3TU4D

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
b'TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4D00
3LZ0B 5FUGB 3B6FD 1HQ3B 4UUZA 3KXBD 3C1CC 5AY8A 3B0CW 3O62C 3MGQB 1S32B 5C3IB 5CPKA 3MGSA 2PYOA 3W97B 5GSUA 4JJNC 1P3LB 4H9PA 1TZYC 1U35D 3VH6W 3X1UA 5B0YC 4H9QB 4KHAB 3X1SB 1P3PC 4G92C 5E5AB 3B0CT 5CPIB 5F99D 3UTAC 4YM6B 4H9RB 1KU5A 4HGAC 1TZYD 3AYWC 1M19A 5KDMA 5B32D 5B0YD 5B1LD 5B1MA 5DNMC 3RELA 4AWLB 3VH6T 2F8NH 1P3BC 1AOID 5CP6A 4J8XC 3AZJC 3AZLB 2HIOA 3NQJB 5B24B 3KWQB 4J8VC 1M18D 4NE3A 4J8WB 5CPJB 3AFAC 4R8PA 5B31A 3X1TB 4Z66C 3AV1C 3R45A 5DNND 4KGCC 4J8XD 3LELC 4YS3B 4J8VD 3MGQD 1S32D 1B67A 3AZGC 1P3GC 4ZUXD 5AV8B 5GXQA 1M19B 5B1MB 3LZ1B 3KUYB 1P3IA 3MVDA 4NE6A 5B2JC 3AV1D 5GT0A 5AVCD 5AV5B 3AZMC 2YFVB 5AY8C 3X1SD 4EO5C 3AZFC 5CPKC 4KUDC 3MGSC 1P3GD 5E5AD 2PYOC 1EQZB 4YM6D 5GSUC 4J8UB 2AROA 3AN2A 3W99A 3X1UC 2FJ7A 1P34B 3MGPA 3REKA 3REJA 1BH8A 3LJAC 3W98B 5CPKD 3VH6A 3VH5W 2F8NB 5AV9C 3KWQD 5B2IB 4J8WD 1P3OC 5CPJD 4LD9A 1P3FA 3UT9A 3AZHA 3RELC 2LY8A 1N1JB 3WKJB 2HIOC 1TAFA 5AVBB 2L5AA 3VH5T 1P3AA 4H9NB 5AV8D 1M19D 4R8PC 5B1MD 3LZ1D 4XZQC 3KUYD 5B31C 3RELD 3AZNC 3KXBB 3REJB 2CV5A 3MGRA 1BH9A 5AV5D 3UTBB 5CP6D 1P3KC 3WA9A 5G49B 4WZSB 1ZLAB 3WTPA 5GXQC 1P3MA 4R8PD 1U35B 1P3IC 3AZEA 5B31D 3MVDC 4J8UD 3C1CB 5GT0C 3O62B 3WTPE 3NQUB 1P3BA 3AZJA 2BYKA 2JSSA 5GXQD 5B0ZA 4JJNB 1TZYB 3AFAA 2F8ND 5B0YB 2NQBA 2AROC 3B0DC 5B2ID 1F66C 5B32G 3W99C 2FJ7C 1P3PB 4G92B 3MGPC 3REKC 3LELA 3UTAB 4CSRA 4HGAB 1B6WA 1R4VA 3AYWB 3REHC 5AVBD 5DNMB 2AROD 3AN2D 4LD9C 1P3FC 3UT9C 3VH5A 3W99D 5B2JA 3AZMA 3MGPD 4J8XB 3REJD 4J8VB 3UTBD 1KX3A 3AZFA 4ZUXB 4KUDA 3AFAB 1P3AC 5BO0A 4LD9D 4Z66B 1KX4A 1ZLAD 3AZHD 3AV1B 5AVCB 2CV5C 3B6GC 4KGCB 4CAYB 4QLCC 3A6NA 4CSRB 3MGRC 3C1CD 1ID3A 2BYMB 3O62D 3LJAA 3AZGB 1P3GB 4WU8A 3WA9C 3V9RB 5AV9A 5BNVA 3WTPC 3TU4A 1P3MC 4JJND 1P3OA 3AZMB 2CV5D 4G91C 4M6BA 3C1BA 3AZEC 4Z2MH 4UUZB 3REIC 5AY8B 3WAAC 4EO5B 5CPKB 4KUDB 3MGSB 1P3PD 2PYOB 3AZKC 3UTAD 5GSUB 1M1AC 5B0ZC 1P3MD 4H9PB 5JA4A 3AYWD 4Z5TA 3X1UB 3AZED 4DRAA 2NQBC 4XZQA 5DNMD 3AZNA 3W96A 3AZIA 1P3BD 3AZJD 5JRGA 4XUJA 1P3KA 3AFAD 5KDMB 2NQBD 3RELB 1KX5A 4Z66D 3AV2A 3LZ0C 1HQ3C 4KGCD 4H9OA 5CP6B 3LELD 3X1VA 2HIOB 5B33A 1KX3C 3AZGD 4R8PB 5BT1C 5B31B 3AZNB 5AV6A 1KX4C 3R45B 5B31G 5B2JD 1F66A 3AZMD 2CWEA 3A6NC 5AY8D 1ID3C 1F1EA 5CPIC 3AZFD 4WU8C 4KUDD 3MGSD 5GXQB 1P3IB 2PYOD 1ULYA 5GSUD 3MVDB 3REHA 3B0BA 3TU4C 1KX4D 2F8NG 5GT0B 3C1BC 3X1UD 3A6ND 3LJAD 2HUEC 3MNNA 4WV4B 5AV9D 3TU4D 2AROB 3AN2B 1P3OD 3W99B 4Z5TC 2FJ7B 3B6FA 3B6GA 3MGPB 1JFIA 3REKB 3W96C 1BH8B 4QLCA 3AZIC 2NZDC 5JRGC 2HIOD 4XUJC 1BFMA 4LD9B 2RVQC 4WU9A 3UT9B 3AZHB 1P3FB 4Z5TD 4XZQD 3AZND 1KX5C 3REIA 3AV2C 3AZID 3WAAA 3X1VC 4X23A 1TAFB 5JRGD 3KSYA 1P3KD 3AZKA 5B33C 1P3AB 5CHLB 1M1AA 1EQZC 5B32A 5B1LA 2CV5B 1H3OA 1P3ID 3B6GB 5AV6C 4QLCB 1BH9B 3MVDD 3MGRB 1P34C 5GT0D 1AOIA 4NFTA 5BNXA 3WA9B 1WWIA 3WTPB 5B40A 1P3MB 4G91B 3AZEB 5GT3A 5AV6D 3REIB 5DNNA 1F66D 3LZ0A 2FJ7D 5FUGA 1HQ3A 1P3BB 3AZJB 3REKD 2BYKB 1M1AB 5B0ZB 4DRBA 3MNNC 3W97A 2NQBB 3REHD 1P3LA 1P3FD 3UT9D 3B6FC 4E45A 4H9QA 4KHAA 3X1SA 3LELB 2IO5C 5E5AA 5CPIA 4YM6A 4H9RA 1P3AD 4WU9C 5B2JB 3B6GD 4QLCD 3MGRD 1KX3B 3AZFB 5F99C 4X23C 3AZLA 3WA9D 3NQJA 5B24A 3KWQA 5BO0B 4J8WA 5CPJA 4WU9D 1KX4B 3WTPD 5B32C 5B1LC 3A6NB 3REID 3X1TA 1ID3B 3LJAB 1AOIC 3WAAD 4WU8B 4X23D 4YS3A 4ZBJC 3AZKD 1M18C 2NZDA 1WWSA 5BNVB 5AV9B 1M1AD 5B40C 3TU4B 5B0ZD 1P3OB 5AV8A 5BS7A 3KUYA 3LZ1A 3C1BB 5GT3C 5DNNC 5AV5A 2HUEB 2YFVA 4H9SA 3MGQC 1S32C 5C3IC 4ZUXC 5B40D 5JA4B 4Z5TB 1EQZA 3W97C 5GT3D 2F8NK 4J8UA 4XZQB 4WNNA 1P3LC 3W96B 5AVCC 3AZIB 3LZ0D 1HQ3D 1P34A 3X1SC 2NZDB 5JRGB 4XUJB 3W98A 1P3KB 5E5AC 1KX3D 4YM6C 2F8NA 3W97D 4Z2MG 5BT1D 5B2IA 1KX5B 1P3LD 3AV2B 4H9OB 4AWLC 3X1VB 1N1JA 1ID3D 5B33B 5CPID 3AZLC 4WU8D 3WKJA 5B24C 5AVBA 3KWQC 4WNNB 5AV6B 4J8WC 5CPJC 4H9NA 3B0DB 1F66B 3C1BD 1Q9CA 3KXBA 3X1TC 3UTBA 3AZLD 4YS3C 5B24D 5G49A 3REHB 1ZLAA 5AV8C 1M19C 5BS7C 5B1MC 3LZ1C 3KUYC 4E44A 1U35A 3X1TD 3C1CA 3W96D 3O62A 5AV5C 5CP6C 3NQUA 4H9SC 4YS3D 3MNNB 5F99A 2NZDD 4XUJD 4JJNA 2RVQD 1TZYA 3B6FB 5B0YA 4J8UC 1JFIB 1KX5D 3AV2D 2IO5B 1P3PA 2YFWA 3X1VD 3UTAA 3W98C 4NE5A 1M18A 5B33D 4WU9B 3AYWA 1EQZD 5DNMA 5B2IC 1HTAA 1P34D 3WAAB 4J8XA 5F99B 4X23B 3W98D 3AZKB 4J8VA 3MGQA 1S32A 4ZUXA 3WKJC 5B32B 5B1LB 5AVBC 1H3OB 3AN2C 4Z66A 3AV1A 1A7WA 5AVCA 2YFWB 1AOIB 4KGCA 5BNXB 3KXBC 4CAYA 3REJC 4ZBJB 1M18B 2BYMA 3UTBC 3AZGA 5B40B 1P3GA 3WKJD 3MNND 3V9RA 5GT3B 1ZLAC 3AZHC 5DNNB 1U35C
chains in the Genus database with same CATH superfamily
3LZ0B 2Y2NA 5FUGB 1HQ3B 4UUZA 3KXBD 3B6FD 3C1CC 5AY8A 3B0CW 3O62C 3MGQB 1S32B 5C3IB 5CPKA 2G5HC 3MGSA 2PYOA 3W97B 5GSUA 2Y2HA 4JJNC 1P3LB 4H9PA 1TZYC 1U35D 3VH6W 3X1UA 5B0YC 4H9QB 4KHAB 3X1SB 1P3PC 3A1KA 5E5AB 3B0CT 4G92C 5CPIB 5F99D 3UTAC 4YM6B 4H9RB 1KU5A 4HGAC 1TZYD 3AYWC 1M19A 5KDMA 5B32D 5B0YD 5B1LD 5B1MA 5DNMC 3RELA 4AWLB 3VH6T 2F8NH 1P3BC 1AOID 5CP6A 4J8XC 3AZJC 3AZLB 2HIOA 2JCHA 1T3UA 3NQJB 5B24B 3KWQB 3EPLA 4NE3A 4J8WB 4J8VC 5CPJB 1M18D 3AFAC 4R8PA 5B31A 2J8PA 4Z66C 3X1TB 3AV1C 3R45A 5DNND 4KGCC 2XD1A 4J8XD 3LELC 4YS3B 4J8VD 3MGQD 1S32D 1B67A 3AZGC 1P3GC 4ZUXD 5AV8B 5GXQA 1M19B 5B1MB 3LZ1B 3KUYB 1P3IA 3H0RC 3MVDA 4NE6A 2Y2PA 5B2JC 3AV1D 5GT0A 5AVCD 5AV5B 3AZMC 3KFUG 2YFVB 5AY8C 3X1SD 4EO5C 3AZFC 5CPKC 4KUDC 3MGSC 1P3GD 5E5AD 2PYOC 1EQZB 4YM6D 5GSUC 4J8UB 2AROA 3AN2A 3W99A 3X1UC 2FJ7A 1P34B 3MGPA 3REKA 3REJA 1BH8A 3LJAC 3W98B 5CPKD 3VH6A 3VH5W 2F8NB 5AV9C 3KWQD 5B2IB 4J8WD 1P3OC 5CPJD 4LD9A 1P3FA 3UT9A 3AZHA 3RELC 2LY8A 4DQYB 3EPHA 1N1JB 3WKJB 2HIOC 1TAFA 5AVBB 2L5AA 3VH5T 1P3AA 4H9NB 5AV8D 1M19D 4R8PC 5B1MD 3LZ1D 4XZQC 3KUYD 5B31C 3RELD 3AZNC 3KXBB 3REJB 2CV5A 3MGRA 1BH9A 5AV5D 3UTBB 5CP6D 1P3KC 3WA9A 5G49B 4WZSB 1ZLAB 3WTPA 5GXQC 1P3MA 4R8PD 1U35B 1P3IC 3AZEA 5B31D 3MVDC 4J8UD 3C1CB 5GT0C 3O62B 3WTPE 3NQUB 1P3BA 3AZJA 2BYKA 2JSSA 5GXQD 5B0ZA 4JJNB 1TZYB 3AFAA 2F8ND 5B0YB 2NQBA 2AROC 3B0DC 5B2ID 1F66C 5B32G 3W99C 2FJ7C 1P3PB 4G92B 3MGPC 3REKC 2DQNC 3LELA 3UTAB 4CSRA 4HGAB 1B6WA 1R4VA 3AYWB 3REHC 5AVBD 5DNMB 2AROD 3AN2D 4LD9C 1P3FC 3UT9C 3VH5A 3W99D 5B2JA 3AZMA 3MGPD 4J8XB 3REJD 2Y2OA 2RIQA 4J8VB 3UTBD 1KX3A 3AZFA 4ZUXB 4KUDA 3AFAB 1P3AC 5BO0A 4LD9D 4Z66B 1KX4A 1ZLAD 3AZHD 3AV1B 5AVCB 2CV5C 3B6GC 4KGCB 2Y2MA 4CAYB 4QLCC 3A6NA 4CSRB 3MGRC 3C1CD 1ID3A 2BYMB 3O62D 3LJAA 3AZGB 1P3GB 4WU8A 1W2EA 3WA9C 3V9RB 5AV9A 5BNVA 3A1IA 3WTPC 3TU4A 1P3MC 2JE5A 4JJND 1P3OA 3AZMB 2CV5D 4G91C 4M6BA 3C1BA 3AZEC 4Z2MH 4UUZB 3REIC 5AY8B 2ZY4A 3WAAC 4EO5B 5CPKB 4KUDB 3MGSB 1P3PD 2PYOB 3AZKC 3UTAD 5GSUB 1M1AC 5B0ZC 1P3MD 4H9PB 5JA4A 3AYWD 4Z5TA 3X1UB 3AZED 4DRAA 2NQBC 4XZQA 5DNMD 3AZNA 3W96A 3AZIA 1P3BD 3AZJD 5JRGA 4XUJA 1P3KA 1Z2CB 3AFAD 5KDMB 2NQBD 3RELB 1KX5A 4Z66D 3AV2A 3LZ0C 2DF4C 1HQ3C 4KGCD 4H9OA 5CP6B 3LELD 3X1VA 2HIOB 5B33A 1KX3C 3AZGD 4R8PB 5BT1C 5B31B 3AZNB 5AV6A 3EPKA 1KX4C 3R45B 5B31G 5B2JD 1F66A 3AZMD 2CWEA 3A6NC 5AY8D 1ID3C 2VQRA 1F1EA 5CPIC 3AZFD 4WU8C 2Y2LA 3MGSD 4KUDD 5GXQB 1P3IB 2PYOD 1ULYA 5GSUD 3MVDB 3REHA 3B0BA 3TU4C 1KX4D 2F8NG 3P5JB 5GT0B 3C1BC 3X1UD 3A6ND 3LJAD 2HUEC 3MNNA 4WV4B 5AV9D 3TU4D 2AROB 3AN2B 1P3OD 3W99B 4Z5TC 2FJ7B 3B6FA 3B6GA 3MGPB 1JFIA 3REKB 3W96C 1BH8B 4QLCA 3AZIC 2NZDC 5JRGC 2HIOD 4XUJC 1BFMA 4UPKA 4LD9B 2RVQC 4WU9A 3UT9B 3AZHB 1P3FB 4Z5TD 4XZQD 3AZND 3H0LC 1KX5C 3REIA 3AV2C 3AZID 3WAAA 3X1VC 4X23A 1TAFB 5JRGD 3KSYA 1P3KD 3AZKA 5B33C 1P3AB 5CHLB 1M1AA 1EQZC 5B32A 5B1LA 2CV5B 1H3OA 1P3ID 3B6GB 5AV6C 4QLCB 1BH9B 3MVDD 3MGRB 1P34C 5GT0D 1AOIA 4NFTA 5BNXA 2Y2JA 3WA9B 1WWIA 3WTPB 5B40A 1P3MB 4G91B 3AZEB 5GT3A 5AV6D 3REIB 5DNNA 1F66D 3LZ0A 2FJ7D 3H0MC 5FUGA 1HQ3A 1P3BB 3AZJB 3REKD 2BYKB 1M1AB 5B0ZB 3EPJA 3FDDA 2ZY5A 4DRBA 3MNNC 3W97A 2ZY3A 2NQBB 3REHD 1P3LA 1P3FD 3UT9D 2BG1A 3B6FC 4E45A 4H9QA 4KHAA 3X1SA 3LELB 2IO5C 5E5AA 3IP4C 5CPIA 4YM6A 4H9RA 1P3AD 4WU9C 5B2JB 2UWXA 3B6GD 4QLCD 3MGRD 1KX3B 3AZFB 5F99C 4X23C 3AZLA 3WA9D 3NQJA 5B24A 3KWQA 2G5IC 5BO0B 4J8WA 5CPJA 4WU9D 1KX4B 3WTPD 5B32C 5B1LC 3A6NB 3REID 3X1TA 1ID3B 3LJAB 1AOIC 2Y2IA 3WAAD 4WU8B 4X23D 4YS3A 4ZBJC 3AZKD 1M18C 2NZDA 1WWSA 5BNVB 5AV9B 1M1AD 5B40C 3TU4B 5B0ZD 1P3OB 5AV8A 5BS7A 3KUYA 3LZ1A 3C1BB 5GT3C 2Y2KA 5DNNC 2XD5A 5AV5A 2HUEB 2YFVA 4H9SA 3MGQC 1S32C 5C3IC 4ZUXC 5B40D 3AL0C 5JA4B 4WJ3C 4Z5TB 1EQZA 3W97C 5GT3D 2F8NK 4J8UA 4XZQB 4WNNA 1P3LC 3W96B 5AVCC 3AZIB 3LZ0D 1HQ3D 1P34A 3X1SC 2NZDB 5JRGB 4XUJB 3W98A 1P3KB 5E5AC 1KX3D 4YM6C 2F8NA 3W97D 4Z2MG 5BT1D 5B2IA 1KX5B 1P3LD 3AV2B 4H9OB 2F2AC 3EG5B 4AWLC 3X1VB 1N1JA 1ID3D 5B33B 5CPID 3AZLC 4WU8D 3WKJA 5B24C 5AVBA 3KWQC 4WNNB 5AV6B 4J8WC 5CPJC 2Y2QA 4H9NA 3B0DB 2ZM5A 1F66B 3C1BD 1Q9CA 2FFFB 3KXBA 3X1TC 2W8SA 3UTBA 3AZLD 4YS3C 5B24D 5G49A 3REHB 1ZLAA 5AV8C 1M19C 5BS7C 5B1MC 3LZ1C 3KUYC 4E44A 1U35A 3X1TD 3C1CA 3W96D 3O62A 5AV5C 5CP6C 2ZY2A 3NQUA 4H9SC 4YS3D 3MNNB 5F99A 2NZDD 4XUJD 4JJNA 2RVQD 1TZYA 3B6FB 5B0YA 4J8UC 1PZRA 1JFIB 1KX5D 3AV2D 2IO5B 1P3PA 2YFWA 3X1VD 3UTAA 3W98C 4NE5A 1M18A 5B33D 4WU9B 3AYWA 1EQZD 2Y2GA 5DNMA 5B2IC 1HTAA 1P34D 3WAAB 4J8XA 5F99B 4X23B 3W98D 3AZKB 3F6TA 4J8VA 3MGQA 1S32A 4ZUXA 3WKJC 5B32B 5B1LB 5AVBC 1H3OB 3AN2C 4Z66A 3AV1A 1A7WA 5AVCA 2YFWB 1AOIB 4KGCA 5BNXB 3KXBC 4CAYA 3REJC 4ZBJB 1M18B 2BYMA 3UTBC 3AZGA 5B40B 1P3GA 3WKJD 3MNND 3V9RA 5GT3B 1ZLAC 3AZHC 5DNNB 1U35C
