3LJAB 3VH6W 5CPKD 1EQZD 3W99D 3AZLC 2NZDD 5AV9B 4WZSB 5AY8B 4G92C 4WU8D 4H9RA 3W96B 4KGCA 2CV5B 1ULYA 1H3OA 4G91B 5B24D 3LZ1A 2AROD 1ID3A 3W97C 3MNND 5JRGD 1AOIC 1M19B 3KSYA 5B33D 3AZKC 1S32C 3AZEC 5GSUC 1P3KD 1P3OC 5AV8D 4J8WD 5AVCB 3UTBC 1KX4B 1P3BB 3AYWB 1F66C 3KUYA 1P3LC 5CPKC 4JJNA 3AZNB 3AZMA 3W99C 2NZDC 3WAAC 5AV6B 1KX5D 4UUZA 3UTAC 3REJD 3KWQA 3X1VC 2AROC 5B1MC 5E5AA 5G49B 4X23A 4Z66A 5JRGC 4WU9B 3X1UD 1ID3D 4LD9C 3REKC 2NQBB 3X1SB 3B0CT 3MGPD 5CP6D 3A6NA 5AV8C 4J8WC 5CPJD 3O62C 3AZIA 2FJ7D 4KUDB 1P3PD 5B2JA 3AZJB 3REID 5DNMA 1M18B 3C1CB 3B0CW 3KUYD 1M1AA 3TU4B 3C1BB 1P3AA 3MGRA 5B31A 4JJND 4J8VD 3REJC 3WKJB 4YM6A 1BFMA 1BH8A 1U35D 2HIOB 3WTPA 3LZ1C 1TZYA 1ID3C 5E5AD 1R4VA 4XZQA 3LELA 4Z2MH 5GXQA 3LJAA 5AV9A 2FJ7C 3NQUB 1HQ3B 5AY8A 3W96A 5B0ZB 5B1LB 4Z5TB 3AFAD 3AZID 3WA9D 2CV5A 5B2JD 1P3ID 5BNXB 2F8NB 1Q9CA 5BNVB 3KUYC 3MVDD 3RELD 1P3GD 4JJNC 1M19A 3AZMC 1P3FB 1M1AD 3NQJB 3B0DC 3KWQC 5AVCA 4J8UB 1P34D 4WNNB 4YM6D 1KX4A 5E5AC 4X23C 3AYWA 4QLCD 4Z66C 3UT9D 2F8NH 5BT1D 3AZNA 5DNNB 3AN2B 3AZGB 3A6NC 5GT3D 5AV6A 4YS3B 4H9PB 3AZIC 3AFAC 5AY8D 5B2JC 3W96D 1KU5A 4CAYB 3VH5T 5G49A 5DNMC 3AZLD 4R8PB 1P3GC 4WU9A 1M1AC 3R45B 5JA4B 1P3AC 3MGRC 2NQBA 5B31C 3X1SA 1M19D 5F99B 4EO5B 1P3MB 2HUEB 5BS7A 3VH5W 4YM6C 5FUGB 4KUDA 3W98B 3WTPC 1KX4D 3AZJA 1TZYC 3AZED 1P3BD 1M18A 4XZQC 2IO5B 3LELC 3C1CA 1BH9B 3LZ0B 3UTBD 3C1BA 3TU4A 5GXQC 3LJAC 5AV9C 5AV6D 3WKJA 5AY8C 3AZFB 3W96C 2CV5C 3AV1B 2HIOA 4H9QB 4KHAB 3WAAD 4G91C 3UTAD 5CPID 3X1VD 1M19C 2PYOB 5B1MD 3B6FB 3B6GB 3NQUA 1HQ3A 5AVCC 3REKD 4LD9D 4Z5TA 5B1LA 5B0ZA 3V9RB 1KX4C 4KUDD 3MGQD 3REHB 1P3BC 5BNXA 3AYWC 2F8NA 5BNVA 3O62D 3VH6A 1M18D 3AZNC 5GT0B 1P3FA 3C1BD 5AV6C 3NQJA 2JSSA 3WKJD 5B32G 5B0YB 3KXBB 4J8UA 4WNNA 3AZHB 4NE3A 2YFVB 5CPIC 4WU9C 1B67A 4H9NB 4KGCD 2NQBC 5DNNA 3X1SC 3AN2A 3AZGA 4ZBJB 3LZ1D 5BS7C 4H9PA 4YS3A 3AV2B 3W98A 4KUDC 1S32B 3MGQC 1KX3B 1ZLAB 4XUJB 4CAYA 5B1LD 5B32B 1M18C 4R8PA 2F8ND 3X1TB 5AVBB 3R45A 5JA4A 3C1BC 3TU4C 4NE5A 4DRAA 4J8XB 1P3FD 5F99A 1EQZB 3WKJC 1P3MA 3W99B 5FUGA 3AZMD 4WU8B 4J8UD
chains in the Genus database with same CATH superfamily
5B24B 3KWQD 4KGCC 2AROB 1BH9A 3LZ0A 3MNNB 4H9OB 2BYMB 4X23D 2LY8A 4Z66D 3EG5B 5B33B 1HQ3C 3MGSB 3AZFA 4YS3D 1P3KB 5B0ZC 5B1LC 5AV8B 3AV1A 3A6ND 4H9QA 4KHAA 4R8PD 4WU8B 1P3FC 2RVQC 2PYOA 5BO0B 5DNMD 3B6GA 3B6FA 1P3AD 1KX5B 4J8UC 3MGRD 3REJB 5B31D 3V9RA 3REHA 2Y2GA 2G5HC 2J8PA 5GT0A 5DNNC 3X1UB 3AN2C 3AZGC 3WTPD 1TZYD 2XD1A 3MGPB 4XZQD 3LELD 4YS3C 5CP6B 5CPJB 5B0YA 4H9SA 3KXBA 3AZFD 5GXQD 3A1IA 3LJAD 3AZHA 1P3PB 2YFVA 4R8PC 5AV9D 2Y2OA 5C3IB 3REIB 1HTAA 4H9NA 2G5IC 1PZRA 2CV5D 5F99C 3B0BA 4EO5C 1P3MC 2HUEC 2Y2HA 4J8VB 3AV2A 1TAFB 1Z2CB 1S32A 1KX3A 1ZLAA 4XUJA 5B32A 4HGAB 1U35B 3REHD 3X1TA 5AVBA 5AVCD 3LZ0C 4J8XA 5GT0D 3AYWD 1EQZA 5B40B 3AZFC 3W99A 3AZND 3AV1C 4WU8A 1JFIB 3AFAB 3WA9B 1P3IB 5B24A 2AROA 3MVDB 2PYOC 3MNNA 3RELB 1P3GB 3EPKA 4H9OA 2BYMA 3B6FC 3VH5A 5B2IB 3B6GC 5B33A 4WU9D 4ZUXB 2BYKB 2ZM5A 3MGSA 1P3KA 3WTPE 5AV8A 2NQBD 5AV5B 3X1SD 3REHC 1KX3D 1ZLAD 4XUJD 1P34B 4M6BA 4QLCB 3UT9B 3X1TD 5GT0C 4AWLB 5BO0A 3EPJA 4DRBA 3AZJD 3C1CD 5GT3B 5B0YC 4H9SC 3KXBC 3TU4D 1KX5A 4WV4B 3REJA 5KDMB 3AZHC 3AZLB 3X1UA 2HIOD 4G92B 4ZBJC 3MGPA 1WWSA 2ZY3A 5CP6A 3AV2C 5CPJA 3W97B 1KX3C 3MGSD 1ZLAC 4XUJC 2FJ7A 1AOIB 5B32C 1N1JB 2Y2KA 2L5AA 1P3PA 3AZKB 3X1TC 1HQ3D 5AVBC 5GSUB 3REIA 3AZEB 1P3OB 4Z5TD 5B0ZD 3AZJC 4J8XC 3C1CC 3UTBB 1EQZC 4J8VA 1F66B 1TAFA 1P3LB 2RVQD 4WU8C 5CPKB 3H0LC 1U35A 2NZDB 3WAAB 5B24C 4Z2MG 3UTAB 3MNNC 5CPIB 3X1VB 5B33C 5B1MB 5B40A 3MGSC 1P3KC 5JRGB 2YFWB 5DNND 3AN2D 3AZGD 3REKB 1JFIA 4LD9B 3AFAA 3WA9A 4E44A 3MGQB 1P3IA 4Z5TC 4J8WB 2Y2NA 3O62B 4CSRB 3MVDA 3RELA 1P3GA 5CHLB 1WWIA 5B2IA 4ZUXA 2ZY5A 2BYKA 1KX5C 5AV5A 4E45A 2FFFB 5F99D 1P34A 2F8NG 1P3MD 4QLCA 3UT9A 3X1UC 4H9RB 3W98D 2F8NK 4KGCB 3H0MC 3MGPC 1H3OB 5CP6C 5GT3A 3LZ1B 5CPJC 3LZ0D 1ID3B 5B40D 5KDMA 1P3PC 2Y2LA 3KFUG 5C3IC 3REIC 3AZLA 2FJ7B 3AV1D 2Y2JA 5B2ID 4J8VC 4NFTA 3W97A 4ZUXD 3KUYB 2PYOD 3FDDA 4JJNB 1AOIA 5AV5D 1N1JA 4HGAC 3AZMB 1U35C 3B6GD 3B6FD 