3TU4D

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4D00
3AZGB 3UTAD 1P3KA 3REIC 1P3ID 3B6GB 1TAFA 3REHB 3MGRC 3AV1B 5AV5B 2L5AA 1ID3B 5B31A 4NE5A 3AZJA 4KGCC 3W97A 1P3BD 4KHAB 1F66B 1P3LD 3O62A 3X1TC 4YM6C 3REKA 1BH9B 3REJC 5AV9C 5KDMA 1P3AC 4EO5C 2HUEB 1P3OB 4WU8B 5B2JA 2F8NH 1P3GC 5CP6C 3RELA 1S32C 1KX4A 5CPIB 5C3IB 3AZHC 3KWQD 5AY8B 1B6WA 4CSRA 1WWSA 4XZQC 3AYWA 5B40D 5BS7A 4XUJA 4AWLC 5B32B 1M1AB 2HIOA 5AV8B 4Z5TC 2PYOD 1R4VA 5AVCA 3MGSB 4WU9A 1KX5B 2NQBA 4H9NA 5GT3C 5DNMA 5GT0D 3MNNA 3TU4C 4R8PD 3UT9D 3X1VD 4E45A 1M19A 4NE3A 5DNNA 2RVQD 4H9QA 3AV2C 1M18D 1ZLAC 4YS3D 1KX3C 4Z66A 3MGPD 5B32G 3LJAA 3W99C 4J8XC 1U35A 5B24C 3X1UC 1N1JB 4QLCC 5CPKA 3AZKC 3A6NC 5GSUA 3KUYA 3LELA 4ZBJC 5F99A 3AZNC 2FJ7D 2NZDD 1P3FB 3LZ1C 1EQZA 3AN2A 3WAAD 4LD9D 5JRGC 3KXBB 1BH8B 5AV6C 5BT1C 3REIB 1B67A 4G91C 3WTPD 3MGRB 3C1BC 5B1MD 2F8NG 5B2IA 3AZGD 4KGCB 4J8VA 4JJNC 3VH6T 3UTAA 1P3IA 3B6GD 3REHD 5B33A 3V9RA 4YM6B 4CAYA 4J8WD 3AV1D 2YFWA 5AV5D 3X1TB 1ID3D 3VH5W 3REJB 4H9OA 4UUZA 5AV9B 1P3BA 1P3AB 4EO5B 1P3LA 3KXBC 1F66D 5BO0B 3NQJB 1JFIB 3WKJC 3MGQC 4H9PA 5BNXB 3W96C 4J8UD 5CP6B 1S32B 1P3GB 3W98C 3W97C 3AZHB 1P3OD 4XZQB 3UTBC 5BNVB 4AWLB 5CPID 4ZUXC 1HTAA 2JSSA 4Z5TB 3KWQA 5AY8D 5JA4A 4M6BA 5B2JC 5GT3B 5B32C 3TU4B 1M1AD 1KU5A 5AV8D 2PYOA 5G49B 3AV2B 3MGSD 1ZLAB 1KX3B 3X1SC 4R8PA 4J8XB 3W99B 3B6FD 3AZLC 5B24B 3X1UB 3UT9A 1P34D 3X1VA 4QLCB 3R45A 3AZKB 3A6NB 1M18A 4ZBJB 4YS3A 5AVCC 3AZNB 2NQBC 2BYKB 3MGPA 3LZ1B 1TZYC 5JRGB 5B0ZA 5AV6B 2FJ7A 2NZDA 1P3FD 4G91B 3LJAC 5B0YA 3C1BB 3KXBD 3WTPE 5CPKC 4JJNB 3AZFC 3AZIC 5GSUC 3REID 5CPJC 3WTPA 3MGRD 3AZGA 3B6GA 3REHA 3B0DC 1TAFB 3X1TD 4YM6D 4J8WA 3AV1A 3WKJB 5AV5A 3MGQB 3W96B 3REJD 5AV9D 5B2IC 3W98B 2BYMA 4J8VC 1P3AD 1F66A 3W97B 2YFVB 5B33C 1BH9A 4J8UA 3UTBB 4NE6A 5CP6D 5AVBC 1S32D 2CWEA 1P3GD 4ZUXB 5KDMB 3AZHD 1P3LC 5B31G 5B2JB 4XZQD 3MVDD 2AROD 5B1LD 5CPIA 1HQ3D 3C1CC 2CV5C 5FUGB 4Z5TD 5AY8A 3AFAD 4CSRB 4X23C 4H9RA 5E5AA 5GT3D 4DRBA 3X1SB 1H3OB 3AZLB 5GXQC 5AV8A 3KWQC 3AZMA 1P3PD 4KUDD 3AV2D 3MGSA 1ZLAD 1KX3D 5AVCB 1AOIC 2NQBB 4H9NB 4J8XD 3B6FA 5B24D 3X1UD 1P34A 1TZYB 2F8NB 4QLCD 3AZEC 3A6ND 2PYOC 3NQUB 3LZ0C 3LZ1D 3LJAB 5JRGD 3WA9A 5BT1D 5CPKB 2RVQC 3AZFB 3AZIB 5GSUB 3KUYB 1P3FA 4WNNB 5CPJB 3MGPC 3C1BD 3KXBA 1BH8A 5B0ZC 1A7WA 4HGAC 4JJND 3REIA 1P3MC 3B0DB 3MGRA 1Q9CA 3VH5T 5B0YC 2IO5C 5B2IB 1P3KC 4J8VB 3X1TA 3WKJD 3WTPC 5B33B 5B31C 3V9RB 3MGQD 4CAYB 3AZJC 2YFWB 3W96D 3REJA 5AVBB 5AV9A 3W98D 3O62C 1P3AA 3W97D 3VH6A 4WU8D 