1ID3B

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3B00
3AV2A 4Z66A 1ULYA 1N1JA 3AZNC 5AV6B 2CV5A 1P3MA 1M1AC 3UTAC 3REHA 3W97A 4E44A 4QLCA 4R8PD 1P34D 5AV9B 5DNMD 3AZLA 3LZ1C 3LZ0B 4M6BA 3X1TC 5E5AB 5JRGC 1TZYC 5CPIC 3MGRD 4Z2MG 3KSYA 1P3OC 3MGPB 4J8UD 1P3LA 3W98C 3KXBD 3MNNA 2HIOB 1WWSA 3NQUA 5DNNA 1M19D 3RELA 5B0ZB 5AV6D 2NQBC 5B24B 3A6NB 4WU8A 4XUJD 4G92C 2L5AA 4WNNB 3AFAB 5B2ID 5BNXA 1P3KC 4LD9D 3AZFD 3VH5A 5B40D 1P3IC 2F8NK 1TZYA 2HIOD 3C1CD 3AZJA 5BO0B 3C1BD 3TU4D 3O62C 5CPKD 1BFMA 1KX3D 5CPJB 5AY8D 2BYKA 1ID3C 5B2JB 2NQBA 2NZDD 3AZEB 3UT9B 4G91B 5B31G 5CP6C 3UTBA 3WA9C 1R4VA 3WAAB 2F8NG 5AV8B 3LZ0C 4KUDA 5E5AC 4ZUXD 3B6FB 1F1EA 4R8PA 5GT0A 4YS3D 1M18C 1ZLAD 1P3BB 5GSUD 3X1UD 5AVBA 4CAYB 4JJND 4Z5TB 3O62A 3KXBA 5B1LB 4XZQB 2AROB 5AV6A 3WTPB 4XUJA 5AV9A 3X1SB 3AZIB 5B1MD 5E5AA 1F66B 4H9RB 4X23B 3KWQB 3KUYB 3MGQB 1P3FC 3MGPA 3REJC 3AV2D 4Z66D 5B0YB 2F8NH 1AOIB 2HIOA 4YM6B 2CV5D 5B0ZA 5CPJC 1P3MD 5B32G 1H3OB 3C1BA 3REHD 3AZKB 3AZHB 5B24A 4QLCD 5B32B 3A6NA 1M1AB 4NE5A 5AY8A 1KX5C 3UTAB 1TAFA 5B31C 2HUEC 3X1SD 4WNNA 3WAAC 4X23D 5AV8C 3LZ1B 3AFAA 1BH9B 3X1TB 3REID 3B6FC 3R45B 3MNND 5DNND 2PYOC 5CPIB 1AOID 3LJAC 1P3GB 3W98B 4ZUXA 5BO0A 1ZLAA 5G49B 3AZND 4WU8D 4H9SA 3W96C 3W99C 5B1LC 4XZQC 5B2JA 5GXQB 1WWIA 3AZEA 3UT9A 4G92B 3LZ1D 3WTPC 1A7WA 5JRGD 1TZYD 3AZJD 3X1VC 4NFTA 1P3OD 1P3KB 3AZIC 3KWQC 1P3IB 3KUYC 3AV1C 1P3BA 3AZMC 2NQBD 3B6GC 4CAYA 4YM6C 3UTBD 4Z5TA 3VH6T 1ID3B 3AYWC 3AZKC 3AZHC 5B32C 5B1LA 5CP6B 2AROA 4J8VB 4KUDD 3LELB 5GT0D 3WA9B 1B67A 3X1SA 5AVBD 5FUGB 3AZIA 1M18B 5B33B 1F66A 4X23A 3O62D 3KWQA 5BS7C 1S32C 3MGQA 3MGSC 1P3GC 4J8XC 3REIA 4DRAA 5B0YA 1B6WA 1AOIA 3REKB 5CP6D 1H3OA 1KU5A 3AZKA 5GXQC 1HTAA 3AZNA 1P3AB 5AV9D 1M1AA 3LZ0D 3UTAA 5E5AD 2FJ7C 1JFIB 3MGPD 3LZ1A 3X1TA 1BH9A 5JRGA 4H9NB 5CPIA 1P3FB 5B0ZD 1P3OA 4WU9C 3REJB 4H9OA 3W98A 1EQZB 5B24D 2JSSA 4KGCB 3A6ND 5G49A 5AVCC 1U35C 4E45A 1KX5B 4J8VC 3AFAD 3LELC 5B31B 2HUEB 3AN2B 2IO5C 3VH6W 1P34C 1P3KA 3REJD 2F8NB 5DNMC 2PYOB 5B33C 4J8WB 1P3IA 5BNVB 3LJAB 5CPJD 3MGRC 5B2JD 4J8UC 3AZED 3UT9D 3WTPE 3REKC 3W96B 1M19C 1ID3A 3W99B 5B31D 1P3AC 5CP6A 3AZGB 3WAAD 2YFWB 4J8VA 5AV8D 3LELA 3B6FD 5KDMB 3X1VB 3WA9A 4H9PB 3LZ0A 4NE6A 5GT3B 1P3BD 5B2IC 1M18A 4LD9C 5B33A 3AZFC 4Z5TD 4UUZB 5B40C 1HQ3B 3AV1B 3C1CC 3AZMB 1EQZC 4KGCC 3W99D 5B1LD 4XZQD 3B6GB 3TU4C 2AROD 3AYWB 5CPKC 4ZBJB 1KX3C 3WTPD 3W97B 2NZDC 3MVDC 3AN2C 3V9RB 3AZID 1KX4B 1F66D 3KWQD 4KHAB 3KUYD 3MGQD 1JFIA 3VH6A 1P3LB 5B0YD 4J8WC 1S32B 3B6GD 4H9NA 4YM6D 4YS3C 3MGSB 1P3FA 4J8XB 3RELB 3REJA 3WKJB 3AZKD 3AZHD 1EQZA 3B0DB 3X1UC 4KGCA 5B32D 3NQJB 5CPJA 4JJNC 1M1AD 3UTAD 5AV5B 3AZGC 1KX5A 3B0CT 3X1TD 5B31A 3AN2A 5F99B 2FJ7B 5CPID 3WAAA 5AV8A 5GT3C 3MGSD 1P3GD 3W98D 1P3PB 3B6FA 2F8NA 2PYOA 5B1MC 4J8WA 4WU9B 1HQ3C 5BNVA 3LJAA 3AV2C 5GXQD 4Z66C 5AVCB 3W96A 2CV5C 4ZBJC 5JA4B 1U35B 1P3MC 3W99A 4XZQA 3REHC 3W97C 4QLCC 3AZGA 1P3KD 2YFWA 1KX4C 3AZLC 3WTPA 2IO5B 1P3ID 5KDMA 2RVQC 3X1VA 1P34B 5DNMB 4CSRB 5GT3A 1P3LC 4H9RA 3KUYA 5DNNC 4H9QB 3MGRB 4UUZA 3RELC 1HQ3A 3AV1A 4J8UB 1ID3D 3WKJC 3AZMA 3B0DC 1U35D 3B6GA 3KXBB 4YM6A 1M19B 4J8VD 3AYWA 5AV5C 4WU8C 3LELD 3AZHA 5B32A 3WA9D 4XUJB 5CHLB 3V9RA 5F99C 5BT1C 1M18D 4HGAB 1KX4A 5B33D 1BH8B 4KHAA 2BYMB 3AZJC 1P3PC 5B2IB 3R45A 4LD9B 3AZFB 5BS7A 5B40B 1S32A 3REKD 3MGSA 3C1CB 1P3GA 4J8XA 3B0CW 3WKJA 3C1BB 3TU4B 1P3AD 3NQJA 5CPKB 1KX3B 3UTBC 5AY8B 5AV5A 5GXQA 1TAFB 2NZDB 2CWEA 3MVDB 4WV4B 4KUDC 5F99A 2FJ7A 4R8PC 5GT0C 1P3FD 1EQZD 1P3PA 4KGCD 4ZUXB 1ZLAB 5AVBC 4YS3B 4WU9A 5GSUB 3X1UB 4EO5B 3KXBC 2LY8A 4JJNB 1KX5D 5AVCA 4Z2MH 5AV6C 5JA4A 3MVDD 3AN2D 1U35A 2YFVB 4XUJC 5AV9C 2F8ND 4HGAC 2PYOD 4J8WD 3LJAD 1P34A 3MGPC 5FUGA 4CSRA 5DNMA 5B1MB 2HIOC 3W96D 4H9QA 3MGRA 5B0ZC 4J8UA 3C1BC 3AV2B 4Z66B 4AWLB 3VH5T 1N1JB 5B24C 3REKA 1M19A 3A6NC 3AZGD 2CV5B 1P3MB 5AY8C 3REHB 3X1VD 4QLCB 1P3AA 4NE3A 3AZLB 5GT3D 3AFAC 1BH8A 1HQ3D 3AV1D 2BYMA 4DRBA 3AZMD 5B2IA 4ZUXC 3REIB 3MNNB 1ZLAC 4LD9A 5DNNB 3NQUB 3AZFA 3AYWD 5B40A 5C3IB 3C1CA 4H9SC 5GSUC 4EO5C 5B2JC 3TU4A 3W97D 3AZNB 3AZEC 4WU8B 3UT9C 4G91C 5CPKA 1KX3A 1KX4D 3AZLD 2NZDA 2RVQD 3MVDA 5BNXB 1P3LD 5JRGB 1S32D 1TZYB 3AZJB 4J8XD 3RELD 1P3OB 3WKJD 4H9OB 1P3BC 4YS3A 4Z5TC 5AV5D 2BYKB 4AWLC 5GSUA 3X1UA 2NQBB 4JJNA 3UTBB 2AROC 3B0BA 5F99D 5BT1D 2FJ7D 2YFVA 4WZSB 4KUDB 1P3PD 3X1SC 3VH5W 5GT0B 4R8PB 4WU9D 4H9PA 4X23C 1F66C 3MGQC 3REIC 3MNNC 5AVBB 1Q9CA 5B1MA 5AVCD 5B0YC 5C3IC 3O62B 1AOIC