3AZKA 3AZEA 5GSUA 1P3BA 3B0DB 4UUZB 1P3OA 3W98C 3KWQB 2IO5C 3UTBA 1F1EA 5E5AB 4X23B 5B40C 4Z66B 1F66A 5B31G 1P3LA 1B6WA 5CPKA 1A7WA 3WA9C 2CWEA 1P3IC 3A6NB 2NZDA 3WAAA 5B0YD 3KXBD 4NE6A 3MVDC 3UTAA 3RELC 3AZIB 5CPIA 3AZHD 3X1VA 5B2JB 5B2IC 4ZUXC 5B1MA 5DNMB 3F6TA 2XD5A 5JRGA 2YFWA 5AV5C 3W97D 1M1AB 4LD9A 3REKA 1P3AB 1P34C 3MGRB 5B31B 1AOID 3MGQA 3AV2D 4QLCC 3UT9C 4J8WA 3AZKD 3H0RC 3VH6T 3O62A 1S32D 4CSRA 5GSUD 5BT1C 4AWLC 1P3OD 4YM6B 5B32D 1BH8B 3WTPB 5GT3C 5AVBD 1TZYB 4XZQB 3LELB 1F66D 2F2AC 4J8XD 1P3LD 5GXQB 3LJAB 3VH6W 5CPKD 1EQZD 4WJ3C 3W99D 3AZLC 2NZDD 5AV9B 4WZSB 5AY8B 4G92C 4WU8D 4H9RA 3W96B 4KGCA 2CV5B 1ULYA 1H3OA 4G91B 5B24D 3LZ1A 2AROD 1ID3A 3W97C 3MNND 5JRGD 1AOIC 1M19B 2DF4C 3KSYA 5B33D 3AZKC 1S32C 3AZEC 5GSUC 1P3KD 1P3OC 5AV8D 4J8WD 5AVCB 3UTBC 2Y2QA 1KX4B 1P3BB 3AYWB 1F66C 3KUYA 1P3LC 5CPKC 4JJNA 3AZNB 3AZMA 3W99C 2ZY4A 2NZDC 3WAAC 5AV6B 1KX5D 2UWXA 4UUZA 3UTAC 3REJD 4UPKA 3KWQA 3X1VC 2AROC 5B1MC 5E5AA 5G49B 4X23A 4Z66A 5JRGC 4WU9B 3X1UD 1ID3D 4LD9C 3REKC 2NQBB 3X1SB 3B0CT 3MGPD 5CP6D 3A6NA 5AV8C 4J8WC 5CPJD 3O62C 3AZIA 2FJ7D 4KUDB 1P3PD 2BG1A 5B2JA 2W8SA 3AZJB 3REID 5DNMA 1M18B 3C1CB 3B0CW 3KUYD 1M1AA 3TU4B 3C1BB 1P3AA 3EPHA 3MGRA 5B31A 4JJND 4J8VD 3REJC 3WKJB 4YM6A 1BFMA 1BH8A 2VQRA 1U35D 2HIOB 3WTPA 3LZ1C 1TZYA 1ID3C 5E5AD 1R4VA 4XZQA 3LELA 4Z2MH 5GXQA 3LJAA 5AV9A 2FJ7C 3NQUB 1HQ3B 5AY8A 3W96A 4Z5TB 5B1LB 5B0ZB 3AFAD 3AZID 3WA9D 2CV5A 5B2JD 1P3ID 5BNXB 2F8NB 1Q9CA 5BNVB 3KUYC 3MVDD 3RELD 1P3GD 4JJNC 1M19A 3AZMC 1P3FB 1M1AD 3NQJB 3B0DC 3KWQC 5AVCA 4J8UB 1P34D 4WNNB 4YM6D 1KX4A 5E5AC 4X23C 3AYWA 4QLCD 4Z66C 3UT9D 2F8NH 2Y2MA 5BT1D 3AZNA 5DNNB 3AN2B 3AZGB 3A6NC 5GT3D 5AV6A 4YS3B 2Y2IA 4H9PB 3AZIC 3AFAC 1W2EA 5AY8D 5B2JC 2JCHA 1KU5A 4CAYB 3W96D 3IP4C 3VH5T 5G49A 5DNMC 3AZLD 4R8PB 1P3GC 4WU9A 1M1AC 3R45B 5JA4B 1P3AC 2RIQA 3MGRC 2NQBA 5B31C 3X1SA 1M19D 5F99B 4EO5B 1P3MB 2HUEB 5BS7A 3VH5W 4YM6C 5FUGB 4KUDA 3W98B 3WTPC 1KX4D 3AZJA 1TZYC 3AZED 1P3BD 1M18A 4XZQC 2IO5B 3LELC 3C1CA 1BH9B 3LZ0B 3UTBD 3C1BA 3P5JB 5GXQC 3LJAC 3TU4A 5AV9C 5AV6D 3WKJA 5AY8C 3AZFB 3W96C 2CV5C 3AV1B 2HIOA 4H9QB 4KHAB 3WAAD 4G91C 3A1KA 3UTAD 5CPID 3X1VD 1M19C 2PYOB 5B1MD 3B6FB 3B6GB 3NQUA 1HQ3A 5AVCC 3REKD 4LD9D 4Z5TA 5B1LA 5B0ZA 3V9RB 1KX4C 4KUDD 3MGQD 3REHB 1P3BC 5BNXA 3AYWC 2F8NA 5BNVA 3O62D 3VH6A 1M18D 2Y2PA 3AZNC 5GT0B 1P3FA 3C1BD 5AV6C 3NQJA 2JSSA 3WKJD 5B32G 5B0YB 3KXBB 1T3UA 4J8UA 3AL0C 4WNNA 2JE5A 3AZHB 4NE3A 2YFVB 5CPIC 4WU9C 1B67A 4H9NB 4KGCD 2NQBC 5DNNA 3X1SC 3AN2A 3AZGA 4ZBJB 3LZ1D 2ZY2A 5BS7C 4H9PA 4YS3A 3AV2B 3W98A 4KUDC 1S32B 3MGQC 1KX3B 1ZLAB 4XUJB 4CAYA 5B1LD 5B32B 1M18C 4R8PA 4DQYB 2F8ND 3X1TB 5AVBB 3R45A 5JA4A 3C1BC 3TU4C 4NE5A 4DRAA 4J8XB 1P3FD 5F99A 1EQZB 3WKJC 1P3MA 2DQNC 3W99B 5FUGA 3EPLA 3AZMD 2HIOC 4J8UD
chains in the Genus database with same CATH topology
5B24B 3KWQD 4KGCC 2AROB 1BH9A 3LZ0A 3MNNB 4H9OB 2BYMB 4X23D 2LY8A 4Z66D 3EG5B 5B33B 1HQ3C 3MGSB 3AZFA 4YS3D 1P3KB 5B0ZC 5B1LC 5AV8B 3AV1A 3A6ND 4H9QA 4KHAA 4R8PD 4WU8B 1P3FC 2RVQC 2PYOA 5BO0B 5DNMD 3B6GA 3B6FA 1P3AD 1KX5B 4J8UC 3MGRD 3REJB 5B31D 3V9RA 3REHA 2Y2GA 2G5HC 2J8PA 5GT0A 5DNNC 3X1UB 3AN2C 3AZGC 3WTPD 1TZYD 2XD1A 3MGPB 4XZQD 3LELD 4YS3C 5CP6B 5CPJB 5B0YA 4H9SA 3KXBA 3AZFD 5GXQD 3A1IA 3LJAD 3AZHA 1P3PB 2YFVA 4R8PC 5AV9D 2Y2OA 5C3IB 3REIB 1HTAA 4H9NA 2G5IC 1PZRA 2CV5D 5F99C 3B0BA 4EO5C 1P3MC 2HUEC 2Y2HA 4J8VB 3AV2A 1TAFB 1Z2CB 1S32A 1KX3A 1ZLAA 4XUJA 5B32A 4HGAB 1U35B 3REHD 3X1TA 5AVBA 5AVCD 3LZ0C 4J8XA 5GT0D 3AYWD 1EQZA 5B40B 3AZFC 3W99A 3AZND 3AV1C 4WU8A 1JFIB 3AFAB 3WA9B 1P3IB 5B24A 2AROA 3MVDB 2PYOC 3MNNA 3RELB 1P3GB 3EPKA 4H9OA 2BYMA 3B6FC 3VH5A 5B2IB 3B6GC 5B33A 4WU9D 4ZUXB 2BYKB 2ZM5A 3MGSA 1P3KA 3WTPE 5AV8A 2NQBD 5AV5B 3X1SD 3REHC 1KX3D 1ZLAD 4XUJD 1P34B 4M6BA 4QLCB 3UT9B 3X1TD 5GT0C 4AWLB 5BO0A 3EPJA 4DRBA 3AZJD 3C1CD 5GT3B 5B0YC 4H9SC 3KXBC 3TU4D 1KX5A 4WV4B 3REJA 5KDMB 3AZHC 3AZLB 3X1UA 2HIOD 4G92B 4ZBJC 3MGPA 1WWSA 2ZY3A 5CP6A 3AV2C 5CPJA 3W97B 1KX3C 3MGSD 1ZLAC 4XUJC 2FJ7A 1AOIB 5B32C 1N1JB 2Y2KA 2L5AA 1P3PA 3AZKB 3X1TC 1HQ3D 5AVBC 