5BO0A 1P3LB 3NQJA 1BFMA 3VH6W 3REKC 4J8WC 5BNXA 4H9PB 3UTBD 1P3GA 1S32A 4ZUXD 3C1CB 2CV5B 3AZHA 5CHLB 4H9SA 5B40A 4G92C 4X23B 5B2JD 4XZQA 3RELC 3MVDA 1KX4C 5B32D 5BNVA 2AROA 5B1LA 4J8UC 1HQ3A 5GXQB 4Z5TA 1KX5D 3AFAA 3KWQB 5GT0A 3AYWC 5GT3A 5BS7C 1AOIB 4XUJC 3X1SD 2HIOC 3AZLD 4KUDA 4WU9C 1P3PA 5G49A 3AZEB 2PYOB 5DNMC 1ZLAA 3MNNC 1KX3A 5AVCD 2NQBD 3KSYA 5E5AC 3LZ0B 4J8XA 5B24A 1TZYD 1M19C 2F8ND 4QLCA 5DNNC 3B0CW 3A6NA 3AZMC 4Z66C 3WAAA 4LD9A 2BYKA 1U35C 3LZ1A 3MGPB 3B6FC 5JRGA 1P34C 5B0ZB 3KUYC 3LELC 4HGAB 5F99C 3AZFD 3AZID 1EQZC 3AN2C 5B1MA 5CPJD 1P3MB 3C1BA 4KGCD 5B0YB 3WA9C 2LY8A 2IO5B 4JJNA 1P3KB 1ID3A 3WTPB 5B31B 3AZJB 4KHAA 3UTAC 5B2ID 1P3IC 3O62B 4J8VD 4WZSB 3WKJA 3REKB 5B33D 4WV4B 3MGQA 4J8WB 3W96A 4NFTA 1P3BC 5AVBD 3W98A 1P3OA 4WU8A 2BYMB 2YFVA 4G92B 3B0BA 3RELB 3UTBA 1KX4B 4J8UB 4ZUXA 3C1CD 2CV5D 3TU4D 3AYWB 4X23D 5B32A 1M1AA 4XUJB 2HIOB 5GXQD 5FUGA 1KX5A 4WU9B 4H9SC 5DNMB 5B40C 3W99D 3MNNB 1AOID 3X1SA 4H9RB 5E5AB 3MVDC 1H3OA 3AZLA 2AROC 5B1LC 3AZKD 1HQ3C 1M19B 5DNNB 4H9QB 3AZND 3AZED 3AFAC 3AZMB 5GT0C 4Z66B 4R8PC 1N1JA 1U35B 3LZ0D 3UT9C 3X1VC 5AV6D 3B6FB 1TZYA 1P34B 2F8NA 1F1EA 1M18C 3LELB 4YS3C 5F99B 1P3PC 4KUDC 3NQUA 1EQZB 3AN2B 4Z2MH 5B0ZD 3WA9B 2FJ7C 3AZFA 3AZIA 2NZDC 3WAAC 4LD9C 4WNNA 5CPJA 1P3MD 4KGCA 5B0YD 3UTAB 1P3KD 1P3IB 4YM6A 5B1MC 5B31D 3AZJD 3AZGC 4H9OB 4UUZB 1P3BB 3O62D 3B6GC 1JFIA 3REHC 3AV1C 2F8NK 5AV5C 3REKD 1ID3C 5CP6A 3VH5A 5AVBA 1F66C 3RELD 1KX4D 3C1CA 2HUEC 2CV5A 1P3OC 4WU8C 5JA4B 3TU4A 3AYWD 4X23A 5B40B 4XUJD 5CPIC 3MVDB 2HIOD 5C3IC 2AROB 5B1LB 4DRAA 5GXQA 1HQ3B 5AY8C 3AV2A 4Z2MG 4WU9D 3AFAB 5DNMD 5GT0B 3W99A 3MNND 1AOIA 3X1UA 4R8PB 5E5AD 1M1AC 3UT9B 3X1VB 5AV8C 3B0CT 3AZKA 1M19D 3R45B 5DNND 1M18B 3AZNA 3MGSC 3AZEA 1KX5C 4YS3B 4KUDB 4E44A 3AZMD 4Z66D 1P3PB 3LJAD 1U35D 3LZ0A 1ULYA 5AV6A 5CPKD 1WWIA 5GSUD 3KUYD 3LELD 2FJ7B 5F99D 2NZDB 1EQZD 3AN2D 3WAAB 4LD9B 3WA9D 1P3FC 1P3MA 5B1MB
chains in the Genus database with same CATH superfamily
3AZGB 2J8PA 3UTAD 1P3KA 3REIC 1P3ID 3B6GB 1TAFA 3REHB 3MGRC 3AV1B 5AV5B 2L5AA 1ID3B 2Y2PA 4NE5A 5B31A 3AZJA 2JCHA 4KGCC 3W97A 1P3BD 4KHAB 1F66B 1P3LD 3O62A 3X1TC 4YM6C 3EPJA 3REKA 1BH9B 3REJC 5AV9C 5KDMA 1P3AC 4EO5C 2HUEB 1P3OB 4WU8B 5B2JA 2F8NH 1P3GC 5CP6C 3RELA 1S32C 1KX4A 5CPIB 2ZY4A 5C3IB 3AZHC 3KWQD 5AY8B 1B6WA 4CSRA 2VQRA 1WWSA 4XZQC 3AYWA 5B40D 5BS7A 4XUJA 4AWLC 5B32B 1M1AB 2HIOA 5AV8B 4Z5TC 2PYOD 1R4VA 5AVCA 3MGSB 4WU9A 1KX5B 2NQBA 4H9NA 5GT3C 5DNMA 5GT0D 3MNNA 3TU4C 4R8PD 3UT9D 