3TU4D

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4D00
1P34B 3WA9C 5AVCB 3KWQB 3X1TB 5AV9C 3AZFB 3W97B 1P34D 3NQJA 4Z66C 4J8XC 5AVCD 3WKJC 5BNVB 3KWQD 3X1TD 3LZ0C 5KDMA 3W97D 1ID3B 4WU8C 1P34A 3O62C 3REKA 1F66D 1B67A 1P3MD 3KWQA 5AV8D 2YFWB 1ID3D 4YS3D 3W97A 4NE6A 4E44A 4NE3A 5BT1D 5E5AD 1M1AB 4WNNB 3A6NB 1F66A 1P3GB 1P3MA 3MGQC 5AV8A 2CWEA 1ID3A 4YS3A 3AZKB 3REHB 5E5AA 3AYWD 1P3GD 3W98C 2YFWA 3B6GC 5CPKD 5GT0A 5B0YC 4E45A 4WNNA 3C1BB 4WU9C 3MGPB 3AYWA 1KX5B 1Q9CA 4J8WA 5BO0B 5CPKA 1P3KC 3VH6T 4G91B 3C1BD 5CPJC 1WWIA 4H9QB 3B6FA 3REIC 5B32C 5AVBB 5DNNB 5GT3C 3C1BA 5AV5C 4LD9C 3W96C 1M19C 2IO5B 3KXBB 1ULYA 3B0DC 3MNNB 1P3IC 5AV6D 3LELA 1HQ3D 4QLCD 5DNMC 3AZMB 3VH6W 5DNND 3X1SB 2JSSA 1TZYB 1P3OC 3AN2D 3MNND 5BNXA 4J8UA 1KX3B 4H9NA 5AV6A 1HQ3A 4QLCA 1TZYD 3AZHA 1P3BC 3WAAB 5DNNA 3AN2A 3MGSD 3MNNA 3LJAD 1KX3D 4ZUXB 3UTAA 1P3PC 4H9RA 3WAAD 1U35C 3KUYA 1N1JA 3W99B 3REIB 4ZUXD 3MGSA 3WTPA 3LJAA 2NQBC 2FJ7B 5CPIC 4WZSB 5GXQC 2LY8A 1TAFB 4ZUXA 2BYMA 4ZBJB 4AWLB 3REJB 3UTBB 1P34C 3AZND 3MVDD 2F8NK 5AVCC 1KX4D 3KWQC 3X1TC 4KUDB 3AZFC 2AROB 3VH6A 3C1CD 3UTBD 5B1MB 2CV5B 1S32B 3AV1D 2HIOD 3V9RB 2HUEB 3AFAB 4Z2MH 3AZNA 3MVDA 1KX4A 5B33A 1BH8B 3LZ1B 2F8NG 1S32D 1ID3C 3AFAD 3C1CA 3AV1A 2HIOA 3LZ1D 2YFVA 3NQJB 1S32A 1M1AC 3A6NC 5F99D 1P3GC 3AV2D 5AY8D 4R8PD 5FUGB 1JFIA 1F1EA 3REKB 3AZKC 3REHC 1BH9A 5F99A 2PYOD 1P3FA 4J8VD 3AV2A 5AY8A 4R8PA 3REKD 1BFMA 1F66B 3C1BC 3MGPC 1P3MB 1KX5C 5AV8B 4H9OA 2PYOA 4J8VA 5FUGA 4YS3B 4UUZA 5E5AB 4KGCC 1ZLAD 4G91C 3RELB 5B2JA 5GT0B 4X23D 5AVBC 3RELD 3AYWB 1ZLAA 5DNNC 4J8WB 5B0ZD 2IO5C 3KXBC 5CPKB 3MNNC 5B24A 5GT0D 4X23A 3AZMC 1P3AA 1M18D 2RVQD 3X1SC 3B6FB 4EO5B 1TZYC 3RELA 4J8WD 5B0ZA 1KX3C 3B0BA 3AZGD 3B6FD 3WAAC 1M18A 3AZEA 3LELB 5G49A 4ZUXC 3AZLB 4YM6A 3AZGA 5B40D 3W99C 5BNXB 1AOIB 4J8UB 4JJNB 3LELD 4H9NB 5B31G 5AV6B 3AZLD 1HQ3B 4QLCB 3AZHB 2FJ7C 4H9PB 3W97C 3AN2B 1AOID 5B40A 4J8UD 4JJND 3UTAB 5AV9D 3AZHD 4H9RB 2F8ND 3AZLA 4KGCA 4ZBJC 4AWLC 3KUYB 1N1JB 4H9SC 3REJC 4J8XD 3UTBC 5B2IB 1AOIA 3MGSB 3WTPB 3UTAD 4JJNA 3LJAB 3B0CT 3LZ0D 3WA9A 5AV9A 4KUDC 2F8NA 3KUYD 4H9PA 2AROC 4WU8D 5B2ID 5B1MC 2CV5C 1S32C 3AFAC 2HUEC 4J8XA 3WTPD 3WKJA 2BYMB 3LZ0A 3LZ1C 3R45A 4WU8A 5B2IA 3B0CW 2NZDD 5GSUB 3AZNB 3MVDB 1KX4B 5GSUD 5B33B 3B6GD 4G92B 2NZDA 2F8NH 3AZIB 1H3OA 3C1CB 4Z5TB 3AV1B 2HIOB 3REKC 4WU9D 5B33D 5GSUA 3AZID 2YFVB 3B6GA 4Z5TD 1F66C 4WU9A 1P3MC 5AV8C 3AZIA 4YS3C 1JFIB 4CAYA 4Z5TA 5BT1C 5E5AC 1BH9B 3RELC 5F99B 1P3FB 3AV2B 5AY8B 4HGAB 4DRBA 4R8PB 1EQZB 5GT0C 5B32A 5JA4B 3AYWC 1P3FD 5AV5A 4H9OB 4J8WC 2PYOB 4WV4B 4J8VB 1M19A 5CP6B 1EQZD 4XZQB 5JRGB 5CPKC 5B1LB 1P3IA 4M6BA 4UUZB 3MGRB 1P3BD 3B6FC 4EO5C 1P3OA 5B2JB 5CP6D 3X1VB 4XZQD 5JRGD 5B1LD 1EQZA 5B31D 3MGRD 1P3PD 5JA4A 1ZLAB 1P3BA 5B2JD 1HTAA 3X1VD 5B24B 5CP6A 4XZQA 5JRGA 5B1LA 3LELC 5B31A 4X23B 3MGRA 1P3AB 1P3PA 3AZLC 1U35A 3X1UB 5GXQD 5B24D 3AZJB 3X1VA 1AOIC 5B0ZB 4J8UC 4JJNC 1P3AD 2NQBA 5C3IB 5AV6C 5CPIA 1HQ3C 4QLCC 3X1UD 3UT9B 3AZHC 1M18B 3AN2C 3AZEB 3AZJD 5GXQA 5G49B 3UTAC 5B32G 3NQUB 3AZFD 4YM6B 3UT9D 1P3LB 3AZGB 3X1UA 3KUYC 3AZED 5B2IC 3AZJA 3MGSC 3WTPC 3LJAC 5AVCA 4YM6D 1P3LD 3X1TA 3AZFA 3VH5A 3UT9A 4XUJB 5BS7A 5B40B 3TU4B 2BYKB 5BNVA 3NQUA 4NFTA 1P3LA 4KGCB 4XUJD 2NZDC 3WTPE 3TU4D 1M1AD 3WA9B 3A6ND 5AV9B 4KGCD 2F8NB 1KU5A 5GSUC 4XUJA 4Z66B 3AZKD 4J8XB 3REHD 3TU4A 2BYKA 3WA9D 1M1AA 3WKJB 3AZNC 3MVDC 3LZ0B 3A6NA 1KX4C 5B33C 1P3GA 3R45B 4G92C 1R4VA 3AZIC 4Z66D 4WU8B 3C1CC 4Z5TC 3AV1C 2HIOC 3O62B 3AZKA 3WKJD 3REHA 3MGPD 1KX5D 1WWSA 4DRAA 4Z66A 3O62D 3MGPA 1KX5A 2NZDB 3KSYA 3MGQB 1H3OB 5BO0A 4KHAB 5AVBD 3O62A 3W98B 4H9QA 5F99C 3MGQD 1P3FC 3AV2C 3B6GB 5AY8C 3KXBD 4HGAC 4R8PC 1EQZC 5B0YB 3AZMD 3X1SD 5AVBA 4NE5A 4WU9B 3W98D 3MGQA 2PYOC 4J8VC 5CP6C 4CAYB 4XZQC 4KHAA 5JRGC 5B1LC 5B0YD 3KXBA 1P3KB 5B31C 3MGRC 5CPJB 3AZMA 3X1SA 1A7WA 1B6WA 1TZYA 3W98A 5B2JC 3X1VC 1P3KD 5B32B 5CHLB 5B0YA 1KX3A 5CPJD 1ZLAC 5GT3B 3WAAA 5AV5B 4LD9B 3W99D 3W96B 1M19B 3REID 3B0DB 5B24C 1P3IB 5B32D 2FJ7D 3VH5T 5DNMB 4X23C 1P3KA 1P3AC 5GT3D 5CPJA 5AV5D 3X1UC 1P3OB 3W96D 4LD9D 1M19D 4CSRB 3W99A 3AZJC 1P3ID 5B0ZC 3REIA 5DNMD 5C3IC 2FJ7A 1P3BB 3UT9C 1P3OD 1M18C 5GT3A 3REJD 2RVQC 5BS7C 4LD9A 3W96A 3AZEC 2L5AA 5B31B 4KUDD 1TAFA 3VH5W 5DNMA 1P3PB 4YM6C 1U35B 1P3LC 2AROD 3AZGC 5B1MD 2CV5D 4H9SA 3REJA 4CSRA 3UTBA 2NQBB 5CPIB 1U35D 4KUDA 4XUJC 2AROA 5B1MA 2CV5A 5GXQB 3TU4C 5B40C 3V9RA 3AFAA 4Z2MG 2NQBD 5CPID 5KDMB 3LZ1A 1BH8A
