1ID3B

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3B00
3WTPE 1KX5B 5DNNA 3AZKA 3AV1B 1R4VA 3AZGC 1AOID 2CV5C 3W96D 3REJA 3WKJD 1P3GA 1KX3A 4XZQC 1N1JA 3KUYD 3UTAB 5B31G 4H9PA 1BH9B 3TU4C 1S32D 4J8WD 5B2JB 3W99D 2IO5C 3C1BB 3AZMD 2YFVA 5AV9B 3AZJC 4R8PA 3X1TD 3AZND 5GXQC 5E5AC 5CPIC 3MVDD 5AVBA 3LZ0B 5DNMB 3B6GD 3AYWB 3V9RA 1KU5A 4Z66B 1P34D 3MGQC 3LJAA 2FJ7D 5B31C 1JFIB 4CAYB 3WTPA 4KGCD 3AZIC 4XUJC 3KWQA 4ZUXC 1KX5D 4X23A 3AV1D 5CHLB 5FUGB 1H3OB 4YM6D 1F66D 5B0ZA 3UT9A 5B1MA 3AN2B 5AV6B 4QLCA 4JJNA 3X1VB 5DNMC 3LZ0C 3MGRD 2HUEB 3LZ1B 4J8XD 4LD9C 5B2IB 1P3AD 1P3FB 5AY8A 5B2JD 5CP6D 3AZFB 3VH6W 5GSUD 5AV9D 4AWLC 4WU8A 4M6BA 4J8UB 1EQZA 3AV2C 1P3PC 5AV5B 3X1SB 3O62C 1ID3C 3AFAC 3AYWD 4KUDC 4Z66D 3LELA 5BNVB 5JA4A 2RVQD 1P3IC 3AN2C 5AV6C 3X1VC 1P3KB 5CPKB 5GT3B 5B0YC 2HUEC 5CPJC 4HGAC 3AZGA 5AVCB 1P3FC 5BNXA 2CV5A 3AZFC 4Z5TC 1HQ3B 4XZQA 3MGSB 5B32D 4J8VB 2AROD 1U35B 3WAAD 3TU4A 2HIOA 5B24D 1M19D 4Z2MG 3WA9C 3MNND 3A6NC 5B2ID 2NZDD 5GT3C 3AZLC 5JRGB 3AZED 3B0CT 5E5AA 5CPIA 3REIC 2F8NG 4ZBJB 4G92B 5F99B 4J8UD 1AOIB 1HTAA 5AV5D 5DNND 1P3MC 3KUYB 3NQJB 3MGQA 3AZHA 5B0ZB 3C1CA 3REJD 5B1MB 5B31A 5B40B 1S32B 1KX3D 1P3KD 5CPKD 3B6FA 3MGPB 1P3BC 3AZIA 4NE6A 5AV8C 1P3OC 4YS3B 4H9SC 3VH5W 4H9RB 1M1AA 3MGSD 4ZBJC 4R8PD 3B6GB 1EQZB 3UTBB 3W96C 3REKC 3WKJC 3X1UC 4LD9A 5B33B 5GT0A 2FJ7B 4KGCB 4J8WC 3RELB 5JRGD 3LJAD 3W99C 1P3PA 3AZMC 3KXBB 3O62A 1ID3A 3X1TC 3AFAA 5F99D 5BNXB 4YM6B 3KWQD 3AZNC 1F66B 4KUDA 4EO5C 4X23D 3MVDC 1P3IA 1TZYC 3B6GC 5B0YA 3MGRB 5B0ZD 1KX4A 5CPJA 4J8XB 1P34C 3NQUB 4NFTA 3UT9D 5B1MD 5B40D 2HIOB 1P3LC 2BYMA 1P3AB 3MGPD 1M18A 5CP6B 2FJ7C 3B0DB 5GSUB 4Z5TA 5B1LB 4YS3D 4H9OB 2PYOA 1KX5C 3R45A 3AV1C 1EQZD 1F66C 3UTBD 3WA9A 3A6NA 4E44A 2BYKA 5B33D 4NE5A 3UTAC 3AZHB 3AZLA 3LELD 4WU9A 3REIA 3RELD 5B2JC 5CP6C 3C1BC 4UUZB 5AV9C 3KXBD 5G49B 1P3MA 1B6WA 5B32B 3REHA 2AROB 2CV5D 4G91B 5BO0A 1TAFB 3WAAB 5B24B 3W97A 1P3BA 3AYWC 1M19B 4Z66C 3MNNB 2NQBA 2HIOD 5AV8A 2NZDB 4H9NA 3AZEB 1P3OA 2YFWA 4H9QA 1ZLAB 5B1LD 2F8NA 3W96A 3REKA 3WKJA 5DNNB 3X1UA 3AZKB 3W98A 1BH8A 5KDMA 3REJB 3WAAC 1P3GB 1KX3B 1N1JB 4CSRA 1WWSA 3MGQD 3C1CD 3AZHD 3LZ1C 2L5AA 4H9PB 3W99A 3AZMA 5B31D 5B2IC 3B6FD 2NZDC 1M18B 3AZID 3AZNA 3X1TA 2YFVB 3MVDA 1TZYA 4R8PB 4J8UC 2PYOB 5AV5C 1M1AD 1P34A 5DNNC 1P3LA 3X1SC 5AVBB 1Q9CA 3V9RB 3AZJA 2BYKB 1P3KC 5CPKC 5GT0D 3LJAB 5GXQA 4WU9B 1KX5A 3AV1A 3WTPB 1ZLAD 5AVCC 3KWQB 4X23B 3AZKD 1HQ3C 3MGSC 4J8VC 4R8PC 3REHB 3AFAD 3UTAA 4KHAA 3UT9B 1U35C 1P3GD 1BH9A 1P3ID 4QLCB 5BT1D 4JJNB 3W97B 5B2JA 4XUJA 1KX4D 3C1BA 4ZUXA 4DRAA 5AY8B 1M18D 5JRGC 5DNMA 4WU8B 3LZ0A 5F99C 4G92C 1AOIC 2F8NB 2PYOD 4Z66A 3W98B 5AVBD 3KUYC 5B0ZC 3LELB 1BFMA 5JA4B 5B1MC 5B40C 1S32C 1JFIA 4CAYA 3MGPC 3AZLD 3AV2A 4WU9D 4E45A 3REID 3WTPD 3AZGB 5FUGA 1H3OA 4YS3C 2CV5B 1P3MD 3AN2A 4XZQB 5AV6A 3REHD 3X1VA 1EQZC 3UTBC 3LZ1A 3TU4B 4QLCD 5B2IA 4JJND 5B33C 1P3FA 3W97D 2IO5B 3LELC 3AZFA 2NQBD 4KGCC 5AV8D 5AY8D 3RELC 1P3OD 4J8UA 5GXQB 5AV5A 5E5AB 5CPIB 3KXBC 3X1SA 4WU8D 4YM6C 2F8ND 3REKD 5BNVA 3X1UD 4DRBA 3W98D 1P3KA 5CPKA 5GT3A 3MGQB 3MGRC 3C1CB 4KHAB 4J8XC 5B31B 2HIOC 1P3AC 3B6FB 5AVCA 3AZIB 4XUJB 4WNNA 5B32G 4ZUXB 3B0DC 5GSUC 1HQ3A 3AZGD 3MGSA 4J8VA 5B1LC 4Z2MH 1M1AB 1U35A 1TZYD 3VH6A 4XZQD 3TU4D 2F8NH 4LD9B 2RVQC 1P3LD 3AZHC 5JRGA 3C1CC 5GT0B 4H9SA 3AZJD 3B6FC 4AWLB 1AOIA 5F99A 3AV2B 1P3PB 5GXQD 5E5AD 5CPID 3O62B 5B32C 1ID3B 3AFAB 3KUYA 2AROC 3NQJA 4KUDB 4G91C 1M1AC 3VH6T 5BS7C 5B40A 1S32A 1P3IB 4J8WA 5B0YB 5B24C 3MGPA 3UTAD 1M19C 1KX4B 5CPJB 3MNNC 4HGAB 2BYMB 3AZEC 4XUJD 4YS3A 5GT0C 2F8NK 3C1BD 4H9RA 1WWIA 4ZUXD 4Z5TB 1ZLAC 3B6GA 1A7WA 2JSSA 3UTBA 3R45B 3AZKC 4WV4B 5B33A 5DNMD 3LZ0D 3WA9B 3B0BA 3A6NB 3REJC 2FJ7A 1P3GC 4LD9D 1KX3C 5BT1C 4KGCA 3AZLB 3RELA 1KX4C 1F1EA 4NE3A 3REIB 3KXBA 1M18C 4WNNB 1F66A 4YM6A 3AV2D 1P3PD 1P3MB 3O62D 1ID3D 3MGRA 4KUDD 3B0CW 5BO0B 2PYOC 4J8XA 1B67A 3NQUA 3VH5A 3AN2D 5AV6D 3X1VD 1P3AA 5AVBC 5B0YD 1P3BB 3LZ1D 5CP6A 5CPJD 2NQBB 5GSUA 5AV9A 5AV8B 1P3FD 2CWEA 4H9NB 1P3OB 5B1LA 4H9OA 3LJAC 2YFWB 3AZFD 4WU9C 4Z5TD 4H9QB 3WTPC 4WZSB 3KSYA 3AYWA 3KWQC 3REKB 3W96B 3WKJB 3X1UB 4X23C 3X1SD 3REHC 1BH8B 5KDMB 3WA9D 3VH5T 3A6ND 3UT9C 5C3IB 4QLCC 4JJNC 4CSRB 4J8WB 5GT3D 3W97C 1ULYA 3W99B 3AZMB 4UUZA 2NQBC 5G49A 5AVCD 5B32A 5AY8C 3AZNB 3X1TB 2AROA 1TAFA 4EO5B 2LY8A 3MVDB 3WAAA 5BS7A 1HQ3D 1TZYB 4J8VD 4WU8C 5B24A 1M19A 1P34B 1U35D 3MNNA 3W98C 1P3LB 2NZDA 3AZEA 1P3BD 5C3IC 3AZJB 1ZLAA