3X1VD 4E45A 1M19A 4NE3A 5DNNA 2RVQD 4H9QA 3AV2C 1M18D 1ZLAC 4YS3D 1KX3C 4Z66A 3MGPD 5B32G 3LJAA 3W99C 4J8XC 1U35A 5B24C 3X1UC 1N1JB 4QLCC 5CPKA 4DQYB 3AZKC 3A6NC 5GSUA 3KUYA 3LELA 4ZBJC 5F99A 3AZNC 2FJ7D 2NZDD 1P3FB 3LZ1C 1EQZA 3AN2A 3WAAD 4LD9D 5JRGC 3KXBB 1BH8B 5AV6C 5BT1C 3REIB 1B67A 4G91C 3WTPD 3MGRB 3C1BC 5B1MD 2F8NG 5B2IA 3AZGD 4KGCB 4J8VA 3EPHA 4JJNC 3VH6T 3UTAA 1P3IA 3B6GD 3REHD 5B33A 3V9RA 4YM6B 4CAYA 4J8WD 3AV1D 2YFWA 5AV5D 3X1TB 1ID3D 3VH5W 3REJB 4H9OA 4UUZA 5AV9B 1P3BA 2Y2LA 1P3AB 4EO5B 1P3LA 3KXBC 1F66D 2G5IC 5BO0B 2DF4C 3NQJB 1JFIB 3WKJC 3MGQC 4H9PA 5BNXB 3W96C 4J8UD 5CP6B 1S32B 1P3GB 3W98C 3W97C 3AZHB 1P3OD 4XZQB 3UTBC 5BNVB 4AWLB 5CPID 4ZUXC 1HTAA 2JSSA 4Z5TB 3KWQA 5AY8D 5JA4A 4M6BA 5B2JC 5GT3B 5B32C 3TU4B 1M1AD 1KU5A 5AV8D 2PYOA 5G49B 3AV2B 3MGSD 1ZLAB 1KX3B 3X1SC 4R8PA 4J8XB 3W99B 3B6FD 3AZLC 5B24B 3X1UB 3UT9A 1P34D 3X1VA 4QLCB 3R45A 3AZKB 3A6NB 1M18A 2Y2HA 4ZBJB 4YS3A 5AVCC 3AZNB 2NQBC 2BYKB 3MGPA 3A1IA 3LZ1B 2DQNC 1TZYC 5JRGB 5B0ZA 5AV6B 2FJ7A 1T3UA 2NZDA 1P3FD 4G91B 3LJAC 5B0YA 3C1BB 3KXBD 3WTPE 5CPKC 4JJNB 3AZFC 3AZIC 5GSUC 3REID 5CPJC 3WTPA 3MGRD 2BG1A 3AZGA 3B6GA 3REHA 3B0DC 1TAFB 3X1TD 4YM6D 4J8WA 3AV1A 3WKJB 5AV5A 3MGQB 3W96B 3REJD 5AV9D 5B2IC 3W98B 2BYMA 4J8VC 1P3AD 1F66A 3W97B 3P5JB 2YFVB 5B33C 1BH9A 4J8UA 3UTBB 4NE6A 5CP6D 5AVBC 1S32D 2CWEA 1P3GD 4ZUXB 5KDMB 3AZHD 1P3LC 5B31G 5B2JB 4XZQD 3MVDD 2AROD 5B1LD 5CPIA 1HQ3D 3C1CC 2CV5C 5FUGB 4Z5TD 5AY8A 3AFAD 3EPKA 4CSRB 4X23C 4H9RA 5E5AA 5GT3D 4DRBA 3X1SB 1H3OB 2Y2GA 3AZLB 5GXQC 5AV8A 3KWQC 3AZMA 1P3PD 4KUDD 3AV2D 3MGSA 2F2AC 1ZLAD 1KX3D 5AVCB 1AOIC 2NQBB 4H9NB 4J8XD 3B6FA 5B24D 3X1UD 1P34A 1TZYB 2F8NB 4QLCD 3AZEC 3A6ND 2PYOC 3NQUB 3LZ0C 3LZ1D 3LJAB 1KX5C 5JRGD 3WA9A 5BT1D 5CPKB 2RVQC 3AZFB 3AZIB 5GSUB 3KUYB 1P3FA 4WNNB 5CPJB 3MGPC 3C1BD 3KXBA 1BH8A 5B0ZC 1A7WA 4HGAC 4JJND 3REIA 1P3MC 3B0DB 3MGRA 1Q9CA 3VH5T 5B0YC 2IO5C 5B2IB 1P3KC 4J8VB 1PZRA 3X1TA 3WKJD 3WTPC 5B33B 5B31C 3V9RB 3MGQD 4CAYB 3AZJC 2YFWB 3W96D 3REJA 5AVBB 5AV9A 3W98D 3O62C 1P3AA 3W97D 3AL0C 3VH6A 4WU8D 5BO0A 1P3LB 3NQJA 1BFMA 3VH6W 3REKC 2XD1A 4J8WC 3A1KA 5BNXA 4H9PB 3H0RC 3UTBD 1P3GA 1S32A 2Y2KA 4ZUXD 3C1CB 2CV5B 3AZHA 5CHLB 4H9SA 5B40A 4G92C 4X23B 5B2JD 4XZQA 3RELC 3MVDA 1KX4C 5B32D 5BNVA 2AROA 5B1LA 4J8UC 1HQ3A 5GXQB 4Z5TA 1KX5D 2ZY3A 3AFAA 3KWQB 5GT0A 3AYWC 5GT3A 5BS7C 1AOIB 4XUJC 3X1SD 2HIOC 3AZLD 4KUDA 4WU9C 1P3PA 5G49A 3AZEB 2PYOB 5DNMC 1ZLAA 3MNNC 1KX3A 5AVCD 2NQBD 3KSYA 5E5AC 3LZ0B 3EPLA 4J8XA 5B24A 1TZYD 