chains in the Genus database with same CATH superfamily
1P34B 3WA9C 5AVCB 3KWQB 3X1TB 5AV9C 3AZFB 3W97B 1P34D 3NQJA 4Z66C 4J8XC 5AVCD 3WKJC 5BNVB 3KWQD 3X1TD 3LZ0C 5KDMA 3W97D 1ID3B 4WU8C 1P34A 2DQNC 2UWXA 3O62C 3REKA 1F66D 1B67A 1P3MD 3KWQA 5AV8D 2YFWB 1ID3D 4YS3D 3W97A 4NE6A 4E44A 4NE3A 5BT1D 5E5AD 1M1AB 4WNNB 3EPJA 3A6NB 1F66A 1P3GB 1P3MA 2FFFB 3MGQC 5AV8A 2CWEA 1ID3A 4YS3A 3AZKB 3REHB 5E5AA 3AYWD 1P3GD 1Z2CB 3W98C 2YFWA 3B6GC 5CPKD 4WJ3C 2Y2QA 5GT0A 5B0YC 4E45A 4WNNA 3C1BB 4WU9C 3MGPB 3AYWA 1KX5B 1Q9CA 4J8WA 5BO0B 5CPKA 1P3KC 3VH6T 4G91B 3C1BD 5CPJC 1WWIA 4H9QB 3B6FA 3A1KA 3REIC 5B32C 2VQRA 5AVBB 5DNNB 5GT3C 3C1BA 5AV5C 4LD9C 3W96C 1T3UA 1M19C 2IO5B 3KXBB 1ULYA 3B0DC 3MNNB 1P3IC 3FDDA 5AV6D 3LELA 1HQ3D 4QLCD 5DNMC 3AZMB 2Y2JA 3VH6W 5DNND 3X1SB 2JSSA 1TZYB 1P3OC 3AN2D 3MNND 5BNXA 4J8UA 1KX3B 4H9NA 5AV6A 1HQ3A 4QLCA 1TZYD 3AZHA 1P3BC 3WAAB 2Y2LA 5DNNA 3AN2A 3MGSD 3MNNA 3LJAD 1KX3D 4ZUXB 2JE5A 3UTAA 1P3PC 4H9RA 3WAAD 1U35C 3KUYA 1N1JA 3W99B 2Y2PA 3REIB 4ZUXD 3MGSA 3WTPA 3LJAA 2NQBC 2FJ7B 5CPIC 4WZSB 2ZY3A 5GXQC 2LY8A 1TAFB 4ZUXA 2BYMA 4ZBJB 4AWLB 4DQYB 3REJB 3UTBB 1P34C 3AZND 3MVDD 2F8NK 5AVCC 1KX4D 3KWQC 3X1TC 4KUDB 3AZFC 2AROB 3VH6A 3C1CD 3UTBD 5B1MB 2CV5B 1S32B 3AV1D 2HIOD 3V9RB 2HUEB 3AFAB 4Z2MH 3AZNA 3MVDA 1KX4A 5B33A 1BH8B 3LZ1B 2F8NG 1S32D 1ID3C 3AFAD 3C1CA 3H0LC 3AV1A 2HIOA 3LZ1D 2G5IC 2YFVA 3NQJB 1S32A 1M1AC 3A6NC 5F99D 1P3GC 3AV2D 5AY8D 2Y2HA 4R8PD 5FUGB 2ZY4A 1JFIA 1F1EA 3REKB 3AZKC 3REHC 1BH9A 2DF4C 5F99A 2PYOD 1P3FA 4J8VD 3AV2A 5AY8A 4R8PA 3REKD 1BFMA 1F66B 3C1BC 3MGPC 1P3MB 3KFUG 1KX5C 5AV8B 4UPKA 2ZY2A 4H9OA 2PYOA 4J8VA 5FUGA 4YS3B 3EG5B 4UUZA 5E5AB 4KGCC 1ZLAD 4G91C 3RELB 5B2JA 5GT0B 4X23D 2G5HC 2Y2MA 5AVBC 3RELD 3AYWB 1ZLAA 5DNNC 4J8WB 5B0ZD 2IO5C 3KXBC 5CPKB 3MNNC 5B24A 5GT0D 3AL0C 4X23A 3AZMC 1P3AA 1M18D 2RVQD 3X1SC 3B6FB 4EO5B 1TZYC 3RELA 4J8WD 5B0ZA 1KX3C 3B0BA 3AZGD 3B6FD 3WAAC 1M18A 3AZEA 3LELB 5G49A 4ZUXC 3AZLB 4YM6A 3AZGA 5B40D 3W99C 5BNXB 1AOIB 4J8UB 4JJNB 3LELD 4H9NB 5B31G 5AV6B 3AZLD 1HQ3B 4QLCB 3AZHB 2FJ7C 4H9PB 3W97C 3P5JB 3AN2B 1AOID 5B40A 2Y2IA 4J8UD 4JJND 3UTAB 5AV9D 3AZHD 4H9RB 2F8ND 3AZLA 4KGCA 4ZBJC 4AWLC 3KUYB 1N1JB 4H9SC 3REJC 4J8XD 3UTBC 5B2IB 1AOIA 3MGSB 3WTPB 3UTAD 4JJNA 3LJAB 3B0CT 3LZ0D 3WA9A 5AV9A 4KUDC 2F8NA 3KUYD 4H9PA 2AROC 4WU8D 5B2ID 5B1MC 2CV5C 1S32C 3AFAC 2HUEC 4J8XA 3WTPD 3EPKA 3WKJA 2BYMB 3LZ0A 3LZ1C 3R45A 2W8SA 2Y2OA 4WU8A 5B2IA 3B0CW 2NZDD 5GSUB 3AZNB 3MVDB 1PZRA 1KX4B 5GSUD 5B33B 3B6GD 4G92B 2NZDA 2F8NH 3AZIB 1H3OA 3C1CB 4Z5TB 3AV1B 2HIOB 3H0RC 3REKC 4WU9D 5B33D 5GSUA 3AZID 2YFVB 2XD5A 3B6GA 4Z5TD 2J8PA 1F66C 4WU9A 1P3MC 5AV8C 3AZIA 4YS3C 1JFIB 4CAYA 4Z5TA 5BT1C 5E5AC 1BH9B 3RELC 5F99B 1P3FB 3AV2B 5AY8B 2JCHA 4HGAB 4DRBA 4R8PB 1EQZB 5GT0C 5B32A 3IP4C 5JA4B 3AYWC 1P3FD 5AV5A 4H9OB 4J8WC 2PYOB 4WV4B 4J8VB 1M19A 5CP6B 1EQZD 4XZQB 5JRGB 5CPKC 5B1LB 1P3IA 4M6BA 4UUZB 2Y2GA 3MGRB 1P3BD 3B6FC 4EO5C 1P3OA 5B2JB 5CP6D 3X1VB 4XZQD 5JRGD 5B1LD 1EQZA 5B31D 3MGRD 1P3PD 5JA4A 1ZLAB 1P3BA 5B2JD 1HTAA 3X1VD 5B24B 5CP6A 4XZQA 5JRGA 5B1LA 3LELC 5B31A 4X23B 3MGRA 1P3AB 1P3PA 3AZLC 1U35A 3X1UB 5GXQD 5B24D 3AZJB 3X1VA 1AOIC 5B0ZB 4J8UC 4JJNC 2XD1A 1P3AD 3F6TA 2NQBA 5C3IB 5AV6C 5CPIA 1HQ3C 4QLCC 3X1UD 3UT9B 3AZHC 2ZM5A 1M18B 3AN2C 3AZEB 3AZJD 5GXQA 5G49B 3UTAC 5B32G 3NQUB 3AZFD 4YM6B 3UT9D 1P3LB 3AZGB 3X1UA 3KUYC 3AZED 5B2IC 3AZJA 3MGSC 3WTPC 3LJAC 5AVCA 4YM6D 1P3LD 3X1TA 3AZFA 3VH5A 3UT9A 4XUJB 5BS7A 5B40B 3TU4B 2BYKB 5BNVA 3NQUA 4NFTA 1P3LA 4KGCB 4XUJD 2NZDC 3WTPE 3TU4D 1M1AD 3WA9B 3A6ND 5AV9B 4KGCD 2F8NB 1KU5A 5GSUC 2F2AC 4XUJA 4Z66B 3AZKD 4J8XB 3REHD 3TU4A 2BYKA 3WA9D 1M1AA 3WKJB 3AZNC 3MVDC 3LZ0B 3A6NA 1KX4C 5B33C 1P3GA 3R45B 4G92C 1R4VA 3AZIC 4Z66D 4WU8B 3C1CC 4Z5TC 3AV1C 2HIOC 2RIQA 3O62B 3AZKA 3WKJD 3REHA 3MGPD 1KX5D 1WWSA 4DRAA 4Z66A 3O62D 2Y2NA 3MGPA 1KX5A 2NZDB 3KSYA 3MGQB 1H3OB 5BO0A 4KHAB 5AVBD 3O62A 3EPLA 3W98B 4H9QA 5F99C 3MGQD 1P3FC 3AV2C 3B6GB 5AY8C 3KXBD 4HGAC 4R8PC 1EQZC 5B0YB 1W2EA 3AZMD 3X1SD 5AVBA 4NE5A 4WU9B 3W98D 3MGQA 2PYOC 4J8VC 5CP6C 4CAYB 4XZQC 4KHAA 5JRGC 5B1LC 5B0YD 3KXBA 1P3KB 5B31C 3MGRC 5CPJB 3AZMA 3X1SA 1A7WA 1B6WA 1TZYA 3W98A 5B2JC 3X1VC 1P3KD 5B32B 5CHLB 5B0YA 1KX3A 5CPJD 2ZY5A 1ZLAC 5GT3B 3WAAA 5AV5B 4LD9B 3W99D 3W96B 1M19B 3REID 3B0DB 5B24C 1P3IB 5B32D 2FJ7D 3VH5T 5DNMB 4X23C 1P3KA 1P3AC 5GT3D 5CPJA 5AV5D 2BG1A 3X1UC 3A1IA 1P3OB 1M19D 4CSRB 3W96D 4LD9D 3W99A 3AZJC 1P3ID 5B0ZC 3REIA 5DNMD 5C3IC 2FJ7A 1P3BB 2Y2KA 3UT9C 1P3OD 5GT3A 3REJD 2RVQC 1M18C 5BS7C 4LD9A 3W96A 3AZEC 2L5AA 5B31B 4KUDD 1TAFA 3VH5W 5DNMA 1P3PB 4YM6C 1U35B 1P3LC 2AROD 3AZGC 5B1MD 2CV5D 4H9SA 3REJA 4CSRA 3UTBA 2NQBB 5CPIB 1U35D 4KUDA 4XUJC 2AROA 5B1MA 2CV5A 5GXQB 3TU4C 5B40C 3V9RA 3AFAA 4Z2MG 3EPHA 2NQBD 5CPID 5KDMB 3H0MC 3LZ1A 1BH8A
