1ID3B

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2001-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3B00
5B31G 3R45A 3AN2D 1ID3A 5DNMD 4Z66C 3KUYC 3AZKC 1P3LB 2F8NG 3WAAD 3O62B 1HTAA 5B1LB 5E5AA 4Z2MH 5AV8D 4ZBJC 1AOID 3UTBA 3MGRB 3AZEB 2PYOA 5B2JA 3AZND 5AV5C 3UTBD 4WNNA 4LD9C 3WAAC 2BYKB 5B32D 2FJ7A 3AZID 3KWQD 5B0ZC 2BYMB 5BT1C 4J8XD 3WAAA 5B24D 3LELC 1TZYA 5BNXA 3AN2A 5JRGA 4KHAB 4J8UA 4E44A 3AYWA 1ZLAC 1P3LD 5DNNC 1P3KA 1S32C 3AZJA 5B1MA 3KUYA 3REID 1P3ID 3WTPB 3AYWB 3MGRD 3AZED 5B1MC 1M1AB 1P34A 5GT0B 1P3GD 1B6WA 3LELD 4J8WB 4NFTA 4J8VD 1P3PA 2F8ND 5KDMB 3W98B 3AZLC 1F66A 5AV6C 3W96D 5GXQD 1TZYC 4WU8B 2CWEA 4J8UD 1P3IB 2JSSA 4KGCD 3AZJB 4CSRB 3REHA 5G49A 3B0BA 5CP6C 1M19C 3B6GA 3AN2C 3A6NC 5B2IB 1KU5A 5GSUC 3REJB 3VH5T 4KUDD 1KX3A 1P3MB 3LJAC 4YM6B 4H9QB 5GT3A 2PYOC 2CV5B 3B0CW 3KXBC 1P3PC 2F8NB 5C3IB 2HIOA 3V9RB 3X1SC 4H9QA 3KWQC 4WU8D 1P3FB 4ZUXD 4WU9A 3LZ0D 1P3AB 4KUDB 3AZNC 3WKJA 1KX3B 5B31C 2NQBA 1P3OB 5GSUA 3A6NA 3MGQB 5CP6A 3AZGB 1A7WA 3X1UA 1P3MD 4DRBA 3UTAA 5CPKB 2FJ7B 2RVQC 3W97B 5B1MD 3KXBD 3X1UC 1P3FA 5B0YB 1P3LA 3X1TC 2HUEC 2NZDB 3B6GB 1P3FD 3UTBB 1HQ3B 1M1AA 5B32B 3UT9B 3X1UD 4QLCC 4XZQD 1KX4C 5KDMA 3AYWC 1KX5A 4NE3A 4J8UC 5B0YA 5JRGC 5CPID 3WKJD 3MNNA 5AV9B 2AROA 1AOIA 3TU4B 4ZUXA 5AVCC 4WU8A 5B40B 4WU8C 5DNMA 5AV8C 2YFVA 4ZUXC 4R8PB 4LD9A 4Z66D 3AZKD 3B6FD 3AZMC 1P3OA 1BFMA 4KGCC 3AV1A 3LJAD 3UT9D 1P3BA 3UTAB 3MGSC 3MGPD 1KX4A 4CAYB 4XZQB 5B1LA 4QLCA 5BO0A 1M1AD 2F8NK 4XUJD 5AY8B 5F99D 1P3GB 4J8WC 3LZ1B 4ZBJB 3B6FC 5AVBC 3REHD 2YFVB 5AY8A 3X1VC 1TZYB 2PYOB 3MVDD 3REJD 3O62D 5DNND 4XUJC 3KWQB 3UTAD 1P3FC 2BYKA 1F66D 4R8PD 3REJA 1S32A 5CP6B 4UUZA 4JJNC 5F99B 3AZNB 3AV1C 3REKA 1EQZD 1P3GA 1TAFA 4G92B 2RVQD 3AZMA 1P3OC 2YFWB 1KX5B 5F99A 4H9PB 4EO5C 4WU9D 1P3KD 3W98A 1F66B 3AZHD 4LD9B 3AZFA 5CPIC 5JRGD 4Z66A 3AZKA 3X1TB 5CPJC 1P34B 2HUEB 4H9NB 2NZDC 1P3AC 2IO5B 4M6BA 3REIB 1H3OB 4J8XA 3VH5A 3MGPA 1KX4D 5E5AC 5GXQB 2YFWA 3LJAA 3RELC 1KX3D 5BT1D 1P3OD 3MNND 3AFAB 3MGQC 5B0YD 1ZLAB 2F8NH 4LD9D 2NZDD 1KX5D 4AWLC 4KGCA 4WV4B 5B1MB 3TU4C 3AZHB 3KSYA 1P3PD 3W98C 5B2JB 4XZQA 5BO0B 2AROC 3AZLD 3C1BC 1ULYA 3W96C 1P3BB 4YM6D 1BH8A 4J8UB 3AZMD 3WA9A 5GSUB 1N1JA 3REJC 5FUGA 5B31B 3WKJB 3X1SA 5B40A 3B6FB 4R8PA 1S32D 3KXBA 3AZGC 5B40C 3AV2D 3MGQD 4YM6C 4J8XB 5CPKC 3KXBB 5AY8D 5C3IC 4XUJB 4J8WA 1M18C 1Q9CA 5GSUD 1BH8B 1M19A 3B6GC 4XZQC 4QLCD 3W97D 4HGAB 3LZ0A 3W99C 4YS3B 3UTBC 3UT9A 1HQ3C 3AV1D 4KUDA 4JJNA 4EO5B 5B33B 3X1VB 4KHAA 5B31D 4CSRA 3REHB 3NQJA 3AZFD 1F66C 3MGQA 3AZHA 4WU9C 3W97C 5CPIB 3W98D 3W99D 3X1UB 2HIOC 5AV9C 1BH9B 3W97A 3TU4D 5B0ZD 1AOIB 3AV1B 4Z5TA 5AVCB 4G92C 3AZFC 3WA9B 4J8VA 3NQUA 3AFAC 1ZLAA 5B33A 3MGPC 1P34D 3UT9C 1P3AA 3MGRA 3LZ0C 3AZEA 3C1CA 3C1BA 4H9SC 3AV2A 1KX4B 1P3IA 4KGCB 3C1CC 1B67A 3MGSB 3X1SD 5CPJB 5JRGB 2IO5C 3R45B 3WA9D 5B2IA 4WZSB 3LZ1C 4YM6A 5AVBB 1TZYD 2L5AA 3RELB 1F1EA 1P3MA 2AROB 4R8PC 4ZUXB 1JFIB 3AYWD 5CP6D 3B6FA 3A6ND 3AZNA 4JJNB 4UUZB 5FUGB 5B2JD 5B24A 5GT0A 3B0DB 5AY8C 2LY8A 1WWIA 3AZIA 5B32A 2FJ7D 4H9NA 2AROD 5GT0D 1EQZB 5GT3D 3LZ1A 4X23A 3W96B 3B0CT 5E5AD 5CPKA 1P3KB 3AV2B 3REIC 5F99C 3KUYB 4YS3A 4HGAC 5JA4A 5GXQC 4NE6A 3WKJC 1M18A 3AFAD 5B2ID 4WNNB 1KX5C 5B33C 2CV5D 1HQ3D 4J8VC 4DRAA 5AV5B 1ID3C 4J8XC 2BYMA 4AWLB 3VH6T 3WAAB 3C1CD 5GT3C 3MNNB 2HIOB 3V9RA 1P34C 3LELB 5B33D 3REKD 3AZHC 4Z66B 5G49B 3AZKB 1P3LC 3AZFB 5DNMB 2NQBD 5E5AB 1U35A 4H9OA 5B1LC 3MGSA 3TU4A 3KUYD 3REIA 3O62A 3AZIB 3C1BB 4H9RA 3REHC 4H9OB 2HIOD 3AFAA 5GT0C 1M18D 5B31A 2NQBC 5AV5D 5BNVB 4XUJA 3MVDB 1JFIA 5BNXB 1P3BD 1AOIC 1R4VA 3RELA 1U35B 4X23D 5B2JC 4H9RB 4G91B 2PYOD 1S32B 4J8WD 1M18B 3WTPA 3AN2B 5B2IC 1P3BC 1M1AC 3B0DC 3MGSD 5GXQA 4YS3C 5CPIA 1U35D 3O62C 4X23B 2F8NA 3VH6W 3LELA 5BS7A 3NQJB 3MGRC 3AZEC 3X1VD 3VH6A 5AV9D 5AVBD 4Z5TB 5AVCA 4WU9B 3AZJD 5AV6D 5B0ZB 5B24B 3REKC 1H3OA 3A6NB 3REKB 3X1TD 3WA9C 5AV6A 3W99B 3WTPE 3MGPB 5DNNB 5BNVA 3KWQA 3LZ0B 1P3AD 1ID3B 5AVCD 1EQZC 2CV5C 3WTPD 5AVBA 1ZLAD 5GT3B 2NZDA 5CPJD 3X1SB 3VH5W 1N1JB 4Z5TD 1P3KC 4H9PA 5DNMC 5AV8A 3RELD 3AZLB 1KX3C 5AV6B 3AZMB 3W99A 5B32C 1ID3D 3AZIC 5AV5A 1P3IC 4J8VB 3NQUB 3AZGA 4JJND 2FJ7C 4NE5A 2NQBB 3WTPC 3C1CB 5CHLB 1M19D 1P3MC 3B6GD 1EQZA 5CPJA 5B32G 4Z2MG 4G91C 1BH9A 4QLCB 3AZJC 4CAYA 3C1BD 3W96A 5DNNA 3UTAC 4KUDC 1M19B 4H9SA 5B40D 3MVDA 1HQ3A 3AV2C 3X1TA 1P3GC 5JA4B 3MVDC 4X23C 4YS3D 1U35C 5B0ZA 5B1LD 3LJAB 5AV8B 4E45A 4Z5TC 3AZLA 5CPKD 5BS7C 1WWSA 1P3PB 5AV9A 2CV5A 3X1VA 3MNNC 1TAFB 3AZGD 3LZ1D 5B24C 5B0YC