chains in the Genus database with same CATH topology
3LZ0B 2Y2NA 5FUGB 1HQ3B 4UUZA 3KXBD 3B6FD 3C1CC 5AY8A 3B0CW 3O62C 3MGQB 1S32B 5C3IB 5CPKA 2G5HC 3MGSA 2PYOA 3W97B 5GSUA 2Y2HA 4JJNC 1P3LB 4H9PA 1TZYC 1U35D 3VH6W 3X1UA 5B0YC 4H9QB 4KHAB 3X1SB 1P3PC 3A1KA 5E5AB 3B0CT 4G92C 5CPIB 5F99D 3UTAC 4YM6B 4H9RB 1KU5A 4HGAC 1TZYD 3AYWC 1M19A 5KDMA 5B32D 5B0YD 5B1LD 5B1MA 5DNMC 3RELA 4AWLB 3VH6T 2F8NH 1P3BC 1AOID 5CP6A 4J8XC 3AZJC 3AZLB 2HIOA 2JCHA 1T3UA 3NQJB 5B24B 3KWQB 3EPLA 4NE3A 4J8WB 4J8VC 5CPJB 1M18D 3AFAC 4R8PA 5B31A 2J8PA 4Z66C 3X1TB 3AV1C 3R45A 5DNND 4KGCC 2XD1A 4J8XD 3LELC 4YS3B 4J8VD 3MGQD 1S32D 1B67A 3AZGC 1P3GC 4ZUXD 5AV8B 5GXQA 1M19B 5B1MB 3LZ1B 3KUYB 1P3IA 3H0RC 3MVDA 4NE6A 2Y2PA 5B2JC 3AV1D 5GT0A 5AVCD 5AV5B 3AZMC 3KFUG 2YFVB 5AY8C 3X1SD 4EO5C 3AZFC 5CPKC 4KUDC 3MGSC 1P3GD 5E5AD 2PYOC 1EQZB 4YM6D 5GSUC 4J8UB 2AROA 3AN2A 3W99A 3X1UC 2FJ7A 1P34B 3MGPA 3REKA 3REJA 1BH8A 3LJAC 3W98B 5CPKD 3VH6A 3VH5W 2F8NB 5AV9C 3KWQD 5B2IB 4J8WD 1P3OC 5CPJD 4LD9A 1P3FA 3UT9A 3AZHA 3RELC 2LY8A 4DQYB 3EPHA 1N1JB 3WKJB 2HIOC 1TAFA 5AVBB 2L5AA 3VH5T 1P3AA 4H9NB 5AV8D 1M19D 4R8PC 5B1MD 3LZ1D 4XZQC 3KUYD 5B31C 3RELD 3AZNC 3KXBB 3REJB 2CV5A 3MGRA 1BH9A 5AV5D 3UTBB 5CP6D 1P3KC 3WA9A 5G49B 4WZSB 1ZLAB 3WTPA 5GXQC 1P3MA 4R8PD 1U35B 1P3IC 3AZEA 5B31D 3MVDC 4J8UD 3C1CB 5GT0C 3O62B 3WTPE 3NQUB 1P3BA 3AZJA 2BYKA 2JSSA 5GXQD 5B0ZA 4JJNB 1TZYB 3AFAA 2F8ND 5B0YB 2NQBA 2AROC 3B0DC 5B2ID 1F66C 5B32G 3W99C 2FJ7C 1P3PB 4G92B 3MGPC 3REKC 2DQNC 3LELA 3UTAB 4CSRA 4HGAB 1B6WA 1R4VA 3AYWB 3REHC 5AVBD 5DNMB 2AROD 3AN2D 4LD9C 1P3FC 3UT9C 3VH5A 3W99D 5B2JA 3AZMA 3MGPD 4J8XB 3REJD 2Y2OA 2RIQA 4J8VB 3UTBD 1KX3A 3AZFA 4ZUXB 4KUDA 3AFAB 1P3AC 5BO0A 4LD9D 4Z66B 1KX4A 1ZLAD 3AZHD 3AV1B 5AVCB 2CV5C 3B6GC 4KGCB 2Y2MA 4CAYB 4QLCC 3A6NA 4CSRB 3MGRC 3C1CD 1ID3A 2BYMB 3O62D 3LJAA 3AZGB 1P3GB 4WU8A 1W2EA 3WA9C 3V9RB 5AV9A 5BNVA 3A1IA 3WTPC 3TU4A 1P3MC 2JE5A 4JJND 1P3OA 3AZMB 2CV5D 4G91C 4M6BA 3C1BA 3AZEC 4Z2MH 4UUZB 3REIC 5AY8B 2ZY4A 3WAAC 4EO5B 5CPKB 4KUDB 3MGSB 1P3PD 2PYOB 3AZKC 3UTAD 5GSUB 1M1AC 5B0ZC 1P3MD 4H9PB 5JA4A 3AYWD 4Z5TA 3X1UB 3AZED 4DRAA 2NQBC 4XZQA 5DNMD 3AZNA 3W96A 3AZIA 1P3BD 3AZJD 5JRGA 4XUJA 1P3KA 1Z2CB 3AFAD 5KDMB 2NQBD 3RELB 1KX5A 4Z66D 3AV2A 3LZ0C 2DF4C 1HQ3C 4KGCD 4H9OA 5CP6B 3LELD 3X1VA 2HIOB 5B33A 1KX3C 3AZGD 4R8PB 5BT1C 5B31B 3AZNB 5AV6A 3EPKA 1KX4C 3R45B 5B31G 5B2JD 1F66A 3AZMD 2CWEA 3A6NC 5AY8D 1ID3C 2VQRA 1F1EA 5CPIC 3AZFD 4WU8C 2Y2LA 3MGSD 4KUDD 5GXQB 1P3IB 2PYOD 1ULYA 5GSUD 3MVDB 3REHA 3B0BA 3TU4C 1KX4D 2F8NG 3P5JB 5GT0B 3C1BC 3X1UD 3A6ND 3LJAD 2HUEC 3MNNA 4WV4B 5AV9D 3TU4D 2AROB 3AN2B 1P3OD 3W99B 4Z5TC 2FJ7B 3B6FA 3B6GA 3MGPB 1JFIA 3REKB 3W96C 1BH8B 4QLCA 3AZIC 2NZDC 5JRGC 2HIOD 4XUJC 1BFMA 4UPKA 4LD9B 2RVQC 4WU9A 3UT9B 3AZHB 1P3FB 4Z5TD 4XZQD 3AZND 3H0LC 1KX5C 3REIA 3AV2C 3AZID 3WAAA 3X1VC 4X23A 1TAFB 5JRGD 3KSYA 1P3KD 3AZKA 5B33C 1P3AB 5CHLB 1M1AA 1EQZC 5B32A 5B1LA 2CV5B 1H3OA 1P3ID 3B6GB 5AV6C 4QLCB 1BH9B 3MVDD 3MGRB 1P34C 5GT0D 1AOIA 4NFTA 5BNXA 2Y2JA 3WA9B 1WWIA 3WTPB 5B40A 1P3MB 4G91B 3AZEB 5GT3A 5AV6D 3REIB 5DNNA 1F66D 3LZ0A 2FJ7D 3H0MC 5FUGA 1HQ3A 1P3BB 3AZJB 3REKD 2BYKB 1M1AB 5B0ZB 3EPJA 3FDDA 2ZY5A 4DRBA 3MNNC 3W97A 2ZY3A 2NQBB 3REHD 1P3LA 1P3FD 3UT9D 2BG1A 3B6FC 4E45A 4H9QA 4KHAA 3X1SA 3LELB 2IO5C 5E5AA 3IP4C 5CPIA 4YM6A 4H9RA 1P3AD 4WU9C 5B2JB 2UWXA 3B6GD 4QLCD 3MGRD 1KX3B 3AZFB 5F99C 4X23C 3AZLA 3WA9D 3NQJA 5B24A 3KWQA 2G5IC 5BO0B 4J8WA 5CPJA 4WU9D 1KX4B 3WTPD 5B32C 5B1LC 3A6NB 3REID 3X1TA 1ID3B 3LJAB 1AOIC 2Y2IA 3WAAD 4WU8B 4X23D 4YS3A 4ZBJC 3AZKD 1M18C 2NZDA 1WWSA 5BNVB 5AV9B 1M1AD 5B40C 3TU4B 5B0ZD 1P3OB 5AV8A 5BS7A 3KUYA 3LZ1A 3C1BB 5GT3C 2Y2KA 5DNNC 2XD5A 5AV5A 2HUEB 2YFVA 4H9SA 3MGQC 1S32C 5C3IC 4ZUXC 5B40D 3AL0C 5JA4B 4WJ3C 4Z5TB 1EQZA 3W97C 5GT3D 2F8NK 4J8UA 4XZQB 4WNNA 1P3LC 3W96B 5AVCC 3AZIB 3LZ0D 