chains in the Genus database with same CATH superfamily
3WTPE 1KX5B 5DNNA 3AZKA 3AV1B 1R4VA 3AZGC 1AOID 2CV5C 3W96D 3REJA 3WKJD 1P3GA 1KX3A 4XZQC 1N1JA 3KUYD 3UTAB 5B31G 4H9PA 1BH9B 3TU4C 1S32D 4J8WD 5B2JB 3W99D 2IO5C 3C1BB 3AZMD 2YFVA 5AV9B 3AZJC 4R8PA 3X1TD 2BG1A 4UPKA 3AZND 3H0LC 5GXQC 5E5AC 5CPIC 3MVDD 5AVBA 3LZ0B 5DNMB 3B6GD 3AYWB 3V9RA 1KU5A 4Z66B 1P34D 2JCHA 3F6TA 3MGQC 3LJAA 2FJ7D 5B31C 1JFIB 4CAYB 3WTPA 4KGCD 2DF4C 3AZIC 4XUJC 3KWQA 4ZUXC 2DQNC 4X23A 1KX5D 3AV1D 5CHLB 5FUGB 1H3OB 4YM6D 1F66D 5B0ZA 3UT9A 5B1MA 3AN2B 5AV6B 4QLCA 4JJNA 3X1VB 5DNMC 3LZ0C 3MGRD 2HUEB 3LZ1B 4J8XD 4LD9C 5B2IB 1P3AD 1P3FB 5AY8A 5B2JD 2Y2PA 5CP6D 3AZFB 3VH6W 5GSUD 5AV9D 2G5IC 4AWLC 4WU8A 4M6BA 4J8UB 1EQZA 3H0MC 3AV2C 1P3PC 5AV5B 2Y2MA 3X1SB 3O62C 1ID3C 3AFAC 2ZY3A 3AYWD 4KUDC 4Z66D 3LELA 5BNVB 5JA4A 2RVQD 1P3IC 3AN2C 5AV6C 3X1VC 1P3KB 5CPKB 5GT3B 5B0YC 2HUEC 5CPJC 4HGAC 2XD5A 5AVCB 3AZGA 1P3FC 5BNXA 2CV5A 3A1KA 3AZFC 4Z5TC 1HQ3B 4XZQA 3MGSB 5B32D 4J8VB 2AROD 1U35B 3WAAD 3EPJA 3TU4A 2Y2KA 2HIOA 2G5HC 5B24D 1M19D 4Z2MG 3WA9C 3MNND 3A6NC 5B2ID 2NZDD 5GT3C 3AZLC 5JRGB 3AZED 3B0CT 5E5AA 5CPIA 3REIC 2F8NG 4ZBJB 4G92B 5F99B 4J8UD 1AOIB 1HTAA 5AV5D 2Y2HA 5DNND 1P3MC 3KUYB 3NQJB 3MGQA 3AZHA 5B0ZB 3C1CA 3REJD 5B1MB 3H0RC 5B31A 5B40B 1S32B 1KX3D 1P3KD 5CPKD 3B6FA 3MGPB 1P3BC 3AZIA 4NE6A 5AV8C 1P3OC 4YS3B 4H9SC 3VH5W 4H9RB 1M1AA 3MGSD 4ZBJC 4R8PD 3B6GB 1EQZB 3UTBB 3W96C 3REKC 3WKJC 3X1UC 4LD9A 5B33B 5GT0A 2FJ7B 4KGCB 4J8WC 3RELB 5JRGD 3LJAD 3W99C 1P3PA 3AZMC 3KXBB 3O62A 1ID3A 3X1TC 3AFAA 5F99D 5BNXB 4YM6B 3KWQD 3AZNC 1F66B 4KUDA 4EO5C 4X23D 3MVDC 1P3IA 1TZYC 3B6GC 5B0YA 3MGRB 5B0ZD 1KX4A 5CPJA 4J8XB 1P34C 3NQUB 4NFTA 1W2EA 5B1MD 3UT9D 5B40D 2HIOB 1P3LC 2BYMA 1P3AB 3AL0C 3MGPD 1M18A 5CP6B 2FJ7C 3B0DB 5GSUB 4Z5TA 5B1LB 4YS3D 4H9OB 2PYOA 1KX5C 2RIQA 3R45A 2Y2IA 3AV1C 1EQZD 1F66C 3UTBD 3WA9A 3A6NA 4E44A 2Y2JA 4DQYB 2BYKA 5B33D 4NE5A 3UTAC 3AZHB 3AZLA 3LELD 4WU9A 3REIA 3RELD 5B2JC 5CP6C 3C1BC 4UUZB 5AV9C 3KXBD 5G49B 1P3MA 1B6WA 5B32B 3REHA 2AROB 2CV5D 4G91B 5BO0A 1TAFB 3WAAB 2Y2OA 5B24B 3W97A 1P3BA 3AYWC 1M19B 4Z66C 3MNNB 2NQBA 2HIOD 5AV8A 2NZDB 4H9NA 3AZEB 1P3OA 2YFWA 4H9QA 1ZLAB 5B1LD 2F8NA 3W96A 3REKA 2ZM5A 3WKJA 5DNNB 3X1UA 3AZKB 3W98A 1BH8A 5KDMA 3REJB 3WAAC 1P3GB 1KX3B 1N1JB 4CSRA 1WWSA 3MGQD 3C1CD 3AZHD 3LZ1C 2L5AA 4H9PB 3W99A 3AZMA 5B31D 5B2IC 3B6FD 2NZDC 1M18B 3AZID 3AZNA 3X1TA 1Z2CB 2YFVB 3MVDA 1TZYA 2Y2NA 4R8PB 4J8UC 2PYOB 5AV5C 1M1AD 1P34A 5DNNC 1P3LA 3X1SC 5AVBB 1Q9CA 1PZRA 3V9RB 3AZJA 2BYKB 1P3KC 5CPKC 5GT0D 3LJAB 5GXQA 4WU9B 1KX5A 3AV1A 3WTPB 1ZLAD 5AVCC 3KWQB 4X23B 3AZKD 1HQ3C 3MGSC 4J8VC 4R8PC 3REHB 3AFAD 3UTAA 4KHAA 3UT9B 2J8PA 1U35C 1P3GD 1BH9A 1P3ID 4QLCB 5BT1D 4JJNB 3W97B 5B2JA 4XUJA 1KX4D 3C1BA 4ZUXA 4DRAA 5AY8B 1M18D 5JRGC 5DNMA 4WU8B 3LZ0A 5F99C 4G92C 1AOIC 2F8NB 2PYOD 4Z66A 2W8SA 3W98B 3FDDA 5AVBD 3KUYC 5B0ZC 3LELB 3IP4C 5JA4B 1BFMA 5B1MC 3EPLA 5B40C 1S32C 1JFIA 4CAYA 3MGPC 3AZLD 2ZY2A 1T3UA 3AV2A 3A1IA 4WU9D 4E45A 3REID 2ZY5A 3WTPD 3AZGB 5FUGA 1H3OA 4YS3C 2CV5B 4WJ3C 1P3MD 3AN2A 4XZQB 5AV6A 3REHD 3X1VA 1EQZC 3UTBC 3LZ1A 3TU4B 4QLCD 5B2IA 4JJND 5B33C 1P3FA 3W97D 2IO5B 3LELC 3AZFA 2NQBD 4KGCC 5AV8D 5AY8D 3RELC 1P3OD 4J8UA 5GXQB 5AV5A 5E5AB 5CPIB 3KFUG 3EPKA 3KXBC 3X1SA 4WU8D 4YM6C 2F8ND 3REKD 5BNVA 3X1UD 4DRBA 3W98D 1P3KA 5CPKA 5GT3A 3MGQB 3MGRC 3C1CB 4KHAB 4J8XC 5B31B 2HIOC 1P3AC 3B6FB 5AVCA 3AZIB 4XUJB 4WNNA 5B32G 4ZUXB 3B0DC 5GSUC 1HQ3A 3AZGD 3MGSA 4J8VA 5B1LC 4Z2MH 1M1AB 1U35A 1TZYD 3VH6A 4XZQD 2VQRA 3TU4D 2F8NH 2RVQC 4LD9B 1P3LD 3AZHC 5JRGA 3C1CC 5GT0B 4H9SA 3AZJD 3B6FC 4AWLB 1AOIA 5F99A 3AV2B 1P3PB 5GXQD 5E5AD 5CPID 3O62B 5B32C 1ID3B 3AFAB 3KUYA 2AROC 3NQJA 4KUDB 4G91C 1M1AC 3VH6T 5BS7C 5B40A 1S32A 1P3IB 4J8WA 5B0YB 5B24C 3MGPA 3UTAD 1M19C 1KX4B 5CPJB 3MNNC 4HGAB 2BYMB 3AZEC 4XUJD 4YS3A 5GT0C 2F8NK 3C1BD 4H9RA 1WWIA 4ZUXD 4Z5TB 2XD1A 1ZLAC 3B6GA 1A7WA 2JSSA 3P5JB 3UTBA 3R45B 3AZKC 4WV4B 5B33A 2Y2LA 5DNMD 3LZ0D 3WA9B 3B0BA 3A6NB 3REJC 2FJ7A 1P3GC 4LD9D 3EG5B 1KX3C 5BT1C 4KGCA 3AZLB 3RELA 1KX4C 1F1EA 4NE3A 3REIB 3KXBA 1M18C 4WNNB 1F66A 4YM6A 3AV2D 1P3PD 1P3MB 3O62D 1ID3D 3MGRA 4KUDD 3B0CW 5BO0B 2PYOC 4J8XA 1B67A 3NQUA 3VH5A 3AN2D 5AV6D 3X1VD 1P3AA 5AVBC 5B0YD 1P3BB 3LZ1D 5CP6A 5CPJD 2NQBB 5GSUA 5AV9A 5AV8B 1P3FD 2CWEA 4H9NB 1P3OB 5B1LA 2F2AC 4H9OA 3LJAC 2YFWB 3AZFD 4WU9C 4Z5TD 4H9QB 3WTPC 4WZSB 3KSYA 3AYWA 3KWQC 3REKB 3W96B 3WKJB 3X1UB 4X23C 3X1SD 3REHC 2Y2QA 1BH8B 5KDMB 3WA9D 3VH5T 3A6ND 3UT9C 5C3IB 4QLCC 4JJNC 4CSRB 4J8WB 5GT3D 3W97C 2ZY4A 1ULYA 3W99B 3AZMB 4UUZA 2NQBC 5G49A 5AVCD 5B32A 5AY8C 3AZNB 3X1TB 2AROA 2UWXA 1TAFA 4EO5B 2LY8A 3MVDB 3WAAA 5BS7A 1HQ3D 1TZYB 2Y2GA 4J8VD 4WU8C 5B24A 1M19A 1P34B 1U35D 3MNNA 3W98C 1P3LB 3EPHA 2NZDA 3AZEA 1P3BD 2FFFB 5C3IC 3AZJB 1ZLAA 2JE5A