5GSUB 3REIA 3AZEB 1P3OB 4Z5TD 5B0ZD 3AZJC 4J8XC 3C1CC 3UTBB 1EQZC 4J8VA 1F66B 1TAFA 1P3LB 2RVQD 4WU8C 5CPKB 3H0LC 1U35A 2NZDB 3WAAB 5B24C 4Z2MG 3UTAB 3MNNC 5CPIB 3X1VB 5B33C 5B1MB 5B40A 3MGSC 1P3KC 5JRGB 2YFWB 5DNND 3AN2D 3AZGD 3REKB 1JFIA 4LD9B 3AFAA 3WA9A 4E44A 3MGQB 1P3IA 4Z5TC 4J8WB 2Y2NA 3O62B 4CSRB 3MVDA 3RELA 1P3GA 5CHLB 1WWIA 5B2IA 4ZUXA 2ZY5A 2BYKA 1KX5C 5AV5A 4E45A 2FFFB 5F99D 1P34A 2F8NG 1P3MD 4QLCA 3UT9A 3X1UC 4H9RB 3W98D 2F8NK 4KGCB 3H0MC 3MGPC 1H3OB 5CP6C 5GT3A 3LZ1B 5CPJC 3LZ0D 1ID3B 5B40D 5KDMA 1P3PC 2Y2LA 3KFUG 5C3IC 3REIC 3AZLA 2FJ7B 3AV1D 2Y2JA 5B2ID 4J8VC 4NFTA 3W97A 4ZUXD 3KUYB 2PYOD 3FDDA 4JJNB 1AOIA 5AV5D 1N1JA 4HGAC 3AZMB 1U35C 3B6GD 3B6FD 3AZKA 3AZEA 5GSUA 1P3BA 3B0DB 4UUZB 1P3OA 3W98C 3KWQB 2IO5C 3UTBA 1F1EA 5E5AB 4X23B 5B40C 4Z66B 1F66A 5B31G 1P3LA 1B6WA 5CPKA 1A7WA 3WA9C 2CWEA 1P3IC 3A6NB 2NZDA 3WAAA 5B0YD 3KXBD 4NE6A 3MVDC 3UTAA 3RELC 3AZIB 5CPIA 3AZHD 3X1VA 5B2JB 5B2IC 4ZUXC 5B1MA 5DNMB 3F6TA 2XD5A 5JRGA 2YFWA 5AV5C 3W97D 1M1AB 4LD9A 3REKA 1P3AB 1P34C 3MGRB 5B31B 1AOID 3MGQA 3AV2D 4QLCC 3UT9C 4J8WA 3AZKD 3H0RC 3VH6T 3O62A 1S32D 4CSRA 5GSUD 5BT1C 4AWLC 1P3OD 4YM6B 5B32D 1BH8B 3WTPB 5GT3C 5AVBD 1TZYB 4XZQB 3LELB 1F66D 2F2AC 4J8XD 1P3LD 5GXQB 3LJAB 3VH6W 5CPKD 1EQZD 4WJ3C 3W99D 3AZLC 2NZDD 5AV9B 4WZSB 5AY8B 4G92C 4WU8D 4H9RA 3W96B 4KGCA 2CV5B 1ULYA 1H3OA 4G91B 5B24D 3LZ1A 2AROD 1ID3A 3W97C 3MNND 5JRGD 1AOIC 1M19B 2DF4C 3KSYA 5B33D 3AZKC 1S32C 3AZEC 5GSUC 1P3KD 1P3OC 5AV8D 4J8WD 5AVCB 3UTBC 2Y2QA 1KX4B 1P3BB 3AYWB 1F66C 3KUYA 1P3LC 5CPKC 4JJNA 3AZNB 3AZMA 3W99C 2ZY4A 2NZDC 3WAAC 5AV6B 1KX5D 2UWXA 4UUZA 3UTAC 3REJD 4UPKA 3KWQA 3X1VC 2AROC 5B1MC 5E5AA 5G49B 4X23A 4Z66A 5JRGC 4WU9B 3X1UD 1ID3D 4LD9C 3REKC 2NQBB 3X1SB 3B0CT 3MGPD 5CP6D 3A6NA 5AV8C 4J8WC 5CPJD 3O62C 3AZIA 2FJ7D 4KUDB 1P3PD 2BG1A 5B2JA 2W8SA 3AZJB 3REID 5DNMA 1M18B 3C1CB 3B0CW 3KUYD 1M1AA 3TU4B 3C1BB 1P3AA 3EPHA 3MGRA 5B31A 4JJND 4J8VD 3REJC 3WKJB 4YM6A 1BFMA 1BH8A 2VQRA 1U35D 2HIOB 3WTPA 3LZ1C 1TZYA 1ID3C 5E5AD 1R4VA 4XZQA 3LELA 4Z2MH 5GXQA 3LJAA 5AV9A 2FJ7C 3NQUB 1HQ3B 5AY8A 3W96A 4Z5TB 5B1LB 5B0ZB 3AFAD 3AZID 3WA9D 2CV5A 5B2JD 1P3ID 5BNXB 2F8NB 1Q9CA 5BNVB 3KUYC 3MVDD 3RELD 1P3GD 4JJNC 1M19A 3AZMC 1P3FB 1M1AD 3NQJB 3B0DC 3KWQC 5AVCA 4J8UB 1P34D 4WNNB 4YM6D 1KX4A 5E5AC 4X23C 3AYWA 4QLCD 4Z66C 3UT9D 2F8NH 2Y2MA 5BT1D 3AZNA 5DNNB 3AN2B 3AZGB 3A6NC 5GT3D 5AV6A 4YS3B 2Y2IA 4H9PB 3AZIC 3AFAC 1W2EA 5AY8D 5B2JC 2JCHA 1KU5A 4CAYB 3W96D 3IP4C 3VH5T 5G49A 5DNMC 3AZLD 4R8PB 1P3GC 4WU9A 1M1AC 3R45B 5JA4B 1P3AC 2RIQA 3MGRC 2NQBA 5B31C 3X1SA 1M19D 5F99B 4EO5B 1P3MB 2HUEB 5BS7A 3VH5W 4YM6C 5FUGB 4KUDA 3W98B 3WTPC 1KX4D 3AZJA 1TZYC 3AZED 1P3BD 1M18A 4XZQC 2IO5B 3LELC 3C1CA 1BH9B 3LZ0B 3UTBD 3C1BA 3P5JB 5GXQC 3LJAC 3TU4A 5AV9C 5AV6D 3WKJA 5AY8C 3AZFB 3W96C 2CV5C 3AV1B 2HIOA 4H9QB 4KHAB 3WAAD 4G91C 3A1KA 3UTAD 5CPID 3X1VD 1M19C 2PYOB 5B1MD 3B6FB 3B6GB 3NQUA 1HQ3A 5AVCC 3REKD 4LD9D 4Z5TA 5B1LA 5B0ZA 3V9RB 1KX4C 4KUDD 3MGQD 3REHB 1P3BC 5BNXA 3AYWC 2F8NA 5BNVA 3O62D 3VH6A 1M18D 2Y2PA 3AZNC 5GT0B 1P3FA 3C1BD 5AV6C 3NQJA 2JSSA 3WKJD 5B32G 5B0YB 3KXBB 1T3UA 4J8UA 3AL0C 4WNNA 2JE5A 3AZHB 4NE3A 2YFVB 5CPIC 4WU9C 1B67A 4H9NB 4KGCD 2NQBC 5DNNA 3X1SC 3AN2A 3AZGA 4ZBJB 3LZ1D 2ZY2A 5BS7C 4H9PA 4YS3A 3AV2B 3W98A 4KUDC 1S32B 3MGQC 1KX3B 1ZLAB 4XUJB 4CAYA 5B1LD 5B32B 1M18C 4R8PA 4DQYB 2F8ND 3X1TB 5AVBB 3R45A 5JA4A 3C1BC 3TU4C 4NE5A 4DRAA 4J8XB 1P3FD 5F99A 1EQZB 3WKJC 1P3MA 2DQNC 3W99B 5FUGA 3EPLA 3AZMD 2HIOC 4J8UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  3KWQ D;  4KGC C;  2ARO B;  1BH9 A;  3LZ0 A;  3MNN B;  4H9O B;  2BYM B;  4X23 D;  2LY8 A;  4Z66 D;  5B33 B;  1HQ3 C;  3MGS B;  3AZF A;  4YS3 D;  1P3K B;  5B0Z C;  5B1L C;  5AV8 B;  3AV1 A;  3A6N D;  4H9Q A;  4KHA A;  4R8P D;  2HIO C;  1P3F C;  2RVQ C;  2PYO A;  5BO0 B;  5DNM D;  3B6G A;  3B6F A;  1P3A D;  1KX5 B;  4J8U C;  3MGR D;  3REJ B;  5B31 D;  3V9R A;  3REH A;  5GT0 A;  5DNN C;  3X1U B;  3AN2 C;  3AZG C;  3WTP D;  1TZY D;  3MGP B;  4XZQ D;  3LEL D;  4YS3 C;  5CP6 B;  5CPJ B;  5B0Y A;  4H9S