chains in the Genus database with same CATH superfamily
5B31G 3R45A 3AN2D 1ID3A 5DNMD 4Z66C 3KUYC 3AZKC 1P3LB 2F8NG 3WAAD 3O62B 1HTAA 5B1LB 5E5AA 4Z2MH 5AV8D 4ZBJC 1AOID 3UTBA 3MGRB 3AZEB 2PYOA 5B2JA 3AZND 5AV5C 3EPJA 4WNNA 3UTBD 4LD9C 3WAAC 2BYKB 5B32D 2FJ7A 3AZID 3KWQD 5B0ZC 2BYMB 5BT1C 4J8XD 3WAAA 5B24D 3LELC 1TZYA 5BNXA 3AN2A 5JRGA 4KHAB 4J8UA 4E44A 3EG5B 3AYWA 1ZLAC 1P3LD 5DNNC 1P3KA 1S32C 3AZJA 5B1MA 3KUYA 3REID 1P3ID 3WTPB 3AYWB 3MGRD 3AZED 5B1MC 1M1AB 1P34A 5GT0B 1P3GD 1B6WA 3LELD 4J8WB 4NFTA 4J8VD 1P3PA 2F8ND 5KDMB 3W98B 3AZLC 1F66A 5AV6C 3W96D 5GXQD 3H0RC 1TZYC 4WU8B 2CWEA 4J8UD 1P3IB 2JSSA 4KGCD 3AZJB 4CSRB 2G5HC 3REHA 5G49A 3B0BA 5CP6C 1M19C 2Y2PA 3AN2C 3B6GA 3A6NC 5B2IB 3AL0C 1KU5A 5GSUC 3REJB 3VH5T 4KUDD 1KX3A 2ZY2A 1P3MB 2ZY4A 3LJAC 2JE5A 4YM6B 4H9QB 5GT3A 2PYOC 2CV5B 3B0CW 3KXBC 1P3PC 2F8NB 5C3IB 2Y2LA 2HIOA 3V9RB 3X1SC 4H9QA 3KWQC 4WU8D 1P3FB 2XD1A 4ZUXD 4WU9A 3LZ0D 1P3AB 4KUDB 3AZNC 3WKJA 1KX3B 5B31C 2NQBA 1P3OB 5GSUA 4WJ3C 2Y2OA 3A6NA 3MGQB 5CP6A 3AZGB 1A7WA 3X1UA 1P3MD 4DRBA 3UTAA 5CPKB 2FJ7B 2RVQC 3W97B 5B1MD 3KXBD 3X1UC 1P3FA 2Y2MA 5B0YB 1P3LA 2W8SA 3X1TC 2HUEC 2NZDB 3B6GB 1P3FD 3UTBB 1HQ3B 1M1AA 5B32B 3UT9B 3X1UD 4QLCC 4XZQD 1KX4C 2DF4C 5KDMA 3AYWC 1KX5A 2G5IC 4NE3A 4J8UC 5B0YA 5JRGC 5CPID 3WKJD 3MNNA 5AV9B 3KFUG 2Y2GA 2AROA 3H0LC 1AOIA 3TU4B 4ZUXA 5AVCC 4WU8A 5B40B 4WU8C 5DNMA 5AV8C 2YFVA 4ZUXC 4R8PB 4LD9A 4Z66D 3AZKD 2Y2QA 3B6FD 2Y2JA 3AZMC 1P3OA 1BFMA 3IP4C 4KGCC 3AV1A 3LJAD 3UT9D 1P3BA 3UTAB 3MGSC 3MGPD 1KX4A 4CAYB 4XZQB 5B1LA 4QLCA 5BO0A 1M1AD 2F8NK 4XUJD 5AY8B 5F99D 1P3GB 4J8WC 3LZ1B 4ZBJB 3B6FC 5AVBC 3REHD 2YFVB 5AY8A 3X1VC 1TZYB 2PYOB 3MVDD 3REJD 3O62D 5DNND 4XUJC 3KWQB 2ZY5A 3UTAD 2BYKA 1P3FC 1F66D 4R8PD 3REJA 1S32A 5CP6B 4UUZA 4JJNC 5F99B 3AZNB 3AV1C 3REKA 1EQZD 1P3GA 1TAFA 4G92B 2RVQD 3AZMA 1P3OC 2YFWB 1KX5B 5F99A 4H9PB 4EO5C 4WU9D 1P3KD 3W98A 1F66B 3AZHD 4LD9B 3AZFA 5CPIC 5JRGD 4Z66A 3AZKA 3X1TB 5CPJC 1P34B 2HUEB 4H9NB 2NZDC 1P3AC 2IO5B 4M6BA 3FDDA 3REIB 1H3OB 4J8XA 3VH5A 3MGPA 1KX4D 5E5AC 5GXQB 2YFWA 3LJAA 3RELC 1KX3D 5BT1D 1P3OD 3MNND 3AFAB 3MGQC 5B0YD 1ZLAB 2F8NH 4LD9D 2NZDD 1KX5D 4AWLC 3EPHA 4KGCA 4WV4B 5B1MB 2Y2HA 3TU4C 3AZHB 2BG1A 3KSYA 1P3PD 3W98C 5B2JB 4XZQA 5BO0B 2AROC 3AZLD 3C1BC 1ULYA 3W96C 1P3BB 4YM6D 1W2EA 1BH8A 4J8UB 3AZMD 3WA9A 5GSUB 1N1JA 3REJC 5FUGA 5B31B 3WKJB 2VQRA 3X1SA 5B40A 3B6FB 4R8PA 1S32D 3KXBA 3AZGC 5B40C 3AV2D 3MGQD 4YM6C 4J8XB 5CPKC 3KXBB 5AY8D 5C3IC 3A1IA 4XUJB 4J8WA 1M18C 1Q9CA 5GSUD 1BH8B 1M19A 3B6GC 4XZQC 4QLCD 3W97D 4HGAB 3LZ0A 3W99C 4YS3B 3UTBC 3UT9A 1HQ3C 3AV1D 4KUDA 4JJNA 4EO5B 5B33B 3X1VB 4KHAA 5B31D 4CSRA 3REHB 3NQJA 3AZFD 1F66C 2Y2NA 3MGQA 3AZHA 4WU9C 3W97C 5CPIB 2JCHA 3W98D 3W99D 3X1UB 2HIOC 5AV9C 1BH9B 3W97A 3TU4D 5B0ZD 1AOIB 3AV1B 4Z5TA 5AVCB 4G92C 3AZFC 3WA9B 4J8VA 3NQUA 3AFAC 1ZLAA 5B33A 3MGPC 1P34D 3UT9C 1P3AA 3MGRA 3LZ0C 3AZEA 3EPLA 3C1CA 3C1BA 4H9SC 3AV2A 1KX4B 1P3IA 2J8PA 4KGCB 2ZY3A 3C1CC 1B67A 3MGSB 3X1SD 5CPJB 4UPKA 5JRGB 2IO5C 3R45B 3WA9D 5B2IA 4WZSB 3LZ1C 3F6TA 4YM6A 5AVBB 1TZYD 2L5AA 3RELB 1F1EA 1P3MA 2AROB 4R8PC 4ZUXB 2DQNC 1JFIB 3AYWD 5CP6D 3B6FA 3A6ND 3AZNA 4JJNB 4UUZB 5FUGB 5B2JD 5B24A 5GT0A 3B0DB 5AY8C 2LY8A 1WWIA 3AZIA 5B32A 2FJ7D 4H9NA 2AROD 5GT0D 1PZRA 1EQZB 5GT3D 3LZ1A 4X23A 3W96B 3B0CT 5E5AD 5CPKA 1P3KB 3AV2B 3REIC 5F99C 3KUYB 4YS3A 4HGAC 5JA4A 5GXQC 4NE6A 3WKJC 1M18A 3AFAD 5B2ID 4WNNB 1KX5C 5B33C 2CV5D 1HQ3D 4J8VC 4DRAA 5AV5B 1ID3C 4J8XC 2BYMA 4AWLB 3VH6T 3WAAB 3C1CD 5GT3C 3MNNB 2HIOB 3V9RA 1P34C 3LELB 5B33D 3REKD 3AZHC 4Z66B 5G49B 3AZKB 1P3LC 3AZFB 5DNMB 2NQBD 5E5AB 1U35A 4H9OA 5B1LC 3MGSA 3TU4A 3KUYD 3REIA 3O62A 3AZIB 3C1BB 4H9RA 3REHC 4H9OB 2HIOD 3AFAA 5GT0C 1M18D 2Y2IA 5B31A 2NQBC 5AV5D 5BNVB 4XUJA 3MVDB 1JFIA 5BNXB 1P3BD 1AOIC 2FFFB 1R4VA 3RELA 1U35B 4X23D 5B2JC 4H9RB 4G91B 2PYOD 1S32B 4J8WD 1M18B 3P5JB 3WTPA 3AN2B 5B2IC 1P3BC 1M1AC 3B0DC 3MGSD 5GXQA 4YS3C 5CPIA 1U35D 3O62C 4X23B 2F8NA 3VH6W 3LELA 5BS7A 3NQJB 3MGRC 3AZEC 3X1VD 3VH6A 5AV9D 5AVBD 4Z5TB 5AVCA 3EPKA 4WU9B 3H0MC 3AZJD 5AV6D 5B0ZB 2RIQA 5B24B 3REKC 1H3OA 2Y2KA 3A6NB 3REKB 3X1TD 1Z2CB 3WA9C 5AV6A 3W99B 2XD5A 3WTPE 3MGPB 5DNNB 5BNVA 3KWQA 3LZ0B 1P3AD 1ID3B 5AVCD 1EQZC 2CV5C 3WTPD 5AVBA 1ZLAD 5GT3B 2NZDA 3X1SB 5CPJD 3VH5W 2UWXA 1N1JB 4Z5TD 1P3KC 4DQYB 4H9PA 5AV8A 5DNMC 3RELD 3AZLB 1KX3C 1T3UA 5AV6B 3AZMB 3W99A 5B32C 1ID3D 3AZIC 5AV5A 1P3IC 4J8VB 2F2AC 3NQUB 3AZGA 4JJND 2FJ7C 4NE5A 2NQBB 3WTPC 3C1CB 5CHLB 1M19D 1P3MC 3B6GD 1EQZA 5CPJA 5B32G 4Z2MG 4G91C 1BH9A 3A1KA 4QLCB 3AZJC 4CAYA 3C1BD 3W96A 5DNNA 3UTAC 4KUDC 1M19B 4H9SA 5B40D 3MVDA 1HQ3A 3AV2C 3X1TA 1P3GC 5JA4B 3MVDC 4X23C 4YS3D 1U35C 5B0ZA 5B1LD 3LJAB 5AV8B 4E45A 4Z5TC 3AZLA 5CPKD 5BS7C 1WWSA 2ZM5A 1P3PB 5AV9A 2CV5A 3X1VA 3MNNC 1TAFB 3AZGD 3LZ1D 5B24C 5B0YC