chains in the Genus database with same CATH topology
3WTPE 1KX5B 5DNNA 3AZKA 3AV1B 1R4VA 3AZGC 1AOID 2CV5C 3W96D 3REJA 3WKJD 1P3GA 1KX3A 4XZQC 1N1JA 3KUYD 3UTAB 5B31G 4H9PA 1BH9B 3TU4C 1S32D 4J8WD 5B2JB 3W99D 2IO5C 3C1BB 3AZMD 2YFVA 5AV9B 3AZJC 4R8PA 3X1TD 2BG1A 4UPKA 3AZND 3H0LC 5GXQC 5E5AC 5CPIC 3MVDD 5AVBA 3LZ0B 5DNMB 3B6GD 3AYWB 3V9RA 1KU5A 4Z66B 1P34D 2JCHA 3F6TA 3MGQC 3LJAA 2FJ7D 5B31C 1JFIB 4CAYB 3WTPA 4KGCD 2DF4C 3AZIC 4XUJC 3KWQA 4ZUXC 2DQNC 4X23A 1KX5D 3AV1D 5CHLB 5FUGB 1H3OB 4YM6D 1F66D 5B0ZA 3UT9A 5B1MA 3AN2B 5AV6B 4QLCA 4JJNA 3X1VB 5DNMC 3LZ0C 3MGRD 2HUEB 3LZ1B 4J8XD 4LD9C 5B2IB 1P3AD 1P3FB 5AY8A 5B2JD 2Y2PA 5CP6D 3AZFB 3VH6W 5GSUD 5AV9D 2G5IC 4AWLC 4WU8A 4M6BA 4J8UB 1EQZA 3H0MC 3AV2C 1P3PC 5AV5B 2Y2MA 3X1SB 3O62C 1ID3C 3AFAC 2ZY3A 3AYWD 4KUDC 4Z66D 3LELA 5BNVB 5JA4A 2RVQD 1P3IC 3AN2C 5AV6C 3X1VC 1P3KB 5CPKB 5GT3B 5B0YC 2HUEC 5CPJC 4HGAC 2XD5A 5AVCB 3AZGA 1P3FC 5BNXA 2CV5A 3A1KA 3AZFC 4Z5TC 1HQ3B 4XZQA 3MGSB 5B32D 4J8VB 2AROD 1U35B 3WAAD 3EPJA 3TU4A 2Y2KA 2HIOA 2G5HC 5B24D 1M19D 4Z2MG 3WA9C 3MNND 3A6NC 5B2ID 2NZDD 5GT3C 3AZLC 5JRGB 3AZED 3B0CT 5E5AA 5CPIA 3REIC 2F8NG 4ZBJB 4G92B 5F99B 4J8UD 1AOIB 1HTAA 5AV5D 2Y2HA 5DNND 1P3MC 3KUYB 3NQJB 3MGQA 3AZHA 5B0ZB 3C1CA 3REJD 5B1MB 3H0RC 5B31A 5B40B 1S32B 1KX3D 1P3KD 5CPKD 3B6FA 3MGPB 1P3BC 3AZIA 4NE6A 5AV8C 1P3OC 4YS3B 4H9SC 3VH5W 4H9RB 1M1AA 3MGSD 4ZBJC 4R8PD 3B6GB 1EQZB 3UTBB 3W96C 3REKC 3WKJC 3X1UC 4LD9A 5B33B 5GT0A 2FJ7B 4KGCB 4J8WC 3RELB 5JRGD 3LJAD 3W99C 1P3PA 3AZMC 3KXBB 3O62A 1ID3A 3X1TC 3AFAA 5F99D 5BNXB 4YM6B 3KWQD 3AZNC 1F66B 4KUDA 4EO5C 4X23D 3MVDC 1P3IA 1TZYC 3B6GC 5B0YA 3MGRB 5B0ZD 1KX4A 5CPJA 4J8XB 1P34C 3NQUB 4NFTA 1W2EA 5B1MD 3UT9D 5B40D 2HIOB 1P3LC 2BYMA 1P3AB 3AL0C 3MGPD 1M18A 5CP6B 2FJ7C 3B0DB 5GSUB 4Z5TA 5B1LB 4YS3D 4H9OB 2PYOA 1KX5C 2RIQA 3R45A 2Y2IA 3AV1C 1EQZD 1F66C 3UTBD 3WA9A 3A6NA 4E44A 2Y2JA 4DQYB 2BYKA 5B33D 4NE5A 3UTAC 3AZHB 3AZLA 3LELD 4WU9A 3REIA 3RELD 5B2JC 5CP6C 3C1BC 4UUZB 5AV9C 3KXBD 5G49B 1P3MA 1B6WA 5B32B 3REHA 2AROB 2CV5D 4G91B 5BO0A 1TAFB 3WAAB 2Y2OA 5B24B 3W97A 1P3BA 3AYWC 1M19B 4Z66C 3MNNB 2NQBA 2HIOD 5AV8A 2NZDB 4H9NA 3AZEB 1P3OA 2YFWA 4H9QA 1ZLAB 5B1LD 2F8NA 3W96A 3REKA 2ZM5A 3WKJA 5DNNB 3X1UA 3AZKB 3W98A 1BH8A 5KDMA 3REJB 3WAAC 1P3GB 1KX3B 1N1JB 4CSRA 1WWSA 3MGQD 3C1CD 3AZHD 3LZ1C 2L5AA 4H9PB 3W99A 3AZMA 5B31D 5B2IC 3B6FD 2NZDC 1M18B 3AZID 3AZNA 3X1TA 1Z2CB 2YFVB 3MVDA 1TZYA 2Y2NA 4R8PB 4J8UC 2PYOB 5AV5C 1M1AD 1P34A 5DNNC 1P3LA 3X1SC 5AVBB 1Q9CA 1PZRA 3V9RB 3AZJA 2BYKB 1P3KC 5CPKC 5GT0D 3LJAB 5GXQA 4WU9B 1KX5A 3AV1A 3WTPB 1ZLAD 5AVCC 3KWQB 4X23B 3AZKD 1HQ3C 3MGSC 4J8VC 4R8PC 3REHB 3AFAD 3UTAA 4KHAA 3UT9B 2J8PA 1U35C 1P3GD 1BH9A 1P3ID 4QLCB 5BT1D 4JJNB 3W97B 5B2JA 4XUJA 1KX4D 3C1BA 4ZUXA 4DRAA 5AY8B 1M18D 5JRGC 5DNMA 4WU8B 3LZ0A 5F99C 4G92C 1AOIC 2F8NB 2PYOD 4Z66A 2W8SA 3W98B 3FDDA 5AVBD 3KUYC 5B0ZC 3LELB 3IP4C 5JA4B 1BFMA 5B1MC 3EPLA 5B40C 1S32C 1JFIA 4CAYA 3MGPC 3AZLD 2ZY2A 1T3UA 3AV2A 3A1IA 4WU9D 4E45A 3REID 2ZY5A 3WTPD 3AZGB 5FUGA 1H3OA 4YS3C 2CV5B 4WJ3C 1P3MD 3AN2A 4XZQB 5AV6A 3REHD 3X1VA 1EQZC 3UTBC 3LZ1A 3TU4B 4QLCD 5B2IA 4JJND 5B33C 1P3FA 3W97D 2IO5B 3LELC 3AZFA 2NQBD 4KGCC 5AV8D 5AY8D 3RELC 1P3OD 4J8UA 5GXQB 5AV5A 5E5AB 5CPIB 3KFUG 3EPKA 3KXBC 3X1SA 4WU8D 4YM6C 2F8ND 3REKD 5BNVA 3X1UD 4DRBA 3W98D 1P3KA 5CPKA 5GT3A 3MGQB 3MGRC 3C1CB 4KHAB 4J8XC 5B31B 2HIOC 1P3AC 3B6FB 5AVCA 3AZIB 4XUJB 4WNNA 5B32G 4ZUXB 3B0DC 5GSUC 1HQ3A 3AZGD 3MGSA 4J8VA 5B1LC 4Z2MH 1M1AB 1U35A 1TZYD 3VH6A 4XZQD 2VQRA 3TU4D 2F8NH 2RVQC 4LD9B 1P3LD 3AZHC 5JRGA 3C1CC 5GT0B 4H9SA 3AZJD 3B6FC 4AWLB 1AOIA 5F99A 3AV2B 1P3PB 5GXQD 5E5AD 5CPID 3O62B 5B32C 1ID3B 3AFAB 3KUYA 2AROC 3NQJA 4KUDB 4G91C 1M1AC 3VH6T 5BS7C 5B40A 1S32A 1P3IB 4J8WA 5B0YB 5B24C 3MGPA 3UTAD 1M19C 1KX4B 5CPJB 3MNNC 4HGAB 2BYMB 3AZEC 4XUJD 4YS3A 5GT0C 2F8NK 3C1BD 4H9RA 1WWIA 4ZUXD 4Z5TB 