chains in the Genus database with same CATH topology
1P34B 3WA9C 5AVCB 3KWQB 3X1TB 5AV9C 3AZFB 3W97B 1P34D 3NQJA 4Z66C 4J8XC 5AVCD 3WKJC 5BNVB 3KWQD 3X1TD 3LZ0C 5KDMA 3W97D 1ID3B 4WU8C 1P34A 2DQNC 2UWXA 3O62C 3REKA 1F66D 1B67A 1P3MD 3KWQA 5AV8D 2YFWB 1ID3D 4YS3D 3W97A 4NE6A 4E44A 4NE3A 5BT1D 5E5AD 1M1AB 4WNNB 3EPJA 3A6NB 1F66A 1P3GB 1P3MA 2FFFB 3MGQC 5AV8A 2CWEA 1ID3A 4YS3A 3AZKB 3REHB 5E5AA 3AYWD 1P3GD 1Z2CB 3W98C 2YFWA 3B6GC 5CPKD 4WJ3C 2Y2QA 5GT0A 5B0YC 4E45A 4WNNA 3C1BB 4WU9C 3MGPB 3AYWA 1KX5B 1Q9CA 4J8WA 5BO0B 5CPKA 1P3KC 3VH6T 4G91B 3C1BD 5CPJC 1WWIA 4H9QB 3B6FA 3A1KA 3REIC 5B32C 2VQRA 5AVBB 5DNNB 5GT3C 3C1BA 5AV5C 4LD9C 3W96C 1T3UA 1M19C 2IO5B 3KXBB 1ULYA 3B0DC 3MNNB 1P3IC 3FDDA 5AV6D 3LELA 1HQ3D 4QLCD 5DNMC 3AZMB 2Y2JA 3VH6W 5DNND 3X1SB 2JSSA 1TZYB 1P3OC 3AN2D 3MNND 5BNXA 4J8UA 1KX3B 4H9NA 5AV6A 1HQ3A 4QLCA 1TZYD 3AZHA 1P3BC 3WAAB 2Y2LA 5DNNA 3AN2A 3MGSD 3MNNA 3LJAD 1KX3D 4ZUXB 2JE5A 3UTAA 1P3PC 4H9RA 3WAAD 1U35C 3KUYA 1N1JA 3W99B 2Y2PA 3REIB 4ZUXD 3MGSA 3WTPA 3LJAA 2NQBC 2FJ7B 5CPIC 4WZSB 2ZY3A 5GXQC 2LY8A 1TAFB 4ZUXA 2BYMA 4ZBJB 4AWLB 4DQYB 3REJB 3UTBB 1P34C 3AZND 3MVDD 2F8NK 5AVCC 1KX4D 3KWQC 3X1TC 4KUDB 3AZFC 2AROB 3VH6A 3C1CD 3UTBD 5B1MB 2CV5B 1S32B 3AV1D 2HIOD 3V9RB 2HUEB 3AFAB 4Z2MH 3AZNA 3MVDA 1KX4A 5B33A 1BH8B 3LZ1B 2F8NG 1S32D 1ID3C 3AFAD 3C1CA 3H0LC 3AV1A 2HIOA 3LZ1D 2G5IC 2YFVA 3NQJB 1S32A 1M1AC 3A6NC 5F99D 1P3GC 3AV2D 5AY8D 2Y2HA 4R8PD 5FUGB 2ZY4A 1JFIA 1F1EA 3REKB 3AZKC 3REHC 1BH9A 2DF4C 5F99A 2PYOD 1P3FA 4J8VD 3AV2A 5AY8A 4R8PA 3REKD 1BFMA 1F66B 3C1BC 3MGPC 1P3MB 3KFUG 1KX5C 5AV8B 4UPKA 2ZY2A 4H9OA 2PYOA 4J8VA 5FUGA 4YS3B 3EG5B 4UUZA 5E5AB 4KGCC 1ZLAD 4G91C 3RELB 5B2JA 5GT0B 4X23D 2G5HC 2Y2MA 5AVBC 3RELD 3AYWB 1ZLAA 5DNNC 4J8WB 5B0ZD 2IO5C 3KXBC 5CPKB 3MNNC 5B24A 5GT0D 3AL0C 4X23A 3AZMC 1P3AA 1M18D 2RVQD 3X1SC 3B6FB 4EO5B 1TZYC 3RELA 4J8WD 5B0ZA 1KX3C 3B0BA 3AZGD 3B6FD 3WAAC 1M18A 3AZEA 3LELB 5G49A 4ZUXC 3AZLB 4YM6A 3AZGA 5B40D 3W99C 5BNXB 1AOIB 4J8UB 4JJNB 3LELD 4H9NB 5B31G 5AV6B 3AZLD 1HQ3B 4QLCB 3AZHB 2FJ7C 4H9PB 3W97C 3P5JB 3AN2B 1AOID 5B40A 2Y2IA 4J8UD 4JJND 3UTAB 5AV9D 3AZHD 4H9RB 2F8ND 3AZLA 4KGCA 4ZBJC 4AWLC 3KUYB 1N1JB 4H9SC 3REJC 4J8XD 3UTBC 5B2IB 1AOIA 3MGSB 3WTPB 3UTAD 4JJNA 3LJAB 3B0CT 3LZ0D 3WA9A 5AV9A 4KUDC 2F8NA 3KUYD 4H9PA 2AROC 4WU8D 5B2ID 5B1MC 2CV5C 1S32C 3AFAC 2HUEC 4J8XA 3WTPD 3EPKA 3WKJA 2BYMB 3LZ0A 3LZ1C 3R45A 2W8SA 2Y2OA 4WU8A 5B2IA 3B0CW 2NZDD 5GSUB 3AZNB 3MVDB 1PZRA 1KX4B 5GSUD 5B33B 3B6GD 4G92B 2NZDA 2F8NH 3AZIB 1H3OA 3C1CB 4Z5TB 3AV1B 2HIOB 3H0RC 3REKC 4WU9D 5B33D 5GSUA 3AZID 2YFVB 2XD5A 3B6GA 4Z5TD 2J8PA 1F66C 4WU9A 1P3MC 5AV8C 3AZIA 4YS3C 1JFIB 4CAYA 4Z5TA 5BT1C 5E5AC 1BH9B 3RELC 5F99B 1P3FB 3AV2B 5AY8B 2JCHA 4HGAB 4DRBA 4R8PB 1EQZB 5GT0C 5B32A 3IP4C 5JA4B 3AYWC 1P3FD 5AV5A 4H9OB 4J8WC 2PYOB 4WV4B 4J8VB 1M19A 5CP6B 1EQZD 4XZQB 5JRGB 5CPKC 5B1LB 1P3IA 4M6BA 4UUZB 2Y2GA 3MGRB 1P3BD 3B6FC 4EO5C 1P3OA 5B2JB 5CP6D 3X1VB 4XZQD 5JRGD 5B1LD 1EQZA 5B31D 3MGRD 1P3PD 5JA4A 1ZLAB 1P3BA 5B2JD 1HTAA 3X1VD 5B24B 5CP6A 4XZQA 5JRGA 5B1LA 3LELC 5B31A 4X23B 3MGRA 1P3AB 1P3PA 3AZLC 1U35A 3X1UB 5GXQD 5B24D 3AZJB 3X1VA 1AOIC 5B0ZB 4J8UC 4JJNC 2XD1A 1P3AD 3F6TA 2NQBA 5C3IB 5AV6C 5CPIA 1HQ3C 4QLCC 3X1UD 3UT9B 3AZHC 2ZM5A 1M18B 3AN2C 3AZEB 3AZJD 5GXQA 5G49B 3UTAC 5B32G 3NQUB 3AZFD 4YM6B 3UT9D 1P3LB 3AZGB 3X1UA 3KUYC 3AZED 5B2IC 3AZJA 3MGSC 3WTPC 3LJAC 5AVCA 4YM6D 1P3LD 3X1TA 3AZFA 3VH5A 3UT9A 4XUJB 5BS7A 5B40B 3TU4B 2BYKB 5BNVA 3NQUA 4NFTA 1P3LA 4KGCB 4XUJD 2NZDC 3WTPE 3TU4D 1M1AD 3WA9B 3A6ND 5AV9B 4KGCD 2F8NB 1KU5A 5GSUC 2F2AC 4XUJA 4Z66B 3AZKD 4J8XB 3REHD 3TU4A 2BYKA 3WA9D 1M1AA 3WKJB 3AZNC 3MVDC 3LZ0B 3A6NA 1KX4C 5B33C 1P3GA 3R45B 4G92C 1R4VA 3AZIC 4Z66D 4WU8B 3C1CC 4Z5TC 3AV1C 2HIOC 2RIQA 3O62B 3AZKA 3WKJD 3REHA 3MGPD 1KX5D 1WWSA 4DRAA 4Z66A 3O62D 2Y2NA 3MGPA 1KX5A 2NZDB 3KSYA 3MGQB 1H3OB 5BO0A 