chains in the Genus database with same CATH topology
5B31G 3R45A 3AN2D 1ID3A 5DNMD 4Z66C 3KUYC 3AZKC 1P3LB 2F8NG 3WAAD 3O62B 1HTAA 5B1LB 5E5AA 4Z2MH 5AV8D 4ZBJC 1AOID 3UTBA 3MGRB 3AZEB 2PYOA 5B2JA 3AZND 5AV5C 3EPJA 4WNNA 3UTBD 4LD9C 3WAAC 2BYKB 5B32D 2FJ7A 3AZID 3KWQD 5B0ZC 2BYMB 5BT1C 4J8XD 3WAAA 5B24D 3LELC 1TZYA 5BNXA 3AN2A 5JRGA 4KHAB 4J8UA 4E44A 3EG5B 3AYWA 1ZLAC 1P3LD 5DNNC 1P3KA 1S32C 3AZJA 5B1MA 3KUYA 3REID 1P3ID 3WTPB 3AYWB 3MGRD 3AZED 5B1MC 1M1AB 1P34A 5GT0B 1P3GD 1B6WA 3LELD 4J8WB 4NFTA 4J8VD 1P3PA 2F8ND 5KDMB 3W98B 3AZLC 1F66A 5AV6C 3W96D 5GXQD 3H0RC 1TZYC 4WU8B 2CWEA 4J8UD 1P3IB 2JSSA 4KGCD 3AZJB 4CSRB 2G5HC 3REHA 5G49A 3B0BA 5CP6C 1M19C 2Y2PA 3AN2C 3B6GA 3A6NC 5B2IB 3AL0C 1KU5A 5GSUC 3REJB 3VH5T 4KUDD 1KX3A 2ZY2A 1P3MB 2ZY4A 3LJAC 2JE5A 4YM6B 4H9QB 5GT3A 2PYOC 2CV5B 3B0CW 3KXBC 1P3PC 2F8NB 5C3IB 2Y2LA 2HIOA 3V9RB 3X1SC 4H9QA 3KWQC 4WU8D 1P3FB 2XD1A 4ZUXD 4WU9A 3LZ0D 1P3AB 4KUDB 3AZNC 3WKJA 1KX3B 5B31C 2NQBA 1P3OB 5GSUA 4WJ3C 2Y2OA 3A6NA 3MGQB 5CP6A 3AZGB 1A7WA 3X1UA 1P3MD 4DRBA 3UTAA 5CPKB 2FJ7B 2RVQC 3W97B 5B1MD 3KXBD 3X1UC 1P3FA 2Y2MA 5B0YB 1P3LA 2W8SA 3X1TC 2HUEC 2NZDB 3B6GB 1P3FD 3UTBB 1HQ3B 1M1AA 5B32B 3UT9B 3X1UD 4QLCC 4XZQD 1KX4C 2DF4C 5KDMA 3AYWC 1KX5A 2G5IC 4NE3A 4J8UC 5B0YA 5JRGC 5CPID 3WKJD 3MNNA 5AV9B 3KFUG 2Y2GA 2AROA 3H0LC 1AOIA 3TU4B 4ZUXA 5AVCC 4WU8A 5B40B 4WU8C 5DNMA 5AV8C 2YFVA 4ZUXC 4R8PB 4LD9A 4Z66D 3AZKD 2Y2QA 3B6FD 2Y2JA 3AZMC 1P3OA 1BFMA 3IP4C 4KGCC 3AV1A 3LJAD 3UT9D 1P3BA 3UTAB 3MGSC 3MGPD 1KX4A 4CAYB 4XZQB 5B1LA 4QLCA 5BO0A 1M1AD 2F8NK 4XUJD 5AY8B 5F99D 1P3GB 4J8WC 3LZ1B 4ZBJB 3B6FC 5AVBC 3REHD 2YFVB 5AY8A 3X1VC 1TZYB 2PYOB 3MVDD 3REJD 3O62D 5DNND 4XUJC 3KWQB 2ZY5A 3UTAD 2BYKA 1P3FC 1F66D 4R8PD 3REJA 1S32A 5CP6B 4UUZA 4JJNC 5F99B 3AZNB 3AV1C 3REKA 1EQZD 1P3GA 1TAFA 4G92B 2RVQD 3AZMA 1P3OC 2YFWB 1KX5B 5F99A 4H9PB 4EO5C 4WU9D 1P3KD 3W98A 1F66B 3AZHD 4LD9B 3AZFA 5CPIC 5JRGD 4Z66A 3AZKA 3X1TB 5CPJC 1P34B 2HUEB 4H9NB 2NZDC 1P3AC 2IO5B 4M6BA 3FDDA 3REIB 1H3OB 4J8XA 3VH5A 3MGPA 1KX4D 5E5AC 5GXQB 2YFWA 3LJAA 3RELC 1KX3D 5BT1D 1P3OD 3MNND 3AFAB 3MGQC 5B0YD 1ZLAB 2F8NH 4LD9D 2NZDD 1KX5D 4AWLC 3EPHA 4KGCA 4WV4B 5B1MB 2Y2HA 3TU4C 3AZHB 2BG1A 3KSYA 1P3PD 3W98C 5B2JB 4XZQA 5BO0B 2AROC 3AZLD 3C1BC 1ULYA 3W96C 1P3BB 4YM6D 1W2EA 1BH8A 4J8UB 3AZMD 3WA9A 5GSUB 1N1JA 3REJC 5FUGA 5B31B 3WKJB 2VQRA 3X1SA 5B40A 3B6FB 4R8PA 1S32D 3KXBA 3AZGC 5B40C 3AV2D 3MGQD 4YM6C 4J8XB 5CPKC 3KXBB 5AY8D 5C3IC 3A1IA 4XUJB 4J8WA 1M18C 1Q9CA 5GSUD 1BH8B 1M19A 3B6GC 4XZQC 4QLCD 3W97D 4HGAB 3LZ0A 3W99C 4YS3B 3UTBC 3UT9A 1HQ3C 3AV1D 4KUDA 4JJNA 4EO5B 5B33B 3X1VB 4KHAA 5B31D 4CSRA 3REHB 3NQJA 3AZFD 1F66C 2Y2NA 3MGQA 3AZHA 4WU9C 3W97C 5CPIB 2JCHA 3W98D 3W99D 3X1UB 2HIOC 5AV9C 1BH9B 3W97A 3TU4D 5B0ZD 1AOIB 3AV1B 4Z5TA 5AVCB 4G92C 3AZFC 3WA9B 4J8VA 3NQUA 3AFAC 1ZLAA 5B33A 3MGPC 1P34D 3UT9C 1P3AA 3MGRA 3LZ0C 3AZEA 3EPLA 3C1CA 3C1BA 4H9SC 3AV2A 1KX4B 1P3IA 2J8PA 4KGCB 2ZY3A 3C1CC 1B67A 3MGSB 3X1SD 5CPJB 4UPKA 5JRGB 2IO5C 3R45B 3WA9D 5B2IA 4WZSB 3LZ1C 3F6TA 4YM6A 5AVBB 1TZYD 2L5AA 3RELB 1F1EA 1P3MA 2AROB 4R8PC 4ZUXB 2DQNC 1JFIB 3AYWD 5CP6D 3B6FA 3A6ND 3AZNA 4JJNB 4UUZB 5FUGB 5B2JD 5B24A 5GT0A 3B0DB 5AY8C 2LY8A 1WWIA 3AZIA 5B32A 2FJ7D 4H9NA 2AROD 5GT0D 1PZRA 1EQZB 5GT3D 3LZ1A 4X23A 3W96B 3B0CT 5E5AD 5CPKA 1P3KB 3AV2B 3REIC 5F99C 3KUYB 4YS3A 4HGAC 5JA4A 5GXQC 4NE6A 3WKJC 1M18A 3AFAD 5B2ID 4WNNB 1KX5C 5B33C 2CV5D 1HQ3D 4J8VC 4DRAA 5AV5B 1ID3C 4J8XC 2BYMA 4AWLB 3VH6T 3WAAB 3C1CD 5GT3C 3MNNB 2HIOB 3V9RA 1P34C 3LELB 5B33D 3REKD 3AZHC 4Z66B 5G49B 3AZKB 1P3LC 3AZFB 5DNMB 2NQBD 5E5AB 1U35A 4H9OA 5B1LC 3MGSA 3TU4A 3KUYD 3REIA 3O62A 3AZIB 3C1BB 4H9RA 3REHC 4H9OB 2HIOD 3AFAA 5GT0C 1M18D 2Y2IA 5B31A 2NQBC 5AV5D 5BNVB 4XUJA 3MVDB 1JFIA 5BNXB 1P3BD 1AOIC 2FFFB 1R4VA 3RELA 1U35B 4X23D 5B2JC 4H9RB 4G91B 2PYOD 1S32B 4J8WD 1M18B 