2XD1A 1ZLAC 3B6GA 1A7WA 2JSSA 3P5JB 3UTBA 3R45B 3AZKC 4WV4B 5B33A 2Y2LA 5DNMD 3LZ0D 3WA9B 3B0BA 3A6NB 3REJC 2FJ7A 1P3GC 4LD9D 3EG5B 1KX3C 5BT1C 4KGCA 3AZLB 3RELA 1KX4C 1F1EA 4NE3A 3REIB 3KXBA 1M18C 4WNNB 1F66A 4YM6A 3AV2D 1P3PD 1P3MB 3O62D 1ID3D 3MGRA 4KUDD 3B0CW 5BO0B 2PYOC 4J8XA 1B67A 3NQUA 3VH5A 3AN2D 5AV6D 3X1VD 1P3AA 5AVBC 5B0YD 1P3BB 3LZ1D 5CP6A 5CPJD 2NQBB 5GSUA 5AV9A 5AV8B 1P3FD 2CWEA 4H9NB 1P3OB 5B1LA 2F2AC 4H9OA 3LJAC 2YFWB 3AZFD 4WU9C 4Z5TD 4H9QB 3WTPC 4WZSB 3KSYA 3AYWA 3KWQC 3REKB 3W96B 3WKJB 3X1UB 4X23C 3X1SD 3REHC 2Y2QA 1BH8B 5KDMB 3WA9D 3VH5T 3A6ND 3UT9C 5C3IB 4QLCC 4JJNC 4CSRB 4J8WB 5GT3D 3W97C 2ZY4A 1ULYA 3W99B 3AZMB 4UUZA 2NQBC 5G49A 5AVCD 5B32A 5AY8C 3AZNB 3X1TB 2AROA 2UWXA 1TAFA 4EO5B 2LY8A 3MVDB 3WAAA 5BS7A 1HQ3D 1TZYB 2Y2GA 4J8VD 4WU8C 5B24A 1M19A 1P34B 1U35D 3MNNA 3W98C 1P3LB 3EPHA 2NZDA 3AZEA 1P3BD 2FFFB 5C3IC 3AZJB 1ZLAA 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTP E;  1KX5 B;  5DNN A;  3AZK A;  3AV1 B;  1R4V A;  3AZG C;  1AOI D;  2CV5 C;  3W96 D;  3REJ A;  3WKJ D;  1P3G A;  1KX3 A;  4XZQ C;  1N1J A;  3KUY D;  3UTA B;  5B31 G;  4H9P A;  1BH9 B;  3TU4 C;  1S32 D;  4J8W D;  5B2J B;  3W99 D;  2IO5 C;  3C1B B;  3AZM D;  2YFV A;  5AV9 B;  3AZJ C;  4R8P A;  3X1T D;  3AZN D;  5GXQ C;  5E5A C;  5CPI C;  3MVD D;  5AVB A;  3LZ0 B;  5DNM B;  3B6G D;  3AYW B;  3V9R A;  1KU5 A;  4Z66 B;  1P34 D;  3MGQ C;  3LJA A;  2FJ7 D;  5B31 C;  1JFI B;  4CAY B;  3WTP A;  4KGC D;  3AZI C;  4XUJ C;  3KWQ A;  4ZUX C;  1KX5 D;  4X23 A;  3AV1 D;  5CHL B;  5FUG B;  1H3O B;  4YM6 D;  1F66 D;  5B0Z A;  3UT9 A;  5B1M A;  3AN2 B;  5AV6 B;  4QLC A;  4JJN A;  3X1V B;  5DNM C;  3LZ0 C;  3MGR D;  2HUE B;  3LZ1 B;  4J8X D;  4LD9 C;  5B2I B;  1P3A D;  1P3F B;  5AY8 A;  5B2J D;  5CP6 D;  3AZF B;  3VH6 W;  5GSU D;  5AV9 D;  4AWL C;  4WU8 A;  4M6B A;  4J8U B;  1EQZ A;  3AV2 C;  1P3P C;  5AV5 B;  3X1S B;  3O62 C;  1ID3 C;  3AFA C;  3AYW D;  4KUD C;  4Z66 D;  3LEL A;  5BNV B;  5JA4 A;  2RVQ D;  1P3I C;  3AN2 C;  5AV6 C;  3X1V C;  1P3K B;  5CPK B;  5GT3 B;  5B0Y C;  2HUE C;  5CPJ C;  4HGA C;  3AZG A;  5AVC B;  1P3F C;  5BNX A;  2CV5 A;  3AZF C;  4Z5T C;  1HQ3 B;  4XZQ A;  3MGS B;  5B32 D;  4J8V B;  2ARO D;  1U35 B;  3WAA D;  3TU4 A;  2HIO A;  5B24 D;  1M19 D;  4Z2M G;  3WA9 C;  3MNN D;  3A6N C;  5B2I D;  2NZD D;  5GT3 C;  3AZL C;  5JRG B;  3AZE D;  3B0C T;  5E5A A;  5CPI A;  3REI C;  2F8N G;  4ZBJ B;  4G92 B;  5F99 B;  4J8U D;  1AOI B;  1HTA A;  5AV5 D;  5DNN D;  1P3M C;  3KUY B;  3NQJ B;  3MGQ A;  3AZH A;  5B0Z B;  3C1C A;  3REJ D;  5B1M B;  5B31 A;  5B40 B;  1S32 B;  1KX3 D;  1P3K D;  5CPK D;  3B6F A;  3MGP B;  1P3B C;  3AZI A;  4NE6 A;  5AV8 C;  1P3O C;  4YS3 B;  4H9S C;  3VH5 W;  4H9R B;  1M1A A;  3MGS D;  4ZBJ C;  4R8P D;  3B6G B;  1EQZ B;  3UTB B;  3W96 C;  3REK C;  3WKJ C;  3X1U C;  4LD9 A;  5B33 B;  5GT0 A;  2FJ7 B;  4KGC B;  4J8W C;  3REL B;  5JRG D;  3LJA D;  3W99 C;  1P3P A;  3AZM C;  3KXB B;  3O62 A;  1ID3 A;  3X1T C;  3AFA A;  5F99 D;  5BNX B;  4YM6 B;  3KWQ D;  3AZN C;  1F66 B;  4KUD A;  4EO5 C;  4X23 D;  3MVD C;  1P3I A;  1TZY C;  3B6G C;  5B0Y A;  3MGR B;  5B0Z D;  1KX4 A;  5CPJ A;  4J8X B;  1P34 C;  3NQU B;  4NFT A;  3UT9 D;  5B1M D;  5B40 D;  2HIO B;  1P3L C;  2BYM A;  1P3A B;  3MGP D;  1M18 A;  5CP6 B;  2FJ7 C;  3B0D B;  5GSU B;  4Z5T A;  5B1L B;  4YS3 D;  4H9O B;  2PYO A;  1KX5 C;  3R45 A;  3AV1 C;  1EQZ D;  1F66 C;  3UTB D;  3WA9 A;  3A6N A;  4E44 A;  2BYK A;  5B33 D;  4NE5 A;  3UTA C;  3AZH B;  3AZL A;  3LEL D;  4WU9 A;  3REI A;  3REL D;  5B2J C;  5CP6 C;  3C1B C;  4UUZ B;  5AV9 C;  3KXB D;  5G49 B;  1P3M A;  1B6W A;  5B32 B;  3REH A;  2ARO B;  2CV5 D;  4G91 B;  5BO0 A;  1TAF B;  3WAA B;  5B24 B;  3W97 A;  1P3B A;  3AYW C;  1M19 B;  4Z66 C;  3MNN B;  2NQB A;  2HIO D;  5AV8 A;  2NZD B;  4H9N A;  3AZE B;  1P3O A;  2YFW A;  4H9Q A;  1ZLA B;  5B1L D;  2F8N A;  3W96 A;  3REK A;  3WKJ A;  5DNN B;  3X1U A;  3AZK B;  3W98 A;  1BH8 A;  5KDM A;  3REJ B;  3WAA C;  1P3G B;  1KX3 B;  1N1J B;  4CSR A;  1WWS A;  3MGQ D;  3C1C D;  3AZH D;  3LZ1 C;  2L5A A;  4H9P B;  3W99 A;  3AZM A;  5B31 D;  5B2I C;  3B6F D;  2NZD C;  1M18 B;  3AZI D;  3AZN A;  3X1T A;  2YFV B;  3MVD A;  1TZY A;  4R8P B;  4J8U C;  2PYO B;  5AV5 C;  1M1A D;  1P34 A;  5DNN C;  1P3L A;  3X1S C;  5AVB B;  1Q9C A;  3V9R B;  3AZJ A;  2BYK B;  1P3K C;  5CPK C;  5GT0 D;  3LJA B;  5GXQ A;  4WU9 B;  1KX5 A;  3AV1 A;  3WTP B;  1ZLA D;  5AVC C;  3KWQ B;  4X23 B;  3AZK D;  1HQ3 C;  3MGS C;  4J8V C;  4R8P C;  3REH B;  3AFA D;  3UTA A;  4KHA A;  3UT9 B;  1U35 C;  1P3G D;  1BH9 A;  1P3I D;  4QLC B;  5BT1 D;  4JJN B;  3W97 B;  5B2J A;  4XUJ A;  1KX4 D;  3C1B A;  4ZUX A;  4DRA A;  5AY8 B;  1M18 D;  5JRG C;  5DNM A;  4WU8 B;  3LZ0 A;  5F99 C;  4G92 C;  1AOI C;  2F8N B;  2PYO D;  4Z66 A;  3W98 B;  5AVB D;  3KUY C;  5B0Z C;  3LEL B;  1BFM A;  5JA4 B;  5B1M C;  5B40 C;  1S32 C;  1JFI A;  4CAY A;  3MGP C;  3AZL D;  3AV2 A;  4WU9 D;  4E45 A;  3REI D;  3WTP D;  3AZG B;  5FUG A;  1H3O A;  4YS3 C;  2CV5 B;  1P3M D;  3AN2 A;  4XZQ B;  5AV6 A;  3REH D;  3X1V A;  1EQZ C;  3UTB C;  3LZ1 A;  3TU4 B;  4QLC D;  5B2I A;  4JJN D;  5B33 C;  1P3F A;  3W97 D;  2IO5 B;  3LEL C;  3AZF A;  2NQB D;  4KGC C;  5AV8 D;  5AY8 D;  3REL C;  1P3O D;  4J8U A;  5GXQ B;  5AV5 A;  5E5A B;  5CPI B;  3KXB C;  3X1S A;  4WU8 D;  4YM6 C;  2F8N D;  3REK D;  5BNV A;  3X1U D;  4DRB A;  3W98 D;  1P3K A;  5CPK A;  5GT3 A;  3MGQ B;  3MGR C;  3C1C B;  4KHA B;  4J8X C;  5B31 B;  2HIO C;  1P3A C;  3B6F B;  5AVC A;  3AZI B;  4XUJ B;  4WNN A;  5B32 G;  4ZUX B;  3B0D C;  5GSU C;  1HQ3 A;  3AZG D;  3MGS A;  4J8V A;  5B1L C;  4Z2M H;  1M1A B;  1U35 A;  1TZY D;  3VH6 A;  4XZQ D;  3TU4 D;  2F8N H;  4LD9 B;  2RVQ C;  1P3L D;  3AZH C;  5JRG A;  3C1C C;  5GT0 B;  4H9S A;  3AZJ D;  3B6F C;  4AWL B;  1AOI A;  5F99 A;  3AV2 B;  1P3P B;  5GXQ D;  5E5A D;  5CPI D;  3O62 B;  5B32 C;  1ID3 B;  3AFA B;  3KUY A;  2ARO C;  3NQJ A;  4KUD B;  4G91 C;  1M1A C;  3VH6 T;  5BS7 C;  5B40 A;  1S32 A;  1P3I B;  4J8W A;  5B0Y B;  5B24 C;  3MGP A;  3UTA D;  1M19 C;  1KX4 B;  5CPJ B;  3MNN C;  4HGA B;  2BYM B;  3AZE C;  4XUJ D;  4YS3 A;  5GT0 C;  2F8N K;  3C1B D;  4H9R A;  1WWI A;  4ZUX D;  4Z5T B;  1ZLA C;  3B6G A;  1A7W A;  2JSS A;  3UTB A;  3R45 B;  3AZK C;  4WV4 B;  5B33 A;  5DNM D;  3LZ0 D;  3WA9 B;  3B0B A;  3A6N B;  3REJ C;  2FJ7 A;  1P3G C;  4LD9 D;  1KX3 C;  5BT1 C;  4KGC A;  3AZL B;  3REL A;  1KX4 C;  1F1E A;  4NE3 A;  3REI B;  3KXB A;  1M18 C;  4WNN B;  1F66 A;  4YM6 A;  3AV2 D;  1P3P D;  1P3M B;  3O62 D;  1ID3 D;  3MGR A;  4KUD D;  3B0C W;  5BO0 B;  2PYO C;  4J8X A;  1B67 A;  3NQU A;  3VH5 A;  3AN2 D;  5AV6 D;  3X1V D;  1P3A A;  5AVB C;  5B0Y D;  1P3B B;  3LZ1 D;  5CP6 A;  5CPJ D;  2NQB B;  5GSU A;  5AV9 A;  5AV8 B;  1P3F D;  2CWE A;  4H9N B;  1P3O B;  5B1L A;  4H9O A;  3LJA C;  2YFW B;  3AZF D;  4WU9 C;  4Z5T D;  4H9Q B;  3WTP C;  4WZS B;  3KSY A;  3AYW A;  3KWQ C;  3REK B;  3W96 B;  3WKJ B;  3X1U B;  4X23 C;  3X1S D;  3REH C;  1BH8 B;  5KDM B;  3WA9 D;  3VH5 T;  3A6N D;  3UT9 C;  5C3I B;  4QLC C;  4JJN C;  4CSR B;  4J8W B;  5GT3 D;  3W97 C;  1ULY A;  3W99 B;  3AZM B;  4UUZ A;  2NQB C;  5G49 A;  5AVC D;  5B32 A;  5AY8 C;  3AZN B;  3X1T B;  2ARO A;  1TAF A;  4EO5 B;  2LY8 A;  3MVD B;  3WAA A;  5BS7 A;  1HQ3 D;  1TZY B;  4J8V D;  4WU8 C;  5B24 A;  1M19 A;  1P34 B;  1U35 D;  3MNN A;  3W98 C;  1P3L B;  2NZD A;  3AZE A;  1P3B D;  5C3I C;  3AZJ B;  1ZLA A; 
#chains in the Genus database with same CATH topology
 3WTP E;  1KX5 B;  5DNN A;  3AZK A;  3AV1 B;  1R4V A;  3AZG C;  1AOI D;  2CV5 C;  3W96 D;  3REJ A;  3WKJ D;  1P3G A;  1KX3 A;  4XZQ C;  1N1J A;  3KUY D;  3UTA B;  5B31 G;  4H9P A;  1BH9 B;  3TU4 C;  1S32 D;  4J8W D;  5B2J B;  3W99 D;  2IO5 C;  3C1B B;  3AZM D;  2YFV A;  5AV9 B;  3AZJ C;  4R8P A;  3X1T D;  2BG1 A;  4UPK A;  3AZN D;  3H0L C;  5GXQ C;  5E5A C;  5CPI C;  3MVD D;  5AVB A;  3LZ0 B;  5DNM B;  3B6G D;  3AYW B;  3V9R A;  1KU5 A;  4Z66 B;  1P34 D;  2JCH A;  3F6T A;  3MGQ C;  3LJA A;  2FJ7 D;  5B31 C;  1JFI B;  4CAY B;  3WTP A;  4KGC D;  2DF4 C;  3AZI C;  4XUJ C;  3KWQ A;  4ZUX C;  2DQN C;  4X23 A;  1KX5 D;  3AV1 D;  5CHL B;  5FUG B;  1H3O B;  4YM6 D;  1F66 D;  5B0Z A;  3UT9 A;  5B1M A;  3AN2 B;  5AV6 B;  4QLC A;  4JJN A;  3X1V B;  5DNM C;  3LZ0 C;  3MGR D;  2HUE B;  3LZ1 B;  4J8X D;  4LD9 C;  5B2I B;  1P3A D;  1P3F B;  5AY8 A;  5B2J D;  2Y2P A;  5CP6 D;  3AZF B;  3VH6 W;  5GSU D;  5AV9 D;  2G5I C;  4AWL C;  4WU8 A;  4M6B A;  4J8U B;  1EQZ A;  3H0M C;  3AV2 C;  1P3P C;  5AV5 B;  2Y2M A;  3X1S B;  3O62 C;  1ID3 C;  3AFA C;  2ZY3 A;  3AYW D;  4KUD C;  4Z66 D;  3LEL A;  5BNV B;  5JA4 