4KHAB 5AVBD 3O62A 3EPLA 3W98B 4H9QA 5F99C 3MGQD 1P3FC 3AV2C 3B6GB 5AY8C 3KXBD 4HGAC 4R8PC 1EQZC 5B0YB 1W2EA 3AZMD 3X1SD 5AVBA 4NE5A 4WU9B 3W98D 3MGQA 2PYOC 4J8VC 5CP6C 4CAYB 4XZQC 4KHAA 5JRGC 5B1LC 5B0YD 3KXBA 1P3KB 5B31C 3MGRC 5CPJB 3AZMA 3X1SA 1A7WA 1B6WA 1TZYA 3W98A 5B2JC 3X1VC 1P3KD 5B32B 5CHLB 5B0YA 1KX3A 5CPJD 2ZY5A 1ZLAC 5GT3B 3WAAA 5AV5B 4LD9B 3W99D 3W96B 1M19B 3REID 3B0DB 5B24C 1P3IB 5B32D 2FJ7D 3VH5T 5DNMB 4X23C 1P3KA 1P3AC 5GT3D 5CPJA 5AV5D 2BG1A 3X1UC 3A1IA 1P3OB 1M19D 4CSRB 3W96D 4LD9D 3W99A 3AZJC 1P3ID 5B0ZC 3REIA 5DNMD 5C3IC 2FJ7A 1P3BB 2Y2KA 3UT9C 1P3OD 5GT3A 3REJD 2RVQC 1M18C 5BS7C 4LD9A 3W96A 3AZEC 2L5AA 5B31B 4KUDD 1TAFA 3VH5W 5DNMA 1P3PB 4YM6C 1U35B 1P3LC 2AROD 3AZGC 5B1MD 2CV5D 4H9SA 3REJA 4CSRA 3UTBA 2NQBB 5CPIB 1U35D 4KUDA 4XUJC 2AROA 5B1MA 2CV5A 5GXQB 3TU4C 5B40C 3V9RA 3AFAA 4Z2MG 3EPHA 2NQBD 5CPID 5KDMB 3H0MC 3LZ1A 1BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 B;  3WA9 C;  5AVC B;  3KWQ B;  3X1T B;  5AV9 C;  3AZF B;  3W97 B;  1P34 D;  3NQJ A;  4Z66 C;  4J8X C;  5AVC D;  3WKJ C;  5BNV B;  3KWQ D;  3X1T D;  3LZ0 C;  5KDM A;  3W97 D;  1ID3 B;  4WU8 C;  1P34 A;  3O62 C;  3REK A;  1F66 D;  1B67 A;  1P3M D;  3KWQ A;  5AV8 D;  2YFW B;  1ID3 D;  4YS3 D;  3W97 A;  4NE6 A;  4E44 A;  4NE3 A;  5BT1 D;  5E5A D;  1M1A B;  4WNN B;  3A6N B;  1F66 A;  1P3G B;  1P3M A;  3MGQ C;  5AV8 A;  2CWE A;  1ID3 A;  4YS3 A;  3AZK B;  3REH B;  5E5A A;  3AYW D;  1P3G D;  3W98 C;  2YFW A;  3B6G C;  5CPK D;  5GT0 A;  5B0Y C;  4E45 A;  4WNN A;  3C1B B;  4WU9 C;  3MGP B;  3AYW A;  1KX5 B;  1Q9C A;  4J8W A;  5BO0 B;  5CPK A;  1P3K C;  3VH6 T;  4G91 B;  3C1B D;  5CPJ C;  1WWI A;  4H9Q B;  3B6F A;  3REI C;  5B32 C;  5AVB B;  5DNN B;  5GT3 C;  3C1B A;  5AV5 C;  4LD9 C;  3W96 C;  1M19 C;  2IO5 B;  3KXB B;  1ULY A;  3B0D C;  3MNN B;  1P3I C;  5AV6 D;  3LEL A;  1HQ3 D;  4QLC D;  5DNM C;  3AZM B;  3VH6 W;  5DNN D;  3X1S B;  2JSS A;  1TZY B;  1P3O C;  3AN2 D;  3MNN D;  5BNX A;  4J8U A;  1KX3 B;  4H9N A;  5AV6 A;  1HQ3 A;  4QLC A;  1TZY D;  3AZH A;  1P3B C;  3WAA B;  5DNN A;  3AN2 A;  3MGS D;  3MNN A;  3LJA D;  1KX3 D;  4ZUX B;  3UTA A;  1P3P C;  4H9R A;  3WAA D;  1U35 C;  3KUY A;  1N1J A;  3W99 B;  3REI B;  4ZUX D;  3MGS A;  3WTP A;  3LJA A;  2NQB C;  2FJ7 B;  5CPI C;  4WZS B;  5GXQ C;  2LY8 A;  1TAF B;  4ZUX A;  2BYM A;  4ZBJ B;  4AWL B;  3REJ B;  3UTB B;  1P34 C;  3AZN D;  3MVD D;  2F8N K;  5AVC C;  1KX4 D;  3KWQ C;  3X1T C;  4KUD B;  3AZF C;  2ARO B;  3VH6 A;  3C1C D;  3UTB D;  5B1M B;  2CV5 B;  1S32 B;  3AV1 D;  2HIO D;  3V9R B;  2HUE B;  3AFA B;  4Z2M H;  3AZN A;  3MVD A;  1KX4 A;  5B33 A;  1BH8 B;  3LZ1 B;  2F8N G;  1S32 D;  1ID3 C;  3AFA D;  3C1C A;  3AV1 A;  2HIO A;  3LZ1 D;  2YFV A;  3NQJ B;  1S32 A;  1M1A C;  3A6N C;  5F99 D;  1P3G C;  3AV2 D;  5AY8 D;  4R8P D;  5FUG B;  1JFI A;  1F1E A;  3REK B;  3AZK C;  3REH C;  1BH9 A;  5F99 A;  2PYO D;  1P3F A;  4J8V D;  3AV2 A;  5AY8 A;  4R8P A;  3REK D;  1BFM A;  1F66 B;  3C1B C;  3MGP C;  1P3M B;  1KX5 C;  5AV8 B;  4H9O A;  2PYO A;  4J8V A;  5FUG A;  4YS3 B;  4UUZ A;  5E5A B;  4KGC C;  1ZLA D;  4G91 C;  3REL B;  5B2J A;  5GT0 B;  4X23 D;  5AVB C;  3REL D;  3AYW B;  1ZLA A;  5DNN C;  4J8W B;  5B0Z D;  2IO5 C;  3KXB C;  5CPK B;  3MNN C;  5B24 A;  5GT0 D;  4X23 A;  3AZM C;  1P3A A;  1M18 D;  2RVQ D;  3X1S C;  3B6F B;  4EO5 B;  1TZY C;  3REL A;  4J8W D;  5B0Z A;  1KX3 C;  3B0B A;  3AZG D;  3B6F D;  3WAA C;  1M18 A;  3AZE A;  3LEL B;  5G49 A;  4ZUX C;  3AZL B;  4YM6 A;  3AZG A;  5B40 D;  3W99 C;  5BNX B;  1AOI B;  4J8U B;  4JJN B;  3LEL D;  4H9N B;  5B31 G;  5AV6 B;  3AZL D;  1HQ3 B;  4QLC B;  3AZH B;  2FJ7 C;  4H9P B;  3W97 C;  3AN2 B;  1AOI D;  5B40 A;  4J8U D;  4JJN D;  3UTA B;  5AV9 D;  3AZH D;  4H9R B;  2F8N D;  3AZL A;  4KGC A;  4ZBJ C;  4AWL C;  3KUY B;  1N1J B;  4H9S C;  3REJ C;  4J8X D;  3UTB C;  5B2I B;  1AOI A;  3MGS B;  3WTP B;  3UTA D;  4JJN A;  3LJA B;  3B0C T;  3LZ0 D;  3WA9 A;  5AV9 A;  4KUD C;  2F8N A;  3KUY D;  4H9P A;  2ARO C;  4WU8 D;  5B2I D;  5B1M C;  2CV5 C;  1S32 C;  3AFA C;  2HUE C;  4J8X A;  3WTP D;  3WKJ A;  2BYM B;  3LZ0 A;  3LZ1 C;  3R45 A;  4WU8 A;  5B2I A;  3B0C W;  2NZD D;  5GSU B;  3AZN B;  3MVD B;  1KX4 B;  5GSU D;  5B33 B;  3B6G D;  4G92 B;  2NZD A;  2F8N H;  3AZI B;  1H3O A;  3C1C B;  4Z5T B;  3AV1 B;  2HIO B;  3REK