A;  3KXB A;  3AZF D;  5GXQ D;  3LJA D;  3AZH A;  1P3P B;  2YFV A;  4R8P C;  5AV9 D;  5C3I B;  3REI B;  1HTA A;  4H9N A;  2CV5 D;  5F99 C;  3B0B A;  4EO5 C;  1P3M C;  2HUE C;  4J8V B;  3AV2 A;  1TAF B;  1S32 A;  1KX3 A;  1ZLA A;  4XUJ A;  5B32 A;  4HGA B;  1U35 B;  3REH D;  3X1T A;  5AVC D;  5AVB A;  3LZ0 C;  4J8X A;  5GT0 D;  3AYW D;  1EQZ A;  5B40 B;  3AZF C;  3W99 A;  3AZN D;  3AV1 C;  4WU8 A;  1JFI B;  3AFA B;  3WA9 B;  1P3I B;  5B24 A;  2ARO A;  3MVD B;  2PYO C;  3MNN A;  3REL B;  1P3G B;  4H9O A;  2BYM A;  3B6F C;  3VH5 A;  5B2I B;  3B6G C;  5B33 A;  4WU9 D;  4ZUX B;  2BYK B;  3MGS A;  1P3K A;  3WTP E;  5AV8 A;  2NQB D;  5AV5 B;  3X1S D;  3REH C;  1KX3 D;  1ZLA D;  4XUJ D;  1P34 B;  4M6B A;  4QLC B;  3UT9 B;  3X1T D;  5GT0 C;  4AWL B;  5BO0 A;  4DRB A;  3AZJ D;  3C1C D;  5GT3 B;  5B0Y C;  4H9S C;  3KXB C;  3TU4 D;  1KX5 A;  4WV4 B;  3REJ A;  5KDM B;  3AZH C;  3AZL B;  3X1U A;  2HIO D;  4G92 B;  4ZBJ C;  3MGP A;  1WWS A;  5CP6 A;  3AV2 C;  5CPJ A;  3W97 B;  1KX3 C;  3MGS D;  1ZLA C;  4XUJ C;  2FJ7 A;  1AOI B;  5B32 C;  1N1J B;  1P3P A;  2L5A A;  3AZK B;  3X1T C;  1HQ3 D;  5AVB C;  5GSU B;  3REI A;  3AZE B;  1P3O B;  4Z5T D;  5B0Z D;  3AZJ C;  4J8X C;  3C1C C;  3UTB B;  1EQZ C;  4J8V A;  1F66 B;  1TAF A;  1P3L B;  2RVQ D;  4WU8 C;  5CPK B;  1U35 A;  2NZD B;  3WAA B;  5B24 C;  4Z2M G;  3UTA B;  3MNN C;  5CPI B;  3X1V B;  5B33 C;  5B1M B;  5B40 A;  3MGS C;  1P3K C;  5JRG B;  2YFW B;  5DNN D;  3AN2 D;  3AZG D;  3REK B;  1JFI A;  4LD9 B;  3AFA A;  3WA9 A;  4E44 A;  3MGQ B;  1P3I A;  4Z5T C;  4J8W B;  3O62 B;  4CSR B;  3MVD A;  3REL A;  1P3G A;  5CHL B;  1WWI A;  5B2I A;  4ZUX A;  2BYK A;  1KX5 C;  5AV5 A;  4E45 A;  5F99 D;  1P34 A;  2F8N G;  1P3M D;  4QLC A;  3UT9 A;  3X1U C;  4H9R B;  3W98 D;  2F8N K;  4KGC B;  3MGP C;  1H3O B;  5CP6 C;  5GT3 A;  3LZ1 B;  5CPJ C;  3LZ0 D;  1ID3 B;  5B40 D;  5KDM A;  1P3P C;  5C3I C;  3REI C;  3AZL A;  2FJ7 B;  3AV1 D;  5B2I D;  4J8V C;  4NFT A;  3W97 A;  4ZUX D;  3KUY B;  2PYO D;  4JJN B;  1AOI A;  5AV5 D;  1N1J A;  4HGA C;  3AZM B;  1U35 C;  3B6G D;  3B6F D;  3AZK A;  3AZE A;  5GSU A;  1P3B A;  3B0D B;  4UUZ B;  1P3O A;  3W98 C;  3KWQ B;  2IO5 C;  3UTB A;  1F1E A;  5E5A B;  4X23 B;  5B40 C;  4Z66 B;  1F66 A;  5B31 G;  1P3L A;  1B6W A;  5CPK A;  1A7W A;  3WA9 C;  2CWE A;  1P3I C;  3A6N B;  2NZD A;  3WAA A;  5B0Y D;  3KXB D;  4NE6 A;  3MVD C;  3UTA A;  3REL C;  3AZI B;  5CPI A;  3AZH D;  3X1V A;  5B2J B;  5B2I C;  4ZUX C;  5B1M A;  5DNM B;  5JRG A;  2YFW A;  5AV5 C;  3W97 D;  1M1A B;  4LD9 A;  3REK A;  1P3A B;  1P34 C;  3MGR B;  5B31 B;  1AOI D;  3MGQ A;  3AV2 D;  4QLC C;  3UT9 C;  4J8W A;  3AZK D;  3VH6 T;  1S32 D;  3O62 A;  4CSR A;  5GSU D;  5BT1 C;  4AWL C;  1P3O D;  4YM6 B;  5B32 D;  1BH8 B;  3WTP B;  5GT3 C;  5AVB D;  1TZY B;  4XZQ B;  3LEL B;  1F66 D;  4J8X D;  1P3L D;  5GXQ B;  3LJA B;  3VH6 W;  5CPK D;  1EQZ D;  3W99 D;  3AZL C;  2NZD D;  5AV9 B;  4WZS B;  5AY8 B;  4G92 C;  4WU8 D;  4H9R A;  3W96 B;  4KGC A;  2CV5 B;  1ULY A;  1H3O A;  4G91 B;  5B24 D;  3LZ1 A;  2ARO D;  1ID3 A;  3W97 C;  3MNN D;  5JRG D;  1AOI C;  1M19 B;  3KSY A;  5B33 D;  3AZK C;  1S32 C;  3AZE C;  5GSU C;  1P3K D;  1P3O C;  5AV8 D;  4J8W D;  5AVC B;  3UTB C;  1KX4 B;  1P3B B;  3AYW B;  1F66 C;  3KUY A;  1P3L C;  5CPK C;  4JJN A;  3AZN B;  3AZM A;  3W99 C;  2NZD C;  3WAA C;  5AV6 B;  1KX5 D;  4UUZ A;  3UTA C;  3REJ D;  3KWQ A;  3X1V C;  2ARO C;  5B1M C;  5E5A A;  5G49 B;  4X23 A;  4Z66 A;  5JRG C;  4WU9 B;  3X1U D;  1ID3 D;  4LD9 C;  3REK C;  2NQB B;  3X1S B;  3B0C T;  3MGP D;  5CP6 D;  3A6N A;  5AV8 C;  4J8W C;  5CPJ D;  3O62 C;  3AZI A;  2FJ7 D;  4KUD B;  1P3P D;  5B2J A;  3AZJ B;  3REI D;  5DNM A;  1M18 B;  3C1C B;  3B0C W;  3KUY D;  1M1A A;  3TU4 B;  3C1B B;  1P3A A;  3MGR A;  5B31 A;  4JJN D;  4J8V D;  3REJ C;  3WKJ B;  4YM6 A;  1BFM A;  1BH8 A;  1U35 D;  2HIO B;  3WTP A;  3LZ1 C;  1TZY A;  1ID3 C;  5E5A D;  1R4V A;  4XZQ A;  3LEL A;  4Z2M H;  5GXQ A;  3LJA A;  5AV9 A;  2FJ7 C;  3NQU B;  1HQ3 