chains in the Genus database with same CATH superfamily
3AV2A 4Z66A 1ULYA 1N1JA 3AZNC 5AV6B 2CV5A 1PZRA 1P3MA 1M1AC 3UTAC 3REHA 3W97A 4E44A 4QLCA 4R8PD 1P34D 5AV9B 5DNMD 3AZLA 3LZ1C 3LZ0B 4M6BA 3X1TC 5E5AB 5JRGC 1TZYC 5CPIC 3MGRD 4Z2MG 3KSYA 1P3OC 3MGPB 4J8UD 1P3LA 3W98C 3KXBD 3MNNA 2HIOB 1WWSA 3NQUA 5DNNA 1M19D 3RELA 5B0ZB 5AV6D 2NQBC 5B24B 3EPHA 3A6NB 4WU8A 4XUJD 4G92C 2L5AA 4WNNB 3AFAB 5B2ID 5BNXA 1P3KC 4LD9D 3AZFD 3VH5A 5B40D 1P3IC 2F8NK 1TZYA 2HIOD 3C1CD 3AZJA 5BO0B 3C1BD 3TU4D 3O62C 5CPKD 1BFMA 2Y2PA 4UPKA 5CPJB 1KX3D 5AY8D 2BYKA 1ID3C 5B2JB 2NQBA 2NZDD 3AZEB 3A1KA 3UT9B 4G91B 5B31G 5CP6C 3UTBA 3WA9C 1R4VA 3WAAB 2F8NG 5AV8B 3LZ0C 4KUDA 5E5AC 4ZUXD 3B6FB 1F1EA 4R8PA 5GT0A 4YS3D 1M18C 1ZLAD 1P3BB 5GSUD 3X1UD 5AVBA 4CAYB 4JJND 4Z5TB 3O62A 3KXBA 5B1LB 4XZQB 2AROB 4WJ3C 2Y2HA 5AV6A 3WTPB 4XUJA 5AV9A 3X1SB 3AZIB 5B1MD 5E5AA 1F66B 4H9RB 4X23B 3KWQB 3KUYB 3MGQB 1P3FC 3MGPA 2ZY2A 3REJC 3AV2D 4Z66D 5B0YB 2F8NH 1AOIB 2HIOA 4YM6B 2CV5D 5B0ZA 5CPJC 1P3MD 5B32G 1H3OB 3C1BA 2Y2JA 3REHD 3AZKB 3AZHB 5B24A 4QLCD 5B32B 3A6NA 2VQRA 4NE5A 5AY8A 1M1AB 1KX5C 3UTAB 1TAFA 5B31C 2HUEC 3X1SD 4WNNA 3WAAC 4X23D 5AV8C 3LZ1B 3AFAA 1BH9B 3X1TB 3REID 3B6FC 3R45B 3MNND 5DNND 2PYOC 5CPIB 1AOID 3LJAC 1P3GB 3W98B 4ZUXA 5BO0A 1ZLAA 5G49B 3AZND 4WU8D 4H9SA 3W96C 3KFUG 3W99C 5B1LC 4XZQC 5B2JA 5GXQB 1WWIA 3AZEA 3UT9A 4G92B 3LZ1D 3EPLA 3WTPC 1A7WA 5JRGD 1TZYD 2G5IC 3X1VC 4NFTA 3AZJD 1P3OD 1P3KB 3AZIC 3KWQC 1P3IB 3KUYC 3AV1C 1P3BA 3AZMC 2NQBD 3P5JB 3B6GC 4CAYA 4YM6C 3UTBD 4Z5TA 3VH6T 3EPJA 3AYWC 1ID3B 3AZKC 3AZHC 5B32C 5B1LA 5CP6B 2AROA 4J8VB 4KUDD 3LELB 5GT0D 3WA9B 1B67A 3X1SA 5AVBD 5FUGB 3AZIA 1M18B 5B33B 1F66A 4X23A 3O62D 3KWQA 5BS7C 1S32C 3AL0C 3MGQA 3MGSC 1P3GC 4J8XC 3REIA 4DRAA 5B0YA 1B6WA 1AOIA 3REKB 5CP6D 1H3OA 1KU5A 3AZKA 5GXQC 1HTAA 3AZNA 1P3AB 5AV9D 1M1AA 3LZ0D 2JE5A 3UTAA 5E5AD 2FJ7C 1JFIB 3MGPD 1T3UA 3LZ1A 3X1TA 1BH9A 2Y2GA 5JRGA 3EG5B 4H9NB 5CPIA 1P3FB 5B0ZD 1P3OA 4WU9C 3REJB 4H9OA 2RIQA 2Y2IA 3W98A 1EQZB 5B24D 2JSSA 4KGCB 3A6ND 2DF4C 5G49A 5AVCC 1U35C 2XD5A 4E45A 1KX5B 4J8VC 3AFAD 3LELC 5B31B 2HUEB 3AN2B 2IO5C 3VH6W 1P34C 1P3KA 3REJD 2F8NB 5DNMC 2PYOB 5B33C 4J8WB 1P3IA 2Y2LA 5BNVB 3LJAB 5CPJD 3MGRC 5B2JD 4J8UC 2UWXA 2Y2KA 3AZED 3UT9D 3WTPE 3REKC 3W96B 1M19C 1ID3A 3W99B 5B31D 1P3AC 5CP6A 3AZGB 3WAAD 2YFWB 4J8VA 5AV8D 3LELA 3B6FD 5KDMB 3X1VB 3WA9A 4H9PB 3LZ0A 4NE6A 5GT3B 1P3BD 5B2IC 1M18A 4DQYB 5B33A 3AZFC 4Z5TD 4LD9C 4UUZB 5B40C 1HQ3B 3AV1B 3C1CC 3AZMB 1EQZC 3A1IA 4KGCC 3W99D 5B1LD 4XZQD 3B6GB 3TU4C 2AROD 3AYWB 5CPKC 4ZBJB 1KX3C 3WTPD 3W97B 2NZDC 3EPKA 3MVDC 3AN2C 3V9RB 3AZID 1KX4B 1F66D 3KWQD 4KHAB 3KUYD 3MGQD 1JFIA 3VH6A 2ZY3A 1P3LB 5B0YD 4J8WC 1S32B 3B6GD 4H9NA 4YM6D 4YS3C 3MGSB 1P3FA 4J8XB 3RELB 3REJA 3WKJB 3AZKD 2DQNC 3AZHD 1EQZA 3B0DB 3X1UC 4KGCA 5B32D 3NQJB 5CPJA 4JJNC 1M1AD 3UTAD 5AV5B 3AZGC 1KX5A 2W8SA 3B0CT 5B31A 3X1TD 3AN2A 5F99B 2FJ7B 5CPID 3WAAA 5AV8A 5GT3C 3MGSD 1P3GD 3W98D 1P3PB 3B6FA 2F8NA 2PYOA 5B1MC 4J8WA 4WU9B 1HQ3C 5BNVA 3LJAA 3AV2C 5GXQD 4Z66C 5AVCB 3W96A 3FDDA 2CV5C 4ZBJC 5JA4B 1U35B 1P3MC 3W99A 4XZQA 3REHC 3W97C 3H0MC 4QLCC 3AZGA 1P3KD 2YFWA 1KX4C 3AZLC 2G5HC 3WTPA 2IO5B 1P3ID 5KDMA 2RVQC 3X1VA 1P34B 5DNMB 4CSRB 5GT3A 1P3LC 4H9RA 3KUYA 5DNNC 4H9QB 3MGRB 4UUZA 3RELC 1HQ3A 3AV1A 4J8UB 1ID3D 3WKJC 3AZMA 3B0DC 1U35D 3B6GA 2XD1A 4YM6A 3KXBB 1M19B 4J8VD 3AYWA 5AV5C 4WU8C 3LELD 3AZHA 5B32A 3WA9D 4XUJB 5CHLB 3V9RA 5F99C 5BT1C 1M18D 4HGAB 1KX4A 5B33D 1BH8B 4KHAA 2BYMB 3AZJC 1P3PC 5B2IB 3R45A 4LD9B 3AZFB 5BS7A 5B40B 1S32A 3REKD 3MGSA 2BG1A 3C1CB 4J8XA 3B0CW 1P3GA 2ZY5A 3WKJA 3C1BB 3TU4B 1P3AD 3NQJA 2J8PA 5CPKB 1KX3B 3UTBC 5AY8B 5AV5A 5GXQA 1TAFB 2NZDB 2CWEA 3MVDB 4WV4B 4KUDC 5F99A 2FJ7A 4R8PC 5GT0C 1P3FD 3H0LC 1EQZD 1P3PA 4KGCD 4ZUXB 2FFFB 1ZLAB 5AVBC 4YS3B 4WU9A 5GSUB 3X1UB 4EO5B 3KXBC 2LY8A 4JJNB 1KX5D 5AVCA 4Z2MH 5AV6C 5JA4A 3MVDD 3AN2D 1U35A 2YFVB 2ZY4A 4XUJC 2ZM5A 5AV9C 2F8ND 4HGAC 2PYOD 4J8WD 3LJAD 1P34A 3MGPC 3IP4C 3H0RC 5FUGA 4CSRA 5DNMA 5B1MB 2HIOC 3W96D 4H9QA 3MGRA 2Y2NA 2JCHA 5B0ZC 4J8UA 3C1BC 3AV2B 4Z66B 4AWLB 3VH5T 1N1JB 5B24C 3REKA 1M19A 3A6NC 3AZGD 2CV5B 1P3MB 5AY8C 2Y2MA 3REHB 3X1VD 4QLCB 1P3AA 4NE3A 3AZLB 5GT3D 3AFAC 1BH8A 1W2EA 1HQ3D 3AV1D 2BYMA 4DRBA 3AZMD 5B2IA 4ZUXC 3REIB 3MNNB 2Y2QA 1ZLAC 5DNNB 3NQUB 3AZFA 4LD9A 3AYWD 5B40A 5C3IB 3C1CA 4H9SC 5GSUC 4EO5C 5B2JC 3TU4A 3W97D 3F6TA 3AZNB 3AZEC 4WU8B 3UT9C 4G91C 5CPKA 1KX3A 1KX4D 3AZLD 2NZDA 2RVQD 3MVDA 5BNXB 1P3LD 5JRGB 1S32D 1TZYB 2F2AC 3AZJB 4J8XD 3RELD 1P3OB 3WKJD 4H9OB 1P3BC 4YS3A 4Z5TC 5AV5D 2BYKB 4AWLC 5GSUA 3X1UA 2NQBB 4JJNA 1Z2CB 3UTBB 2AROC 3B0BA 5F99D 5BT1D 2FJ7D 2YFVA 2Y2OA 4WZSB 4KUDB 1P3PD 3X1SC 3VH5W 5GT0B 4R8PB 4WU9D 4H9PA 4X23C 1F66C 3MGQC 3REIC 3MNNC 5AVBB 1Q9CA 5B1MA 5AVCD 5B0YC 5C3IC 3O62B 1AOIC