1M19C 2F8ND 4QLCA 5DNNC 3B0CW 3A6NA 3AZMC 4Z66C 3WAAA 4LD9A 2BYKA 1U35C 3LZ1A 3MGPB 3B6FC 5JRGA 1P34C 5B0ZB 3KUYC 3LELC 4HGAB 5F99C 3AZFD 3AZID 1EQZC 3AN2C 5B1MA 5CPJD 1P3MB 3C1BA 4KGCD 5B0YB 3WA9C 2LY8A 2IO5B 4JJNA 3FDDA 1P3KB 2W8SA 2ZM5A 2Y2MA 1ID3A 3WTPB 5B31B 2JE5A 3AZJB 4KHAA 3UTAC 5B2ID 1P3IC 3O62B 4J8VD 4WZSB 3WKJA 3REKB 5B33D 4WV4B 3MGQA 4J8WB 3W96A 4NFTA 1P3BC 5AVBD 3W98A 1P3OA 4WU8A 2BYMB 2YFVA 4G92B 3B0BA 3RELB 3UTBA 1KX4B 2Y2QA 4J8UB 4ZUXA 3C1CD 2CV5D 1Z2CB 3TU4D 3AYWB 4X23D 5B32A 1M1AA 4XUJB 2HIOB 5GXQD 5FUGA 1KX5A 2RIQA 4WU9B 4H9SC 5DNMB 5B40C 3W99D 3MNNB 1AOID 3X1SA 4H9RB 5E5AB 3MVDC 1H3OA 3AZLA 2AROC 5B1LC 2ZY2A 3AZKD 1HQ3C 1M19B 5DNNB 4H9QB 3AZND 3AZED 3AFAC 3AZMB 5GT0C 4Z66B 4R8PC 1N1JA 1U35B 3LZ0D 3UT9C 3X1VC 5AV6D 3B6FB 1TZYA 1P34B 2F8NA 1F1EA 3F6TA 1M18C 3LELB 4YS3C 5F99B 1P3PC 4KUDC 3NQUA 1EQZB 3AN2B 2UWXA 3IP4C 4Z2MH 5B0ZD 3WA9B 2FJ7C 3AZFA 2XD5A 3AZIA 2NZDC 3WAAC 4LD9C 4WNNA 5CPJA 1P3MD 4KGCA 5B0YD 3UTAB 1P3KD 1P3IB 4YM6A 5B1MC 5B31D 3AZJD 3AZGC 4H9OB 4UUZB 1P3BB 3O62D 3B6GC 1JFIA 3REHC 3KFUG 3AV1C 2F8NK 5AV5C 3REKD 1ID3C 5CP6A 3VH5A 5AVBA 2Y2NA 1F66C 2ZY5A 2Y2OA 4WJ3C 3H0MC 3RELD 1KX4D 3H0LC 2HUEC 3C1CA 2CV5A 1P3OC 4WU8C 5JA4B 3TU4A 3AYWD 4X23A 5B40B 3EG5B 4XUJD 5CPIC 3MVDB 2HIOD 5C3IC 2AROB 5B1LB 4DRAA 5GXQA 1HQ3B 5AY8C 3AV2A 4Z2MG 4WU9D 3AFAB 5DNMD 5GT0B 3W99A 3MNND 1AOIA 3X1UA 4R8PB 5E5AD 1M1AC 3UT9B 3X1VB 5AV8C 3B0CT 3AZKA 1M19D 3R45B 5DNND 1M18B 3AZNA 3MGSC 2Y2IA 2Y2JA 3AZEA 1W2EA 4YS3B 2G5HC 4E44A 4Z66D 3AZMD 1P3PB 4KUDB 3LJAD 1U35D 3LZ0A 2FFFB 1ULYA 5AV6A 5CPKD 1WWIA 5GSUD 3KUYD 3LELD 2FJ7B 5F99D 2NZDB 1EQZD 3AN2D 3WAAB 4LD9B 3WA9D 4UPKA 1P3FC 1P3MA 5B1MB
chains in the Genus database with same CATH topology
3AZGB 2J8PA 3UTAD 1P3KA 3REIC 1P3ID 3B6GB 1TAFA 3REHB 3MGRC 3AV1B 5AV5B 2L5AA 1ID3B 2Y2PA 4NE5A 5B31A 3AZJA 2JCHA 4KGCC 3W97A 1P3BD 4KHAB 1F66B 1P3LD 3O62A 3X1TC 4YM6C 3EPJA 3REKA 1BH9B 3REJC 5AV9C 5KDMA 1P3AC 4EO5C 2HUEB 1P3OB 4WU8B 5B2JA 2F8NH 1P3GC 5CP6C 3RELA 1S32C 1KX4A 5CPIB 2ZY4A 5C3IB 3AZHC 3KWQD 5AY8B 1B6WA 4CSRA 2VQRA 1WWSA 4XZQC 3AYWA 5B40D 5BS7A 4XUJA 4AWLC 5B32B 1M1AB 2HIOA 5AV8B 4Z5TC 2PYOD 1R4VA 5AVCA 3MGSB 4WU9A 1KX5B 2NQBA 4H9NA 5GT3C 5DNMA 5GT0D 3MNNA 3TU4C 4R8PD 3UT9D 3X1VD 4E45A 1M19A 4NE3A 5DNNA 2RVQD 4H9QA 3AV2C 1M18D 1ZLAC 4YS3D 1KX3C 4Z66A 3MGPD 5B32G 3LJAA 3W99C 4J8XC 1U35A 5B24C 3X1UC 1N1JB 4QLCC 5CPKA 4DQYB 3AZKC 3A6NC 5GSUA 3KUYA 3LELA 4ZBJC 5F99A 3AZNC 2FJ7D 2NZDD 1P3FB 3LZ1C 1EQZA 