1HQ3D 1P34A 3X1SC 2NZDB 5JRGB 4XUJB 3W98A 1P3KB 5E5AC 1KX3D 4YM6C 2F8NA 3W97D 4Z2MG 5BT1D 5B2IA 1KX5B 1P3LD 3AV2B 4H9OB 2F2AC 3EG5B 4AWLC 3X1VB 1N1JA 1ID3D 5B33B 5CPID 3AZLC 4WU8D 3WKJA 5B24C 5AVBA 3KWQC 4WNNB 5AV6B 4J8WC 5CPJC 2Y2QA 4H9NA 3B0DB 2ZM5A 1F66B 3C1BD 1Q9CA 2FFFB 3KXBA 3X1TC 2W8SA 3UTBA 3AZLD 4YS3C 5B24D 5G49A 3REHB 1ZLAA 5AV8C 1M19C 5BS7C 5B1MC 3LZ1C 3KUYC 4E44A 1U35A 3X1TD 3C1CA 3W96D 3O62A 5AV5C 5CP6C 2ZY2A 3NQUA 4H9SC 4YS3D 3MNNB 5F99A 2NZDD 4XUJD 4JJNA 2RVQD 1TZYA 3B6FB 5B0YA 4J8UC 1PZRA 1JFIB 1KX5D 3AV2D 2IO5B 1P3PA 2YFWA 3X1VD 3UTAA 3W98C 4NE5A 1M18A 5B33D 4WU9B 3AYWA 1EQZD 2Y2GA 5DNMA 5B2IC 1HTAA 1P34D 3WAAB 4J8XA 5F99B 4X23B 3W98D 3AZKB 3F6TA 4J8VA 3MGQA 1S32A 4ZUXA 3WKJC 5B32B 5B1LB 5AVBC 1H3OB 3AN2C 4Z66A 3AV1A 1A7WA 5AVCA 2YFWB 1AOIB 4KGCA 5BNXB 3KXBC 4CAYA 3REJC 4ZBJB 1M18B 2BYMA 3UTBC 3AZGA 5B40B 1P3GA 3WKJD 3MNND 3V9RA 5GT3B 1ZLAC 3AZHC 5DNNB 1U35C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 B;  5FUG B;  3B6F D;  1HQ3 B;  4UUZ A;  3KXB D;  3C1C C;  5AY8 A;  3B0C W;  3O62 C;  3MGQ B;  1S32 B;  5C3I B;  5CPK A;  3MGS A;  2PYO A;  3W97 B;  5GSU A;  4JJN C;  1P3L B;  4H9P A;  1TZY C;  1U35 D;  3VH6 W;  3X1U A;  5B0Y C;  4H9Q B;  4KHA B;  3X1S B;  1P3P C;  4G92 C;  5E5A B;  3B0C T;  5CPI B;  5F99 D;  3UTA C;  4YM6 B;  4H9R B;  1KU5 A;  4HGA C;  1TZY D;  3AYW C;  1M19 A;  5KDM A;  5B32 D;  5B0Y D;  5B1L D;  5B1M A;  5DNM C;  3REL A;  4AWL B;  3VH6 T;  2F8N H;  1P3B C;  1AOI D;  5CP6 A;  4J8X C;  3AZJ C;  3AZL B;  2HIO A;  3NQJ B;  5B24 B;  3KWQ B;  4J8V C;  1M18 D;  4NE3 A;  4J8W B;  5CPJ B;  3AFA C;  4R8P A;  5B31 A;  3X1T B;  4Z66 C;  3AV1 C;  3R45 A;  5DNN D;  4KGC C;  4J8X D;  3LEL C;  4YS3 B;  4J8V D;  3MGQ D;  1S32 D;  1B67 A;  3AZG C;  1P3G C;  4ZUX D;  5AV8 B;  5GXQ A;  1M19 B;  5B1M B;  3LZ1 B;  3KUY B;  1P3I A;  3MVD A;  4NE6 A;  5B2J C;  3AV1 D;  5GT0 A;  5AVC D;  5AV5 B;  3AZM C;  2YFV B;  5AY8 C;  3X1S D;  4EO5 C;  3AZF C;  5CPK C;  4KUD C;  3MGS C;  1P3G D;  5E5A D;  2PYO C;  1EQZ B;  4YM6 D;  5GSU C;  4J8U B;  2ARO A;  3AN2 A;  3W99 A;  3X1U C;  2FJ7 A;  1P34 B;  3MGP A;  3REK A;  3REJ A;  1BH8 A;  3LJA C;  3W98 B;  5CPK D;  3VH6 A;  3VH5 W;  2F8N B;  5AV9 C;  3KWQ D;  5B2I B;  4J8W D;  1P3O C;  5CPJ D;  4LD9 A;  1P3F A;  3UT9 A;  3AZH A;  3REL C;  2LY8 A;  1N1J B;  3WKJ B;  2HIO C;  1TAF A;  5AVB B;  2L5A A;  3VH5 T;  1P3A A;  4H9N B;  5AV8 D;  1M19 D;  4R8P C;  5B1M D;  3LZ1 D;  4XZQ C;  3KUY D;  5B31 C;  3REL D;  3AZN C;  3KXB B;  3REJ B;  2CV5 A;  3MGR A;  1BH9 A;  5AV5 D;  3UTB B;  5CP6 D;  1P3K C;  3WA9 A;  5G49 B;  4WZS B;  1ZLA B;  3WTP A;  5GXQ C;  1P3M A;  4R8P D;  1U35 B;  1P3I C;  3AZE A;  5B31 D;  3MVD C;  4J8U D;  3C1C B;  5GT0 C;  3O62 B;  3WTP E;  3NQU B;  1P3B A;  3AZJ A;  2BYK A;  2JSS A;  5GXQ D;  5B0Z A;  4JJN B;  1TZY B;  3AFA A;  2F8N D;  5B0Y B;  2NQB A;  2ARO C;  3B0D C;  5B2I D;  1F66 C;  5B32 G;  3W99 C;  2FJ7 C;  1P3P B;  4G92 B;  3MGP C;  3REK C;  3LEL A;  3UTA B;  4CSR A;  4HGA B;  1B6W A;  1R4V A;  3AYW B;  3REH C;  5AVB D;  5DNM B;  2ARO D;  3AN2 D;  4LD9 C;  1P3F C;  3UT9 C;  3VH5 A;  3W99 D;  5B2J A;  3AZM A;  3MGP D;  4J8X B;  3REJ D;  4J8V B;  3UTB D;  1KX3 A;  3AZF A;  4ZUX B;  4KUD A;  3AFA B;  1P3A C;  5BO0 A;  4LD9 D;  4Z66 B;  1KX4 A;  1ZLA D;  3AZH D;  3AV1 B;  5AVC B;  2CV5 C;  3B6G C;  4KGC B;  4CAY B;  4QLC C;  3A6N A;  4CSR B;  3MGR C;  3C1C D;  1ID3 A;  2BYM B;  3O62 D;  3LJA A;  3AZG B;  1P3G B;  4WU8 A;  3WA9 C;  3V9R B;  5AV9 A;  5BNV A;  3WTP C;  3TU4 A;  1P3M C;  4JJN D;  1P3O A;  3AZM B;  2CV5 D;  4G91 C;  4M6B A;  3C1B A;  3AZE C;  4Z2M H;  4UUZ B;  3REI C;  5AY8 B;  3WAA C;  4EO5 B;  5CPK B;  4KUD B;  3MGS B;  1P3P D;  2PYO B;  3AZK C;  3UTA D;  5GSU B;  1M1A C;  5B0Z C;  1P3M D;  4H9P B;  5JA4 A;  3AYW D;  4Z5T A;  3X1U B;  3AZE D;  4DRA A;  2NQB C;  4XZQ A;  5DNM D;  3AZN A;  3W96 A;  3AZI A;  1P3B D;  3AZJ D;  5JRG A;  4XUJ A;  1P3K A;  3AFA D;  5KDM B;  2NQB D;  3REL B;  1KX5 A;  4Z66 D;  3AV2 A;  3LZ0 C;  1HQ3 C;  4KGC D;  4H9O A;  5CP6 B;  3LEL D;  3X1V A;  2HIO B;  5B33 A;  1KX3 C;  3AZG D;  4R8P B;  5BT1 C;  5B31 B;  3AZN B;  5AV6 A;  1KX4 C;  3R45 B;  5B31 G;  5B2J D;  1F66 A;  3AZM D;  2CWE A;  3A6N C;  5AY8 D;  1ID3 C;  1F1E A;  5CPI C;  3AZF D;  4WU8 C;  4KUD D;  3MGS D;  5GXQ B;  1P3I