chains in the Genus database with same CATH topology
3AV2A 4Z66A 1ULYA 1N1JA 3AZNC 5AV6B 2CV5A 1PZRA 1P3MA 1M1AC 3UTAC 3REHA 3W97A 4E44A 4QLCA 4R8PD 1P34D 5AV9B 5DNMD 3AZLA 3LZ1C 3LZ0B 4M6BA 3X1TC 5E5AB 5JRGC 1TZYC 5CPIC 3MGRD 4Z2MG 3KSYA 1P3OC 3MGPB 4J8UD 1P3LA 3W98C 3KXBD 3MNNA 2HIOB 1WWSA 3NQUA 5DNNA 1M19D 3RELA 5B0ZB 5AV6D 2NQBC 5B24B 3EPHA 3A6NB 4WU8A 4XUJD 4G92C 2L5AA 4WNNB 3AFAB 5B2ID 5BNXA 1P3KC 4LD9D 3AZFD 3VH5A 5B40D 1P3IC 2F8NK 1TZYA 2HIOD 3C1CD 3AZJA 5BO0B 3C1BD 3TU4D 3O62C 5CPKD 1BFMA 2Y2PA 4UPKA 5CPJB 1KX3D 5AY8D 2BYKA 1ID3C 5B2JB 2NQBA 2NZDD 3AZEB 3A1KA 3UT9B 4G91B 5B31G 5CP6C 3UTBA 3WA9C 1R4VA 3WAAB 2F8NG 5AV8B 3LZ0C 4KUDA 5E5AC 4ZUXD 3B6FB 1F1EA 4R8PA 5GT0A 4YS3D 1M18C 1ZLAD 1P3BB 5GSUD 3X1UD 5AVBA 4CAYB 4JJND 4Z5TB 3O62A 3KXBA 5B1LB 4XZQB 2AROB 4WJ3C 2Y2HA 5AV6A 3WTPB 4XUJA 5AV9A 3X1SB 3AZIB 5B1MD 5E5AA 1F66B 4H9RB 4X23B 3KWQB 3KUYB 3MGQB 1P3FC 3MGPA 2ZY2A 3REJC 3AV2D 4Z66D 5B0YB 2F8NH 1AOIB 2HIOA 4YM6B 2CV5D 5B0ZA 5CPJC 1P3MD 5B32G 1H3OB 3C1BA 2Y2JA 3REHD 3AZKB 3AZHB 5B24A 4QLCD 5B32B 3A6NA 2VQRA 4NE5A 5AY8A 1M1AB 1KX5C 3UTAB 1TAFA 5B31C 2HUEC 3X1SD 4WNNA 3WAAC 4X23D 5AV8C 3LZ1B 3AFAA 1BH9B 3X1TB 3REID 3B6FC 3R45B 3MNND 5DNND 2PYOC 5CPIB 1AOID 3LJAC 1P3GB 3W98B 4ZUXA 5BO0A 1ZLAA 5G49B 3AZND 4WU8D 4H9SA 3W96C 3KFUG 3W99C 5B1LC 4XZQC 5B2JA 5GXQB 1WWIA 3AZEA 3UT9A 4G92B 3LZ1D 3EPLA 3WTPC 1A7WA 5JRGD 1TZYD 2G5IC 3X1VC 4NFTA 3AZJD 1P3OD 1P3KB 3AZIC 3KWQC 1P3IB 3KUYC 3AV1C 1P3BA 3AZMC 2NQBD 3P5JB 3B6GC 4CAYA 4YM6C 3UTBD 4Z5TA 3VH6T 3EPJA 3AYWC 1ID3B 3AZKC 3AZHC 5B32C 5B1LA 5CP6B 2AROA 4J8VB 4KUDD 3LELB 5GT0D 3WA9B 1B67A 3X1SA 5AVBD 5FUGB 3AZIA 1M18B 5B33B 1F66A 4X23A 3O62D 3KWQA 5BS7C 1S32C 3AL0C 3MGQA 3MGSC 1P3GC 4J8XC 3REIA 4DRAA 5B0YA 1B6WA 1AOIA 3REKB 5CP6D 1H3OA 1KU5A 3AZKA 5GXQC 1HTAA 3AZNA 1P3AB 5AV9D 1M1AA 3LZ0D 2JE5A 3UTAA 5E5AD 2FJ7C 1JFIB 3MGPD 1T3UA 3LZ1A 3X1TA 1BH9A 2Y2GA 5JRGA 3EG5B 4H9NB 5CPIA 1P3FB 5B0ZD 1P3OA 4WU9C 3REJB 4H9OA 2RIQA 2Y2IA 3W98A 1EQZB 5B24D 2JSSA 4KGCB 3A6ND 2DF4C 5G49A 5AVCC 1U35C 2XD5A 4E45A 1KX5B 4J8VC 3AFAD 3LELC 5B31B 2HUEB 3AN2B 2IO5C 3VH6W 1P34C 1P3KA 3REJD 2F8NB 5DNMC 2PYOB 5B33C 4J8WB 1P3IA 2Y2LA 5BNVB 3LJAB 5CPJD 3MGRC 5B2JD 4J8UC 2UWXA 2Y2KA 3AZED 3UT9D 3WTPE 3REKC 3W96B 1M19C 1ID3A 3W99B 5B31D 1P3AC 5CP6A 3AZGB 3WAAD 2YFWB 4J8VA 5AV8D 3LELA 3B6FD 5KDMB 3X1VB 3WA9A 4H9PB 3LZ0A 4NE6A 5GT3B 1P3BD 5B2IC 1M18A 4DQYB 5B33A 3AZFC 4Z5TD 4LD9C 4UUZB 5B40C 1HQ3B 3AV1B 3C1CC 3AZMB 1EQZC 3A1IA 4KGCC 3W99D 5B1LD 4XZQD 3B6GB 3TU4C 2AROD 3AYWB 5CPKC 4ZBJB 1KX3C 3WTPD 3W97B 2NZDC 3EPKA 3MVDC 3AN2C 3V9RB 3AZID 1KX4B 1F66D 3KWQD 4KHAB 3KUYD 3MGQD 1JFIA 3VH6A 2ZY3A 1P3LB 5B0YD 4J8WC 1S32B 3B6GD 4H9NA 4YM6D 4YS3C 3MGSB 1P3FA 4J8XB 3RELB 3REJA 3WKJB 3AZKD 2DQNC 3AZHD 1EQZA 3B0DB 3X1UC 4KGCA 5B32D 3NQJB 5CPJA 4JJNC 1M1AD 3UTAD 5AV5B 3AZGC 1KX5A 2W8SA 3B0CT 5B31A 3X1TD 3AN2A 5F99B 2FJ7B 5CPID 3WAAA 5AV8A 5GT3C 3MGSD 1P3GD 3W98D 1P3PB 3B6FA 2F8NA 2PYOA 5B1MC 4J8WA 4WU9B 1HQ3C 5BNVA 3LJAA 3AV2C 5GXQD 4Z66C 5AVCB 3W96A 3FDDA 2CV5C 4ZBJC 5JA4B 1U35B 1P3MC 3W99A 4XZQA 3REHC 3W97C 3H0MC 4QLCC 3AZGA 1P3KD 2YFWA 1KX4C 3AZLC 2G5HC 3WTPA 2IO5B 1P3ID 5KDMA 2RVQC 3X1VA 1P34B 5DNMB 4CSRB 5GT3A 1P3LC 4H9RA 3KUYA 5DNNC 4H9QB 3MGRB 4UUZA 3RELC 1HQ3A 3AV1A 4J8UB 1ID3D 3WKJC 3AZMA 3B0DC 1U35D 3B6GA 2XD1A 4YM6A 3KXBB 1M19B 4J8VD 3AYWA 5AV5C 4WU8C 3LELD 3AZHA 5B32A 3WA9D 4XUJB 5CHLB 3V9RA 5F99C 5BT1C 1M18D 4HGAB 1KX4A 5B33D 1BH8B 4KHAA 2BYMB 3AZJC 1P3PC 5B2IB 3R45A 4LD9B 3AZFB 5BS7A 5B40B 1S32A 3REKD 3MGSA 2BG1A 3C1CB 4J8XA 3B0CW 1P3GA 2ZY5A 3WKJA 3C1BB 3TU4B 1P3AD 3NQJA 2J8PA 5CPKB 1KX3B 3UTBC 5AY8B 5AV5A 5GXQA 1TAFB 2NZDB 2CWEA 3MVDB 4WV4B 4KUDC 5F99A 2FJ7A 4R8PC 5GT0C 1P3FD 3H0LC 1EQZD 1P3PA 4KGCD 4ZUXB 2FFFB 1ZLAB 5AVBC 4YS3B 4WU9A 5GSUB 3X1UB 4EO5B 3KXBC 2LY8A 4JJNB 1KX5D 5AVCA 4Z2MH 5AV6C 5JA4A 3MVDD 3AN2D 1U35A 