3P5JB 3WTPA 3AN2B 5B2IC 1P3BC 1M1AC 3B0DC 3MGSD 5GXQA 4YS3C 5CPIA 1U35D 3O62C 4X23B 2F8NA 3VH6W 3LELA 5BS7A 3NQJB 3MGRC 3AZEC 3X1VD 3VH6A 5AV9D 5AVBD 4Z5TB 5AVCA 3EPKA 4WU9B 3H0MC 3AZJD 5AV6D 5B0ZB 2RIQA 5B24B 3REKC 1H3OA 2Y2KA 3A6NB 3REKB 3X1TD 1Z2CB 3WA9C 5AV6A 3W99B 2XD5A 3WTPE 3MGPB 5DNNB 5BNVA 3KWQA 3LZ0B 1P3AD 1ID3B 5AVCD 1EQZC 2CV5C 3WTPD 5AVBA 1ZLAD 5GT3B 2NZDA 3X1SB 5CPJD 3VH5W 2UWXA 1N1JB 4Z5TD 1P3KC 4DQYB 4H9PA 5AV8A 5DNMC 3RELD 3AZLB 1KX3C 1T3UA 5AV6B 3AZMB 3W99A 5B32C 1ID3D 3AZIC 5AV5A 1P3IC 4J8VB 2F2AC 3NQUB 3AZGA 4JJND 2FJ7C 4NE5A 2NQBB 3WTPC 3C1CB 5CHLB 1M19D 1P3MC 3B6GD 1EQZA 5CPJA 5B32G 4Z2MG 4G91C 1BH9A 3A1KA 4QLCB 3AZJC 4CAYA 3C1BD 3W96A 5DNNA 3UTAC 4KUDC 1M19B 4H9SA 5B40D 3MVDA 1HQ3A 3AV2C 3X1TA 1P3GC 5JA4B 3MVDC 4X23C 4YS3D 1U35C 5B0ZA 5B1LD 3LJAB 5AV8B 4E45A 4Z5TC 3AZLA 5CPKD 5BS7C 1WWSA 2ZM5A 1P3PB 5AV9A 2CV5A 3X1VA 3MNNC 1TAFB 3AZGD 3LZ1D 5B24C 5B0YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 G;  3R45 A;  3AN2 D;  1ID3 A;  5DNM D;  4Z66 C;  3KUY C;  3AZK C;  1P3L B;  2F8N G;  3WAA D;  3O62 B;  1HTA A;  5B1L B;  5E5A A;  4Z2M H;  5AV8 D;  4ZBJ C;  1AOI D;  3UTB A;  3MGR B;  3AZE B;  2PYO A;  5B2J A;  3AZN D;  5AV5 C;  3UTB D;  4WNN A;  4LD9 C;  3WAA C;  2BYK B;  5B32 D;  2FJ7 A;  3AZI D;  3KWQ D;  5B0Z C;  2BYM B;  5BT1 C;  4J8X D;  3WAA A;  5B24 D;  3LEL C;  1TZY A;  5BNX A;  3AN2 A;  5JRG A;  4KHA B;  4J8U A;  4E44 A;  3AYW A;  1ZLA C;  1P3L D;  5DNN C;  1P3K A;  1S32 C;  3AZJ A;  5B1M A;  3KUY A;  3REI D;  1P3I D;  3WTP B;  3AYW B;  3MGR D;  3AZE D;  5B1M C;  1M1A B;  1P34 A;  5GT0 B;  1P3G D;  1B6W A;  3LEL D;  4J8W B;  4NFT A;  4J8V D;  1P3P A;  2F8N D;  5KDM B;  3W98 B;  3AZL C;  1F66 A;  5AV6 C;  3W96 D;  5GXQ D;  1TZY C;  4WU8 B;  2CWE A;  4J8U D;  1P3I B;  2JSS A;  4KGC D;  3AZJ B;  4CSR B;  3REH A;  5G49 A;  3B0B A;  5CP6 C;  1M19 C;  3B6G A;  3AN2 C;  3A6N C;  5B2I B;  1KU5 A;  5GSU C;  3REJ B;  3VH5 T;  4KUD D;  1KX3 A;  1P3M B;  3LJA C;  4YM6 B;  4H9Q B;  5GT3 A;  2PYO C;  2CV5 B;  3B0C W;  3KXB C;  1P3P C;  2F8N B;  5C3I B;  2HIO A;  3V9R B;  3X1S C;  4H9Q A;  3KWQ C;  4WU8 D;  1P3F B;  4ZUX D;  4WU9 A;  3LZ0 D;  1P3A B;  4KUD B;  3AZN C;  3WKJ A;  1KX3 B;  5B31 C;  2NQB A;  1P3O B;  5GSU A;  3A6N A;  3MGQ B;  5CP6 A;  3AZG B;  1A7W A;  3X1U A;  1P3M D;  4DRB A;  3UTA A;  5CPK B;  2FJ7 B;  2RVQ C;  3W97 B;  5B1M D;  3KXB D;  3X1U C;  1P3F A;  5B0Y B;  1P3L A;  3X1T C;  2HUE C;  2NZD B;  3B6G B;  1P3F D;  3UTB B;  1HQ3 B;  1M1A A;  5B32 B;  3UT9 B;  3X1U D;  4QLC C;  4XZQ D;  1KX4 C;  5KDM A;  3AYW C;  1KX5 A;  4NE3 A;  4J8U C;  5B0Y A;  5JRG C;  5CPI D;  3WKJ D;  3MNN A;  5AV9 B;  2ARO A;  1AOI A;  3TU4 B;  4ZUX A;  5AVC C;  4WU8 A;  5B40 B;  4WU8 C;  5DNM A;  5AV8 C;  2YFV A;  4ZUX C;  4R8P B;  4LD9 A;  4Z66 D;  3AZK D;  3B6F D;  3AZM C;  1P3O A;  1BFM A;  4KGC C;  3AV1 A;  3LJA D;  3UT9 D;  1P3B A;  3UTA B;  3MGS C;  3MGP D;  1KX4 A;  4CAY B;  4XZQ B;  5B1L A;  4QLC A;  5BO0 A;  1M1A D;  2F8N K;  4XUJ D;  5AY8 B;  5F99 D;  1P3G B;  4J8W C;  3LZ1 B;  4ZBJ B;  3B6F C;  5AVB C;  3REH D;  2YFV B;  5AY8 A;  3X1V C;  1TZY B;  2PYO B;  3MVD D;  3REJ D;  3O62 D;  5DNN D;  4XUJ C;  3KWQ B;  3UTA D;  1P3F C;  2BYK A;  1F66 D;  4R8P D;  3REJ A;  1S32 A;  5CP6 B;  4UUZ A;  4JJN C;  5F99 B;  3AZN B;  3AV1 C;  3REK A;  1EQZ D;  1P3G A;  1TAF A;  4G92 B;  2RVQ D;  3AZM A;  1P3O C;  2YFW B;  1KX5 B;  5F99 A;  4H9P B;  4EO5 C;  4WU9 D;  1P3K D;  3W98 A;  1F66 B;  3AZH D;  4LD9 B;  3AZF A;  5CPI C;  5JRG D;  4Z66 A;  3AZK A;  3X1T B;  5CPJ C;  1P34 B;  2HUE B;  4H9N B;  2NZD C;  1P3A C;  2IO5 B;  4M6B A;  3REI B;  1H3O B;  4J8X A;  3VH5 A;  3MGP A;  1KX4 D;  5E5A C;  5GXQ B;  2YFW A;  3LJA A;  3REL C;  1KX3 D;  5BT1 D;  1P3O D;  3MNN D;  3AFA B;  3MGQ C;  5B0Y D;  1ZLA B;  2F8N H;  4LD9 D;  2NZD D;  1KX5 D;  4AWL C;  4KGC A;  4WV4 B;  5B1M B;  3TU4 C;  3AZH B;  3KSY A;  1P3P D;  3W98 C;  5B2J B;  4XZQ A;  5BO0 B;  2ARO C;  3AZL D;  3C1B C;  1ULY A;  3W96 C;  1P3B B;  4YM6 D;  1BH8 A;  4J8U B;  3AZM D;  3WA9 A;  5GSU B;  1N1J A;  3REJ C;  5FUG A;  5B31 B;  3WKJ B;  3X1S A;  5B40 A;  3B6F B;  4R8P A;  1S32 D;  3KXB A;  3AZG C;  5B40 C;  3AV2 D;  3MGQ D;  4YM6 C;  4J8X B;  5CPK C;  3KXB B;  5AY8 D;  5C3I C;  4XUJ B;  4J8W A;  1M18 C;  1Q9C A;  5GSU D;  1BH8 B;  