3AN2A 3WAAD 4LD9D 5JRGC 3KXBB 1BH8B 5AV6C 5BT1C 3REIB 1B67A 4G91C 3WTPD 3MGRB 3C1BC 5B1MD 2F8NG 5B2IA 3AZGD 4KGCB 4J8VA 3EPHA 4JJNC 3VH6T 3UTAA 1P3IA 3B6GD 3REHD 5B33A 3V9RA 4YM6B 4CAYA 4J8WD 3AV1D 2YFWA 5AV5D 3X1TB 1ID3D 3VH5W 3REJB 4H9OA 4UUZA 5AV9B 1P3BA 2Y2LA 1P3AB 4EO5B 1P3LA 3KXBC 1F66D 2G5IC 5BO0B 2DF4C 3NQJB 1JFIB 3WKJC 3MGQC 4H9PA 5BNXB 3W96C 4J8UD 5CP6B 1S32B 1P3GB 3W98C 3W97C 3AZHB 1P3OD 4XZQB 3UTBC 5BNVB 4AWLB 5CPID 4ZUXC 1HTAA 2JSSA 4Z5TB 3KWQA 5AY8D 5JA4A 4M6BA 5B2JC 5GT3B 5B32C 3TU4B 1M1AD 1KU5A 5AV8D 2PYOA 5G49B 3AV2B 3MGSD 1ZLAB 1KX3B 3X1SC 4R8PA 4J8XB 3W99B 3B6FD 3AZLC 5B24B 3X1UB 3UT9A 1P34D 3X1VA 4QLCB 3R45A 3AZKB 3A6NB 1M18A 2Y2HA 4ZBJB 4YS3A 5AVCC 3AZNB 2NQBC 2BYKB 3MGPA 3A1IA 3LZ1B 2DQNC 1TZYC 5JRGB 5B0ZA 5AV6B 2FJ7A 1T3UA 2NZDA 1P3FD 4G91B 3LJAC 5B0YA 3C1BB 3KXBD 3WTPE 5CPKC 4JJNB 3AZFC 3AZIC 5GSUC 3REID 5CPJC 3WTPA 3MGRD 2BG1A 3AZGA 3B6GA 3REHA 3B0DC 1TAFB 3X1TD 4YM6D 4J8WA 3AV1A 3WKJB 5AV5A 3MGQB 3W96B 3REJD 5AV9D 5B2IC 3W98B 2BYMA 4J8VC 1P3AD 1F66A 3W97B 3P5JB 2YFVB 5B33C 1BH9A 4J8UA 3UTBB 4NE6A 5CP6D 5AVBC 1S32D 2CWEA 1P3GD 4ZUXB 5KDMB 3AZHD 1P3LC 5B31G 5B2JB 4XZQD 3MVDD 2AROD 5B1LD 5CPIA 1HQ3D 3C1CC 2CV5C 5FUGB 4Z5TD 5AY8A 3AFAD 3EPKA 4CSRB 4X23C 4H9RA 5E5AA 5GT3D 4DRBA 3X1SB 1H3OB 2Y2GA 3AZLB 5GXQC 5AV8A 3KWQC 3AZMA 1P3PD 4KUDD 3AV2D 3MGSA 2F2AC 1ZLAD 1KX3D 5AVCB 1AOIC 2NQBB 4H9NB 4J8XD 3B6FA 5B24D 3X1UD 1P34A 1TZYB 2F8NB 4QLCD 3AZEC 3A6ND 2PYOC 3NQUB 3LZ0C 3LZ1D 3LJAB 1KX5C 5JRGD 3WA9A 5BT1D 5CPKB 2RVQC 3AZFB 3AZIB 5GSUB 3KUYB 1P3FA 4WNNB 5CPJB 3MGPC 3C1BD 3KXBA 1BH8A 5B0ZC 1A7WA 4HGAC 4JJND 3REIA 1P3MC 3B0DB 3MGRA 1Q9CA 3VH5T 5B0YC 2IO5C 5B2IB 1P3KC 4J8VB 1PZRA 3X1TA 3WKJD 3WTPC 5B33B 5B31C 3V9RB 3MGQD 4CAYB 3AZJC 2YFWB 3W96D 3REJA 5AVBB 5AV9A 3W98D 3O62C 1P3AA 3W97D 3AL0C 3VH6A 4WU8D 5BO0A 1P3LB 3NQJA 1BFMA 3VH6W 3REKC 2XD1A 4J8WC 3A1KA 5BNXA 4H9PB 3H0RC 3UTBD 1P3GA 1S32A 2Y2KA 4ZUXD 3C1CB 2CV5B 3AZHA 5CHLB 4H9SA 5B40A 4G92C 4X23B 5B2JD 4XZQA 3RELC 3MVDA 1KX4C 5B32D 5BNVA 2AROA 5B1LA 4J8UC 1HQ3A 5GXQB 4Z5TA 1KX5D 2ZY3A 3AFAA 3KWQB 5GT0A 3AYWC 5GT3A 5BS7C 1AOIB 4XUJC 3X1SD 2HIOC 3AZLD 4KUDA 4WU9C 1P3PA 5G49A 3AZEB 2PYOB 5DNMC 1ZLAA 3MNNC 1KX3A 5AVCD 2NQBD 3KSYA 5E5AC 3LZ0B 3EPLA 4J8XA 5B24A 1TZYD 1M19C 2F8ND 4QLCA 5DNNC 3B0CW 3A6NA 3AZMC 4Z66C 3WAAA 4LD9A 2BYKA 1U35C 3LZ1A 3MGPB 3B6FC 5JRGA 1P34C 5B0ZB 3KUYC 3LELC 4HGAB 5F99C 3AZFD 3AZID 1EQZC 3AN2C 5B1MA 5CPJD 1P3MB 3C1BA 4KGCD 5B0YB 3WA9C 2LY8A 2IO5B 4JJNA 3FDDA 1P3KB 