2YFVB 2ZY4A 4XUJC 2ZM5A 5AV9C 2F8ND 4HGAC 2PYOD 4J8WD 3LJAD 1P34A 3MGPC 3IP4C 3H0RC 5FUGA 4CSRA 5DNMA 5B1MB 2HIOC 3W96D 4H9QA 3MGRA 2Y2NA 2JCHA 5B0ZC 4J8UA 3C1BC 3AV2B 4Z66B 4AWLB 3VH5T 1N1JB 5B24C 3REKA 1M19A 3A6NC 3AZGD 2CV5B 1P3MB 5AY8C 2Y2MA 3REHB 3X1VD 4QLCB 1P3AA 4NE3A 3AZLB 5GT3D 3AFAC 1BH8A 1W2EA 1HQ3D 3AV1D 2BYMA 4DRBA 3AZMD 5B2IA 4ZUXC 3REIB 3MNNB 2Y2QA 1ZLAC 5DNNB 3NQUB 3AZFA 4LD9A 3AYWD 5B40A 5C3IB 3C1CA 4H9SC 5GSUC 4EO5C 5B2JC 3TU4A 3W97D 3F6TA 3AZNB 3AZEC 4WU8B 3UT9C 4G91C 5CPKA 1KX3A 1KX4D 3AZLD 2NZDA 2RVQD 3MVDA 5BNXB 1P3LD 5JRGB 1S32D 1TZYB 2F2AC 3AZJB 4J8XD 3RELD 1P3OB 3WKJD 4H9OB 1P3BC 4YS3A 4Z5TC 5AV5D 2BYKB 4AWLC 5GSUA 3X1UA 2NQBB 4JJNA 1Z2CB 3UTBB 2AROC 3B0BA 5F99D 5BT1D 2FJ7D 2YFVA 2Y2OA 4WZSB 4KUDB 1P3PD 3X1SC 3VH5W 5GT0B 4R8PB 4WU9D 4H9PA 4X23C 1F66C 3MGQC 3REIC 3MNNC 5AVBB 1Q9CA 5B1MA 5AVCD 5B0YC 5C3IC 3O62B 1AOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 A;  4Z66 A;  1ULY A;  1N1J A;  3AZN C;  5AV6 B;  2CV5 A;  1P3M A;  1M1A C;  3UTA C;  3REH A;  3W97 A;  4E44 A;  4QLC A;  4R8P D;  1P34 D;  5AV9 B;  5DNM D;  3AZL A;  3LZ1 C;  3LZ0 B;  4M6B A;  3X1T C;  5E5A B;  5JRG C;  1TZY C;  5CPI C;  3MGR D;  4Z2M G;  3KSY A;  1P3O C;  3MGP B;  4J8U D;  1P3L A;  3W98 C;  3KXB D;  3MNN A;  2HIO B;  1WWS A;  3NQU A;  5DNN A;  1M19 D;  3REL A;  5B0Z B;  5AV6 D;  2NQB C;  5B24 B;  3A6N B;  4WU8 A;  4XUJ D;  4G92 C;  2L5A A;  4WNN B;  3AFA B;  5B2I D;  5BNX A;  1P3K C;  4LD9 D;  3AZF D;  3VH5 A;  5B40 D;  1P3I C;  2F8N K;  1TZY A;  2HIO D;  3C1C D;  3AZJ A;  5BO0 B;  3C1B D;  3TU4 D;  3O62 C;  5CPK D;  1BFM A;  1KX3 D;  5CPJ B;  5AY8 D;  2BYK A;  1ID3 C;  5B2J B;  2NQB A;  2NZD D;  3AZE B;  3UT9 B;  4G91 B;  5B31 G;  5CP6 C;  3UTB A;  3WA9 C;  1R4V A;  3WAA B;  2F8N G;  5AV8 B;  3LZ0 C;  4KUD A;  5E5A C;  4ZUX D;  3B6F B;  1F1E A;  4R8P A;  5GT0 A;  4YS3 D;  1M18 C;  1ZLA D;  1P3B B;  5GSU D;  3X1U D;  5AVB A;  4CAY B;  4JJN D;  4Z5T B;  3O62 A;  3KXB A;  5B1L B;  4XZQ B;  2ARO B;  5AV6 A;  3WTP B;  4XUJ A;  5AV9 A;  3X1S B;  3AZI B;  5B1M D;  5E5A A;  1F66 B;  4H9R B;  4X23 B;  3KWQ B;  3KUY B;  3MGQ B;  1P3F C;  3MGP A;  3REJ C;  3AV2 D;  4Z66 D;  5B0Y B;  2F8N H;  1AOI B;  2HIO A;  4YM6 B;  2CV5 D;  5B0Z A;  5CPJ C;  1P3M D;  5B32 G;  1H3O B;  3C1B A;  3REH D;  3AZK B;  3AZH B;  5B24 A;  4QLC D;  5B32 B;  3A6N A;  1M1A B;  4NE5 A;  5AY8 A;  1KX5 C;  3UTA B;  1TAF A;  5B31 C;  2HUE C;  3X1S D;  4WNN A;  3WAA C;  4X23 D;  5AV8 C;  3LZ1 B;  3AFA A;  1BH9 B;  3X1T B;  3REI D;  3B6F C;  3R45 B;  3MNN D;  5DNN D;  2PYO C;  5CPI B;  1AOI D;  3LJA C;  1P3G B;  3W98 B;  4ZUX A;  5BO0 A;  1ZLA A;  5G49 B;  3AZN D;  4WU8 D;  4H9S A;  3W96 C;  3W99 C;  5B1L C;  4XZQ C;  5B2J A;  5GXQ B;  1WWI A;  3AZE A;  3UT9 A;  4G92 B;  3LZ1 D;  3WTP C;  1A7W A;  5JRG D;  1TZY D;  3AZJ D;  3X1V C;  4NFT A;  1P3O D;  1P3K B;  3AZI C;  3KWQ C;  1P3I B;  3KUY C;  3AV1 C;  1P3B A;  3AZM C;  2NQB D;  3B6G C;  4CAY A;  4YM6 C;  3UTB D;  4Z5T A;  3VH6 T;  1ID3 B;  3AYW C;  3AZK C;  3AZH C;  5B32 C;  5B1L A;  5CP6 B;  2ARO A;  4J8V B;  4KUD D;  3LEL B;  5GT0 D;  3WA9 B;  1B67 A;  3X1S A;  5AVB D;  5FUG B;  3AZI A;  1M18 B;  5B33 B;  1F66 A;  4X23 A;  3O62 D;  3KWQ A;  5BS7 C;  1S32 C;  3MGQ A;  3MGS C;  1P3G C;  4J8X C;  3REI A;  4DRA A;  5B0Y A;  1B6W A;  1AOI A;  3REK B;  5CP6 D;  1H3O A;  1KU5 A;  3AZK A;  5GXQ C;  1HTA A;  3AZN A;  1P3A B;  5AV9 D;  1M1A A;  3LZ0 D;  3UTA A;  5E5A D;  2FJ7 C;  1JFI B;  3MGP D;  3LZ1 A;  3X1T A;  1BH9 A;  5JRG A;  4H9N B;  5CPI A;  1P3F B;  5B0Z D;  1P3O A;  4WU9 C;  3REJ B;  4H9O A;  3W98 A;  1EQZ B;  5B24 D;  2JSS A;  4KGC B;  3A6N D;  5G49 A;  5AVC C;  1U35 C;  4E45 A;  1KX5 B;  4J8V C;  3AFA D;  3LEL C;  5B31 B;  2HUE B;  3AN2 B;  2IO5 C;  3VH6 W;  1P34 C;  1P3K A;  3REJ D;  2F8N B;  5DNM C;  2PYO B;  5B33 C;  4J8W B;  1P3I A;  5BNV B;  3LJA B;  5CPJ D;  3MGR C;  5B2J D;  4J8U C;  3AZE D;  3UT9 D;  3WTP E;  3REK C;  3W96 B;  1M19 C;  1ID3 A;  3W99 B;  5B31 D;  1P3A C;  5CP6 A;  3AZG B;  3WAA D;  2YFW B;  4J8V A;  5AV8 D;  3LEL A;  3B6F D;  5KDM B;  3X1V B;  3WA9 A;  4H9P B;  3LZ0 A;  4NE6 A;  5GT3 B;  1P3B D;  5B2I C;  1M18 A;  4LD9 C;  5B33 A;  3AZF C;  4Z5T D;  4UUZ B;  5B40 C;  1HQ3 B;  3AV1 B;  3C1C C;  3AZM B;  1EQZ C;  4KGC C;  3W99 D;  5B1L D;  4XZQ D;  3B6G B;  3TU4 C;  2ARO D;  3AYW B;  5CPK C;  4ZBJ B;  1KX3 C;  3WTP D;  3W97 B;  2NZD C;  3MVD C;  3AN2 C;  3V9R B;  3AZI D;  1KX4 B;  1F66 D;  3KWQ D;  4KHA B;  3KUY D;  3MGQ D;  1JFI A;  3VH6 A;  1P3L B;  5B0Y D;  4J8W C;  1S32 B;  3B6G D;  4H9N A;  4YM6 D;  4YS3 C;  3MGS B;  1P3F A;  4J8X B;  3REL B;  3REJ A;  3WKJ B;  3AZK D;  3AZH D;  1EQZ A;  3B0D B;  3X1U C;  4KGC A;  5B32 D;  3NQJ B;  5CPJ A;  4JJN C;  1M1A D;  3UTA D;  5AV5 B;  3AZG C;  1KX5 A;  3B0C T;  3X1T D;  5B31 A;  3AN2 A;  5F99 B;  2FJ7 B;  5CPI D;  3WAA A;  5AV8 A;  5GT3 C;  3MGS D;  1P3G D;  3W98 D;  1P3P B;  3B6F A;  2F8N A;  2PYO A;  5B1M C;  4J8W A;  4WU9 B;  1HQ3 C;  5BNV A;  3LJA A;  3AV2 C;  5GXQ D;  4Z66 C;  5AVC B;  3W96 A;  2CV5 C;  4ZBJ C;  5JA4 B;  1U35 B;  1P3M C;  3W99 A;  4XZQ A;  3REH C;  3W97 C;  4QLC C;  3AZG A;  1P3K D;  2YFW A;  1KX4 C;  3AZL C;  3WTP A;  2IO5 B;  1P3I D;  5KDM A;  2RVQ C;  3X1V A;  1P34 B;  5DNM B;  4CSR B;  5GT3 A;  1P3L C;  4H9R A;  3KUY A;  5DNN C;  4H9Q B;  3MGR B;  4UUZ A;  3REL C;  1HQ3 A;  3AV1 A;  4J8U B;  1ID3 D;  3WKJ C;  3AZM A;  3B0D C;  1U35 D;  3B6G A;  3KXB B;  4YM6 A;  1M19 B;  4J8V D;  3AYW A;  5AV5 C;  4WU8 C;  3LEL D;  3AZH A;  5B32 A;  3WA9 D;  4XUJ B;  5CHL B;  3V9R A;  5F99 C;  5BT1 C;  1M18 D;  4HGA B;  1KX4 A;  5B33 D;  1BH8 B;  4KHA A;  2BYM B;  3AZJ C;  1P3P C;  5B2I B;  3R45 A;  4LD9 B;  3AZF B;  5BS7 A;  5B40 B;  1S32 A;  3REK D;  3MGS A;  3C1C B;  1P3G A;  4J8X A;  3B0C W;  3WKJ A;  3C1B B;  3TU4 B;  1P3A D;  3NQJ A;  5CPK B;  1KX3 B;  3UTB C;  5AY8 B;  5AV5 A;  5GXQ A;  1TAF B;  2NZD B;  2CWE A;  3MVD B;  4WV4 B;  4KUD C;  5F99 A;  2FJ7 A;  4R8P C;  5GT0 C;  1P3F D;  1EQZ D;  1P3P A;  4KGC D;  4ZUX B;  1ZLA B;  5AVB C;  4YS3 B;  4WU9 A;  5GSU B;  3X1U B;  4EO5 B;  3KXB C;  2LY8 A;  4JJN B;  1KX5 D;  5AVC A;  4Z2M H;  5AV6 C;  5JA4 A;  3MVD D;  3AN2 D;  1U35 A;  2YFV B;  4XUJ C;  5AV9 C;  2F8N D;  4HGA C;  2PYO D;  4J8W D;  3LJA D;  1P34 A;  3MGP C;  5FUG A;  4CSR A;  5DNM A;  5B1M B;  2HIO C;  3W96 D;  4H9Q A;  3MGR A;  5B0Z C;  4J8U A;  3C1B C;  3AV2 B;  4Z66 B;  4AWL B;  3VH5 T;  1N1J B;  5B24 C;  3REK A;  1M19 A;  3A6N C;  3AZG D;  2CV5 B;  1P3M B;  5AY8 C;  3REH B;  3X1V D;  4QLC B;  1P3A A;  4NE3 A;  3AZL B;  5GT3 D;  3AFA C;  1BH8 A;  1HQ3 D;  3AV1 D;  2BYM A;  4DRB A;  3AZM D;  5B2I A;  4ZUX C;  3REI B;  3MNN B;  1ZLA C;  4LD9 A;  5DNN B;  3NQU B;  3AZF A;  3AYW D;  5B40 A;  5C3I B;  3C1C A;  4H9S C;  5GSU C;  4EO5 C;  5B2J C;  3TU4 A;  3W97 D;  3AZN B;  3AZE C;  4WU8 B;  3UT9 C;  4G91 C;  5CPK A;  1KX3 A;  1KX4 D;  3AZL D;  2NZD A;  2RVQ D;  3MVD A;  5BNX B;  1P3L D;  5JRG B;  1S32 D;  1TZY B;  3AZJ B;  4J8X D;  3REL D;  1P3O B;  3WKJ D;  4H9O B;  1P3B C;  4YS3 A;  4Z5T C;  5AV5 D;  2BYK B;  4AWL C;  5GSU A;  3X1U A;  2NQB B;  4JJN A;  3UTB B;  2ARO C;  3B0B A;  5F99 D;  5BT1 D;  2FJ7 D;  2YFV A;  4WZS B;  4KUD B;  1P3P D;  3X1S C;  3VH5 W;  5GT0 B;  4R8P B;  4WU9 D;  4H9P A;  4X23 C;  1F66 C;  3MGQ C;  3REI C;  3MNN C;  5AVB B;  1Q9C A;  5B1M A;  5AVC D;  5B0Y C;  5C3I C;  3O62 B;  1AOI C; 
#chains in the Genus database with same CATH topology
 3AV2 A;  4Z66 A;  1ULY A;  1N1J A;  3AZN C;  5AV6 B;  2CV5 A;  1PZR A;  1P3M A;  1M1A C;  3UTA C;  3REH A;  3W97 A;  4E44 A;  4QLC A;  4R8P D;  1P34 D;  5AV9 B;  5DNM D;  3AZL A;  3LZ1 C;  3LZ0 B;  4M6B A;  3X1T C;  5E5A B;  5JRG C;  1TZY C;  5CPI C;  3MGR D;  4Z2M G;  3KSY A;  1P3O C;  3MGP B;  4J8U D;  1P3L A;  3W98 C;  3KXB D;  3MNN A;  2HIO B;  1WWS A;  3NQU A;  5DNN A;  1M19 D;  3REL A;  5B0Z B;  5AV6 D;  2NQB C;  5B24 B;  3EPH A;  3A6N B;  4WU8 A;  4XUJ D;  4G92 C;  2L5A A;  4WNN B;  3AFA B;  5B2I D;  5BNX A;  1P3K C;  4LD9 D;  3AZF D;  3VH5 A;  5B40 D;  1P3I C;  2F8N K;  1TZY A;  2HIO D;  3C1C D;  3AZJ A;  5BO0 B;  3C1B D;  3TU4 D;  3O62 C;  5CPK D;  1BFM A;  2Y2P A;  4UPK A;  5CPJ B;  1KX3 D;  5AY8 D;  2BYK A;  1ID3 C;  5B2J B;  2NQB A;  2NZD D;  3AZE B;  3A1K A;  3UT9 B;  4G91 B;  5B31 G;  5CP6 C;  3UTB A;  3WA9 C;  1R4V A;  3WAA B;  2F8N G;  5AV8 B;  3LZ0 C;  4KUD A;  5E5A C;  4ZUX D;  3B6F B;  1F1E A;  4R8P A;  5GT0 A;  4YS3 D;  1M18 C;  1ZLA D;  1P3B B;  5GSU D;  3X1U D;  5AVB A;  4CAY B;  4JJN D;  4Z5T B;  3O62 A;  3KXB A;  5B1L B;  4XZQ B;  2ARO B;  4WJ3 C;  2Y2H A;  5AV6 A;  3WTP B;  