C;  4WU9 D;  5B33 D;  5GSU A;  3AZI D;  2YFV B;  3B6G A;  4Z5T D;  1F66 C;  4WU9 A;  1P3M C;  5AV8 C;  3AZI A;  4YS3 C;  1JFI B;  4CAY A;  4Z5T A;  5BT1 C;  5E5A C;  1BH9 B;  3REL C;  5F99 B;  1P3F B;  3AV2 B;  5AY8 B;  4HGA B;  4DRB A;  4R8P B;  1EQZ B;  5GT0 C;  5B32 A;  5JA4 B;  3AYW C;  1P3F D;  5AV5 A;  4H9O B;  4J8W C;  2PYO B;  4WV4 B;  4J8V B;  1M19 A;  5CP6 B;  1EQZ D;  4XZQ B;  5JRG B;  5CPK C;  5B1L B;  1P3I A;  4M6B A;  4UUZ B;  3MGR B;  1P3B D;  3B6F C;  4EO5 C;  1P3O A;  5B2J B;  5CP6 D;  3X1V B;  4XZQ D;  5JRG D;  5B1L D;  1EQZ A;  5B31 D;  3MGR D;  1P3P D;  5JA4 A;  1ZLA B;  1P3B A;  5B2J D;  1HTA A;  3X1V D;  5B24 B;  5CP6 A;  4XZQ A;  5JRG A;  5B1L A;  3LEL C;  5B31 A;  4X23 B;  3MGR A;  1P3A B;  1P3P A;  3AZL C;  1U35 A;  3X1U B;  5GXQ D;  5B24 D;  3AZJ B;  3X1V A;  1AOI C;  5B0Z B;  4J8U C;  4JJN C;  1P3A D;  2NQB A;  5C3I B;  5AV6 C;  5CPI A;  1HQ3 C;  4QLC C;  3X1U D;  3UT9 B;  3AZH C;  1M18 B;  3AN2 C;  3AZE B;  3AZJ D;  5GXQ A;  5G49 B;  3UTA C;  5B32 G;  3NQU B;  3AZF D;  4YM6 B;  3UT9 D;  1P3L B;  3AZG B;  3X1U A;  3KUY C;  3AZE D;  5B2I C;  3AZJ A;  3MGS C;  3WTP C;  3LJA C;  5AVC A;  4YM6 D;  1P3L D;  3X1T A;  3AZF A;  3VH5 A;  3UT9 A;  4XUJ B;  5BS7 A;  5B40 B;  3TU4 B;  2BYK B;  5BNV A;  3NQU A;  4NFT A;  1P3L A;  4KGC B;  4XUJ D;  2NZD C;  3WTP E;  3TU4 D;  1M1A D;  3WA9 B;  3A6N D;  5AV9 B;  4KGC D;  2F8N B;  1KU5 A;  5GSU C;  4XUJ A;  4Z66 B;  3AZK D;  4J8X B;  3REH D;  3TU4 A;  2BYK A;  3WA9 D;  1M1A A;  3WKJ B;  3AZN C;  3MVD C;  3LZ0 B;  3A6N A;  1KX4 C;  5B33 C;  1P3G A;  3R45 B;  4G92 C;  1R4V A;  3AZI C;  4Z66 D;  4WU8 B;  3C1C C;  4Z5T C;  3AV1 C;  2HIO C;  3O62 B;  3AZK A;  3WKJ D;  3REH A;  3MGP D;  1KX5 D;  1WWS A;  4DRA A;  4Z66 A;  3O62 D;  3MGP A;  1KX5 A;  2NZD B;  3KSY A;  3MGQ B;  1H3O B;  5BO0 A;  4KHA B;  5AVB D;  3O62 A;  3W98 B;  4H9Q A;  5F99 C;  3MGQ D;  1P3F C;  3AV2 C;  3B6G B;  5AY8 C;  3KXB D;  4HGA C;  4R8P C;  1EQZ C;  5B0Y B;  3AZM D;  3X1S D;  5AVB A;  4NE5 A;  4WU9 B;  3W98 D;  3MGQ A;  2PYO C;  4J8V C;  5CP6 C;  4CAY B;  4XZQ C;  4KHA A;  5JRG C;  5B1L C;  5B0Y D;  3KXB A;  1P3K B;  5B31 C;  3MGR C;  5CPJ B;  3AZM A;  3X1S A;  1A7W A;  1B6W A;  1TZY A;  3W98 A;  5B2J C;  3X1V C;  1P3K D;  5B32 B;  5CHL B;  5B0Y A;  1KX3 A;  5CPJ D;  1ZLA C;  5GT3 B;  3WAA A;  5AV5 B;  4LD9 B;  3W99 D;  3W96 B;  1M19 B;  3REI D;  3B0D B;  5B24 C;  1P3I B;  5B32 D;  2FJ7 D;  3VH5 T;  5DNM B;  4X23 C;  1P3K A;  1P3A C;  5GT3 D;  5CPJ A;  5AV5 D;  3X1U C;  1P3O B;  3W96 D;  4LD9 D;  1M19 D;  4CSR B;  3W99 A;  3AZJ C;  1P3I D;  5B0Z C;  3REI A;  5DNM D;  5C3I C;  2FJ7 A;  1P3B B;  3UT9 C;  1P3O D;  1M18 C;  5GT3 A;  3REJ D;  2RVQ C;  5BS7 C;  4LD9 A;  3W96 A;  3AZE C;  2L5A A;  5B31 B;  4KUD D;  1TAF A;  3VH5 W;  5DNM A;  1P3P B;  4YM6 C;  1U35 B;  1P3L C;  2ARO D;  3AZG C;  5B1M D;  2CV5 D;  4H9S A;  3REJ A;  4CSR A;  3UTB A;  2NQB B;  5CPI B;  1U35 D;  4KUD A;  4XUJ C;  2ARO A;  5B1M A;  2CV5 A;  5GXQ B;  3TU4 C;  5B40 C;  3V9R A;  3AFA A;  4Z2M G;  2NQB D;  5CPI D;  5KDM B;  3LZ1 A;  1BH8 A; 
#chains in the Genus database with same CATH topology
 1P34 B;  3WA9 C;  5AVC B;  3KWQ B;  3X1T B;  5AV9 C;  3AZF B;  3W97 B;  1P34 D;  3NQJ A;  4Z66 C;  4J8X C;  5AVC D;  3WKJ C;  5BNV B;  3KWQ D;  3X1T D;  3LZ0 C;  5KDM A;  3W97 D;  1ID3 B;  4WU8 C;  1P34 A;  2DQN C;  2UWX A;  3O62 C;  3REK A;  1F66 D;  1B67 A;  1P3M D;  3KWQ A;  5AV8 D;  2YFW B;  1ID3 D;  4YS3 D;  3W97 A;  4NE6 A;  4E44 A;  4NE3 A;  5BT1 D;  5E5A D;  1M1A B;  4WNN B;  3EPJ A;  3A6N B;  1F66 A;  1P3G B;  1P3M A;  2FFF B;  3MGQ C;  5AV8 A;  2CWE A;  1ID3 A;  4YS3 A;  3AZK B;  3REH B;  5E5A A;  3AYW D;  1P3G D;  1Z2C B;  3W98 C;  2YFW A;  3B6G C;  5CPK D;  4WJ3 C;  2Y2Q A;  5GT0 A;  5B0Y C;  4E45 A;  4WNN A;  3C1B B;  4WU9 C;  3MGP B;  3AYW A;  1KX5 B;  1Q9C A;  4J8W A;  5BO0 B;  5CPK A;  1P3K C;  3VH6 T;  4G91 B;  3C1B D;  5CPJ C;  1WWI A;  4H9Q B;  3B6F A;  3A1K A;  3REI C;  5B32 C;  2VQR A;  5AVB B;  5DNN B;  5GT3 C;  3C1B A;  5AV5 C;  4LD9 C;  3W96 C;  1T3U A;  1M19 C;  2IO5 B;  3KXB B;  1ULY A;  3B0D C;  3MNN B;  1P3I C;  3FDD A;  5AV6 D;  3LEL A;  1HQ3 D;  4QLC D;  5DNM C;  3AZM B;  2Y2J A;  3VH6 W;  5DNN D;  3X1S B;  2JSS A;  1TZY B;  1P3O C;  3AN2 D;  3MNN D;  5BNX A;  4J8U A;  