A;  2RVQ D;  1P3I C;  3AN2 C;  5AV6 C;  3X1V C;  1P3K B;  5CPK B;  5GT3 B;  5B0Y C;  2HUE C;  5CPJ C;  4HGA C;  2XD5 A;  5AVC B;  3AZG A;  1P3F C;  5BNX A;  2CV5 A;  3A1K A;  3AZF C;  4Z5T C;  1HQ3 B;  4XZQ A;  3MGS B;  5B32 D;  4J8V B;  2ARO D;  1U35 B;  3WAA D;  3EPJ A;  3TU4 A;  2Y2K A;  2HIO A;  2G5H C;  5B24 D;  1M19 D;  4Z2M G;  3WA9 C;  3MNN D;  3A6N C;  5B2I D;  2NZD D;  5GT3 C;  3AZL C;  5JRG B;  3AZE D;  3B0C T;  5E5A A;  5CPI A;  3REI C;  2F8N G;  4ZBJ B;  4G92 B;  5F99 B;  4J8U D;  1AOI B;  1HTA A;  5AV5 D;  2Y2H A;  5DNN D;  1P3M C;  3KUY B;  3NQJ B;  3MGQ A;  3AZH A;  5B0Z B;  3C1C A;  3REJ D;  5B1M B;  3H0R C;  5B31 A;  5B40 B;  1S32 B;  1KX3 D;  1P3K D;  5CPK D;  3B6F A;  3MGP B;  1P3B C;  3AZI A;  4NE6 A;  5AV8 C;  1P3O C;  4YS3 B;  4H9S C;  3VH5 W;  4H9R B;  1M1A A;  3MGS D;  4ZBJ C;  4R8P D;  3B6G B;  1EQZ B;  3UTB B;  3W96 C;  3REK C;  3WKJ C;  3X1U C;  4LD9 A;  5B33 B;  5GT0 A;  2FJ7 B;  4KGC B;  4J8W C;  3REL B;  5JRG D;  3LJA D;  3W99 C;  1P3P A;  3AZM C;  3KXB B;  3O62 A;  1ID3 A;  3X1T C;  3AFA A;  5F99 D;  5BNX B;  4YM6 B;  3KWQ D;  3AZN C;  1F66 B;  4KUD A;  4EO5 C;  4X23 D;  3MVD C;  1P3I A;  1TZY C;  3B6G C;  5B0Y A;  3MGR B;  5B0Z D;  1KX4 A;  5CPJ A;  4J8X B;  1P34 C;  3NQU B;  4NFT A;  1W2E A;  5B1M D;  3UT9 D;  5B40 D;  2HIO B;  1P3L C;  2BYM A;  1P3A B;  3AL0 C;  3MGP D;  1M18 A;  5CP6 B;  2FJ7 C;  3B0D B;  5GSU B;  4Z5T A;  5B1L B;  4YS3 D;  4H9O B;  2PYO A;  1KX5 C;  2RIQ A;  3R45 A;  2Y2I A;  3AV1 C;  1EQZ D;  1F66 C;  3UTB D;  3WA9 A;  3A6N A;  4E44 A;  2Y2J A;  4DQY B;  2BYK A;  5B33 D;  4NE5 A;  3UTA C;  3AZH B;  3AZL A;  3LEL D;  4WU9 A;  3REI A;  3REL D;  5B2J C;  5CP6 C;  3C1B C;  4UUZ B;  5AV9 C;  3KXB D;  5G49 B;  1P3M A;  1B6W A;  5B32 B;  3REH A;  2ARO B;  2CV5 D;  4G91 B;  5BO0 A;  1TAF B;  3WAA B;  2Y2O A;  5B24 B;  3W97 A;  1P3B A;  3AYW C;  1M19 B;  4Z66 C;  3MNN B;  2NQB A;  2HIO D;  5AV8 A;  2NZD B;  4H9N A;  3AZE B;  1P3O A;  2YFW A;  4H9Q A;  1ZLA B;  5B1L D;  2F8N A;  3W96 A;  3REK A;  2ZM5 A;  3WKJ A;  5DNN B;  3X1U A;  3AZK B;  3W98 A;  1BH8 A;  5KDM A;  3REJ B;  3WAA C;  1P3G B;  1KX3 B;  1N1J B;  4CSR A;  1WWS A;  3MGQ D;  3C1C D;  3AZH D;  3LZ1 C;  2L5A A;  4H9P B;  3W99 A;  3AZM A;  5B31 D;  5B2I C;  3B6F D;  2NZD C;  1M18 B;  3AZI D;  3AZN A;  3X1T A;  1Z2C B;  2YFV B;  3MVD A;  1TZY A;  2Y2N A;  4R8P B;  4J8U C;  2PYO B;  5AV5 C;  1M1A D;  1P34 A;  5DNN C;  1P3L A;  3X1S C;  5AVB B;  1Q9C A;  1PZR A;  3V9R B;  3AZJ A;  2BYK B;  1P3K C;  5CPK C;  5GT0 D;  3LJA B;  5GXQ A;  4WU9 B;  1KX5 A;  3AV1 A;  3WTP B;  1ZLA D;  5AVC C;  3KWQ B;  4X23 B;  3AZK D;  1HQ3 C;  3MGS C;  4J8V C;  4R8P C;  3REH B;  3AFA D;  3UTA A;  4KHA A;  3UT9 B;  2J8P A;  1U35 C;  1P3G D;  1BH9 A;  1P3I D;  4QLC B;  5BT1 D;  4JJN B;  3W97 B;  5B2J A;  4XUJ A;  1KX4 D;  3C1B A;  4ZUX A;  4DRA A;  5AY8 B;  1M18 D;  5JRG C;  5DNM A;  4WU8 B;  3LZ0 A;  5F99 C;  4G92 C;  1AOI C;  2F8N B;  2PYO D;  4Z66 A;  2W8S A;  3W98 B;  3FDD A;  5AVB D;  3KUY C;  5B0Z C;  3LEL B;  3IP4 C;  5JA4 B;  1BFM A;  5B1M C;  3EPL A;  5B40 C;  1S32 C;  1JFI A;  4CAY A;  3MGP C;  3AZL D;  2ZY2 A;  1T3U A;  3AV2 A;  3A1I A;  4WU9 D;  4E45 A;  3REI D;  2ZY5 A;  3WTP D;  3AZG B;  5FUG A;  1H3O A;  4YS3 C;  2CV5 B;  4WJ3 C;  1P3M D;  3AN2 A;  4XZQ B;  5AV6 A;  3REH D;  3X1V A;  1EQZ C;  3UTB C;  3LZ1 A;  3TU4 B;  4QLC D;  5B2I A;  4JJN D;  5B33 C;  1P3F A;  3W97 D;  2IO5 B;  3LEL C;  3AZF A;  2NQB D;  4KGC C;  5AV8 D;  5AY8 D;  3REL C;  1P3O D;  4J8U A;  5GXQ B;  5AV5 A;  5E5A B;  5CPI B;  3KFU G;  3EPK A;  3KXB C;  3X1S A;  4WU8 D;  4YM6 C;  2F8N D;  3REK D;  5BNV A;  3X1U D;  4DRB A;  3W98 D;  1P3K A;  5CPK A;  5GT3 A;  3MGQ B;  3MGR C;  3C1C B;  4KHA B;  4J8X C;  5B31 B;  2HIO C;  1P3A C;  3B6F B;  5AVC A;  3AZI B;  4XUJ B;  4WNN A;  5B32 G;  4ZUX B;  3B0D C;  5GSU C;  1HQ3 A;  3AZG D;  3MGS A;  4J8V A;  5B1L C;  4Z2M H;  1M1A B;  1U35 A;  1TZY D;  3VH6 A;  4XZQ D;  2VQR A;  3TU4 D;  2F8N H;  2RVQ C;  4LD9 B;  1P3L D;  3AZH C;  5JRG A;  3C1C C;  5GT0 B;  4H9S A;  3AZJ D;  3B6F C;  4AWL B;  1AOI A;  5F99 A;  3AV2 B;  1P3P B;  5GXQ D;  5E5A D;  5CPI D;  3O62 B;  5B32 C;  1ID3 B;  3AFA B;  3KUY A;  2ARO C;  3NQJ A;  4KUD B;  4G91 C;  1M1A C;  3VH6 T;  5BS7 C;  5B40 A;  1S32 A;  1P3I B;  