2W8SA 2ZM5A 2Y2MA 1ID3A 3WTPB 5B31B 2JE5A 3AZJB 4KHAA 3UTAC 5B2ID 1P3IC 3O62B 4J8VD 4WZSB 3WKJA 3REKB 5B33D 4WV4B 3MGQA 4J8WB 3W96A 4NFTA 1P3BC 5AVBD 3W98A 1P3OA 4WU8A 2BYMB 2YFVA 4G92B 3B0BA 3RELB 3UTBA 1KX4B 2Y2QA 4J8UB 4ZUXA 3C1CD 2CV5D 1Z2CB 3TU4D 3AYWB 4X23D 5B32A 1M1AA 4XUJB 2HIOB 5GXQD 5FUGA 1KX5A 2RIQA 4WU9B 4H9SC 5DNMB 5B40C 3W99D 3MNNB 1AOID 3X1SA 4H9RB 5E5AB 3MVDC 1H3OA 3AZLA 2AROC 5B1LC 2ZY2A 3AZKD 1HQ3C 1M19B 5DNNB 4H9QB 3AZND 3AZED 3AFAC 3AZMB 5GT0C 4Z66B 4R8PC 1N1JA 1U35B 3LZ0D 3UT9C 3X1VC 5AV6D 3B6FB 1TZYA 1P34B 2F8NA 1F1EA 3F6TA 1M18C 3LELB 4YS3C 5F99B 1P3PC 4KUDC 3NQUA 1EQZB 3AN2B 2UWXA 3IP4C 4Z2MH 5B0ZD 3WA9B 2FJ7C 3AZFA 2XD5A 3AZIA 2NZDC 3WAAC 4LD9C 4WNNA 5CPJA 1P3MD 4KGCA 5B0YD 3UTAB 1P3KD 1P3IB 4YM6A 5B1MC 5B31D 3AZJD 3AZGC 4H9OB 4UUZB 1P3BB 3O62D 3B6GC 1JFIA 3REHC 3KFUG 3AV1C 2F8NK 5AV5C 3REKD 1ID3C 5CP6A 3VH5A 5AVBA 2Y2NA 1F66C 2ZY5A 2Y2OA 4WJ3C 3H0MC 3RELD 1KX4D 3H0LC 2HUEC 3C1CA 2CV5A 1P3OC 4WU8C 5JA4B 3TU4A 3AYWD 4X23A 5B40B 3EG5B 4XUJD 5CPIC 3MVDB 2HIOD 5C3IC 2AROB 5B1LB 4DRAA 5GXQA 1HQ3B 5AY8C 3AV2A 4Z2MG 4WU9D 3AFAB 5DNMD 5GT0B 3W99A 3MNND 1AOIA 3X1UA 4R8PB 5E5AD 1M1AC 3UT9B 3X1VB 5AV8C 3B0CT 3AZKA 1M19D 3R45B 5DNND 1M18B 3AZNA 3MGSC 2Y2IA 2Y2JA 3AZEA 1W2EA 4YS3B 2G5HC 4E44A 4Z66D 3AZMD 1P3PB 4KUDB 3LJAD 1U35D 3LZ0A 2FFFB 1ULYA 5AV6A 5CPKD 1WWIA 5GSUD 3KUYD 3LELD 2FJ7B 5F99D 2NZDB 1EQZD 3AN2D 3WAAB 4LD9B 3WA9D 4UPKA 1P3FC 1P3MA 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG B;  3UTA D;  1P3K A;  3REI C;  1P3I D;  3B6G B;  1TAF A;  3REH B;  3MGR C;  3AV1 B;  5AV5 B;  2L5A A;  1ID3 B;  5B31 A;  4NE5 A;  3AZJ A;  4KGC C;  3W97 A;  1P3B D;  4KHA B;  1F66 B;  1P3L D;  3O62 A;  3X1T C;  4YM6 C;  3REK A;  1BH9 B;  3REJ C;  5AV9 C;  5KDM A;  1P3A C;  4EO5 C;  2HUE B;  1P3O B;  4WU8 B;  5B2J A;  2F8N H;  1P3G C;  5CP6 C;  3REL A;  1S32 C;  1KX4 A;  5CPI B;  5C3I B;  3AZH C;  3KWQ D;  5AY8 B;  1B6W A;  4CSR A;  1WWS A;  4XZQ C;  3AYW A;  5B40 D;  5BS7 A;  4XUJ A;  4AWL C;  5B32 B;  1M1A B;  2HIO A;  5AV8 B;  4Z5T C;  2PYO D;  1R4V A;  5AVC A;  3MGS B;  4WU9 A;  1KX5 B;  2NQB A;  4H9N A;  5GT3 C;  5DNM A;  5GT0 D;  3MNN A;  3TU4 C;  4R8P D;  3UT9 D;  3X1V D;  4E45 A;  1M19 A;  4NE3 A;  5DNN A;  2RVQ D;  4H9Q A;  3AV2 C;  1M18 D;  1ZLA C;  4YS3 D;  1KX3 C;  4Z66 A;  3MGP D;  5B32 G;  3LJA A;  3W99 C;  4J8X C;  1U35 A;  5B24 C;  3X1U C;  1N1J B;  4QLC C;  5CPK A;  3AZK C;  3A6N C;  5GSU A;  3KUY A;  3LEL A;  4ZBJ C;  5F99 