1KX3 B;  4H9N A;  5AV6 A;  1HQ3 A;  4QLC A;  1TZY D;  3AZH A;  1P3B C;  3WAA B;  2Y2L A;  5DNN A;  3AN2 A;  3MGS D;  3MNN A;  3LJA D;  1KX3 D;  4ZUX B;  2JE5 A;  3UTA A;  1P3P C;  4H9R A;  3WAA D;  1U35 C;  3KUY A;  1N1J A;  3W99 B;  2Y2P A;  3REI B;  4ZUX D;  3MGS A;  3WTP A;  3LJA A;  2NQB C;  2FJ7 B;  5CPI C;  4WZS B;  2ZY3 A;  5GXQ C;  2LY8 A;  1TAF B;  4ZUX A;  2BYM A;  4ZBJ B;  4AWL B;  4DQY B;  3REJ B;  3UTB B;  1P34 C;  3AZN D;  3MVD D;  2F8N K;  5AVC C;  1KX4 D;  3KWQ C;  3X1T C;  4KUD B;  3AZF C;  2ARO B;  3VH6 A;  3C1C D;  3UTB D;  5B1M B;  2CV5 B;  1S32 B;  3AV1 D;  2HIO D;  3V9R B;  2HUE B;  3AFA B;  4Z2M H;  3AZN A;  3MVD A;  1KX4 A;  5B33 A;  1BH8 B;  3LZ1 B;  2F8N G;  1S32 D;  1ID3 C;  3AFA D;  3C1C A;  3H0L C;  3AV1 A;  2HIO A;  3LZ1 D;  2G5I C;  2YFV A;  3NQJ B;  1S32 A;  1M1A C;  3A6N C;  5F99 D;  1P3G C;  3AV2 D;  5AY8 D;  2Y2H A;  4R8P D;  5FUG B;  2ZY4 A;  1JFI A;  1F1E A;  3REK B;  3AZK C;  3REH C;  1BH9 A;  2DF4 C;  5F99 A;  2PYO D;  1P3F A;  4J8V D;  3AV2 A;  5AY8 A;  4R8P A;  3REK D;  1BFM A;  1F66 B;  3C1B C;  3MGP C;  1P3M B;  3KFU G;  1KX5 C;  5AV8 B;  4UPK A;  2ZY2 A;  4H9O A;  2PYO A;  4J8V A;  5FUG A;  4YS3 B;  3EG5 B;  4UUZ A;  5E5A B;  4KGC C;  1ZLA D;  4G91 C;  3REL B;  5B2J A;  5GT0 B;  4X23 D;  2G5H C;  2Y2M A;  5AVB C;  3REL D;  3AYW B;  1ZLA A;  5DNN C;  4J8W B;  5B0Z D;  2IO5 C;  3KXB C;  5CPK B;  3MNN C;  5B24 A;  5GT0 D;  3AL0 C;  4X23 A;  3AZM C;  1P3A A;  1M18 D;  2RVQ D;  3X1S C;  3B6F B;  4EO5 B;  1TZY C;  3REL A;  4J8W D;  5B0Z A;  1KX3 C;  3B0B A;  3AZG D;  3B6F D;  3WAA C;  1M18 A;  3AZE A;  3LEL B;  5G49 A;  4ZUX C;  3AZL B;  4YM6 A;  3AZG A;  5B40 D;  3W99 C;  5BNX B;  1AOI B;  4J8U B;  4JJN B;  3LEL D;  4H9N B;  5B31 G;  5AV6 B;  3AZL D;  1HQ3 B;  4QLC B;  3AZH B;  2FJ7 C;  4H9P B;  3W97 C;  3P5J B;  3AN2 B;  1AOI D;  5B40 A;  2Y2I A;  4J8U D;  4JJN D;  3UTA B;  5AV9 D;  3AZH D;  4H9R B;  2F8N D;  3AZL A;  4KGC A;  4ZBJ C;  4AWL C;  3KUY B;  1N1J B;  4H9S C;  3REJ C;  4J8X D;  3UTB C;  5B2I B;  1AOI A;  3MGS B;  3WTP B;  3UTA D;  4JJN A;  3LJA B;  3B0C T;  3LZ0 D;  3WA9 A;  5AV9 A;  4KUD C;  2F8N A;  3KUY D;  4H9P A;  2ARO C;  4WU8 D;  5B2I D;  5B1M C;  2CV5 C;  1S32 C;  3AFA C;  2HUE C;  4J8X A;  3WTP D;  3EPK A;  3WKJ A;  2BYM B;  3LZ0 A;  3LZ1 C;  3R45 A;  2W8S A;  2Y2O A;  4WU8 A;  5B2I A;  3B0C W;  2NZD D;  5GSU B;  3AZN B;  3MVD B;  1PZR A;  1KX4 B;  5GSU D;  5B33 B;  3B6G D;  4G92 B;  2NZD A;  2F8N H;  3AZI B;  1H3O A;  3C1C B;  4Z5T B;  3AV1 B;  2HIO B;  3H0R C;  3REK C;  4WU9 D;  5B33 D;  5GSU A;  3AZI D;  2YFV B;  2XD5 A;  3B6G A;  4Z5T D;  2J8P A;  1F66 C;  4WU9 A;  1P3M C;  5AV8 C;  3AZI A;  4YS3 C;  1JFI B;  4CAY A;  4Z5T A;  5BT1 C;  5E5A C;  1BH9 B;  3REL C;  5F99 B;  1P3F B;  3AV2 B;  5AY8 B;  2JCH A;  4HGA B;  4DRB A;  4R8P B;  1EQZ B;  5GT0 C;  5B32 A;  3IP4 C;  5JA4 B;  3AYW C;  1P3F D;  5AV5 A;  4H9O B;  4J8W C;  2PYO B;  4WV4 B;  4J8V B;  1M19 A;  5CP6 B;  1EQZ D;  4XZQ B;  5JRG B;  5CPK C;  5B1L B;  1P3I A;  4M6B A;  4UUZ B;  2Y2G A;  3MGR B;  1P3B D;  3B6F C;  4EO5 C;  1P3O A;  5B2J B;  5CP6 D;  3X1V B;  4XZQ D;  5JRG D;  5B1L D;  1EQZ A;  5B31 D;  3MGR D;  1P3P D;  5JA4 A;  1ZLA B;  1P3B A;  5B2J D;  1HTA A;  3X1V D;  5B24 B;  5CP6 A;  4XZQ A;  5JRG A;  5B1L A;  3LEL C;  5B31 A;  4X23 B;  3MGR A;  1P3A B;  1P3P A;  3AZL C;  1U35 A;  3X1U B;  5GXQ D;  5B24 D;  3AZJ B;  3X1V A;  1AOI C;  5B0Z B;  4J8U C;  4JJN C;  2XD1 A;  1P3A D;  3F6T A;  2NQB A;  5C3I B;  5AV6 C;  5CPI A;  1HQ3 C;  4QLC C;  3X1U D;  3UT9 B;  3AZH C;  2ZM5 A;  1M18 B;  3AN2 C;  3AZE B;  3AZJ D;  5GXQ A;  5G49 B;  3UTA C;  5B32 G;  3NQU B;  3AZF D;  4YM6 B;  3UT9 D;  1P3L B;  3AZG B;  3X1U A;  3KUY C;  3AZE D;  5B2I C;  3AZJ A;  3MGS C;  3WTP C;  3LJA C;  5AVC A;  4YM6 D;  1P3L D;  3X1T A;  3AZF A;  3VH5 A;  3UT9 A;  4XUJ B;  5BS7 A;  5B40 B;  3TU4 B;  2BYK B;  5BNV A;  3NQU A;  4NFT A;  1P3L A;  4KGC B;  4XUJ D;  2NZD C;  3WTP E;  3TU4 D;  1M1A D;  3WA9 B;  3A6N D;  5AV9 B;  4KGC D;  2F8N B;  1KU5 A;  5GSU C;  2F2A C;  4XUJ A;  4Z66 B;  3AZK D;  4J8X B;  3REH D;  3TU4 A;  2BYK A;  3WA9 D;  1M1A A;  3WKJ B;  3AZN C;  3MVD C;  3LZ0 B;  3A6N A;  1KX4 C;  5B33 C;  1P3G A;  3R45 B;  4G92 C;  1R4V A;  3AZI C;  4Z66 D;  4WU8 B;  3C1C C;  4Z5T C;  3AV1 