B;  5AY8 A;  3W96 A;  5B0Z B;  5B1L B;  4Z5T B;  3AFA D;  3AZI D;  3WA9 D;  2CV5 A;  5B2J D;  1P3I D;  5BNX B;  2F8N B;  1Q9C A;  5BNV B;  3KUY C;  3MVD D;  3REL D;  1P3G D;  4JJN C;  1M19 A;  3AZM C;  1P3F B;  1M1A D;  3NQJ B;  3B0D C;  3KWQ C;  5AVC A;  4J8U B;  1P34 D;  4WNN B;  4YM6 D;  1KX4 A;  5E5A C;  4X23 C;  3AYW A;  4QLC D;  4Z66 C;  3UT9 D;  2F8N H;  5BT1 D;  3AZN A;  5DNN B;  3AN2 B;  3AZG B;  3A6N C;  5GT3 D;  5AV6 A;  4YS3 B;  4H9P B;  3AZI C;  3AFA C;  5AY8 D;  5B2J C;  3W96 D;  1KU5 A;  4CAY B;  3VH5 T;  5G49 A;  5DNM C;  3AZL D;  4R8P B;  1P3G C;  4WU9 A;  1M1A C;  3R45 B;  5JA4 B;  1P3A C;  3MGR C;  2NQB A;  5B31 C;  3X1S A;  1M19 D;  5F99 B;  4EO5 B;  1P3M B;  2HUE B;  5BS7 A;  3VH5 W;  4YM6 C;  5FUG B;  4KUD A;  3W98 B;  3WTP C;  1KX4 D;  3AZJ A;  1TZY C;  3AZE D;  1P3B D;  1M18 A;  4XZQ C;  2IO5 B;  3LEL C;  3C1C A;  1BH9 B;  3LZ0 B;  3UTB D;  3C1B A;  3TU4 A;  5GXQ C;  3LJA C;  5AV9 C;  5AV6 D;  3WKJ A;  5AY8 C;  3AZF B;  3W96 C;  2CV5 C;  3AV1 B;  2HIO A;  4H9Q B;  4KHA B;  3WAA D;  4G91 C;  3UTA D;  5CPI D;  3X1V D;  1M19 C;  2PYO B;  5B1M D;  3B6F B;  3B6G B;  3NQU A;  1HQ3 A;  5AVC C;  3REK D;  4LD9 D;  4Z5T A;  5B1L A;  5B0Z A;  3V9R B;  1KX4 C;  4KUD D;  3MGQ D;  3REH B;  1P3B C;  5BNX A;  3AYW C;  2F8N A;  5BNV A;  3O62 D;  3VH6 A;  1M18 D;  3AZN C;  5GT0 B;  1P3F A;  3C1B D;  5AV6 C;  3NQJ A;  2JSS A;  3WKJ D;  5B32 G;  5B0Y B;  3KXB B;  4J8U A;  4WNN A;  3AZH B;  4NE3 A;  2YFV B;  5CPI C;  4WU9 C;  1B67 A;  4H9N B;  4KGC D;  2NQB C;  5DNN A;  3X1S C;  3AN2 A;  3AZG A;  4ZBJ B;  3LZ1 D;  5BS7 C;  4H9P A;  4YS3 A;  3AV2 B;  3W98 A;  4KUD C;  1S32 B;  3MGQ C;  1KX3 B;  1ZLA B;  4XUJ B;  4CAY A;  5B1L D;  5B32 B;  1M18 C;  4R8P A;  2F8N D;  3X1T B;  5AVB B;  3R45 A;  5JA4 A;  3C1B C;  3TU4 C;  4NE5 A;  4DRA A;  4J8X B;  1P3F D;  5F99 A;  1EQZ B;  3WKJ C;  1P3M A;  3W99 B;  5FUG A;  3AZM D;  4WU8 B;  4J8U D; 
#chains in the Genus database with same CATH topology
 5B24 B;  3KWQ D;  4KGC C;  2ARO B;  1BH9 A;  3LZ0 A;  3MNN B;  4H9O B;  2BYM B;  4X23 D;  2LY8 A;  4Z66 D;  3EG5 B;  5B33 B;  1HQ3 C;  3MGS B;  3AZF A;  4YS3 D;  1P3K B;  5B0Z C;  5B1L C;  5AV8 B;  3AV1 A;  3A6N D;  4H9Q A;  4KHA A;  4R8P D;  4WU8 B;  1P3F C;  2RVQ C;  2PYO A;  5BO0 B;  5DNM D;  3B6G A;  3B6F A;  1P3A D;  1KX5 B;  4J8U C;  3MGR D;  3REJ B;  5B31 D;  3V9R A;  3REH A;  2Y2G A;  2G5H C;  2J8P A;  5GT0 A;  5DNN C;  3X1U B;  3AN2 C;  3AZG C;  3WTP D;  1TZY D;  2XD1 A;  3MGP B;  4XZQ D;  3LEL D;  4YS3 C;  5CP6 B;  5CPJ B;  5B0Y A;  4H9S A;  3KXB A;  3AZF D;  5GXQ D;  3A1I A;  3LJA D;  3AZH A;  1P3P B;  2YFV A;  4R8P C;  5AV9 D;  2Y2O A;  5C3I B;  3REI B;  1HTA A;  4H9N A;  2G5I C;  1PZR A;  2CV5 D;  5F99 C;  3B0B A;  4EO5 C;  1P3M C;  2HUE C;  2Y2H A;  4J8V B;  3AV2 A;  1TAF B;  1Z2C B;  1S32 A;  1KX3 A;  1ZLA A;  4XUJ A;  5B32 A;  4HGA B;  1U35 B;  3REH D;  3X1T A;  5AVB A;  5AVC D;  3LZ0 C;  4J8X A;  5GT0 D;  3AYW D;  1EQZ A;  5B40 B;  3AZF C;  3W99 A;  3AZN D;  3AV1 C;  4WU8 A;  1JFI B;  3AFA B;  3WA9 B;  1P3I B;  5B24 A;  2ARO A;  3MVD B;  2PYO C;  3MNN A;  3REL B;  1P3G B;  3EPK A;  4H9O A;  2BYM A;  3B6F C;  3VH5 A;  5B2I B;  3B6G C;  5B33 A;  4WU9 D;  4ZUX B;  2BYK B;  2ZM5 A;  3MGS A;  1P3K A;  3WTP E;  5AV8 A;  2NQB D;  5AV5 B;  3X1S D;  3REH C;  1KX3 D;  1ZLA D;  4XUJ D;  1P34 B;  4M6B A;  4QLC B;  3UT9 B;  3X1T D;  5GT0 C;  4AWL B;  5BO0 A;  3EPJ A;  4DRB A;  3AZJ D;  3C1C D;  5GT3 B;  5B0Y C;  4H9S C;  3KXB C;  3TU4 D;  1KX5 A;  4WV4 B;  3REJ A;  5KDM B;  3AZH C;  3AZL B;  3X1U A;  2HIO D;  4G92 B;  4ZBJ C;  3MGP A;  1WWS A;  2ZY3 A;  5CP6 A;  3AV2 C;  5CPJ A;  3W97 B;  1KX3 C;  3MGS D;  1ZLA C;  4XUJ C;  2FJ7 A;  1AOI B;  5B32 C;  1N1J B;  2Y2K A;  2L5A A;  1P3P A;  3AZK B;  3X1T C;  1HQ3 D;  5AVB C;  5GSU B;  3REI A;  3AZE B;  1P3O B;  4Z5T D;  5B0Z D;  3AZJ C;  4J8X C;  3C1C C;  3UTB B;  1EQZ C;  4J8V A;  1F66 B;  1TAF A;  1P3L B;  2RVQ D;  4WU8 C;  5CPK B;  3H0L C;  1U35 A;  2NZD B;  3WAA B;  5B24 C;  