B;  2PYO D;  1ULY A;  5GSU D;  3MVD B;  3REH A;  3B0B A;  3TU4 C;  1KX4 D;  2F8N G;  5GT0 B;  3C1B C;  3X1U D;  3A6N D;  3LJA D;  2HUE C;  3MNN A;  4WV4 B;  5AV9 D;  3TU4 D;  2ARO B;  3AN2 B;  1P3O D;  3W99 B;  4Z5T C;  2FJ7 B;  3B6F A;  3B6G A;  3MGP B;  1JFI A;  3REK B;  3W96 C;  1BH8 B;  4QLC A;  3AZI C;  2NZD C;  5JRG C;  2HIO D;  4XUJ C;  1BFM A;  4LD9 B;  2RVQ C;  4WU9 A;  3UT9 B;  3AZH B;  1P3F B;  4Z5T D;  4XZQ D;  3AZN D;  1KX5 C;  3REI A;  3AV2 C;  3AZI D;  3WAA A;  3X1V C;  4X23 A;  1TAF B;  5JRG D;  3KSY A;  1P3K D;  3AZK A;  5B33 C;  1P3A B;  5CHL B;  1M1A A;  1EQZ C;  5B32 A;  5B1L A;  2CV5 B;  1H3O A;  1P3I D;  3B6G B;  5AV6 C;  4QLC B;  1BH9 B;  3MVD D;  3MGR B;  1P34 C;  5GT0 D;  1AOI A;  4NFT A;  5BNX A;  3WA9 B;  1WWI A;  3WTP B;  5B40 A;  1P3M B;  4G91 B;  3AZE B;  5GT3 A;  5AV6 D;  3REI B;  5DNN A;  1F66 D;  3LZ0 A;  2FJ7 D;  5FUG A;  1HQ3 A;  1P3B B;  3AZJ B;  3REK D;  2BYK B;  1M1A B;  5B0Z B;  4DRB A;  3MNN C;  3W97 A;  2NQB B;  3REH D;  1P3L A;  1P3F D;  3UT9 D;  3B6F C;  4E45 A;  4H9Q A;  4KHA A;  3X1S A;  3LEL B;  2IO5 C;  5E5A A;  5CPI A;  4YM6 A;  4H9R A;  1P3A D;  4WU9 C;  5B2J B;  3B6G D;  4QLC D;  3MGR D;  1KX3 B;  3AZF B;  5F99 C;  4X23 C;  3AZL A;  3WA9 D;  3NQJ A;  5B24 A;  3KWQ A;  5BO0 B;  4J8W A;  5CPJ A;  4WU9 D;  1KX4 B;  3WTP D;  5B32 C;  5B1L C;  3A6N B;  3REI D;  3X1T A;  1ID3 B;  3LJA B;  1AOI C;  3WAA D;  4WU8 B;  4X23 D;  4YS3 A;  4ZBJ C;  3AZK D;  1M18 C;  2NZD A;  1WWS A;  5BNV B;  5AV9 B;  1M1A D;  5B40 C;  3TU4 B;  5B0Z D;  1P3O B;  5AV8 A;  5BS7 A;  3KUY A;  3LZ1 A;  3C1B B;  5GT3 C;  5DNN C;  5AV5 A;  2HUE B;  2YFV A;  4H9S A;  3MGQ C;  1S32 C;  5C3I C;  4ZUX C;  5B40 D;  5JA4 B;  4Z5T B;  1EQZ A;  3W97 C;  5GT3 D;  2F8N K;  4J8U A;  4XZQ B;  4WNN A;  1P3L C;  3W96 B;  5AVC C;  3AZI B;  3LZ0 D;  1HQ3 D;  1P34 A;  3X1S C;  2NZD B;  5JRG B;  4XUJ B;  3W98 A;  1P3K B;  5E5A C;  1KX3 D;  4YM6 C;  2F8N A;  3W97 D;  4Z2M G;  5BT1 D;  5B2I A;  1KX5 B;  1P3L D;  3AV2 B;  4H9O B;  4AWL C;  3X1V B;  1N1J A;  1ID3 D;  5B33 B;  5CPI D;  3AZL C;  4WU8 D;  3WKJ A;  5B24 C;  5AVB A;  3KWQ C;  4WNN B;  5AV6 B;  4J8W C;  5CPJ C;  4H9N A;  3B0D B;  1F66 B;  3C1B D;  1Q9C A;  3KXB A;  3X1T C;  3UTB A;  3AZL D;  4YS3 C;  5B24 D;  5G49 A;  3REH B;  1ZLA A;  5AV8 C;  1M19 C;  5BS7 C;  5B1M C;  3LZ1 C;  3KUY C;  4E44 A;  1U35 A;  3X1T D;  3C1C A;  3W96 D;  3O62 A;  5AV5 C;  5CP6 C;  3NQU A;  4H9S C;  4YS3 D;  3MNN B;  5F99 A;  2NZD D;  4XUJ D;  4JJN A;  2RVQ D;  1TZY A;  3B6F B;  5B0Y A;  4J8U C;  1JFI B;  1KX5 D;  3AV2 D;  2IO5 B;  1P3P A;  2YFW A;  3X1V D;  3UTA A;  3W98 C;  4NE5 A;  1M18 A;  5B33 D;  4WU9 B;  3AYW A;  1EQZ D;  5DNM A;  5B2I C;  1HTA A;  1P34 D;  3WAA B;  4J8X A;  5F99 B;  4X23 B;  3W98 D;  3AZK B;  4J8V A;  3MGQ A;  1S32 A;  4ZUX A;  3WKJ C;  5B32 B;  5B1L B;  5AVB C;  1H3O B;  3AN2 C;  4Z66 A;  3AV1 A;  1A7W A;  5AVC A;  2YFW B;  1AOI B;  4KGC A;  5BNX B;  3KXB C;  4CAY A;  3REJ C;  4ZBJ B;  1M18 B;  2BYM A;  3UTB C;  3AZG A;  5B40 B;  1P3G A;  3WKJ D;  3MNN D;  3V9R A;  5GT3 B;  1ZLA C;  3AZH C;  5DNN B;  1U35 C; 
#chains in the Genus database with same CATH topology
 3LZ0 B;  2Y2N A;  5FUG B;  1HQ3 B;  4UUZ A;  3KXB D;  3B6F D;  3C1C C;  5AY8 A;  3B0C W;  3O62 C;  3MGQ B;  1S32 B;  5C3I B;  5CPK A;  2G5H C;  3MGS A;  2PYO A;  3W97 B;  5GSU A;  2Y2H A;  4JJN C;  1P3L B;  4H9P A;  1TZY C;  1U35 D;  3VH6 W;  3X1U A;  5B0Y C;  4H9Q B;  4KHA B;  3X1S B;  1P3P C;  3A1K A;  5E5A B;  3B0C T;  4G92 C;  5CPI B;  5F99 D;  3UTA C;  4YM6 B;  4H9R B;  1KU5 A;  4HGA C;  1TZY D;  3AYW C;  1M19 A;  5KDM A;  5B32 D;  5B0Y D;  5B1L D;  5B1M A;  5DNM C;  3REL A;  4AWL B;  3VH6 T;  2F8N H;  1P3B C;  1AOI D;  5CP6 A;  4J8X C;  3AZJ C;  3AZL B;  2HIO A;  2JCH A;  1T3U A;  3NQJ B;  5B24 B;  3KWQ B;  3EPL A;  4NE3 A;  4J8W B;  4J8V C;  5CPJ B;  1M18 D;  3AFA C;  4R8P A;  5B31 A;  2J8P A;  4Z66 C;  3X1T B;  3AV1 C;  3R45 A;  5DNN D;  4KGC C;  2XD1 A;  4J8X D;  3LEL C;  4YS3 B;  4J8V D;  3MGQ D;  1S32 D;  1B67 A;  3AZG C;  1P3G C;  4ZUX D;  5AV8 B;  5GXQ A;  1M19 B;  5B1M B;  3LZ1 B;  3KUY B;  1P3I A;  3H0R C;  3MVD A;  4NE6 A;  2Y2P A;  5B2J C;  3AV1 D;  5GT0 A;  5AVC D;  5AV5 B;  3AZM C;  3KFU G;  2YFV B;  5AY8 C;  3X1S D;  4EO5 C;  3AZF C;  5CPK C;  4KUD C;  3MGS C;  1P3G D;  5E5A D;  2PYO C;  1EQZ B;  4YM6 D;  5GSU C;  4J8U B;  2ARO A;  3AN2 A;  3W99 A;  3X1U C;  2FJ7 A;  1P34 B;  3MGP A;  3REK A;  3REJ A;  1BH8 A;  3LJA C;  3W98 B;  5CPK D;  3VH6 A;  3VH5 W;  2F8N B;  5AV9 C;  3KWQ D;  5B2I B;  4J8W D;  1P3O C;  5CPJ D;  4LD9 A;  1P3F A;  3UT9 A;  3AZH A;  3REL C;  2LY8 A;  4DQY B;  3EPH A;  1N1J B;  3WKJ B;  2HIO C;  1TAF A;  5AVB B;  2L5A A;  3VH5 T;  1P3A A;  4H9N B;  5AV8 D;  1M19 D;  4R8P C;  5B1M D;  3LZ1 D;  4XZQ C;  3KUY D;  5B31 C;  3REL D;  3AZN C;  3KXB B;  3REJ B;  2CV5 A;  3MGR A;  1BH9 A;  5AV5 D;  3UTB B;  5CP6 D;  1P3K C;  3WA9 A;  5G49 B;  4WZS B;  1ZLA B;  3WTP A;  5GXQ C;  1P3M A;  4R8P D;  1U35 B;  1P3I C;  3AZE A;  5B31 D;  3MVD C;  4J8U D;  3C1C B;  5GT0 C;  3O62 B;  3WTP E;  3NQU B;  1P3B A;  3AZJ A;  2BYK A;  2JSS A;  5GXQ D;  5B0Z A;  4JJN B;  1TZY B;  3AFA A;  2F8N D;  5B0Y B;  2NQB A;  2ARO C;  3B0D C;  5B2I D;  1F66 C;  5B32 G;  3W99 C;  2FJ7 C;  1P3P B;  4G92 B;  3MGP C;  3REK C;  2DQN C;  3LEL A;  3UTA B;  4CSR A;  4HGA B;  1B6W A;  1R4V A;  3AYW B;  3REH C;  5AVB D;  5DNM B;  2ARO D;  3AN2 D;  4LD9 C;  1P3F C;  3UT9 C;  3VH5 A;  3W99 D;  5B2J A;  3AZM A;  3MGP D;  4J8X B;  3REJ D;  2Y2O A;  2RIQ A;  4J8V B;  3UTB D;  1KX3 A;  3AZF A;  4ZUX B;  4KUD A;  3AFA B;  1P3A C;  5BO0 A;  4LD9 D;  4Z66 B;  1KX4 A;  1ZLA D;  3AZH D;  3AV1 B;  5AVC B;  2CV5 C;  3B6G C;  4KGC B;  2Y2M A;  4CAY B;  4QLC C;  3A6N A;  4CSR B;  3MGR C;  3C1C D;  1ID3 A;  2BYM B;  3O62 D;  3LJA A;  3AZG B;  1P3G B;  4WU8 A;  1W2E A;  3WA9 C;  3V9R B;  5AV9 A;  5BNV A;  3A1I A;  3WTP C;  3TU4 A;  1P3M C;  2JE5 A;  4JJN D;  1P3O A;  3AZM B;  2CV5 D;  4G91 C;  4M6B A;  3C1B A;  3AZE C;  4Z2M H;  4UUZ B;  3REI C;  5AY8 B;  2ZY4 A;  3WAA C;  4EO5 B;  5CPK B;  4KUD B;  3MGS B;  1P3P D;  2PYO B;  3AZK C;  3UTA D;  5GSU B;  1M1A C;  5B0Z C;  1P3M D;  4H9P B;  5JA4 A;  3AYW D;  4Z5T A;  3X1U B;  3AZE D;  4DRA A;  2NQB C;  4XZQ A;  5DNM D;  3AZN A;  3W96 A;  3AZI A;  1P3B D;  3AZJ D;  5JRG A;  4XUJ A;  1P3K A;  1Z2C B;  3AFA D;  5KDM B;  2NQB D;  3REL B;  1KX5 A;  4Z66 D;  3AV2 A;  3LZ0 C;  2DF4 C;  1HQ3 C;  4KGC D;  4H9O A;  5CP6 B;  3LEL D;  3X1V A;  2HIO B;  5B33 A;  1KX3 C;  3AZG D;  4R8P B;  5BT1 C;  5B31 B;  3AZN B;  5AV6 A;  3EPK A;  1KX4 C;  3R45 B;  5B31 G;  5B2J D;  1F66 A;  3AZM D;  2CWE A;  3A6N C;  5AY8 D;  1ID3 C;  2VQR A;  1F1E A;  5CPI C;  3AZF D;  4WU8 C;  2Y2L A;  3MGS D;  4KUD D;  5GXQ B;  1P3I B;  2PYO D;  1ULY A;  5GSU D;  3MVD B;  3REH A;  3B0B A;  3TU4 C;  1KX4 D;  2F8N G;  3P5J B;  5GT0 B;  3C1B C;  3X1U D;  3A6N D;  3LJA D;  2HUE C;  3MNN A;  4WV4 B;  5AV9 D;  3TU4 D;  2ARO B;  3AN2 B;  1P3O D;  3W99 B;  4Z5T C;  2FJ7 B;  3B6F A;  3B6G A;  3MGP B;  1JFI A;  3REK B;  3W96 C;  1BH8 B;  4QLC A;  3AZI C;  2NZD C;  5JRG C;  2HIO D;  4XUJ C;  1BFM A;  4UPK A;  4LD9 B;  2RVQ C;  4WU9 A;  3UT9 B;  3AZH B;  1P3F B;  4Z5T D;  4XZQ D;  3AZN D;  3H0L C;  1KX5 C;  3REI A;  3AV2 C;  3AZI D;  3WAA A;  3X1V C;  4X23 A;  1TAF B;  5JRG D;  3KSY A;  1P3K D;  3AZK A;  5B33 C;  1P3A B;  5CHL B;  1M1A A;  1EQZ C;  5B32 A;  5B1L A;  2CV5 B;  1H3O A;  1P3I D;  3B6G B;  5AV6 C;  4QLC B;  1BH9 B;  3MVD D;  3MGR B;  1P34 C;  5GT0 D;  1AOI A;  4NFT A;  5BNX A;  2Y2J A;  3WA9 B;  1WWI A;  3WTP B;  5B40 A;  1P3M B;  4G91 B;  3AZE B;  5GT3 A;  5AV6 D;  3REI B;  5DNN A;  1F66 D;  3LZ0 A;  2FJ7 D;  3H0M C;  5FUG A;  1HQ3 A;  1P3B B;  3AZJ B;  3REK D;  2BYK B;  1M1A B;  5B0Z B;  3EPJ A;  3FDD A;  2ZY5 A;  4DRB A;  3MNN C;  3W97 A;  2ZY3 A;  2NQB B;  3REH D;  1P3L A;  1P3F D;  3UT9 D;  2BG1 A;  3B6F C;  4E45 A;  4H9Q A;  4KHA A;  3X1S A;  3LEL B;  2IO5 C;  5E5A A;  3IP4 C;  5CPI A;  4YM6 A;  4H9R A;  1P3A D;  4WU9 C;  5B2J B;  2UWX A;  3B6G D;  4QLC D;  3MGR D;  1KX3 B;  3AZF B;  5F99 C;  4X23 C;  3AZL A;  3WA9 D;  3NQJ A;  5B24 A;  3KWQ A;  2G5I C;  5BO0 B;  4J8W A;  5CPJ A;  4WU9 D;  1KX4 B;  3WTP D;  5B32 C;  5B1L C;  3A6N B;  3REI D;  3X1T A;  1ID3 B;  3LJA B;  1AOI C;  2Y2I A;  3WAA D;  4WU8 B;  4X23 D;  4YS3 A;  4ZBJ C;  3AZK D;  1M18 C;  2NZD A;  1WWS A;  5BNV B;  5AV9 B;  1M1A D;  5B40 C;  3TU4 B;  5B0Z D;  1P3O B;  5AV8 A;  5BS7 A;  3KUY A;  3LZ1 A;  3C1B B;  5GT3 C;  2Y2K A;  5DNN C;  2XD5 A;  5AV5 A;  2HUE B;  2YFV A;  4H9S A;  3MGQ C;  1S32 C;  5C3I C;  4ZUX C;  