C;  2HIO C;  2RIQ A;  3O62 B;  3AZK A;  3WKJ D;  3REH A;  3MGP D;  1KX5 D;  1WWS A;  4DRA A;  4Z66 A;  3O62 D;  2Y2N A;  3MGP A;  1KX5 A;  2NZD B;  3KSY A;  3MGQ B;  1H3O B;  5BO0 A;  4KHA B;  5AVB D;  3O62 A;  3EPL A;  3W98 B;  4H9Q A;  5F99 C;  3MGQ D;  1P3F C;  3AV2 C;  3B6G B;  5AY8 C;  3KXB D;  4HGA C;  4R8P C;  1EQZ C;  5B0Y B;  1W2E A;  3AZM D;  3X1S D;  5AVB A;  4NE5 A;  4WU9 B;  3W98 D;  3MGQ A;  2PYO C;  4J8V C;  5CP6 C;  4CAY B;  4XZQ C;  4KHA A;  5JRG C;  5B1L C;  5B0Y D;  3KXB A;  1P3K B;  5B31 C;  3MGR C;  5CPJ B;  3AZM A;  3X1S A;  1A7W A;  1B6W A;  1TZY A;  3W98 A;  5B2J C;  3X1V C;  1P3K D;  5B32 B;  5CHL B;  5B0Y A;  1KX3 A;  5CPJ D;  2ZY5 A;  1ZLA C;  5GT3 B;  3WAA A;  5AV5 B;  4LD9 B;  3W99 D;  3W96 B;  1M19 B;  3REI D;  3B0D B;  5B24 C;  1P3I B;  5B32 D;  2FJ7 D;  3VH5 T;  5DNM B;  4X23 C;  1P3K A;  1P3A C;  5GT3 D;  5CPJ A;  5AV5 D;  2BG1 A;  3X1U C;  3A1I A;  1P3O B;  1M19 D;  4CSR B;  3W96 D;  4LD9 D;  3W99 A;  3AZJ C;  1P3I D;  5B0Z C;  3REI A;  5DNM D;  5C3I C;  2FJ7 A;  1P3B B;  2Y2K A;  3UT9 C;  1P3O D;  5GT3 A;  3REJ D;  2RVQ C;  1M18 C;  5BS7 C;  4LD9 A;  3W96 A;  3AZE C;  2L5A A;  5B31 B;  4KUD D;  1TAF A;  3VH5 W;  5DNM A;  1P3P B;  4YM6 C;  1U35 B;  1P3L C;  2ARO D;  3AZG C;  5B1M D;  2CV5 D;  4H9S A;  3REJ A;  4CSR A;  3UTB A;  2NQB B;  5CPI B;  1U35 D;  4KUD A;  4XUJ C;  2ARO A;  5B1M A;  2CV5 A;  5GXQ B;  3TU4 C;  5B40 C;  3V9R A;  3AFA A;  4Z2M G;  3EPH A;  2NQB D;  5CPI D;  5KDM B;  3H0M C;  3LZ1 A;  1BH8 A; 
#chains in the Genus database with same CATH homology
 1P34 B;  3WA9 C;  5AVC B;  3KWQ B;  3X1T B;  5AV9 C;  3AZF B;  3W97 B;  1P34 D;  3NQJ A;  4Z66 C;  4J8X C;  5AVC D;  3WKJ C;  5BNV B;  3KWQ D;  3X1T D;  3LZ0 C;  5KDM A;  3W97 D;  1ID3 B;  4WU8 C;  1P34 A;  2DQN C;  2UWX A;  3O62 C;  3REK A;  1F66 D;  1B67 A;  1P3M D;  3KWQ A;  5AV8 D;  2YFW B;  1ID3 D;  4YS3 D;  3W97 A;  4NE6 A;  4E44 A;  4NE3 A;  5BT1 D;  5E5A D;  1M1A B;  4WNN B;  3EPJ A;  3A6N B;  1F66 A;  1P3G B;  1P3M A;  2FFF B;  3MGQ C;  5AV8 A;  2CWE A;  1ID3 A;  4YS3 A;  3AZK B;  3REH B;  5E5A A;  3AYW D;  1P3G D;  1Z2C B;  3W98 C;  2YFW A;  3B6G C;  5CPK D;  4WJ3 C;  2Y2Q A;  5GT0 A;  5B0Y C;  4E45 A;  4WNN A;  3C1B B;  4WU9 C;  3MGP B;  3AYW A;  1KX5 B;  1Q9C A;  4J8W A;  5BO0 B;  5CPK A;  1P3K C;  3VH6 T;  4G91 B;  3C1B D;  5CPJ C;  1WWI A;  4H9Q B;  3B6F A;  3A1K A;  3REI C;  5B32 C;  2VQR A;  5AVB B;  5DNN B;  5GT3 C;  3C1B A;  5AV5 C;  4LD9 C;  3W96 C;  1T3U A;  1M19 C;  2IO5 B;  3KXB B;  1ULY A;  3B0D C;  3MNN B;  1P3I C;  3FDD A;  5AV6 D;  3LEL A;  1HQ3 D;  4QLC D;  5DNM C;  3AZM B;  2Y2J A;  3VH6 W;  5DNN D;  3X1S B;  2JSS A;  1TZY B;  1P3O C;  3AN2 D;  3MNN D;  5BNX A;  4J8U A;  1KX3 B;  4H9N A;  5AV6 A;  1HQ3 A;  4QLC A;  1TZY D;  3AZH A;  1P3B C;  3WAA B;  2Y2L A;  5DNN A;  3AN2 A;  3MGS D;  3MNN A;  3LJA D;  1KX3 D;  4ZUX B;  2JE5 A;  3UTA A;  1P3P C;  4H9R A;  3WAA D;  1U35 C;  3KUY A;  1N1J A;  3W99 B;  2Y2P A;  3REI B;  4ZUX D;  3MGS A;  3WTP A;  3LJA A;  2NQB C;  2FJ7 B;  5CPI C;  4WZS B;  2ZY3 A;  5GXQ C;  2LY8 A;  1TAF B;  4ZUX A;  2BYM A;  4ZBJ B;  4AWL B;  4DQY B;  3REJ B;  3UTB B;  1P34 C;  3AZN D;  3MVD D;  2F8N K;  5AVC C;  1KX4 D;  3KWQ C;  3X1T C;  4KUD B;  3AZF C;  2ARO B;  3VH6 A;  3C1C D;  3UTB D;  5B1M B;  2CV5 B;  1S32 B;  3AV1 D;  2HIO D;  3V9R B;  2HUE B;  3AFA B;  4Z2M H;  3AZN A;  3MVD A;  1KX4 A;  5B33 A;  1BH8 B;  3LZ1 B;  2F8N G;  1S32 D;  1ID3 C;  3AFA D;  3C1C A;  3H0L C;  3AV1 A;  2HIO A;  3LZ1 D;  2G5I C;  2YFV A;  3NQJ B;  1S32 A;  1M1A C;  3A6N C;  5F99 D;  1P3G C;  3AV2 D;  5AY8 D;  2Y2H A;  4R8P D;  5FUG B;  2ZY4 A;  1JFI A;  1F1E A;  3REK B;  3AZK C;  3REH C;  1BH9 A;  2DF4 C;  5F99 A;  2PYO D;  1P3F A;  4J8V D;  3AV2 A;  5AY8 A;  4R8P A;  3REK D;  1BFM A;  1F66 B;  3C1B C;  3MGP C;  1P3M B;  3KFU G;  1KX5 C;  5AV8 B;  4UPK A;  2ZY2 A;  4H9O A;  2PYO A;  4J8V A;  5FUG A;  4YS3 B;  3EG5 B;  4UUZ A;  5E5A B;  4KGC C;  1ZLA D;  4G91 C;  3REL B;  5B2J A;  5GT0 B;  4X23 D;  2G5H C;  2Y2M A;  5AVB C;  3REL D;  3AYW B;  1ZLA A;  5DNN C;  4J8W B;  5B0Z D;  2IO5 C;  3KXB C;  5CPK B;  3MNN C;  5B24 A;  5GT0 D;  3AL0 C;  4X23 A;  3AZM C;  1P3A A;  1M18 D;  2RVQ D;  3X1S C;  3B6F B;  4EO5 B;  1TZY C;  3REL A;  4J8W D;  5B0Z A;  1KX3 C;  3B0B A;  