4J8W A;  5B0Y B;  5B24 C;  3MGP A;  3UTA D;  1M19 C;  1KX4 B;  5CPJ B;  3MNN C;  4HGA B;  2BYM B;  3AZE C;  4XUJ D;  4YS3 A;  5GT0 C;  2F8N K;  3C1B D;  4H9R A;  1WWI A;  4ZUX D;  4Z5T B;  2XD1 A;  1ZLA C;  3B6G A;  1A7W A;  2JSS A;  3P5J B;  3UTB A;  3R45 B;  3AZK C;  4WV4 B;  5B33 A;  2Y2L A;  5DNM D;  3LZ0 D;  3WA9 B;  3B0B A;  3A6N B;  3REJ C;  2FJ7 A;  1P3G C;  4LD9 D;  3EG5 B;  1KX3 C;  5BT1 C;  4KGC A;  3AZL B;  3REL A;  1KX4 C;  1F1E A;  4NE3 A;  3REI B;  3KXB A;  1M18 C;  4WNN B;  1F66 A;  4YM6 A;  3AV2 D;  1P3P D;  1P3M B;  3O62 D;  1ID3 D;  3MGR A;  4KUD D;  3B0C W;  5BO0 B;  2PYO C;  4J8X A;  1B67 A;  3NQU A;  3VH5 A;  3AN2 D;  5AV6 D;  3X1V D;  1P3A A;  5AVB C;  5B0Y D;  1P3B B;  3LZ1 D;  5CP6 A;  5CPJ D;  2NQB B;  5GSU A;  5AV9 A;  5AV8 B;  1P3F D;  2CWE A;  4H9N B;  1P3O B;  5B1L A;  2F2A C;  4H9O A;  3LJA C;  2YFW B;  3AZF D;  4WU9 C;  4Z5T D;  4H9Q B;  3WTP C;  4WZS B;  3KSY A;  3AYW A;  3KWQ C;  3REK B;  3W96 B;  3WKJ B;  3X1U B;  4X23 C;  3X1S D;  3REH C;  2Y2Q A;  1BH8 B;  5KDM B;  3WA9 D;  3VH5 T;  3A6N D;  3UT9 C;  5C3I B;  4QLC C;  4JJN C;  4CSR B;  4J8W B;  5GT3 D;  3W97 C;  2ZY4 A;  1ULY A;  3W99 B;  3AZM B;  4UUZ A;  2NQB C;  5G49 A;  5AVC D;  5B32 A;  5AY8 C;  3AZN B;  3X1T B;  2ARO A;  2UWX A;  1TAF A;  4EO5 B;  2LY8 A;  3MVD B;  3WAA A;  5BS7 A;  1HQ3 D;  1TZY B;  2Y2G A;  4J8V D;  4WU8 C;  5B24 A;  1M19 A;  1P34 B;  1U35 D;  3MNN A;  3W98 C;  1P3L B;  3EPH A;  2NZD A;  3AZE A;  1P3B D;  2FFF B;  5C3I C;  3AZJ B;  1ZLA A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 3WTP E;  1KX5 B;  5DNN A;  3AZK A;  3AV1 B;  1R4V A;  3AZG C;  1AOI D;  2CV5 C;  3W96 D;  3REJ A;  3WKJ D;  1P3G A;  1KX3 A;  4XZQ C;  1N1J A;  3KUY D;  3UTA B;  5B31 G;  4H9P A;  1BH9 B;  3TU4 C;  1S32 D;  4J8W D;  5B2J B;  3W99 D;  2IO5 C;  3C1B B;  3AZM D;  2YFV A;  5AV9 B;  3AZJ C;  4R8P A;  3X1T D;  2BG1 A;  4UPK A;  3AZN D;  3H0L C;  5GXQ C;  5E5A C;  5CPI C;  3MVD D;  5AVB A;  3LZ0 B;  5DNM B;  3B6G D;  3AYW B;  3V9R A;  1KU5 A;  4Z66 B;  1P34 D;  2JCH A;  3F6T A;  3MGQ C;  3LJA A;  2FJ7 D;  5B31 C;  1JFI B;  4CAY B;  3WTP A;  4KGC D;  2DF4 C;  3AZI C;  4XUJ C;  3KWQ A;  4ZUX C;  2DQN C;  4X23 A;  1KX5 D;  3AV1 D;  5CHL B;  5FUG B;  1H3O B;  4YM6 D;  1F66 D;  5B0Z A;  3UT9 A;  5B1M A;  3AN2 B;  5AV6 B;  4QLC A;  4JJN A;  3X1V B;  5DNM C;  3LZ0 C;  3MGR D;  2HUE B;  3LZ1 B;  4J8X D;  4LD9 C;  5B2I B;  1P3A D;  1P3F B;  5AY8 A;  5B2J D;  2Y2P A;  5CP6 D;  3AZF B;  3VH6 W;  5GSU D;  5AV9 D;  2G5I C;  4AWL C;  4WU8 A;  4M6B A;  4J8U B;  1EQZ A;  3H0M C;  3AV2 C;  1P3P C;  5AV5 B;  2Y2M A;  3X1S B;  3O62 C;  1ID3 C;  3AFA C;  2ZY3 A;  3AYW D;  4KUD C;  4Z66 D;  3LEL A;  5BNV B;  5JA4 A;  2RVQ D;  1P3I C;  3AN2 C;  5AV6 C;  3X1V C;  1P3K B;  5CPK B;  5GT3 B;  5B0Y C;  2HUE C;  5CPJ C;  4HGA C;  2XD5 A;  5AVC B;  3AZG A;  1P3F C;  5BNX A;  2CV5 A;  3A1K A;  3AZF C;  4Z5T C;  1HQ3 B;  4XZQ A;  3MGS B;  5B32 D;  4J8V B;  2ARO D;  1U35 B;  3WAA D;  3EPJ A;  3TU4 A;  2Y2K A;  2HIO A;  2G5H C;  5B24 D;  1M19 D;  4Z2M G;  3WA9 C;  3MNN D;  3A6N C;  5B2I D;  2NZD D;  5GT3 C;  3AZL C;  5JRG B;  3AZE D;  3B0C T;  5E5A A;  5CPI A;  3REI C;  2F8N G;  4ZBJ B;  4G92 B;  5F99 B;  4J8U D;  1AOI B;  1HTA A;  5AV5 D;  2Y2H A;  5DNN D;  1P3M C;  3KUY B;  3NQJ B;  3MGQ A;  3AZH A;  5B0Z B;  3C1C A;  3REJ D;  5B1M B;  3H0R C;  5B31 A;  5B40 B;  1S32 B;  1KX3 D;  1P3K D;  5CPK D;  3B6F A;  3MGP B;  1P3B C;  3AZI A;  4NE6 A;  5AV8 C;  1P3O C;  4YS3 B;  4H9S C;  3VH5 W;  4H9R B;  1M1A A;  3MGS D;  4ZBJ C;  4R8P D;  3B6G B;  1EQZ B;  3UTB B;  3W96 C;  3REK C;  3WKJ C;  3X1U C;  4LD9 A;  5B33 B;  5GT0 A;  2FJ7 B;  4KGC B;  4J8W C;  3REL B;  5JRG D;  3LJA D;  3W99 C;  1P3P A;  3AZM C;  3KXB B;  3O62 A;  1ID3 A;  3X1T C;  3AFA A;  5F99 D;  5BNX B;  4YM6 B;  3KWQ D;  3AZN C;  1F66 B;  4KUD A;  4EO5 C;  4X23 D;  3MVD C;  1P3I A;  1TZY C;  3B6G C;  5B0Y A;  3MGR B;  5B0Z D;  1KX4 A;  5CPJ A;  4J8X B;  1P34 C;  3NQU B;  4NFT A;  1W2E A;  5B1M D;  3UT9 D;  5B40 D;  2HIO B;  1P3L C;  2BYM A;  1P3A B;  3AL0 C;  3MGP D;  1M18 A;  5CP6 B;  2FJ7 C;  3B0D B;  5GSU B;  4Z5T A;  5B1L B;  4YS3 D;  4H9O B;  2PYO A;  1KX5 C;  2RIQ A;  3R45 A;  2Y2I A;  3AV1 C;  1EQZ D;  1F66 C;  3UTB D;  3WA9 A;  3A6N A;  4E44 A;  2Y2J A;  4DQY