1M19 A;  3B6G C;  4XZQ C;  4QLC D;  3W97 D;  4HGA B;  3LZ0 A;  3W99 C;  4YS3 B;  3UTB C;  3UT9 A;  1HQ3 C;  3AV1 D;  4KUD A;  4JJN A;  4EO5 B;  5B33 B;  3X1V B;  4KHA A;  5B31 D;  4CSR A;  3REH B;  3NQJ A;  3AZF D;  1F66 C;  3MGQ A;  3AZH A;  4WU9 C;  3W97 C;  5CPI B;  3W98 D;  3W99 D;  3X1U B;  2HIO C;  5AV9 C;  1BH9 B;  3W97 A;  3TU4 D;  5B0Z D;  1AOI B;  3AV1 B;  4Z5T A;  5AVC B;  4G92 C;  3AZF C;  3WA9 B;  4J8V A;  3NQU A;  3AFA C;  1ZLA A;  5B33 A;  3MGP C;  1P34 D;  3UT9 C;  1P3A A;  3MGR A;  3LZ0 C;  3AZE A;  3C1C A;  3C1B A;  4H9S C;  3AV2 A;  1KX4 B;  1P3I A;  4KGC B;  3C1C C;  1B67 A;  3MGS B;  3X1S D;  5CPJ B;  5JRG B;  2IO5 C;  3R45 B;  3WA9 D;  5B2I A;  4WZS B;  3LZ1 C;  4YM6 A;  5AVB B;  1TZY D;  2L5A A;  3REL B;  1F1E A;  1P3M A;  2ARO B;  4R8P C;  4ZUX B;  1JFI B;  3AYW D;  5CP6 D;  3B6F A;  3A6N D;  3AZN A;  4JJN B;  4UUZ B;  5FUG B;  5B2J D;  5B24 A;  5GT0 A;  3B0D B;  5AY8 C;  2LY8 A;  1WWI A;  3AZI A;  5B32 A;  2FJ7 D;  4H9N A;  2ARO D;  5GT0 D;  1EQZ B;  5GT3 D;  3LZ1 A;  4X23 A;  3W96 B;  3B0C T;  5E5A D;  5CPK A;  1P3K B;  3AV2 B;  3REI C;  5F99 C;  3KUY B;  4YS3 A;  4HGA C;  5JA4 A;  5GXQ C;  4NE6 A;  3WKJ C;  1M18 A;  3AFA D;  5B2I D;  4WNN B;  1KX5 C;  5B33 C;  2CV5 D;  1HQ3 D;  4J8V C;  4DRA A;  5AV5 B;  1ID3 C;  4J8X C;  2BYM A;  4AWL B;  3VH6 T;  3WAA B;  3C1C D;  5GT3 C;  3MNN B;  2HIO B;  3V9R A;  1P34 C;  3LEL B;  5B33 D;  3REK D;  3AZH C;  4Z66 B;  5G49 B;  3AZK B;  1P3L C;  3AZF B;  5DNM B;  2NQB D;  5E5A B;  1U35 A;  4H9O A;  5B1L C;  3MGS A;  3TU4 A;  3KUY D;  3REI A;  3O62 A;  3AZI B;  3C1B B;  4H9R A;  3REH C;  4H9O B;  2HIO D;  3AFA A;  5GT0 C;  1M18 D;  5B31 A;  2NQB C;  5AV5 D;  5BNV B;  4XUJ A;  3MVD B;  1JFI A;  5BNX B;  1P3B D;  1AOI C;  1R4V A;  3REL A;  1U35 B;  4X23 D;  5B2J C;  4H9R B;  4G91 B;  2PYO D;  1S32 B;  4J8W D;  1M18 B;  3WTP A;  3AN2 B;  5B2I C;  1P3B C;  1M1A C;  3B0D C;  3MGS D;  5GXQ A;  4YS3 C;  5CPI A;  1U35 D;  3O62 C;  4X23 B;  2F8N A;  3VH6 W;  3LEL A;  5BS7 A;  3NQJ B;  3MGR C;  3AZE C;  3X1V D;  3VH6 A;  5AV9 D;  5AVB D;  4Z5T B;  5AVC A;  4WU9 B;  3AZJ D;  5AV6 D;  5B0Z B;  5B24 B;  3REK C;  1H3O A;  3A6N B;  3REK B;  3X1T D;  3WA9 C;  5AV6 A;  3W99 B;  3WTP E;  3MGP B;  5DNN B;  5BNV A;  3KWQ A;  3LZ0 B;  1P3A D;  1ID3 B;  5AVC D;  1EQZ C;  2CV5 C;  3WTP D;  5AVB A;  1ZLA D;  5GT3 B;  2NZD A;  5CPJ D;  3X1S B;  3VH5 W;  1N1J B;  4Z5T D;  1P3K C;  4H9P A;  5DNM C;  5AV8 A;  3REL D;  3AZL B;  1KX3 C;  5AV6 B;  3AZM B;  3W99 A;  5B32 C;  1ID3 D;  3AZI C;  5AV5 A;  1P3I C;  4J8V B;  3NQU B;  3AZG A;  4JJN D;  2FJ7 C;  4NE5 A;  2NQB B;  3WTP C;  3C1C B;  5CHL B;  1M19 D;  1P3M C;  3B6G D;  1EQZ A;  5CPJ A;  5B32 G;  4Z2M G;  4G91 C;  1BH9 A;  4QLC B;  3AZJ C;  4CAY A;  3C1B D;  3W96 A;  5DNN A;  3UTA C;  4KUD C;  1M19 B;  4H9S A;  5B40 D;  3MVD A;  1HQ3 A;  3AV2 C;  3X1T A;  1P3G C;  5JA4 B;  3MVD C;  4X23 C;  4YS3 D;  1U35 C;  5B0Z A;  5B1L D;  3LJA B;  5AV8 B;  4E45 A;  4Z5T C;  3AZL A;  5CPK D;  5BS7 C;  1WWS A;  1P3P B;  5AV9 A;  2CV5 A;  3X1V A;  3MNN C;  1TAF B;  3AZG D;  3LZ1 D;  5B24 C;  5B0Y C; 
#chains in the Genus database with same CATH topology
 5B31 G;  3R45 A;  3AN2 D;  1ID3 A;  5DNM D;  4Z66 C;  3KUY C;  3AZK C;  1P3L B;  2F8N G;  3WAA D;  3O62 B;  1HTA A;  5B1L B;  5E5A A;  4Z2M H;  5AV8 D;  4ZBJ C;  1AOI D;  3UTB A;  3MGR B;  3AZE B;  2PYO A;  5B2J A;  3AZN D;  5AV5 C;  3EPJ A;  4WNN A;  3UTB D;  4LD9 C;  3WAA C;  2BYK B;  5B32 D;  2FJ7 A;  3AZI D;  3KWQ D;  5B0Z C;  2BYM B;  5BT1 C;  4J8X D;  3WAA A;  5B24 D;  3LEL C;  1TZY A;  5BNX A;  3AN2 A;  5JRG A;  4KHA B;  4J8U A;  4E44 A;  3EG5 B;  3AYW A;  1ZLA C;  1P3L D;  5DNN C;  1P3K A;  1S32 C;  3AZJ A;  5B1M A;  3KUY A;  3REI D;  1P3I D;  3WTP B;  3AYW B;  3MGR D;  3AZE D;  5B1M C;  1M1A B;  1P34 A;  5GT0 B;  1P3G D;  1B6W A;  3LEL D;  4J8W B;  4NFT A;  4J8V D;  1P3P A;  2F8N D;  5KDM B;  3W98 B;  3AZL C;  1F66 A;  5AV6 C;  3W96 D;  5GXQ D;  3H0R C;  1TZY C;  4WU8 B;  2CWE A;  4J8U D;  1P3I B;  2JSS A;  4KGC D;  3AZJ B;  4CSR B;  2G5H C;  3REH A;  5G49 A;  3B0B A;  5CP6 C;  1M19 C;  2Y2P A;  3AN2 C;  3B6G A;  3A6N C;  5B2I B;  3AL0 C;  1KU5 A;  5GSU C;  3REJ B;  3VH5 T;  4KUD D;  1KX3 A;  2ZY2 A;  1P3M B;  2ZY4 A;  3LJA C;  2JE5 A;  4YM6 B;  4H9Q B;  5GT3 A;  2PYO