3AZG D;  3B6F D;  3WAA C;  1M18 A;  3AZE A;  3LEL B;  5G49 A;  4ZUX C;  3AZL B;  4YM6 A;  3AZG A;  5B40 D;  3W99 C;  5BNX B;  1AOI B;  4J8U B;  4JJN B;  3LEL D;  4H9N B;  5B31 G;  5AV6 B;  3AZL D;  1HQ3 B;  4QLC B;  3AZH B;  2FJ7 C;  4H9P B;  3W97 C;  3P5J B;  3AN2 B;  1AOI D;  5B40 A;  2Y2I A;  4J8U D;  4JJN D;  3UTA B;  5AV9 D;  3AZH D;  4H9R B;  2F8N D;  3AZL A;  4KGC A;  4ZBJ C;  4AWL C;  3KUY B;  1N1J B;  4H9S C;  3REJ C;  4J8X D;  3UTB C;  5B2I B;  1AOI A;  3MGS B;  3WTP B;  3UTA D;  4JJN A;  3LJA B;  3B0C T;  3LZ0 D;  3WA9 A;  5AV9 A;  4KUD C;  2F8N A;  3KUY D;  4H9P A;  2ARO C;  4WU8 D;  5B2I D;  5B1M C;  2CV5 C;  1S32 C;  3AFA C;  2HUE C;  4J8X A;  3WTP D;  3EPK A;  3WKJ A;  2BYM B;  3LZ0 A;  3LZ1 C;  3R45 A;  2W8S A;  2Y2O A;  4WU8 A;  5B2I A;  3B0C W;  2NZD D;  5GSU B;  3AZN B;  3MVD B;  1PZR A;  1KX4 B;  5GSU D;  5B33 B;  3B6G D;  4G92 B;  2NZD A;  2F8N H;  3AZI B;  1H3O A;  3C1C B;  4Z5T B;  3AV1 B;  2HIO B;  3H0R C;  3REK C;  4WU9 D;  5B33 D;  5GSU A;  3AZI D;  2YFV B;  2XD5 A;  3B6G A;  4Z5T D;  2J8P A;  1F66 C;  4WU9 A;  1P3M C;  5AV8 C;  3AZI A;  4YS3 C;  1JFI B;  4CAY A;  4Z5T A;  5BT1 C;  5E5A C;  1BH9 B;  3REL C;  5F99 B;  1P3F B;  3AV2 B;  5AY8 B;  2JCH A;  4HGA B;  4DRB A;  4R8P B;  1EQZ B;  5GT0 C;  5B32 A;  3IP4 C;  5JA4 B;  3AYW C;  1P3F D;  5AV5 A;  4H9O B;  4J8W C;  2PYO B;  4WV4 B;  4J8V B;  1M19 A;  5CP6 B;  1EQZ D;  4XZQ B;  5JRG B;  5CPK C;  5B1L B;  1P3I A;  4M6B A;  4UUZ B;  2Y2G A;  3MGR B;  1P3B D;  3B6F C;  4EO5 C;  1P3O A;  5B2J B;  5CP6 D;  3X1V B;  4XZQ D;  5JRG D;  5B1L D;  1EQZ A;  5B31 D;  3MGR D;  1P3P D;  5JA4 A;  1ZLA B;  1P3B A;  5B2J D;  1HTA A;  3X1V D;  5B24 B;  5CP6 A;  4XZQ A;  5JRG A;  5B1L A;  3LEL C;  5B31 A;  4X23 B;  3MGR A;  1P3A B;  1P3P A;  3AZL C;  1U35 A;  3X1U B;  5GXQ D;  5B24 D;  3AZJ B;  3X1V A;  1AOI C;  5B0Z B;  4J8U C;  4JJN C;  2XD1 A;  1P3A D;  3F6T A;  2NQB A;  5C3I B;  5AV6 C;  5CPI A;  1HQ3 C;  4QLC C;  3X1U D;  3UT9 B;  3AZH C;  2ZM5 A;  1M18 B;  3AN2 C;  3AZE B;  3AZJ D;  5GXQ A;  5G49 B;  3UTA C;  5B32 G;  3NQU B;  3AZF D;  4YM6 B;  3UT9 D;  1P3L B;  3AZG B;  3X1U A;  3KUY C;  3AZE D;  5B2I C;  3AZJ A;  3MGS C;  3WTP C;  3LJA C;  5AVC A;  4YM6 D;  1P3L D;  3X1T A;  3AZF A;  3VH5 A;  3UT9 A;  4XUJ B;  5BS7 A;  5B40 B;  3TU4 B;  2BYK B;  5BNV A;  3NQU A;  4NFT A;  1P3L A;  4KGC B;  4XUJ D;  2NZD C;  3WTP E;  3TU4 D;  1M1A D;  3WA9 B;  3A6N D;  5AV9 B;  4KGC D;  2F8N B;  1KU5 A;  5GSU C;  2F2A C;  4XUJ A;  4Z66 B;  3AZK D;  4J8X B;  3REH D;  3TU4 A;  2BYK A;  3WA9 D;  1M1A A;  3WKJ B;  3AZN C;  3MVD C;  3LZ0 B;  3A6N A;  1KX4 C;  5B33 C;  1P3G A;  3R45 B;  4G92 C;  1R4V A;  3AZI C;  4Z66 D;  4WU8 B;  3C1C C;  4Z5T C;  3AV1 C;  2HIO C;  2RIQ A;  3O62 B;  3AZK A;  3WKJ D;  3REH A;  3MGP D;  1KX5 D;  1WWS A;  4DRA A;  4Z66 A;  3O62 D;  2Y2N A;  3MGP A;  1KX5 A;  2NZD B;  3KSY A;  3MGQ B;  1H3O B;  5BO0 A;  4KHA B;  5AVB D;  3O62 A;  3EPL A;  3W98 B;  4H9Q A;  5F99 C;  3MGQ D;  1P3F C;  3AV2 C;  3B6G B;  5AY8 C;  3KXB D;  4HGA C;  4R8P C;  1EQZ C;  5B0Y B;  1W2E A;  3AZM D;  3X1S D;  5AVB A;  4NE5 A;  4WU9 B;  3W98 D;  3MGQ A;  2PYO C;  4J8V C;  5CP6 C;  4CAY B;  4XZQ C;  4KHA A;  5JRG C;  5B1L C;  5B0Y D;  3KXB A;  1P3K B;  5B31 C;  3MGR C;  5CPJ B;  3AZM A;  3X1S A;  1A7W A;  1B6W A;  1TZY A;  3W98 A;  5B2J C;  3X1V C;  1P3K D;  5B32 B;  5CHL B;  5B0Y A;  1KX3 A;  5CPJ D;  2ZY5 A;  1ZLA C;  5GT3 B;  3WAA A;  5AV5 B;  4LD9 B;  3W99 D;  3W96 B;  1M19 B;  3REI D;  3B0D B;  5B24 C;  1P3I B;  5B32 D;  2FJ7 D;  3VH5 T;  5DNM B;  4X23 C;  1P3K A;  1P3A C;  5GT3 D;  5CPJ A;  5AV5 D;  2BG1 A;  3X1U C;  3A1I A;  1P3O B;  1M19 D;  4CSR B;  3W96 D;  4LD9 D;  3W99 A;  3AZJ C;  1P3I D;  5B0Z C;  3REI A;  5DNM D;  5C3I C;  2FJ7 A;  1P3B B;  2Y2K A;  3UT9 C;  1P3O D;  5GT3 A;  3REJ D;  2RVQ C;  1M18 C;  5BS7 C;  4LD9 A;  3W96 A;  3AZE C;  2L5A A;  5B31 B;  4KUD D;  1TAF A;  3VH5 W;  5DNM A;  1P3P B;  4YM6 C;  1U35 B;  1P3L C;  2ARO D;  3AZG C;  5B1M D;  2CV5 D;  4H9S A;  3REJ A;  4CSR A;  3UTB A;  2NQB B;  5CPI B;  1U35 D;  4KUD A;  4XUJ C;  2ARO A;  5B1M A;  2CV5 A;  5GXQ B;  3TU4 C;  5B40 C;  3V9R A;  3AFA A;  4Z2M G;  3EPH A;  2NQB D;  5CPI D;  5KDM B;  3H0M C;  3LZ1 A;  1BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...