4XUJ A;  5AV9 A;  3X1S B;  3AZI B;  5B1M D;  5E5A A;  1F66 B;  4H9R B;  4X23 B;  3KWQ B;  3KUY B;  3MGQ B;  1P3F C;  3MGP A;  2ZY2 A;  3REJ C;  3AV2 D;  4Z66 D;  5B0Y B;  2F8N H;  1AOI B;  2HIO A;  4YM6 B;  2CV5 D;  5B0Z A;  5CPJ C;  1P3M D;  5B32 G;  1H3O B;  3C1B A;  2Y2J A;  3REH D;  3AZK B;  3AZH B;  5B24 A;  4QLC D;  5B32 B;  3A6N A;  2VQR A;  4NE5 A;  5AY8 A;  1M1A B;  1KX5 C;  3UTA B;  1TAF A;  5B31 C;  2HUE C;  3X1S D;  4WNN A;  3WAA C;  4X23 D;  5AV8 C;  3LZ1 B;  3AFA A;  1BH9 B;  3X1T B;  3REI D;  3B6F C;  3R45 B;  3MNN D;  5DNN D;  2PYO C;  5CPI B;  1AOI D;  3LJA C;  1P3G B;  3W98 B;  4ZUX A;  5BO0 A;  1ZLA A;  5G49 B;  3AZN D;  4WU8 D;  4H9S A;  3W96 C;  3KFU G;  3W99 C;  5B1L C;  4XZQ C;  5B2J A;  5GXQ B;  1WWI A;  3AZE A;  3UT9 A;  4G92 B;  3LZ1 D;  3EPL A;  3WTP C;  1A7W A;  5JRG D;  1TZY D;  2G5I C;  3X1V C;  4NFT A;  3AZJ D;  1P3O D;  1P3K B;  3AZI C;  3KWQ C;  1P3I B;  3KUY C;  3AV1 C;  1P3B A;  3AZM C;  2NQB D;  3P5J B;  3B6G C;  4CAY A;  4YM6 C;  3UTB D;  4Z5T A;  3VH6 T;  3EPJ A;  3AYW C;  1ID3 B;  3AZK C;  3AZH C;  5B32 C;  5B1L A;  5CP6 B;  2ARO A;  4J8V B;  4KUD D;  3LEL B;  5GT0 D;  3WA9 B;  1B67 A;  3X1S A;  5AVB D;  5FUG B;  3AZI A;  1M18 B;  5B33 B;  1F66 A;  4X23 A;  3O62 D;  3KWQ A;  5BS7 C;  1S32 C;  3AL0 C;  3MGQ A;  3MGS C;  1P3G C;  4J8X C;  3REI A;  4DRA A;  5B0Y A;  1B6W A;  1AOI A;  3REK B;  5CP6 D;  1H3O A;  1KU5 A;  3AZK A;  5GXQ C;  1HTA A;  3AZN A;  1P3A B;  5AV9 D;  1M1A A;  3LZ0 D;  2JE5 A;  3UTA A;  5E5A D;  2FJ7 C;  1JFI B;  3MGP D;  1T3U A;  3LZ1 A;  3X1T A;  1BH9 A;  2Y2G A;  5JRG A;  3EG5 B;  4H9N B;  5CPI A;  1P3F B;  5B0Z D;  1P3O A;  4WU9 C;  3REJ B;  4H9O A;  2RIQ A;  2Y2I A;  3W98 A;  1EQZ B;  5B24 D;  2JSS A;  4KGC B;  3A6N D;  2DF4 C;  5G49 A;  5AVC C;  1U35 C;  2XD5 A;  4E45 A;  1KX5 B;  4J8V C;  3AFA D;  3LEL C;  5B31 B;  2HUE B;  3AN2 B;  2IO5 C;  3VH6 W;  1P34 C;  1P3K A;  3REJ D;  2F8N B;  5DNM C;  2PYO B;  5B33 C;  4J8W B;  1P3I A;  2Y2L A;  5BNV B;  3LJA B;  5CPJ D;  3MGR C;  5B2J D;  4J8U C;  2UWX A;  2Y2K A;  3AZE D;  3UT9 D;  3WTP E;  3REK C;  3W96 B;  1M19 C;  1ID3 A;  3W99 B;  5B31 D;  1P3A C;  5CP6 A;  3AZG B;  3WAA D;  2YFW B;  4J8V A;  5AV8 D;  3LEL A;  3B6F D;  5KDM B;  3X1V B;  3WA9 A;  4H9P B;  3LZ0 A;  4NE6 A;  5GT3 B;  1P3B D;  5B2I C;  1M18 A;  4DQY B;  5B33 A;  3AZF C;  4Z5T D;  4LD9 C;  4UUZ B;  5B40 C;  1HQ3 B;  3AV1 B;  3C1C C;  3AZM B;  1EQZ C;  3A1I A;  4KGC C;  3W99 D;  5B1L D;  4XZQ D;  3B6G B;  3TU4 C;  2ARO D;  3AYW B;  5CPK C;  4ZBJ B;  1KX3 C;  3WTP D;  3W97 B;  2NZD C;  3EPK A;  3MVD C;  3AN2 C;  3V9R B;  3AZI D;  1KX4 B;  1F66 D;  3KWQ D;  4KHA B;  3KUY D;  3MGQ D;  1JFI A;  3VH6 A;  2ZY3 A;  1P3L B;  5B0Y D;  4J8W C;  1S32 B;  3B6G D;  4H9N A;  4YM6 D;  4YS3 C;  3MGS B;  1P3F A;  4J8X B;  3REL B;  3REJ A;  3WKJ B;  3AZK D;  2DQN C;  3AZH D;  1EQZ A;  3B0D B;  3X1U C;  4KGC A;  5B32 D;  3NQJ B;  5CPJ A;  4JJN C;  1M1A D;  3UTA D;  5AV5 B;  3AZG C;  1KX5 A;  2W8S A;  3B0C T;  5B31 A;  3X1T D;  3AN2 A;  5F99 B;  2FJ7 B;  5CPI D;  3WAA A;  5AV8 A;  5GT3 C;  3MGS D;  1P3G D;  3W98 D;  1P3P B;  3B6F A;  2F8N A;  2PYO A;  5B1M C;  4J8W A;  4WU9 B;  1HQ3 C;  5BNV A;  3LJA A;  3AV2 C;  5GXQ D;  4Z66 C;  5AVC B;  3W96 A;  3FDD A;  2CV5 C;  4ZBJ C;  5JA4 B;  1U35 B;  1P3M C;  3W99 A;  4XZQ A;  3REH C;  3W97 C;  3H0M C;  4QLC C;  3AZG A;  1P3K D;  2YFW A;  1KX4 C;  3AZL C;  2G5H C;  3WTP A;  2IO5 B;  1P3I D;  5KDM A;  2RVQ C;  3X1V A;  1P34 B;  5DNM B;  4CSR B;  5GT3 A;  1P3L C;  4H9R A;  3KUY A;  5DNN C;  4H9Q B;  3MGR B;  4UUZ A;  3REL C;  1HQ3 A;  3AV1 A;  4J8U B;  1ID3 D;  3WKJ C;  3AZM A;  3B0D C;  1U35 D;  3B6G A;  2XD1 A;  4YM6 A;  3KXB B;  1M19 B;  4J8V D;  3AYW A;  5AV5 C;  4WU8 C;  3LEL D;  3AZH A;  5B32 A;  3WA9 D;  4XUJ B;  5CHL B;  3V9R A;  5F99 C;  5BT1 C;  1M18 D;  4HGA B;  1KX4 A;  5B33 D;  1BH8 B;  4KHA A;  2BYM B;  3AZJ C;  1P3P C;  5B2I B;  3R45 A;  4LD9 B;  3AZF B;  5BS7 A;  5B40 B;  1S32 A;  3REK D;  3MGS A;  2BG1 A;  3C1C B;  4J8X A;  3B0C W;  1P3G A;  2ZY5 A;  3WKJ A;  3C1B B;  3TU4 B;  1P3A D;  3NQJ A;  2J8P A;  5CPK B;  1KX3 B;  3UTB C;  5AY8 B;  5AV5 A;  5GXQ A;  1TAF B;  2NZD B;  2CWE A;  3MVD B;  4WV4 B;  4KUD C;  5F99 A;  2FJ7 A;  4R8P C;  5GT0 C;  1P3F D;  3H0L C;  1EQZ D;  1P3P