4Z2M G;  3UTA B;  3MNN C;  5CPI B;  3X1V B;  5B33 C;  5B1M B;  5B40 A;  3MGS C;  1P3K C;  5JRG B;  2YFW B;  5DNN D;  3AN2 D;  3AZG D;  3REK B;  1JFI A;  4LD9 B;  3AFA A;  3WA9 A;  4E44 A;  3MGQ B;  1P3I A;  4Z5T C;  4J8W B;  2Y2N A;  3O62 B;  4CSR B;  3MVD A;  3REL A;  1P3G A;  5CHL B;  1WWI A;  5B2I A;  4ZUX A;  2ZY5 A;  2BYK A;  1KX5 C;  5AV5 A;  4E45 A;  2FFF B;  5F99 D;  1P34 A;  2F8N G;  1P3M D;  4QLC A;  3UT9 A;  3X1U C;  4H9R B;  3W98 D;  2F8N K;  4KGC B;  3H0M C;  3MGP C;  1H3O B;  5CP6 C;  5GT3 A;  3LZ1 B;  5CPJ C;  3LZ0 D;  1ID3 B;  5B40 D;  5KDM A;  1P3P C;  2Y2L A;  3KFU G;  5C3I C;  3REI C;  3AZL A;  2FJ7 B;  3AV1 D;  2Y2J A;  5B2I D;  4J8V C;  4NFT A;  3W97 A;  4ZUX D;  3KUY B;  2PYO D;  3FDD A;  4JJN B;  1AOI A;  5AV5 D;  1N1J A;  4HGA C;  3AZM B;  1U35 C;  3B6G D;  3B6F D;  3AZK A;  3AZE A;  5GSU A;  1P3B A;  3B0D B;  4UUZ B;  1P3O A;  3W98 C;  3KWQ B;  2IO5 C;  3UTB A;  1F1E A;  5E5A B;  4X23 B;  5B40 C;  4Z66 B;  1F66 A;  5B31 G;  1P3L A;  1B6W A;  5CPK A;  1A7W A;  3WA9 C;  2CWE A;  1P3I C;  3A6N B;  2NZD A;  3WAA A;  5B0Y D;  3KXB D;  4NE6 A;  3MVD C;  3UTA A;  3REL C;  3AZI B;  5CPI A;  3AZH D;  3X1V A;  5B2J B;  5B2I C;  4ZUX C;  5B1M A;  5DNM B;  3F6T A;  2XD5 A;  5JRG A;  2YFW A;  5AV5 C;  3W97 D;  1M1A B;  4LD9 A;  3REK A;  1P3A B;  1P34 C;  3MGR B;  5B31 B;  1AOI D;  3MGQ A;  3AV2 D;  4QLC C;  3UT9 C;  4J8W A;  3AZK D;  3H0R C;  3VH6 T;  3O62 A;  1S32 D;  4CSR A;  5GSU D;  5BT1 C;  4AWL C;  1P3O D;  4YM6 B;  5B32 D;  1BH8 B;  3WTP B;  5GT3 C;  5AVB D;  1TZY B;  4XZQ B;  3LEL B;  1F66 D;  2F2A C;  4J8X D;  1P3L D;  5GXQ B;  3LJA B;  3VH6 W;  5CPK D;  1EQZ D;  4WJ3 C;  3W99 D;  3AZL C;  2NZD D;  5AV9 B;  4WZS B;  5AY8 B;  4G92 C;  4WU8 D;  4H9R A;  3W96 B;  4KGC A;  2CV5 B;  1ULY A;  1H3O A;  4G91 B;  5B24 D;  3LZ1 A;  2ARO D;  1ID3 A;  3W97 C;  3MNN D;  5JRG D;  1AOI C;  1M19 B;  2DF4 C;  3KSY A;  5B33 D;  3AZK C;  1S32 C;  3AZE C;  5GSU C;  1P3K D;  1P3O C;  5AV8 D;  4J8W D;  5AVC B;  3UTB C;  2Y2Q A;  1KX4 B;  1P3B B;  3AYW B;  1F66 C;  3KUY A;  1P3L C;  5CPK C;  4JJN A;  3AZN B;  3AZM A;  3W99 C;  2ZY4 A;  2NZD C;  3WAA C;  5AV6 B;  1KX5 D;  2UWX A;  4UUZ A;  3UTA C;  3REJ D;  4UPK A;  3KWQ A;  3X1V C;  2ARO C;  5B1M C;  5E5A A;  5G49 B;  4X23 A;  4Z66 A;  5JRG C;  4WU9 B;  3X1U D;  1ID3 D;  4LD9 C;  3REK C;  2NQB B;  3X1S B;  3B0C T;  3MGP D;  5CP6 D;  3A6N A;  5AV8 C;  4J8W C;  5CPJ D;  3O62 C;  3AZI A;  2FJ7 D;  4KUD B;  1P3P D;  2BG1 A;  5B2J A;  2W8S A;  3AZJ B;  3REI D;  5DNM A;  1M18 B;  3C1C B;  3B0C W;  3KUY D;  1M1A A;  3TU4 B;  3C1B B;  1P3A A;  3EPH A;  3MGR A;  5B31 A;  4JJN D;  4J8V D;  3REJ C;  3WKJ B;  4YM6 A;  1BFM A;  1BH8 A;  2VQR A;  1U35 D;  2HIO B;  3WTP A;  3LZ1 C;  1TZY A;  1ID3 C;  5E5A D;  1R4V A;  4XZQ A;  3LEL A;  4Z2M H;  5GXQ A;  3LJA A;  5AV9 A;  2FJ7 C;  3NQU B;  1HQ3 B;  5AY8 A;  3W96 A;  4Z5T B;  5B1L B;  5B0Z B;  3AFA D;  3AZI D;  3WA9 D;  2CV5 A;  5B2J D;  1P3I D;  5BNX B;  2F8N B;  1Q9C A;  5BNV B;  3KUY C;  3MVD D;  3REL D;  1P3G D;  4JJN C;  1M19 A;  3AZM C;  1P3F B;  1M1A D;  3NQJ B;  3B0D C;  3KWQ C;  5AVC A;  4J8U B;  1P34 D;  4WNN B;  4YM6 D;  1KX4 A;  5E5A C;  4X23 C;  3AYW A;  4QLC D;  4Z66 C;  3UT9 D;  2F8N H;  2Y2M A;  5BT1 D;  3AZN A;  5DNN B;  3AN2 B;  3AZG B;  3A6N C;  5GT3 D;  5AV6 A;  4YS3 B;  2Y2I A;  4H9P B;  3AZI C;  3AFA C;  1W2E A;  5AY8 D;  5B2J C;  2JCH A;  1KU5 A;  4CAY B;  3W96 D;  3IP4 C;  3VH5 T;  5G49 A;  5DNM C;  3AZL D;  4R8P B;  1P3G C;  4WU9 A;  1M1A C;  3R45 B;  5JA4 B;  1P3A C;  2RIQ A;  3MGR C;  2NQB A;  5B31 C;  3X1S A;  1M19 D;  5F99 B;  4EO5 B;  1P3M B;  2HUE B;  5BS7 A;  3VH5 W;  4YM6 C;  5FUG B;  4KUD A;  3W98 B;  3WTP C;  1KX4 D;  3AZJ A;  1TZY C;  3AZE D;  1P3B D;  1M18 A;  4XZQ C;  2IO5 B;  3LEL C;  3C1C A;  1BH9 B;  3LZ0 B;  3UTB D;  3C1B A;  3P5J B;  5GXQ C;  3LJA C;  3TU4 A;  5AV9 C;  5AV6 D;  3WKJ A;  5AY8 C;  3AZF B;  3W96 C;  2CV5 C;  3AV1 B;  2HIO A;  4H9Q B;  4KHA B;  3WAA D;  4G91 C;  3A1K A;  