5B40 D;  3AL0 C;  5JA4 B;  4WJ3 C;  4Z5T B;  1EQZ A;  3W97 C;  5GT3 D;  2F8N K;  4J8U A;  4XZQ B;  4WNN A;  1P3L C;  3W96 B;  5AVC C;  3AZI B;  3LZ0 D;  1HQ3 D;  1P34 A;  3X1S C;  2NZD B;  5JRG B;  4XUJ B;  3W98 A;  1P3K B;  5E5A C;  1KX3 D;  4YM6 C;  2F8N A;  3W97 D;  4Z2M G;  5BT1 D;  5B2I A;  1KX5 B;  1P3L D;  3AV2 B;  4H9O B;  2F2A C;  3EG5 B;  4AWL C;  3X1V B;  1N1J A;  1ID3 D;  5B33 B;  5CPI D;  3AZL C;  4WU8 D;  3WKJ A;  5B24 C;  5AVB A;  3KWQ C;  4WNN B;  5AV6 B;  4J8W C;  5CPJ C;  2Y2Q A;  4H9N A;  3B0D B;  2ZM5 A;  1F66 B;  3C1B D;  1Q9C A;  2FFF B;  3KXB A;  3X1T C;  2W8S A;  3UTB A;  3AZL D;  4YS3 C;  5B24 D;  5G49 A;  3REH B;  1ZLA A;  5AV8 C;  1M19 C;  5BS7 C;  5B1M C;  3LZ1 C;  3KUY C;  4E44 A;  1U35 A;  3X1T D;  3C1C A;  3W96 D;  3O62 A;  5AV5 C;  5CP6 C;  2ZY2 A;  3NQU A;  4H9S C;  4YS3 D;  3MNN B;  5F99 A;  2NZD D;  4XUJ D;  4JJN A;  2RVQ D;  1TZY A;  3B6F B;  5B0Y A;  4J8U C;  1PZR A;  1JFI B;  1KX5 D;  3AV2 D;  2IO5 B;  1P3P A;  2YFW A;  3X1V D;  3UTA A;  3W98 C;  4NE5 A;  1M18 A;  5B33 D;  4WU9 B;  3AYW A;  1EQZ D;  2Y2G A;  5DNM A;  5B2I C;  1HTA A;  1P34 D;  3WAA B;  4J8X A;  5F99 B;  4X23 B;  3W98 D;  3AZK B;  3F6T A;  4J8V A;  3MGQ A;  1S32 A;  4ZUX A;  3WKJ C;  5B32 B;  5B1L B;  5AVB C;  1H3O B;  3AN2 C;  4Z66 A;  3AV1 A;  1A7W A;  5AVC A;  2YFW B;  1AOI B;  4KGC A;  5BNX B;  3KXB C;  4CAY A;  3REJ C;  4ZBJ B;  1M18 B;  2BYM A;  3UTB C;  3AZG A;  5B40 B;  1P3G A;  3WKJ D;  3MNN D;  3V9R A;  5GT3 B;  1ZLA C;  3AZH C;  5DNN B;  1U35 C; 
#chains in the Genus database with same CATH homology
 3LZ0 B;  2Y2N A;  5FUG B;  1HQ3 B;  4UUZ A;  3KXB D;  3B6F D;  3C1C C;  5AY8 A;  3B0C W;  3O62 C;  3MGQ B;  1S32 B;  5C3I B;  5CPK A;  2G5H C;  3MGS A;  2PYO A;  3W97 B;  5GSU A;  2Y2H A;  4JJN C;  1P3L B;  4H9P A;  1TZY C;  1U35 D;  3VH6 W;  3X1U A;  5B0Y C;  4H9Q B;  4KHA B;  3X1S B;  1P3P C;  3A1K A;  5E5A B;  3B0C T;  4G92 C;  5CPI B;  5F99 D;  3UTA C;  4YM6 B;  4H9R B;  1KU5 A;  4HGA C;  1TZY D;  3AYW C;  1M19 A;  5KDM A;  5B32 D;  5B0Y D;  5B1L D;  5B1M A;  5DNM C;  3REL A;  4AWL B;  3VH6 T;  2F8N H;  1P3B C;  1AOI D;  5CP6 A;  4J8X C;  3AZJ C;  3AZL B;  2HIO A;  2JCH A;  1T3U A;  3NQJ B;  5B24 B;  3KWQ B;  3EPL A;  4NE3 A;  4J8W B;  4J8V C;  5CPJ B;  1M18 D;  3AFA C;  4R8P A;  5B31 A;  2J8P A;  4Z66 C;  3X1T B;  3AV1 C;  3R45 A;  5DNN D;  4KGC C;  2XD1 A;  4J8X D;  3LEL C;  4YS3 B;  4J8V D;  3MGQ D;  1S32 D;  1B67 A;  3AZG C;  1P3G C;  4ZUX D;  5AV8 B;  5GXQ A;  1M19 B;  5B1M B;  3LZ1 B;  3KUY B;  1P3I A;  3H0R C;  3MVD A;  4NE6 A;  2Y2P A;  5B2J C;  3AV1 D;  5GT0 A;  5AVC D;  5AV5 B;  3AZM C;  3KFU G;  2YFV B;  5AY8 C;  3X1S D;  4EO5 C;  3AZF C;  5CPK C;  4KUD C;  3MGS C;  1P3G D;  5E5A D;  2PYO C;  1EQZ B;  4YM6 D;  5GSU C;  4J8U B;  2ARO A;  3AN2 A;  3W99 A;  3X1U C;  2FJ7 A;  1P34 B;  3MGP A;  3REK A;  3REJ A;  1BH8 A;  3LJA C;  3W98 B;  5CPK D;  3VH6 A;  3VH5 W;  2F8N B;  5AV9 C;  3KWQ D;  5B2I B;  4J8W D;  1P3O C;  5CPJ D;  4LD9 A;  1P3F A;  3UT9 A;  3AZH A;  3REL C;  2LY8 A;  4DQY B;  3EPH A;  1N1J B;  3WKJ B;  2HIO C;  1TAF A;  5AVB B;  2L5A A;  3VH5 T;  1P3A A;  4H9N B;  5AV8 D;  1M19 D;  4R8P C;  5B1M D;  3LZ1 D;  4XZQ C;  3KUY D;  5B31 C;  3REL D;  3AZN C;  3KXB B;  3REJ B;  2CV5 A;  3MGR A;  1BH9 A;  5AV5 D;  3UTB B;  5CP6 D;  1P3K C;  3WA9 A;  5G49 B;  4WZS B;  1ZLA B;  3WTP A;  5GXQ C;  1P3M A;  4R8P D;  1U35 B;  1P3I C;  3AZE A;  5B31 D;  3MVD C;  4J8U D;  3C1C B;  5GT0 C;  3O62 B;  3WTP E;  3NQU B;  1P3B A;  3AZJ A;  2BYK A;  2JSS A;  5GXQ D;  5B0Z A;  4JJN B;  1TZY B;  3AFA A;  2F8N D;  5B0Y B;  2NQB A;  2ARO C;  3B0D C;  5B2I D;  1F66 C;  5B32 G;  3W99 C;  2FJ7 C;  1P3P B;  4G92 B;  3MGP C;  3REK C;  2DQN C;  3LEL A;  3UTA B;  4CSR A;  4HGA B;  1B6W A;  1R4V A;  3AYW B;  3REH C;  5AVB D;  5DNM B;  2ARO D;  3AN2 D;  4LD9 C;  1P3F C;  3UT9 C;  3VH5 A;  3W99 D;  5B2J A;  3AZM A;  3MGP D;  4J8X B;  3REJ D;  2Y2O A;  2RIQ A;  4J8V B;  3UTB D;  1KX3 A;  3AZF A;  4ZUX B;  4KUD A;  3AFA B;  1P3A C;  5BO0 A;  4LD9 D;  4Z66 B;  1KX4 A;  1ZLA D;  3AZH D;  3AV1 B;  5AVC B;  2CV5 C;  3B6G C;  4KGC B;  2Y2M A;  4CAY B;  4QLC C;  3A6N A;  4CSR B;  3MGR C;  3C1C D;  1ID3 A;  2BYM B;  3O62 D;  3LJA A;  3AZG B;  1P3G B;  4WU8 A;  1W2E A;  3WA9 C;  3V9R B;  5AV9 A;  5BNV A;  3A1I