C;  2CV5 B;  3B0C W;  3KXB C;  1P3P C;  2F8N B;  5C3I B;  2Y2L A;  2HIO A;  3V9R B;  3X1S C;  4H9Q A;  3KWQ C;  4WU8 D;  1P3F B;  2XD1 A;  4ZUX D;  4WU9 A;  3LZ0 D;  1P3A B;  4KUD B;  3AZN C;  3WKJ A;  1KX3 B;  5B31 C;  2NQB A;  1P3O B;  5GSU A;  4WJ3 C;  2Y2O A;  3A6N A;  3MGQ B;  5CP6 A;  3AZG B;  1A7W A;  3X1U A;  1P3M D;  4DRB A;  3UTA A;  5CPK B;  2FJ7 B;  2RVQ C;  3W97 B;  5B1M D;  3KXB D;  3X1U C;  1P3F A;  2Y2M A;  5B0Y B;  1P3L A;  2W8S A;  3X1T C;  2HUE C;  2NZD B;  3B6G B;  1P3F D;  3UTB B;  1HQ3 B;  1M1A A;  5B32 B;  3UT9 B;  3X1U D;  4QLC C;  4XZQ D;  1KX4 C;  2DF4 C;  5KDM A;  3AYW C;  1KX5 A;  2G5I C;  4NE3 A;  4J8U C;  5B0Y A;  5JRG C;  5CPI D;  3WKJ D;  3MNN A;  5AV9 B;  3KFU G;  2Y2G A;  2ARO A;  3H0L C;  1AOI A;  3TU4 B;  4ZUX A;  5AVC C;  4WU8 A;  5B40 B;  4WU8 C;  5DNM A;  5AV8 C;  2YFV A;  4ZUX C;  4R8P B;  4LD9 A;  4Z66 D;  3AZK D;  2Y2Q A;  3B6F D;  2Y2J A;  3AZM C;  1P3O A;  1BFM A;  3IP4 C;  4KGC C;  3AV1 A;  3LJA D;  3UT9 D;  1P3B A;  3UTA B;  3MGS C;  3MGP D;  1KX4 A;  4CAY B;  4XZQ B;  5B1L A;  4QLC A;  5BO0 A;  1M1A D;  2F8N K;  4XUJ D;  5AY8 B;  5F99 D;  1P3G B;  4J8W C;  3LZ1 B;  4ZBJ B;  3B6F C;  5AVB C;  3REH D;  2YFV B;  5AY8 A;  3X1V C;  1TZY B;  2PYO B;  3MVD D;  3REJ D;  3O62 D;  5DNN D;  4XUJ C;  3KWQ B;  2ZY5 A;  3UTA D;  2BYK A;  1P3F C;  1F66 D;  4R8P D;  3REJ A;  1S32 A;  5CP6 B;  4UUZ A;  4JJN C;  5F99 B;  3AZN B;  3AV1 C;  3REK A;  1EQZ D;  1P3G A;  1TAF A;  4G92 B;  2RVQ D;  3AZM A;  1P3O C;  2YFW B;  1KX5 B;  5F99 A;  4H9P B;  4EO5 C;  4WU9 D;  1P3K D;  3W98 A;  1F66 B;  3AZH D;  4LD9 B;  3AZF A;  5CPI C;  5JRG D;  4Z66 A;  3AZK A;  3X1T B;  5CPJ C;  1P34 B;  2HUE B;  4H9N B;  2NZD C;  1P3A C;  2IO5 B;  4M6B A;  3FDD A;  3REI B;  1H3O B;  4J8X A;  3VH5 A;  3MGP A;  1KX4 D;  5E5A C;  5GXQ B;  2YFW A;  3LJA A;  3REL C;  1KX3 D;  5BT1 D;  1P3O D;  3MNN D;  3AFA B;  3MGQ C;  5B0Y D;  1ZLA B;  2F8N H;  4LD9 D;  2NZD D;  1KX5 D;  4AWL C;  3EPH A;  4KGC A;  4WV4 B;  5B1M B;  2Y2H A;  3TU4 C;  3AZH B;  2BG1 A;  3KSY A;  1P3P D;  3W98 C;  5B2J B;  4XZQ A;  5BO0 B;  2ARO C;  3AZL D;  3C1B C;  1ULY A;  3W96 C;  1P3B B;  4YM6 D;  1W2E A;  1BH8 A;  4J8U B;  3AZM D;  3WA9 A;  5GSU B;  1N1J A;  3REJ C;  5FUG A;  5B31 B;  3WKJ B;  2VQR A;  3X1S A;  5B40 A;  3B6F B;  4R8P A;  1S32 D;  3KXB A;  3AZG C;  5B40 C;  3AV2 D;  3MGQ D;  4YM6 C;  4J8X B;  5CPK C;  3KXB B;  5AY8 D;  5C3I C;  3A1I A;  4XUJ B;  4J8W A;  1M18 C;  1Q9C A;  5GSU D;  1BH8 B;  1M19 A;  3B6G C;  4XZQ C;  4QLC D;  3W97 D;  4HGA B;  3LZ0 A;  3W99 C;  4YS3 B;  3UTB C;  3UT9 A;  1HQ3 C;  3AV1 D;  4KUD A;  4JJN A;  4EO5 B;  5B33 B;  3X1V B;  4KHA A;  5B31 D;  4CSR A;  3REH B;  3NQJ A;  3AZF D;  1F66 C;  2Y2N A;  3MGQ A;  3AZH A;  4WU9 C;  3W97 C;  5CPI B;  2JCH A;  3W98 D;  3W99 D;  3X1U B;  2HIO C;  5AV9 C;  1BH9 B;  3W97 A;  3TU4 D;  5B0Z D;  1AOI B;  3AV1 B;  4Z5T A;  5AVC B;  4G92 C;  3AZF C;  3WA9 B;  4J8V A;  3NQU A;  3AFA C;  1ZLA A;  5B33 A;  3MGP C;  1P34 D;  3UT9 C;  1P3A A;  3MGR A;  3LZ0 C;  3AZE A;  3EPL A;  3C1C A;  3C1B A;  4H9S C;  3AV2 A;  1KX4 B;  1P3I A;  2J8P A;  4KGC B;  2ZY3 A;  3C1C C;  1B67 A;  3MGS B;  3X1S D;  5CPJ B;  4UPK A;  5JRG B;  2IO5 C;  3R45 B;  3WA9 D;  5B2I A;  4WZS B;  3LZ1 C;  3F6T A;  4YM6 A;  5AVB B;  1TZY D;  2L5A A;  3REL B;  1F1E A;  1P3M A;  2ARO B;  4R8P C;  4ZUX B;  2DQN C;  1JFI B;  3AYW D;  5CP6 D;  3B6F A;  3A6N D;  3AZN A;  4JJN B;  4UUZ B;  5FUG B;  5B2J D;  5B24 A;  5GT0 A;  3B0D B;  5AY8 C;  2LY8 A;  1WWI A;  3AZI A;  5B32 A;  2FJ7 D;  4H9N A;  2ARO D;  5GT0 D;  1PZR A;  1EQZ B;  5GT3 D;  3LZ1 A;  4X23 A;  3W96 B;  3B0C T;  5E5A D;  5CPK A;  1P3K B;  3AV2 B;  3REI C;  5F99 C;  3KUY B;  4YS3 A;  4HGA C;  5JA4 A;  5GXQ C;  4NE6 A;  3WKJ C;  1M18 A;  3AFA D;  5B2I D;  4WNN B;  1KX5 C;  5B33 C;  2CV5 D;  1HQ3 D;  4J8V C;  4DRA A;  5AV5 B;  1ID3 C;  4J8X C;  2BYM A;  4AWL B;  3VH6 T;  3WAA B;  3C1C D;  5GT3 C;  3MNN B;  2HIO B;  3V9R A;  1P34 C;  3LEL B;  5B33 D;  3REK D;  3AZH C;  4Z66 B;  5G49 B;  3AZK B;  1P3L C;  3AZF B;  5DNM B;  2NQB D;  5E5A B;  1U35 A;  4H9O A;  5B1L C;  3MGS A;  3TU4 A;  3KUY D;  3REI A;  3O62 A;  3AZI B;  3C1B B;  4H9R A;  3REH C;  4H9O B;  2HIO D;  3AFA A;  5GT0 C;  1M18 D;  2Y2I A;  5B31 A;  2NQB C;  5AV5 D;  5BNV B;  4XUJ A;  