B;  2BYK A;  5B33 D;  4NE5 A;  3UTA C;  3AZH B;  3AZL A;  3LEL D;  4WU9 A;  3REI A;  3REL D;  5B2J C;  5CP6 C;  3C1B C;  4UUZ B;  5AV9 C;  3KXB D;  5G49 B;  1P3M A;  1B6W A;  5B32 B;  3REH A;  2ARO B;  2CV5 D;  4G91 B;  5BO0 A;  1TAF B;  3WAA B;  2Y2O A;  5B24 B;  3W97 A;  1P3B A;  3AYW C;  1M19 B;  4Z66 C;  3MNN B;  2NQB A;  2HIO D;  5AV8 A;  2NZD B;  4H9N A;  3AZE B;  1P3O A;  2YFW A;  4H9Q A;  1ZLA B;  5B1L D;  2F8N A;  3W96 A;  3REK A;  2ZM5 A;  3WKJ A;  5DNN B;  3X1U A;  3AZK B;  3W98 A;  1BH8 A;  5KDM A;  3REJ B;  3WAA C;  1P3G B;  1KX3 B;  1N1J B;  4CSR A;  1WWS A;  3MGQ D;  3C1C D;  3AZH D;  3LZ1 C;  2L5A A;  4H9P B;  3W99 A;  3AZM A;  5B31 D;  5B2I C;  3B6F D;  2NZD C;  1M18 B;  3AZI D;  3AZN A;  3X1T A;  1Z2C B;  2YFV B;  3MVD A;  1TZY A;  2Y2N A;  4R8P B;  4J8U C;  2PYO B;  5AV5 C;  1M1A D;  1P34 A;  5DNN C;  1P3L A;  3X1S C;  5AVB B;  1Q9C A;  1PZR A;  3V9R B;  3AZJ A;  2BYK B;  1P3K C;  5CPK C;  5GT0 D;  3LJA B;  5GXQ A;  4WU9 B;  1KX5 A;  3AV1 A;  3WTP B;  1ZLA D;  5AVC C;  3KWQ B;  4X23 B;  3AZK D;  1HQ3 C;  3MGS C;  4J8V C;  4R8P C;  3REH B;  3AFA D;  3UTA A;  4KHA A;  3UT9 B;  2J8P A;  1U35 C;  1P3G D;  1BH9 A;  1P3I D;  4QLC B;  5BT1 D;  4JJN B;  3W97 B;  5B2J A;  4XUJ A;  1KX4 D;  3C1B A;  4ZUX A;  4DRA A;  5AY8 B;  1M18 D;  5JRG C;  5DNM A;  4WU8 B;  3LZ0 A;  5F99 C;  4G92 C;  1AOI C;  2F8N B;  2PYO D;  4Z66 A;  2W8S A;  3W98 B;  3FDD A;  5AVB D;  3KUY C;  5B0Z C;  3LEL B;  3IP4 C;  5JA4 B;  1BFM A;  5B1M C;  3EPL A;  5B40 C;  1S32 C;  1JFI A;  4CAY A;  3MGP C;  3AZL D;  2ZY2 A;  1T3U A;  3AV2 A;  3A1I A;  4WU9 D;  4E45 A;  3REI D;  2ZY5 A;  3WTP D;  3AZG B;  5FUG A;  1H3O A;  4YS3 C;  2CV5 B;  4WJ3 C;  1P3M D;  3AN2 A;  4XZQ B;  5AV6 A;  3REH D;  3X1V A;  1EQZ C;  3UTB C;  3LZ1 A;  3TU4 B;  4QLC D;  5B2I A;  4JJN D;  5B33 C;  1P3F A;  3W97 D;  2IO5 B;  3LEL C;  3AZF A;  2NQB D;  4KGC C;  5AV8 D;  5AY8 D;  3REL C;  1P3O D;  4J8U A;  5GXQ B;  5AV5 A;  5E5A B;  5CPI B;  3KFU G;  3EPK A;  3KXB C;  3X1S A;  4WU8 D;  4YM6 C;  2F8N D;  3REK D;  5BNV A;  3X1U D;  4DRB A;  3W98 D;  1P3K A;  5CPK A;  5GT3 A;  3MGQ B;  3MGR C;  3C1C B;  4KHA B;  4J8X C;  5B31 B;  2HIO C;  1P3A C;  3B6F B;  5AVC A;  3AZI B;  4XUJ B;  4WNN A;  5B32 G;  4ZUX B;  3B0D C;  5GSU C;  1HQ3 A;  3AZG D;  3MGS A;  4J8V A;  5B1L C;  4Z2M H;  1M1A B;  1U35 A;  1TZY D;  3VH6 A;  4XZQ D;  2VQR A;  3TU4 D;  2F8N H;  2RVQ C;  4LD9 B;  1P3L D;  3AZH C;  5JRG A;  3C1C C;  5GT0 B;  4H9S A;  3AZJ D;  3B6F C;  4AWL B;  1AOI A;  5F99 A;  3AV2 B;  1P3P B;  5GXQ D;  5E5A D;  5CPI D;  3O62 B;  5B32 C;  1ID3 B;  3AFA B;  3KUY A;  2ARO C;  3NQJ A;  4KUD B;  4G91 C;  1M1A C;  3VH6 T;  5BS7 C;  5B40 A;  1S32 A;  1P3I B;  4J8W A;  5B0Y B;  5B24 C;  3MGP A;  3UTA D;  1M19 C;  1KX4 B;  5CPJ B;  3MNN C;  4HGA B;  2BYM B;  3AZE C;  4XUJ D;  4YS3 A;  5GT0 C;  2F8N K;  3C1B D;  4H9R A;  1WWI A;  4ZUX D;  4Z5T B;  2XD1 A;  1ZLA C;  3B6G A;  1A7W A;  2JSS A;  3P5J B;  3UTB A;  3R45 B;  3AZK C;  4WV4 B;  5B33 A;  2Y2L A;  5DNM D;  3LZ0 D;  3WA9 B;  3B0B A;  3A6N B;  3REJ C;  2FJ7 A;  1P3G C;  4LD9 D;  3EG5 B;  1KX3 C;  5BT1 C;  4KGC A;  3AZL B;  3REL A;  1KX4 C;  1F1E A;  4NE3 A;  3REI B;  3KXB A;  1M18 C;  4WNN B;  1F66 A;  4YM6 A;  3AV2 D;  1P3P D;  1P3M B;  3O62 D;  1ID3 D;  3MGR A;  4KUD D;  3B0C W;  5BO0 B;  2PYO C;  4J8X A;  1B67 A;  3NQU A;  3VH5 A;  3AN2 D;  5AV6 D;  3X1V D;  1P3A A;  5AVB C;  5B0Y D;  1P3B B;  3LZ1 D;  5CP6 A;  5CPJ D;  2NQB B;  5GSU A;  5AV9 A;  5AV8 B;  1P3F D;  2CWE A;  4H9N B;  1P3O B;  5B1L A;  2F2A C;  4H9O A;  3LJA C;  2YFW B;  3AZF D;  4WU9 C;  4Z5T D;  4H9Q B;  3WTP C;  4WZS B;  3KSY A;  3AYW A;  3KWQ C;  3REK B;  3W96 B;  3WKJ B;  3X1U B;  4X23 C;  3X1S D;  3REH C;  2Y2Q A;  1BH8 B;  5KDM B;  3WA9 D;  3VH5 T;  3A6N D;  3UT9 C;  5C3I B;  4QLC C;  4JJN C;  4CSR B;  4J8W B;  5GT3 D;  3W97 C;  2ZY4 A;  1ULY A;  3W99 B;  3AZM B;  4UUZ A;  2NQB C;  5G49 A;  5AVC D;  5B32 A;  5AY8 C;  3AZN B;  3X1T B;  2ARO A;  2UWX A;  1TAF A;  4EO5 B;  2LY8 A;  3MVD B;  3WAA A;  5BS7 A;  1HQ3 D;  1TZY B;  2Y2G A;  4J8V D;  4WU8 C;  5B24 A;  1M19 A;  1P34 B;  1U35 D;  3MNN A;  3W98 C;  1P3L B;  3EPH A;  2NZD A;  3AZE A;  1P3B D;  2FFF B;  5C3I C;  3AZJ B;  1ZLA A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...