A;  3WTP C;  3TU4 A;  1P3M C;  2JE5 A;  4JJN D;  1P3O A;  3AZM B;  2CV5 D;  4G91 C;  4M6B A;  3C1B A;  3AZE C;  4Z2M H;  4UUZ B;  3REI C;  5AY8 B;  2ZY4 A;  3WAA C;  4EO5 B;  5CPK B;  4KUD B;  3MGS B;  1P3P D;  2PYO B;  3AZK C;  3UTA D;  5GSU B;  1M1A C;  5B0Z C;  1P3M D;  4H9P B;  5JA4 A;  3AYW D;  4Z5T A;  3X1U B;  3AZE D;  4DRA A;  2NQB C;  4XZQ A;  5DNM D;  3AZN A;  3W96 A;  3AZI A;  1P3B D;  3AZJ D;  5JRG A;  4XUJ A;  1P3K A;  1Z2C B;  3AFA D;  5KDM B;  2NQB D;  3REL B;  1KX5 A;  4Z66 D;  3AV2 A;  3LZ0 C;  2DF4 C;  1HQ3 C;  4KGC D;  4H9O A;  5CP6 B;  3LEL D;  3X1V A;  2HIO B;  5B33 A;  1KX3 C;  3AZG D;  4R8P B;  5BT1 C;  5B31 B;  3AZN B;  5AV6 A;  3EPK A;  1KX4 C;  3R45 B;  5B31 G;  5B2J D;  1F66 A;  3AZM D;  2CWE A;  3A6N C;  5AY8 D;  1ID3 C;  2VQR A;  1F1E A;  5CPI C;  3AZF D;  4WU8 C;  2Y2L A;  3MGS D;  4KUD D;  5GXQ B;  1P3I B;  2PYO D;  1ULY A;  5GSU D;  3MVD B;  3REH A;  3B0B A;  3TU4 C;  1KX4 D;  2F8N G;  3P5J B;  5GT0 B;  3C1B C;  3X1U D;  3A6N D;  3LJA D;  2HUE C;  3MNN A;  4WV4 B;  5AV9 D;  3TU4 D;  2ARO B;  3AN2 B;  1P3O D;  3W99 B;  4Z5T C;  2FJ7 B;  3B6F A;  3B6G A;  3MGP B;  1JFI A;  3REK B;  3W96 C;  1BH8 B;  4QLC A;  3AZI C;  2NZD C;  5JRG C;  2HIO D;  4XUJ C;  1BFM A;  4UPK A;  4LD9 B;  2RVQ C;  4WU9 A;  3UT9 B;  3AZH B;  1P3F B;  4Z5T D;  4XZQ D;  3AZN D;  3H0L C;  1KX5 C;  3REI A;  3AV2 C;  3AZI D;  3WAA A;  3X1V C;  4X23 A;  1TAF B;  5JRG D;  3KSY A;  1P3K D;  3AZK A;  5B33 C;  1P3A B;  5CHL B;  1M1A A;  1EQZ C;  5B32 A;  5B1L A;  2CV5 B;  1H3O A;  1P3I D;  3B6G B;  5AV6 C;  4QLC B;  1BH9 B;  3MVD D;  3MGR B;  1P34 C;  5GT0 D;  1AOI A;  4NFT A;  5BNX A;  2Y2J A;  3WA9 B;  1WWI A;  3WTP B;  5B40 A;  1P3M B;  4G91 B;  3AZE B;  5GT3 A;  5AV6 D;  3REI B;  5DNN A;  1F66 D;  3LZ0 A;  2FJ7 D;  3H0M C;  5FUG A;  1HQ3 A;  1P3B B;  3AZJ B;  3REK D;  2BYK B;  1M1A B;  5B0Z B;  3EPJ A;  3FDD A;  2ZY5 A;  4DRB A;  3MNN C;  3W97 A;  2ZY3 A;  2NQB B;  3REH D;  1P3L A;  1P3F D;  3UT9 D;  2BG1 A;  3B6F C;  4E45 A;  4H9Q A;  4KHA A;  3X1S A;  3LEL B;  2IO5 C;  5E5A A;  3IP4 C;  5CPI A;  4YM6 A;  4H9R A;  1P3A D;  4WU9 C;  5B2J B;  2UWX A;  3B6G D;  4QLC D;  3MGR D;  1KX3 B;  3AZF B;  5F99 C;  4X23 C;  3AZL A;  3WA9 D;  3NQJ A;  5B24 A;  3KWQ A;  2G5I C;  5BO0 B;  4J8W A;  5CPJ A;  4WU9 D;  1KX4 B;  3WTP D;  5B32 C;  5B1L C;  3A6N B;  3REI D;  3X1T A;  1ID3 B;  3LJA B;  1AOI C;  2Y2I A;  3WAA D;  4WU8 B;  4X23 D;  4YS3 A;  4ZBJ C;  3AZK D;  1M18 C;  2NZD A;  1WWS A;  5BNV B;  5AV9 B;  1M1A D;  5B40 C;  3TU4 B;  5B0Z D;  1P3O B;  5AV8 A;  5BS7 A;  3KUY A;  3LZ1 A;  3C1B B;  5GT3 C;  2Y2K A;  5DNN C;  2XD5 A;  5AV5 A;  2HUE B;  2YFV A;  4H9S A;  3MGQ C;  1S32 C;  5C3I C;  4ZUX C;  5B40 D;  3AL0 C;  5JA4 B;  4WJ3 C;  4Z5T B;  1EQZ A;  3W97 C;  5GT3 D;  2F8N K;  4J8U A;  4XZQ B;  4WNN A;  1P3L C;  3W96 B;  5AVC C;  3AZI B;  3LZ0 D;  1HQ3 D;  1P34 A;  3X1S C;  2NZD B;  5JRG B;  4XUJ B;  3W98 A;  1P3K B;  5E5A C;  1KX3 D;  4YM6 C;  2F8N A;  3W97 D;  4Z2M G;  5BT1 D;  5B2I A;  1KX5 B;  1P3L D;  3AV2 B;  4H9O B;  2F2A C;  3EG5 B;  4AWL C;  3X1V B;  1N1J A;  1ID3 D;  5B33 B;  5CPI D;  3AZL C;  4WU8 D;  3WKJ A;  5B24 C;  5AVB A;  3KWQ C;  4WNN B;  5AV6 B;  4J8W C;  5CPJ C;  2Y2Q A;  4H9N A;  3B0D B;  2ZM5 A;  1F66 B;  3C1B D;  1Q9C A;  2FFF B;  3KXB A;  3X1T C;  2W8S A;  3UTB A;  3AZL D;  4YS3 C;  5B24 D;  5G49 A;  3REH B;  1ZLA A;  5AV8 C;  1M19 C;  5BS7 C;  5B1M C;  3LZ1 C;  3KUY C;  4E44 A;  1U35 A;  3X1T D;  3C1C A;  3W96 D;  3O62 A;  5AV5 C;  5CP6 C;  2ZY2 A;  3NQU A;  4H9S C;  4YS3 D;  3MNN B;  5F99 A;  2NZD D;  4XUJ D;  4JJN A;  2RVQ D;  1TZY A;  3B6F B;  5B0Y A;  4J8U C;  1PZR A;  1JFI B;  1KX5 D;  3AV2 D;  2IO5 B;  1P3P A;  2YFW A;  3X1V D;  3UTA A;  3W98 C;  4NE5 A;  1M18 A;  5B33 D;  4WU9 B;  3AYW A;  1EQZ D;  2Y2G A;  5DNM A;  5B2I C;  1HTA A;  1P34 D;  3WAA B;  4J8X A;  5F99 B;  4X23 B;  3W98 D;  3AZK B;  3F6T A;  4J8V A;  3MGQ A;  1S32 A;  4ZUX A;  3WKJ C;  5B32 B;  5B1L B;  5AVB C;  1H3O B;  3AN2 C;  4Z66 A;  3AV1 A;  1A7W A;  5AVC A;  2YFW B;  1AOI B;  4KGC A;  5BNX B;  3KXB C;  4CAY A;  3REJ C;  4ZBJ B;  1M18 B;  2BYM A;  3UTB C;  3AZG A;  5B40 B;  1P3G A;  3WKJ D;  3MNN D;  3V9R A;  5GT3 B;  1ZLA C;  3AZH C;  5DNN B;  1U35 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...