3MVD B;  1JFI A;  5BNX B;  1P3B D;  1AOI C;  2FFF B;  1R4V A;  3REL A;  1U35 B;  4X23 D;  5B2J C;  4H9R B;  4G91 B;  2PYO D;  1S32 B;  4J8W D;  1M18 B;  3P5J B;  3WTP A;  3AN2 B;  5B2I C;  1P3B C;  1M1A C;  3B0D C;  3MGS D;  5GXQ A;  4YS3 C;  5CPI A;  1U35 D;  3O62 C;  4X23 B;  2F8N A;  3VH6 W;  3LEL A;  5BS7 A;  3NQJ B;  3MGR C;  3AZE C;  3X1V D;  3VH6 A;  5AV9 D;  5AVB D;  4Z5T B;  5AVC A;  3EPK A;  4WU9 B;  3H0M C;  3AZJ D;  5AV6 D;  5B0Z B;  2RIQ A;  5B24 B;  3REK C;  1H3O A;  2Y2K A;  3A6N B;  3REK B;  3X1T D;  1Z2C B;  3WA9 C;  5AV6 A;  3W99 B;  2XD5 A;  3WTP E;  3MGP B;  5DNN B;  5BNV A;  3KWQ A;  3LZ0 B;  1P3A D;  1ID3 B;  5AVC D;  1EQZ C;  2CV5 C;  3WTP D;  5AVB A;  1ZLA D;  5GT3 B;  2NZD A;  3X1S B;  5CPJ D;  3VH5 W;  2UWX A;  1N1J B;  4Z5T D;  1P3K C;  4DQY B;  4H9P A;  5AV8 A;  5DNM C;  3REL D;  3AZL B;  1KX3 C;  1T3U A;  5AV6 B;  3AZM B;  3W99 A;  5B32 C;  1ID3 D;  3AZI C;  5AV5 A;  1P3I C;  4J8V B;  2F2A C;  3NQU B;  3AZG A;  4JJN D;  2FJ7 C;  4NE5 A;  2NQB B;  3WTP C;  3C1C B;  5CHL B;  1M19 D;  1P3M C;  3B6G D;  1EQZ A;  5CPJ A;  5B32 G;  4Z2M G;  4G91 C;  1BH9 A;  3A1K A;  4QLC B;  3AZJ C;  4CAY A;  3C1B D;  3W96 A;  5DNN A;  3UTA C;  4KUD C;  1M19 B;  4H9S A;  5B40 D;  3MVD A;  1HQ3 A;  3AV2 C;  3X1T A;  1P3G C;  5JA4 B;  3MVD C;  4X23 C;  4YS3 D;  1U35 C;  5B0Z A;  5B1L D;  3LJA B;  5AV8 B;  4E45 A;  4Z5T C;  3AZL A;  5CPK D;  5BS7 C;  1WWS A;  2ZM5 A;  1P3P B;  5AV9 A;  2CV5 A;  3X1V A;  3MNN C;  1TAF B;  3AZG D;  3LZ1 D;  5B24 C;  5B0Y C; 
#chains in the Genus database with same CATH homology
 5B31 G;  3R45 A;  3AN2 D;  1ID3 A;  5DNM D;  4Z66 C;  3KUY C;  3AZK C;  1P3L B;  2F8N G;  3WAA D;  3O62 B;  1HTA A;  5B1L B;  5E5A A;  4Z2M H;  5AV8 D;  4ZBJ C;  1AOI D;  3UTB A;  3MGR B;  3AZE B;  2PYO A;  5B2J A;  3AZN D;  5AV5 C;  3EPJ A;  4WNN A;  3UTB D;  4LD9 C;  3WAA C;  2BYK B;  5B32 D;  2FJ7 A;  3AZI D;  3KWQ D;  5B0Z C;  2BYM B;  5BT1 C;  4J8X D;  3WAA A;  5B24 D;  3LEL C;  1TZY A;  5BNX A;  3AN2 A;  5JRG A;  4KHA B;  4J8U A;  4E44 A;  3EG5 B;  3AYW A;  1ZLA C;  1P3L D;  5DNN C;  1P3K A;  1S32 C;  3AZJ A;  5B1M A;  3KUY A;  3REI D;  1P3I D;  3WTP B;  3AYW B;  3MGR D;  3AZE D;  5B1M C;  1M1A B;  1P34 A;  5GT0 B;  1P3G D;  1B6W A;  3LEL D;  4J8W B;  4NFT A;  4J8V D;  1P3P A;  2F8N D;  5KDM B;  3W98 B;  3AZL C;  1F66 A;  5AV6 C;  3W96 D;  5GXQ D;  3H0R C;  1TZY C;  4WU8 B;  2CWE A;  4J8U D;  1P3I B;  2JSS A;  4KGC D;  3AZJ B;  4CSR B;  2G5H C;  3REH A;  5G49 A;  3B0B A;  5CP6 C;  1M19 C;  2Y2P A;  3AN2 C;  3B6G A;  3A6N C;  5B2I B;  3AL0 C;  1KU5 A;  5GSU C;  3REJ B;  3VH5 T;  4KUD D;  1KX3 A;  2ZY2 A;  1P3M B;  2ZY4 A;  3LJA C;  2JE5 A;  4YM6 B;  4H9Q B;  5GT3 A;  2PYO C;  2CV5 B;  3B0C W;  3KXB C;  1P3P C;  2F8N B;  5C3I B;  2Y2L A;  2HIO A;  3V9R B;  3X1S C;  4H9Q A;  3KWQ C;  4WU8 D;  1P3F B;  2XD1 A;  4ZUX D;  4WU9 A;  3LZ0 D;  1P3A B;  4KUD B;  3AZN C;  3WKJ A;  1KX3 B;  5B31 C;  2NQB A;  1P3O B;  5GSU A;  4WJ3 C;  2Y2O A;  3A6N A;  3MGQ B;  5CP6 A;  3AZG B;  1A7W A;  3X1U A;  1P3M D;  4DRB A;  3UTA A;  5CPK B;  2FJ7 B;  2RVQ C;  3W97 B;  5B1M D;  3KXB D;  3X1U C;  1P3F A;  2Y2M A;  5B0Y B;  1P3L A;  2W8S A;  3X1T C;  2HUE C;  2NZD B;  3B6G B;  1P3F D;  3UTB B;  1HQ3 B;  1M1A A;  5B32 B;  3UT9 B;  3X1U D;  4QLC C;  4XZQ D;  1KX4 C;  2DF4 C;  5KDM A;  3AYW C;  1KX5 A;  2G5I C;  4NE3 A;  4J8U C;  5B0Y A;  5JRG C;  5CPI D;  3WKJ D;  3MNN A;  5AV9 B;  3KFU G;  2Y2G A;  2ARO A;  3H0L C;  1AOI A;  3TU4 B;  4ZUX A;  5AVC C;  4WU8 A;  5B40 B;  4WU8 C;  5DNM A;  5AV8 C;  2YFV A;  4ZUX C;  4R8P B;  4LD9 A;  4Z66 D;  3AZK D;  2Y2Q A;  3B6F D;  2Y2J A;  3AZM C;  1P3O A;  1BFM A;  3IP4 C;  4KGC C;  3AV1 A;  3LJA D;  3UT9 D;  1P3B A;  3UTA B;  3MGS C;  3MGP D;  1KX4 A;  4CAY B;  4XZQ B;  5B1L A;  4QLC A;  5BO0 A;  1M1A D;  2F8N K;  4XUJ D;  5AY8 B;  5F99 D;  1P3G B;  4J8W C;  3LZ1 B;  4ZBJ B;  3B6F C;  5AVB C;  3REH D;  2YFV B;  5AY8 A;  3X1V C;  1TZY B;  2PYO B;  3MVD D;  3REJ D;  3O62 D;  5DNN D;  4XUJ C;  3KWQ B;  2ZY5 A;  3UTA D;  2BYK A;  1P3F C;  1F66 D;  4R8P D;  3REJ A;  1S32 A;  5CP6 B;  4UUZ A;  4JJN C;  5F99 B;  3AZN B;  3AV1 C;  3REK A;  1EQZ D;  1P3G A;  1TAF A;  4G92 B;  2RVQ D;  3AZM A;  1P3O C;  2YFW B;  1KX5 B;  5F99 A;  4H9P B;  4EO5 C;  4WU9 D;  1P3K D;  3W98 A;  