A;  3AZN C;  2FJ7 D;  2NZD D;  1P3F B;  3LZ1 C;  1EQZ A;  3AN2 A;  3WAA D;  4LD9 D;  5JRG C;  3KXB B;  1BH8 B;  5AV6 C;  5BT1 C;  3REI B;  1B67 A;  4G91 C;  3WTP D;  3MGR B;  3C1B C;  5B1M D;  2F8N G;  5B2I A;  3AZG D;  4KGC B;  4J8V A;  4JJN C;  3VH6 T;  3UTA A;  1P3I A;  3B6G D;  3REH D;  5B33 A;  3V9R A;  4YM6 B;  4CAY A;  4J8W D;  3AV1 D;  2YFW A;  5AV5 D;  3X1T B;  1ID3 D;  3VH5 W;  3REJ B;  4H9O A;  4UUZ A;  5AV9 B;  1P3B A;  1P3A B;  4EO5 B;  1P3L A;  3KXB C;  1F66 D;  5BO0 B;  3NQJ B;  1JFI B;  3WKJ C;  3MGQ C;  4H9P A;  5BNX B;  3W96 C;  4J8U D;  5CP6 B;  1S32 B;  1P3G B;  3W98 C;  3W97 C;  3AZH B;  1P3O D;  4XZQ B;  3UTB C;  5BNV B;  4AWL B;  5CPI D;  4ZUX C;  1HTA A;  2JSS A;  4Z5T B;  3KWQ A;  5AY8 D;  5JA4 A;  4M6B A;  5B2J C;  5GT3 B;  5B32 C;  3TU4 B;  1M1A D;  1KU5 A;  5AV8 D;  2PYO A;  5G49 B;  3AV2 B;  3MGS D;  1ZLA B;  1KX3 B;  3X1S C;  4R8P A;  4J8X B;  3W99 B;  3B6F D;  3AZL C;  5B24 B;  3X1U B;  3UT9 A;  1P34 D;  3X1V A;  4QLC B;  3R45 A;  3AZK B;  3A6N B;  1M18 A;  4ZBJ B;  4YS3 A;  5AVC C;  3AZN B;  2NQB C;  2BYK B;  3MGP A;  3LZ1 B;  1TZY C;  5JRG B;  5B0Z A;  5AV6 B;  2FJ7 A;  2NZD A;  1P3F D;  4G91 B;  3LJA C;  5B0Y A;  3C1B B;  3KXB D;  3WTP E;  5CPK C;  4JJN B;  3AZF C;  3AZI C;  5GSU C;  3REI D;  5CPJ C;  3WTP A;  3MGR D;  3AZG A;  3B6G A;  3REH A;  3B0D C;  1TAF B;  3X1T D;  4YM6 D;  4J8W A;  3AV1 A;  3WKJ B;  5AV5 A;  3MGQ B;  3W96 B;  3REJ D;  5AV9 D;  5B2I C;  3W98 B;  2BYM A;  4J8V C;  1P3A D;  1F66 A;  3W97 B;  2YFV B;  5B33 C;  1BH9 A;  4J8U A;  3UTB B;  4NE6 A;  5CP6 D;  5AVB C;  1S32 D;  2CWE A;  1P3G D;  4ZUX B;  5KDM B;  3AZH D;  1P3L C;  5B31 G;  5B2J B;  4XZQ D;  3MVD D;  2ARO D;  5B1L D;  5CPI A;  1HQ3 D;  3C1C C;  2CV5 C;  5FUG B;  4Z5T D;  5AY8 A;  3AFA D;  4CSR B;  4X23 C;  4H9R A;  5E5A A;  5GT3 D;  4DRB A;  3X1S B;  1H3O B;  3AZL B;  5GXQ C;  5AV8 A;  3KWQ C;  3AZM A;  1P3P D;  4KUD D;  3AV2 D;  3MGS A;  1ZLA D;  1KX3 D;  5AVC B;  1AOI C;  2NQB B;  4H9N B;  4J8X D;  3B6F A;  5B24 D;  3X1U D;  1P34 A;  1TZY B;  2F8N B;  4QLC D;  3AZE C;  3A6N D;  2PYO C;  3NQU B;  3LZ0 C;  3LZ1 D;  3LJA B;  5JRG D;  3WA9 A;  5BT1 D;  5CPK B;  2RVQ C;  3AZF B;  3AZI B;  5GSU B;  3KUY B;  1P3F A;  4WNN B;  5CPJ B;  3MGP C;  3C1B D;  3KXB A;  1BH8 A;  5B0Z C;  1A7W A;  4HGA C;  4JJN D;  3REI A;  1P3M C;  3B0D B;  3MGR A;  1Q9C A;  3VH5 T;  5B0Y C;  2IO5 C;  5B2I B;  1P3K C;  4J8V B;  3X1T A;  3WKJ D;  3WTP C;  5B33 B;  5B31 