3UTA D;  5CPI D;  3X1V D;  1M19 C;  2PYO B;  5B1M D;  3B6F B;  3B6G B;  3NQU A;  1HQ3 A;  5AVC C;  3REK D;  4LD9 D;  4Z5T A;  5B1L A;  5B0Z A;  3V9R B;  1KX4 C;  4KUD D;  3MGQ D;  3REH B;  1P3B C;  5BNX A;  3AYW C;  2F8N A;  5BNV A;  3O62 D;  3VH6 A;  1M18 D;  2Y2P A;  3AZN C;  5GT0 B;  1P3F A;  3C1B D;  5AV6 C;  3NQJ A;  2JSS A;  3WKJ D;  5B32 G;  5B0Y B;  3KXB B;  1T3U A;  4J8U A;  3AL0 C;  4WNN A;  2JE5 A;  3AZH B;  4NE3 A;  2YFV B;  5CPI C;  4WU9 C;  1B67 A;  4H9N B;  4KGC D;  2NQB C;  5DNN A;  3X1S C;  3AN2 A;  3AZG A;  4ZBJ B;  3LZ1 D;  2ZY2 A;  5BS7 C;  4H9P A;  4YS3 A;  3AV2 B;  3W98 A;  4KUD C;  1S32 B;  3MGQ C;  1KX3 B;  1ZLA B;  4XUJ B;  4CAY A;  5B1L D;  5B32 B;  1M18 C;  4R8P A;  4DQY B;  2F8N D;  3X1T B;  5AVB B;  3R45 A;  5JA4 A;  3C1B C;  3TU4 C;  4NE5 A;  4DRA A;  4J8X B;  1P3F D;  5F99 A;  1EQZ B;  3WKJ C;  1P3M A;  2DQN C;  3W99 B;  5FUG A;  3EPL A;  3AZM D;  2HIO C;  4J8U D; 
#chains in the Genus database with same CATH homology
 5B24 B;  3KWQ D;  4KGC C;  2ARO B;  1BH9 A;  3LZ0 A;  3MNN B;  4H9O B;  2BYM B;  4X23 D;  2LY8 A;  4Z66 D;  3EG5 B;  5B33 B;  1HQ3 C;  3MGS B;  3AZF A;  4YS3 D;  1P3K B;  5B0Z C;  5B1L C;  5AV8 B;  3AV1 A;  3A6N D;  4H9Q A;  4KHA A;  4R8P D;  4WU8 B;  1P3F C;  2RVQ C;  2PYO A;  5BO0 B;  5DNM D;  3B6G A;  3B6F A;  1P3A D;  1KX5 B;  4J8U C;  3MGR D;  3REJ B;  5B31 D;  3V9R A;  3REH A;  2Y2G A;  2G5H C;  2J8P A;  5GT0 A;  5DNN C;  3X1U B;  3AN2 C;  3AZG C;  3WTP D;  1TZY D;  2XD1 A;  3MGP B;  4XZQ D;  3LEL D;  4YS3 C;  5CP6 B;  5CPJ B;  5B0Y A;  4H9S A;  3KXB A;  3AZF D;  5GXQ D;  3A1I A;  3LJA D;  3AZH A;  1P3P B;  2YFV A;  4R8P C;  5AV9 D;  2Y2O A;  5C3I B;  3REI B;  1HTA A;  4H9N A;  2G5I C;  1PZR A;  2CV5 D;  5F99 C;  3B0B A;  4EO5 C;  1P3M C;  2HUE C;  2Y2H A;  4J8V B;  3AV2 A;  1TAF B;  1Z2C B;  1S32 A;  1KX3 A;  1ZLA A;  4XUJ A;  5B32 A;  4HGA B;  1U35 B;  3REH D;  3X1T A;  5AVB A;  5AVC D;  3LZ0 C;  4J8X A;  5GT0 D;  3AYW D;  1EQZ A;  5B40 B;  3AZF C;  3W99 A;  3AZN D;  3AV1 C;  4WU8 A;  1JFI B;  3AFA B;  3WA9 B;  1P3I B;  5B24 A;  2ARO A;  3MVD B;  2PYO C;  3MNN A;  3REL B;  1P3G B;  3EPK A;  4H9O A;  2BYM A;  3B6F C;  3VH5 A;  5B2I B;  3B6G C;  5B33 A;  4WU9 D;  4ZUX B;  2BYK B;  2ZM5 A;  3MGS A;  1P3K A;  3WTP E;  5AV8 A;  2NQB D;  5AV5 B;  3X1S D;  3REH C;  1KX3 D;  1ZLA D;  4XUJ D;  1P34 B;  4M6B A;  4QLC B;  3UT9 B;  3X1T D;  5GT0 C;  4AWL B;  5BO0 A;  3EPJ A;  4DRB A;  3AZJ D;  3C1C D;  5GT3 B;  5B0Y C;  4H9S C;  3KXB C;  3TU4 D;  1KX5 A;  4WV4 B;  3REJ A;  5KDM B;  3AZH C;  3AZL B;  3X1U A;  2HIO D;  4G92 B;  4ZBJ C;  3MGP A;  1WWS A;  2ZY3 A;  5CP6 A;  3AV2 C;  5CPJ A;  3W97 B;  1KX3 C;  3MGS D;  1ZLA C;  4XUJ C;  2FJ7 A;  1AOI B;  5B32 C;  1N1J B;  2Y2K A;  2L5A A;  1P3P A;  3AZK B;  3X1T C;  1HQ3 D;  5AVB C;  5GSU B;  3REI A;  3AZE B;  1P3O B;  4Z5T D;  5B0Z D;  3AZJ C;  4J8X C;  3C1C C;  3UTB B;  1EQZ C;  4J8V A;  1F66 B;  1TAF A;  1P3L B;  2RVQ D;  4WU8 C;  5CPK B;  3H0L C;  1U35 A;  2NZD B;  3WAA B;  5B24 C;  4Z2M G;  3UTA B;  3MNN C;  5CPI B;  3X1V B;  5B33 C;  5B1M B;  5B40 A;  3MGS C;  1P3K C;  5JRG B;  2YFW B;  5DNN D;  3AN2 D;  3AZG D;  3REK B;  1JFI A;  4LD9 B;  3AFA A;  3WA9 A;  4E44 A;  3MGQ B;  1P3I A;  4Z5T C;  4J8W B;  2Y2N A;  3O62 B;  4CSR B;  3MVD A;  3REL A;  1P3G A;  5CHL B;  1WWI A;  5B2I A;  4ZUX A;  2ZY5 A;  2BYK A;  1KX5 C;  5AV5 A;  4E45 A;  2FFF B;  5F99 D;  1P34 A;  2F8N G;  1P3M D;  4QLC A;  3UT9 A;  3X1U C;  4H9R B;  3W98 D;  2F8N K;  4KGC B;  3H0M C;  3MGP C;  1H3O B;  5CP6 C;  5GT3 A;  3LZ1 B;  5CPJ C;  3LZ0 D;  1ID3 B;  5B40 D;  5KDM A;  1P3P C;  2Y2L A;  3KFU G;  5C3I C;  3REI C;  3AZL A;  2FJ7 B;  3AV1 D;  2Y2J A;  5B2I D;  4J8V C;  4NFT A;  3W97 A;  4ZUX D;  3KUY B;  2PYO D;  3FDD A;  4JJN B;  1AOI A;  5AV5 D;  1N1J A;  4HGA C;  3AZM B;  1U35 C;  3B6G D;  3B6F D;  3AZK A;  3AZE A;  5GSU A;  1P3B A;  3B0D B;  4UUZ B;  1P3O A;  3W98 C;  3KWQ B;  2IO5 C;  3UTB A;  1F1E A;  5E5A B;  4X23 B;  5B40 C;  4Z66 B;  1F66 A;  5B31 