1F66 B;  3AZH D;  4LD9 B;  3AZF A;  5CPI C;  5JRG D;  4Z66 A;  3AZK A;  3X1T B;  5CPJ C;  1P34 B;  2HUE B;  4H9N B;  2NZD C;  1P3A C;  2IO5 B;  4M6B A;  3FDD A;  3REI B;  1H3O B;  4J8X A;  3VH5 A;  3MGP A;  1KX4 D;  5E5A C;  5GXQ B;  2YFW A;  3LJA A;  3REL C;  1KX3 D;  5BT1 D;  1P3O D;  3MNN D;  3AFA B;  3MGQ C;  5B0Y D;  1ZLA B;  2F8N H;  4LD9 D;  2NZD D;  1KX5 D;  4AWL C;  3EPH A;  4KGC A;  4WV4 B;  5B1M B;  2Y2H A;  3TU4 C;  3AZH B;  2BG1 A;  3KSY A;  1P3P D;  3W98 C;  5B2J B;  4XZQ A;  5BO0 B;  2ARO C;  3AZL D;  3C1B C;  1ULY A;  3W96 C;  1P3B B;  4YM6 D;  1W2E A;  1BH8 A;  4J8U B;  3AZM D;  3WA9 A;  5GSU B;  1N1J A;  3REJ C;  5FUG A;  5B31 B;  3WKJ B;  2VQR A;  3X1S A;  5B40 A;  3B6F B;  4R8P A;  1S32 D;  3KXB A;  3AZG C;  5B40 C;  3AV2 D;  3MGQ D;  4YM6 C;  4J8X B;  5CPK C;  3KXB B;  5AY8 D;  5C3I C;  3A1I A;  4XUJ B;  4J8W A;  1M18 C;  1Q9C A;  5GSU D;  1BH8 B;  1M19 A;  3B6G C;  4XZQ C;  4QLC D;  3W97 D;  4HGA B;  3LZ0 A;  3W99 C;  4YS3 B;  3UTB C;  3UT9 A;  1HQ3 C;  3AV1 D;  4KUD A;  4JJN A;  4EO5 B;  5B33 B;  3X1V B;  4KHA A;  5B31 D;  4CSR A;  3REH B;  3NQJ A;  3AZF D;  1F66 C;  2Y2N A;  3MGQ A;  3AZH A;  4WU9 C;  3W97 C;  5CPI B;  2JCH A;  3W98 D;  3W99 D;  3X1U B;  2HIO C;  5AV9 C;  1BH9 B;  3W97 A;  3TU4 D;  5B0Z D;  1AOI B;  3AV1 B;  4Z5T A;  5AVC B;  4G92 C;  3AZF C;  3WA9 B;  4J8V A;  3NQU A;  3AFA C;  1ZLA A;  5B33 A;  3MGP C;  1P34 D;  3UT9 C;  1P3A A;  3MGR A;  3LZ0 C;  3AZE A;  3EPL A;  3C1C A;  3C1B A;  4H9S C;  3AV2 A;  1KX4 B;  1P3I A;  2J8P A;  4KGC B;  2ZY3 A;  3C1C C;  1B67 A;  3MGS B;  3X1S D;  5CPJ B;  4UPK A;  5JRG B;  2IO5 C;  3R45 B;  3WA9 D;  5B2I A;  4WZS B;  3LZ1 C;  3F6T A;  4YM6 A;  5AVB B;  1TZY D;  2L5A A;  3REL B;  1F1E A;  1P3M A;  2ARO B;  4R8P C;  4ZUX B;  2DQN C;  1JFI B;  3AYW D;  5CP6 D;  3B6F A;  3A6N D;  3AZN A;  4JJN B;  4UUZ B;  5FUG B;  5B2J D;  5B24 A;  5GT0 A;  3B0D B;  5AY8 C;  2LY8 A;  1WWI A;  3AZI A;  5B32 A;  2FJ7 D;  4H9N A;  2ARO D;  5GT0 D;  1PZR A;  1EQZ B;  5GT3 D;  3LZ1 A;  4X23 A;  3W96 B;  3B0C T;  5E5A D;  5CPK A;  1P3K B;  3AV2 B;  3REI C;  5F99 C;  3KUY B;  4YS3 A;  4HGA C;  5JA4 A;  5GXQ C;  4NE6 A;  3WKJ C;  1M18 A;  3AFA D;  5B2I D;  4WNN B;  1KX5 C;  5B33 C;  2CV5 D;  1HQ3 D;  4J8V C;  4DRA A;  5AV5 B;  1ID3 C;  4J8X C;  2BYM A;  4AWL B;  3VH6 T;  3WAA B;  3C1C D;  5GT3 C;  3MNN B;  2HIO B;  3V9R A;  1P34 C;  3LEL B;  5B33 D;  3REK D;  3AZH C;  4Z66 B;  5G49 B;  3AZK B;  1P3L C;  3AZF B;  5DNM B;  2NQB D;  5E5A B;  1U35 A;  4H9O A;  5B1L C;  3MGS A;  3TU4 A;  3KUY D;  3REI A;  3O62 A;  3AZI B;  3C1B B;  4H9R A;  3REH C;  4H9O B;  2HIO D;  3AFA A;  5GT0 C;  1M18 D;  2Y2I A;  5B31 A;  2NQB C;  5AV5 D;  5BNV B;  4XUJ A;  3MVD B;  1JFI A;  5BNX B;  1P3B D;  1AOI C;  2FFF B;  1R4V A;  3REL A;  1U35 B;  4X23 D;  5B2J C;  4H9R B;  4G91 B;  2PYO D;  1S32 B;  4J8W D;  1M18 B;  3P5J B;  3WTP A;  3AN2 B;  5B2I C;  1P3B C;  1M1A C;  3B0D C;  3MGS D;  5GXQ A;  4YS3 C;  5CPI A;  1U35 D;  3O62 C;  4X23 B;  2F8N A;  3VH6 W;  3LEL A;  5BS7 A;  3NQJ B;  3MGR C;  3AZE C;  3X1V D;  3VH6 A;  5AV9 D;  5AVB D;  4Z5T B;  5AVC A;  3EPK A;  4WU9 B;  3H0M C;  3AZJ D;  5AV6 D;  5B0Z B;  2RIQ A;  5B24 B;  3REK C;  1H3O A;  2Y2K A;  3A6N B;  3REK B;  3X1T D;  1Z2C B;  3WA9 C;  5AV6 A;  3W99 B;  2XD5 A;  3WTP E;  3MGP B;  5DNN B;  5BNV A;  3KWQ A;  3LZ0 B;  1P3A D;  1ID3 B;  5AVC D;  1EQZ C;  2CV5 C;  3WTP D;  5AVB A;  1ZLA D;  5GT3 B;  2NZD A;  3X1S B;  5CPJ D;  3VH5 W;  2UWX A;  1N1J B;  4Z5T D;  1P3K C;  4DQY B;  4H9P A;  5AV8 A;  5DNM C;  3REL D;  3AZL B;  1KX3 C;  1T3U A;  5AV6 B;  3AZM B;  3W99 A;  5B32 C;  1ID3 D;  3AZI C;  5AV5 A;  1P3I C;  4J8V B;  2F2A C;  3NQU B;  3AZG A;  4JJN D;  2FJ7 C;  4NE5 A;  2NQB B;  3WTP C;  3C1C B;  5CHL B;  1M19 D;  1P3M C;  3B6G D;  1EQZ A;  5CPJ A;  5B32 G;  4Z2M G;  4G91 C;  1BH9 A;  3A1K A;  4QLC B;  3AZJ C;  4CAY A;  3C1B D;  3W96 A;  5DNN A;  3UTA C;  4KUD C;  1M19 B;  4H9S A;  5B40 D;  3MVD A;  1HQ3 A;  3AV2 C;  3X1T A;  1P3G C;  5JA4 B;  3MVD C;  4X23 C;  4YS3 D;  1U35 C;  5B0Z A;  5B1L D;  3LJA B;  5AV8 B;  4E45 A;  4Z5T C;  3AZL A;  5CPK D;  5BS7 C;  1WWS A;  2ZM5 A;  1P3P B;  5AV9 A;  2CV5 A;  3X1V A;  3MNN C;  1TAF B;  3AZG D;  3LZ1 D;  5B24 C;  5B0Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...