A;  4KGC D;  4ZUX B;  2FFF B;  1ZLA B;  5AVB C;  4YS3 B;  4WU9 A;  5GSU B;  3X1U B;  4EO5 B;  3KXB C;  2LY8 A;  4JJN B;  1KX5 D;  5AVC A;  4Z2M H;  5AV6 C;  5JA4 A;  3MVD D;  3AN2 D;  1U35 A;  2YFV B;  2ZY4 A;  4XUJ C;  2ZM5 A;  5AV9 C;  2F8N D;  4HGA C;  2PYO D;  4J8W D;  3LJA D;  1P34 A;  3MGP C;  3IP4 C;  3H0R C;  5FUG A;  4CSR A;  5DNM A;  5B1M B;  2HIO C;  3W96 D;  4H9Q A;  3MGR A;  2Y2N A;  2JCH A;  5B0Z C;  4J8U A;  3C1B C;  3AV2 B;  4Z66 B;  4AWL B;  3VH5 T;  1N1J B;  5B24 C;  3REK A;  1M19 A;  3A6N C;  3AZG D;  2CV5 B;  1P3M B;  5AY8 C;  2Y2M A;  3REH B;  3X1V D;  4QLC B;  1P3A A;  4NE3 A;  3AZL B;  5GT3 D;  3AFA C;  1BH8 A;  1W2E A;  1HQ3 D;  3AV1 D;  2BYM A;  4DRB A;  3AZM D;  5B2I A;  4ZUX C;  3REI B;  3MNN B;  2Y2Q A;  1ZLA C;  5DNN B;  3NQU B;  3AZF A;  4LD9 A;  3AYW D;  5B40 A;  5C3I B;  3C1C A;  4H9S C;  5GSU C;  4EO5 C;  5B2J C;  3TU4 A;  3W97 D;  3F6T A;  3AZN B;  3AZE C;  4WU8 B;  3UT9 C;  4G91 C;  5CPK A;  1KX3 A;  1KX4 D;  3AZL D;  2NZD A;  2RVQ D;  3MVD A;  5BNX B;  1P3L D;  5JRG B;  1S32 D;  1TZY B;  2F2A C;  3AZJ B;  4J8X D;  3REL D;  1P3O B;  3WKJ D;  4H9O B;  1P3B C;  4YS3 A;  4Z5T C;  5AV5 D;  2BYK B;  4AWL C;  5GSU A;  3X1U A;  2NQB B;  4JJN A;  1Z2C B;  3UTB B;  2ARO C;  3B0B A;  5F99 D;  5BT1 D;  2FJ7 D;  2YFV A;  2Y2O A;  4WZS B;  4KUD B;  1P3P D;  3X1S C;  3VH5 W;  5GT0 B;  4R8P B;  4WU9 D;  4H9P A;  4X23 C;  1F66 C;  3MGQ C;  3REI C;  3MNN C;  5AVB B;  1Q9C A;  5B1M A;  5AVC D;  5B0Y C;  5C3I C;  3O62 B;  1AOI C; 
#chains in the Genus database with same CATH homology
 3AV2 A;  4Z66 A;  1ULY A;  1N1J A;  3AZN C;  5AV6 B;  2CV5 A;  1PZR A;  1P3M A;  1M1A C;  3UTA C;  3REH A;  3W97 A;  4E44 A;  4QLC A;  4R8P D;  1P34 D;  5AV9 B;  5DNM D;  3AZL A;  3LZ1 C;  3LZ0 B;  4M6B A;  3X1T C;  5E5A B;  5JRG C;  1TZY C;  5CPI C;  3MGR D;  4Z2M G;  3KSY A;  1P3O C;  3MGP B;  4J8U D;  1P3L A;  3W98 C;  3KXB D;  3MNN A;  2HIO B;  1WWS A;  3NQU A;  5DNN A;  1M19 D;  3REL A;  5B0Z B;  5AV6 D;  2NQB C;  5B24 B;  3EPH A;  3A6N B;  4WU8 A;  4XUJ D;  4G92 C;  2L5A A;  4WNN B;  3AFA B;  5B2I D;  5BNX A;  1P3K C;  4LD9 D;  3AZF D;  3VH5 A;  5B40 D;  1P3I C;  2F8N K;  1TZY A;  2HIO D;  3C1C D;  3AZJ A;  5BO0 B;  3C1B D;  3TU4 D;  3O62 C;  5CPK D;  1BFM A;  2Y2P A;  4UPK A;  5CPJ B;  1KX3 D;  5AY8 D;  2BYK A;  1ID3 C;  5B2J B;  2NQB A;  2NZD D;  3AZE B;  3A1K A;  3UT9 B;  4G91 B;  5B31 G;  5CP6 C;  3UTB A;  3WA9 C;  1R4V A;  3WAA B;  2F8N G;  5AV8 B;  3LZ0 C;  4KUD A;  5E5A C;  4ZUX D;  3B6F B;  1F1E A;  4R8P A;  5GT0 A;  4YS3 D;  1M18 C;  1ZLA D;  1P3B B;  5GSU D;  3X1U D;  5AVB A;  4CAY B;  4JJN D;  4Z5T B;  3O62 A;  3KXB A;  5B1L B;  4XZQ B;  2ARO B;  4WJ3 C;  2Y2H A;  5AV6 A;  3WTP B;  4XUJ A;  5AV9 A;  3X1S B;  3AZI B;  5B1M D;  5E5A A;  1F66 B;  4H9R B;  4X23 B;  3KWQ B;  3KUY B;  3MGQ B;  1P3F C;  3MGP A;  2ZY2 A;  3REJ C;  3AV2 D;  4Z66 D;  5B0Y B;  2F8N H;  1AOI B;  2HIO A;  4YM6 B;  2CV5 D;  5B0Z A;  5CPJ C;  1P3M D;  5B32 G;  1H3O B;  3C1B A;  2Y2J A;  3REH D;  3AZK B;  3AZH B;  5B24 A;  4QLC D;  5B32 B;  3A6N A;  2VQR A;  4NE5 A;  5AY8 A;  1M1A B;  1KX5 C;  3UTA B;  1TAF A;  5B31 C;  2HUE C;  3X1S D;  4WNN A;  3WAA C;  4X23 D;  5AV8 C;  3LZ1 B;  3AFA A;  1BH9 B;  3X1T B;  3REI D;  3B6F C;  3R45 B;  3MNN D;  5DNN D;  2PYO C;  5CPI B;  1AOI D;  3LJA C;  1P3G B;  3W98 B;  4ZUX A;  5BO0 A;  1ZLA A;  5G49 B;  3AZN D;  4WU8 D;  4H9S A;  3W96 C;  3KFU G;  3W99 C;  5B1L C;  4XZQ C;  5B2J A;  5GXQ B;  1WWI A;  3AZE A;  3UT9 A;  4G92 B;  3LZ1 D;  3EPL A;  3WTP C;  1A7W A;  5JRG D;  1TZY D;  2G5I C;  3X1V C;  4NFT A;  3AZJ D;  1P3O D;  1P3K B;  3AZI C;  3KWQ C;  1P3I B;  3KUY C;  3AV1 C;  1P3B A;  3AZM C;  2NQB D;  3P5J B;  3B6G C;  4CAY A;  4YM6 C;  3UTB D;  4Z5T A;  3VH6 T;  3EPJ A;  3AYW C;  1ID3 B;  3AZK C;  3AZH C;  5B32 C;  5B1L A;  5CP6 B;  2ARO A;  4J8V B;  4KUD D;  3LEL B;  5GT0 D;  3WA9 B;  1B67 A;  3X1S A;  5AVB D;  5FUG B;  3AZI A;  1M18 B;  5B33 B;  1F66 A;  4X23 A;  3O62 D;  3KWQ A;  5BS7 C;  1S32 C;  3AL0 C;  3MGQ A;  3MGS C;  1P3G C;  4J8X C;  3REI A;  4DRA A;  5B0Y A;  1B6W A;  1AOI A;  3REK B;  5CP6 D;  1H3O A;  1KU5 A;  3AZK A;  5GXQ C;  1HTA A;  3AZN A;  1P3A B;  5AV9 D;  1M1A A;  3LZ0 D;  2JE5 A;  3UTA A;  5E5A D;  2FJ7 C;  1JFI B;  3MGP D;  1T3U A;  3LZ1 A;  