G;  1P3L A;  1B6W A;  5CPK A;  1A7W A;  3WA9 C;  2CWE A;  1P3I C;  3A6N B;  2NZD A;  3WAA A;  5B0Y D;  3KXB D;  4NE6 A;  3MVD C;  3UTA A;  3REL C;  3AZI B;  5CPI A;  3AZH D;  3X1V A;  5B2J B;  5B2I C;  4ZUX C;  5B1M A;  5DNM B;  3F6T A;  2XD5 A;  5JRG A;  2YFW A;  5AV5 C;  3W97 D;  1M1A B;  4LD9 A;  3REK A;  1P3A B;  1P34 C;  3MGR B;  5B31 B;  1AOI D;  3MGQ A;  3AV2 D;  4QLC C;  3UT9 C;  4J8W A;  3AZK D;  3H0R C;  3VH6 T;  3O62 A;  1S32 D;  4CSR A;  5GSU D;  5BT1 C;  4AWL C;  1P3O D;  4YM6 B;  5B32 D;  1BH8 B;  3WTP B;  5GT3 C;  5AVB D;  1TZY B;  4XZQ B;  3LEL B;  1F66 D;  2F2A C;  4J8X D;  1P3L D;  5GXQ B;  3LJA B;  3VH6 W;  5CPK D;  1EQZ D;  4WJ3 C;  3W99 D;  3AZL C;  2NZD D;  5AV9 B;  4WZS B;  5AY8 B;  4G92 C;  4WU8 D;  4H9R A;  3W96 B;  4KGC A;  2CV5 B;  1ULY A;  1H3O A;  4G91 B;  5B24 D;  3LZ1 A;  2ARO D;  1ID3 A;  3W97 C;  3MNN D;  5JRG D;  1AOI C;  1M19 B;  2DF4 C;  3KSY A;  5B33 D;  3AZK C;  1S32 C;  3AZE C;  5GSU C;  1P3K D;  1P3O C;  5AV8 D;  4J8W D;  5AVC B;  3UTB C;  2Y2Q A;  1KX4 B;  1P3B B;  3AYW B;  1F66 C;  3KUY A;  1P3L C;  5CPK C;  4JJN A;  3AZN B;  3AZM A;  3W99 C;  2ZY4 A;  2NZD C;  3WAA C;  5AV6 B;  1KX5 D;  2UWX A;  4UUZ A;  3UTA C;  3REJ D;  4UPK A;  3KWQ A;  3X1V C;  2ARO C;  5B1M C;  5E5A A;  5G49 B;  4X23 A;  4Z66 A;  5JRG C;  4WU9 B;  3X1U D;  1ID3 D;  4LD9 C;  3REK C;  2NQB B;  3X1S B;  3B0C T;  3MGP D;  5CP6 D;  3A6N A;  5AV8 C;  4J8W C;  5CPJ D;  3O62 C;  3AZI A;  2FJ7 D;  4KUD B;  1P3P D;  2BG1 A;  5B2J A;  2W8S A;  3AZJ B;  3REI D;  5DNM A;  1M18 B;  3C1C B;  3B0C W;  3KUY D;  1M1A A;  3TU4 B;  3C1B B;  1P3A A;  3EPH A;  3MGR A;  5B31 A;  4JJN D;  4J8V D;  3REJ C;  3WKJ B;  4YM6 A;  1BFM A;  1BH8 A;  2VQR A;  1U35 D;  2HIO B;  3WTP A;  3LZ1 C;  1TZY A;  1ID3 C;  5E5A D;  1R4V A;  4XZQ A;  3LEL A;  4Z2M H;  5GXQ A;  3LJA A;  5AV9 A;  2FJ7 C;  3NQU B;  1HQ3 B;  5AY8 A;  3W96 A;  4Z5T B;  5B1L B;  5B0Z B;  3AFA D;  3AZI D;  3WA9 D;  2CV5 A;  5B2J D;  1P3I D;  5BNX B;  2F8N B;  1Q9C A;  5BNV B;  3KUY C;  3MVD D;  3REL D;  1P3G D;  4JJN C;  1M19 A;  3AZM C;  1P3F B;  1M1A D;  3NQJ B;  3B0D C;  3KWQ C;  5AVC A;  4J8U B;  1P34 D;  4WNN B;  4YM6 D;  1KX4 A;  5E5A C;  4X23 C;  3AYW A;  4QLC D;  4Z66 C;  3UT9 D;  2F8N H;  2Y2M A;  5BT1 D;  3AZN A;  5DNN B;  3AN2 B;  3AZG B;  3A6N C;  5GT3 D;  5AV6 A;  4YS3 B;  2Y2I A;  4H9P B;  3AZI C;  3AFA C;  1W2E A;  5AY8 D;  5B2J C;  2JCH A;  1KU5 A;  4CAY B;  3W96 D;  3IP4 C;  3VH5 T;  5G49 A;  5DNM C;  3AZL D;  4R8P B;  1P3G C;  4WU9 A;  1M1A C;  3R45 B;  5JA4 B;  1P3A C;  2RIQ A;  3MGR C;  2NQB A;  5B31 C;  3X1S A;  1M19 D;  5F99 B;  4EO5 B;  1P3M B;  2HUE B;  5BS7 A;  3VH5 W;  4YM6 C;  5FUG B;  4KUD A;  3W98 B;  3WTP C;  1KX4 D;  3AZJ A;  1TZY C;  3AZE D;  1P3B D;  1M18 A;  4XZQ C;  2IO5 B;  3LEL C;  3C1C A;  1BH9 B;  3LZ0 B;  3UTB D;  3C1B A;  3P5J B;  5GXQ C;  3LJA C;  3TU4 A;  5AV9 C;  5AV6 D;  3WKJ A;  5AY8 C;  3AZF B;  3W96 C;  2CV5 C;  3AV1 B;  2HIO A;  4H9Q B;  4KHA B;  3WAA D;  4G91 C;  3A1K A;  3UTA D;  5CPI D;  3X1V D;  1M19 C;  2PYO B;  5B1M D;  3B6F B;  3B6G B;  3NQU A;  1HQ3 A;  5AVC C;  3REK D;  4LD9 D;  4Z5T A;  5B1L A;  5B0Z A;  3V9R B;  1KX4 C;  4KUD D;  3MGQ D;  3REH B;  1P3B C;  5BNX A;  3AYW C;  2F8N A;  5BNV A;  3O62 D;  3VH6 A;  1M18 D;  2Y2P A;  3AZN C;  5GT0 B;  1P3F A;  3C1B D;  5AV6 C;  3NQJ A;  2JSS A;  3WKJ D;  5B32 G;  5B0Y B;  3KXB B;  1T3U A;  4J8U A;  3AL0 C;  4WNN A;  2JE5 A;  3AZH B;  4NE3 A;  2YFV B;  5CPI C;  4WU9 C;  1B67 A;  4H9N B;  4KGC D;  2NQB C;  5DNN A;  3X1S C;  3AN2 A;  3AZG A;  4ZBJ B;  3LZ1 D;  2ZY2 A;  5BS7 C;  4H9P A;  4YS3 A;  3AV2 B;  3W98 A;  4KUD C;  1S32 B;  3MGQ C;  1KX3 B;  1ZLA B;  4XUJ B;  4CAY A;  5B1L D;  5B32 B;  1M18 C;  4R8P A;  4DQY B;  2F8N D;  3X1T B;  5AVB B;  3R45 A;  5JA4 A;  3C1B C;  3TU4 C;  4NE5 A;  4DRA A;  4J8X B;  1P3F D;  5F99 A;  1EQZ B;  3WKJ C;  1P3M A;  2DQN C;  3W99 B;  5FUG A;  3EPL A;  3AZM D;  2HIO C;  4J8U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...