3X1T A;  1BH9 A;  2Y2G A;  5JRG A;  3EG5 B;  4H9N B;  5CPI A;  1P3F B;  5B0Z D;  1P3O A;  4WU9 C;  3REJ B;  4H9O A;  2RIQ A;  2Y2I A;  3W98 A;  1EQZ B;  5B24 D;  2JSS A;  4KGC B;  3A6N D;  2DF4 C;  5G49 A;  5AVC C;  1U35 C;  2XD5 A;  4E45 A;  1KX5 B;  4J8V C;  3AFA D;  3LEL C;  5B31 B;  2HUE B;  3AN2 B;  2IO5 C;  3VH6 W;  1P34 C;  1P3K A;  3REJ D;  2F8N B;  5DNM C;  2PYO B;  5B33 C;  4J8W B;  1P3I A;  2Y2L A;  5BNV B;  3LJA B;  5CPJ D;  3MGR C;  5B2J D;  4J8U C;  2UWX A;  2Y2K A;  3AZE D;  3UT9 D;  3WTP E;  3REK C;  3W96 B;  1M19 C;  1ID3 A;  3W99 B;  5B31 D;  1P3A C;  5CP6 A;  3AZG B;  3WAA D;  2YFW B;  4J8V A;  5AV8 D;  3LEL A;  3B6F D;  5KDM B;  3X1V B;  3WA9 A;  4H9P B;  3LZ0 A;  4NE6 A;  5GT3 B;  1P3B D;  5B2I C;  1M18 A;  4DQY B;  5B33 A;  3AZF C;  4Z5T D;  4LD9 C;  4UUZ B;  5B40 C;  1HQ3 B;  3AV1 B;  3C1C C;  3AZM B;  1EQZ C;  3A1I A;  4KGC C;  3W99 D;  5B1L D;  4XZQ D;  3B6G B;  3TU4 C;  2ARO D;  3AYW B;  5CPK C;  4ZBJ B;  1KX3 C;  3WTP D;  3W97 B;  2NZD C;  3EPK A;  3MVD C;  3AN2 C;  3V9R B;  3AZI D;  1KX4 B;  1F66 D;  3KWQ D;  4KHA B;  3KUY D;  3MGQ D;  1JFI A;  3VH6 A;  2ZY3 A;  1P3L B;  5B0Y D;  4J8W C;  1S32 B;  3B6G D;  4H9N A;  4YM6 D;  4YS3 C;  3MGS B;  1P3F A;  4J8X B;  3REL B;  3REJ A;  3WKJ B;  3AZK D;  2DQN C;  3AZH D;  1EQZ A;  3B0D B;  3X1U C;  4KGC A;  5B32 D;  3NQJ B;  5CPJ A;  4JJN C;  1M1A D;  3UTA D;  5AV5 B;  3AZG C;  1KX5 A;  2W8S A;  3B0C T;  5B31 A;  3X1T D;  3AN2 A;  5F99 B;  2FJ7 B;  5CPI D;  3WAA A;  5AV8 A;  5GT3 C;  3MGS D;  1P3G D;  3W98 D;  1P3P B;  3B6F A;  2F8N A;  2PYO A;  5B1M C;  4J8W A;  4WU9 B;  1HQ3 C;  5BNV A;  3LJA A;  3AV2 C;  5GXQ D;  4Z66 C;  5AVC B;  3W96 A;  3FDD A;  2CV5 C;  4ZBJ C;  5JA4 B;  1U35 B;  1P3M C;  3W99 A;  4XZQ A;  3REH C;  3W97 C;  3H0M C;  4QLC C;  3AZG A;  1P3K D;  2YFW A;  1KX4 C;  3AZL C;  2G5H C;  3WTP A;  2IO5 B;  1P3I D;  5KDM A;  2RVQ C;  3X1V A;  1P34 B;  5DNM B;  4CSR B;  5GT3 A;  1P3L C;  4H9R A;  3KUY A;  5DNN C;  4H9Q B;  3MGR B;  4UUZ A;  3REL C;  1HQ3 A;  3AV1 A;  4J8U B;  1ID3 D;  3WKJ C;  3AZM A;  3B0D C;  1U35 D;  3B6G A;  2XD1 A;  4YM6 A;  3KXB B;  1M19 B;  4J8V D;  3AYW A;  5AV5 C;  4WU8 C;  3LEL D;  3AZH A;  5B32 A;  3WA9 D;  4XUJ B;  5CHL B;  3V9R A;  5F99 C;  5BT1 C;  1M18 D;  4HGA B;  1KX4 A;  5B33 D;  1BH8 B;  4KHA A;  2BYM B;  3AZJ C;  1P3P C;  5B2I B;  3R45 A;  4LD9 B;  3AZF B;  5BS7 A;  5B40 B;  1S32 A;  3REK D;  3MGS A;  2BG1 A;  3C1C B;  4J8X A;  3B0C W;  1P3G A;  2ZY5 A;  3WKJ A;  3C1B B;  3TU4 B;  1P3A D;  3NQJ A;  2J8P A;  5CPK B;  1KX3 B;  3UTB C;  5AY8 B;  5AV5 A;  5GXQ A;  1TAF B;  2NZD B;  2CWE A;  3MVD B;  4WV4 B;  4KUD C;  5F99 A;  2FJ7 A;  4R8P C;  5GT0 C;  1P3F D;  3H0L C;  1EQZ D;  1P3P A;  4KGC D;  4ZUX B;  2FFF B;  1ZLA B;  5AVB C;  4YS3 B;  4WU9 A;  5GSU B;  3X1U B;  4EO5 B;  3KXB C;  2LY8 A;  4JJN B;  1KX5 D;  5AVC A;  4Z2M H;  5AV6 C;  5JA4 A;  3MVD D;  3AN2 D;  1U35 A;  2YFV B;  2ZY4 A;  4XUJ C;  2ZM5 A;  5AV9 C;  2F8N D;  4HGA C;  2PYO D;  4J8W D;  3LJA D;  1P34 A;  3MGP C;  3IP4 C;  3H0R C;  5FUG A;  4CSR A;  5DNM A;  5B1M B;  2HIO C;  3W96 D;  4H9Q A;  3MGR A;  2Y2N A;  2JCH A;  5B0Z C;  4J8U A;  3C1B C;  3AV2 B;  4Z66 B;  4AWL B;  3VH5 T;  1N1J B;  5B24 C;  3REK A;  1M19 A;  3A6N C;  3AZG D;  2CV5 B;  1P3M B;  5AY8 C;  2Y2M A;  3REH B;  3X1V D;  4QLC B;  1P3A A;  4NE3 A;  3AZL B;  5GT3 D;  3AFA C;  1BH8 A;  1W2E A;  1HQ3 D;  3AV1 D;  2BYM A;  4DRB A;  3AZM D;  5B2I A;  4ZUX C;  3REI B;  3MNN B;  2Y2Q A;  1ZLA C;  5DNN B;  3NQU B;  3AZF A;  4LD9 A;  3AYW D;  5B40 A;  5C3I B;  3C1C A;  4H9S C;  5GSU C;  4EO5 C;  5B2J C;  3TU4 A;  3W97 D;  3F6T A;  3AZN B;  3AZE C;  4WU8 B;  3UT9 C;  4G91 C;  5CPK A;  1KX3 A;  1KX4 D;  3AZL D;  2NZD A;  2RVQ D;  3MVD A;  5BNX B;  1P3L D;  5JRG B;  1S32 D;  1TZY B;  2F2A C;  3AZJ B;  4J8X D;  3REL D;  1P3O B;  3WKJ D;  4H9O B;  1P3B C;  4YS3 A;  4Z5T C;  5AV5 D;  2BYK B;  4AWL C;  5GSU A;  3X1U A;  2NQB B;  4JJN A;  1Z2C B;  3UTB B;  2ARO C;  3B0B A;  5F99 D;  5BT1 D;  2FJ7 D;  2YFV A;  2Y2O A;  4WZS B;  4KUD B;  1P3P D;  3X1S C;  3VH5 W;  5GT0 B;  4R8P B;  4WU9 D;  4H9P A;  4X23 C;  1F66 C;  3MGQ C;  3REI C;  3MNN C;  5AVB B;  1Q9C A;  5B1M A;  5AVC D;  5B0Y C;  5C3I C;  3O62 B;  1AOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...