C;  3V9R B;  3MGQ D;  4CAY B;  3AZJ C;  2YFW B;  3W96 D;  3REJ A;  5AVB B;  5AV9 A;  3W98 D;  3O62 C;  1P3A A;  3W97 D;  3VH6 A;  4WU8 D;  5BO0 A;  1P3L B;  3NQJ A;  1BFM A;  3VH6 W;  3REK C;  4J8W C;  5BNX A;  4H9P B;  3UTB D;  1P3G A;  1S32 A;  4ZUX D;  3C1C B;  2CV5 B;  3AZH A;  5CHL B;  4H9S A;  5B40 A;  4G92 C;  4X23 B;  5B2J D;  4XZQ A;  3REL C;  3MVD A;  1KX4 C;  5B32 D;  5BNV A;  2ARO A;  5B1L A;  4J8U C;  1HQ3 A;  5GXQ B;  4Z5T A;  1KX5 D;  3AFA A;  3KWQ B;  5GT0 A;  3AYW C;  5GT3 A;  5BS7 C;  1AOI B;  4XUJ C;  3X1S D;  2HIO C;  3AZL D;  4KUD A;  4WU9 C;  1P3P A;  5G49 A;  3AZE B;  2PYO B;  5DNM C;  1ZLA A;  3MNN C;  1KX3 A;  5AVC D;  2NQB D;  3KSY A;  5E5A C;  3LZ0 B;  4J8X A;  5B24 A;  1TZY D;  1M19 C;  2F8N D;  4QLC A;  5DNN C;  3B0C W;  3A6N A;  3AZM C;  4Z66 C;  3WAA A;  4LD9 A;  2BYK A;  1U35 C;  3LZ1 A;  3MGP B;  3B6F C;  5JRG A;  1P34 C;  5B0Z B;  3KUY C;  3LEL C;  4HGA B;  5F99 C;  3AZF D;  3AZI D;  1EQZ C;  3AN2 C;  5B1M A;  5CPJ D;  1P3M B;  3C1B A;  4KGC D;  5B0Y B;  3WA9 C;  2LY8 A;  2IO5 B;  4JJN A;  1P3K B;  1ID3 A;  3WTP B;  5B31 B;  3AZJ B;  4KHA A;  3UTA C;  5B2I D;  1P3I C;  3O62 B;  4J8V D;  4WZS B;  3WKJ A;  3REK B;  5B33 D;  4WV4 B;  3MGQ A;  4J8W B;  3W96 A;  4NFT A;  1P3B C;  5AVB D;  3W98 A;  1P3O A;  4WU8 A;  2BYM B;  2YFV A;  4G92 B;  3B0B A;  3REL B;  3UTB A;  1KX4 B;  4J8U B;  4ZUX A;  3C1C D;  2CV5 D;  3TU4 D;  3AYW B;  4X23 D;  5B32 A;  1M1A A;  4XUJ B;  2HIO B;  5GXQ D;  5FUG A;  1KX5 A;  4WU9 B;  4H9S C;  5DNM B;  5B40 C;  3W99 D;  3MNN B;  1AOI D;  3X1S A;  4H9R B;  5E5A B;  3MVD C;  1H3O A;  3AZL A;  2ARO C;  5B1L C;  3AZK D;  1HQ3 C;  1M19 B;  5DNN B;  4H9Q B;  3AZN D;  3AZE D;  3AFA C;  3AZM B;  5GT0 C;  4Z66 B;  4R8P C;  1N1J A;  1U35 B;  3LZ0 D;  3UT9 C;  3X1V C;  5AV6 D;  3B6F B;  1TZY A;  1P34 B;  2F8N A;  1F1E A;  1M18 C;  3LEL B;  4YS3 C;  5F99 B;  1P3P C;  4KUD C;  3NQU A;  1EQZ B;  3AN2 B;  4Z2M H;  5B0Z D;  3WA9 B;  2FJ7 C;  3AZF A;  3AZI A;  2NZD C;  3WAA C;  4LD9 C;  4WNN A;  5CPJ A;  1P3M D;  4KGC A;  5B0Y D;  3UTA B;  1P3K D;  1P3I B;  4YM6 A;  5B1M C;  5B31 D;  3AZJ D;  3AZG C;  4H9O B;  4UUZ B;  1P3B B;  3O62 D;  3B6G C;  1JFI A;  3REH C;  3AV1 C;  2F8N K;  5AV5 C;  3REK D;  1ID3 C;  5CP6 A;  3VH5 A;  5AVB A;  1F66 C;  3REL D;  1KX4 D;  3C1C A;  2HUE C;  2CV5 A;  1P3O C;  4WU8 C;  5JA4 B;  3TU4 A;  3AYW D;  4X23 A;  5B40 B;  4XUJ D;  5CPI C;  3MVD B;  2HIO D;  5C3I C;  2ARO B;  5B1L B;  4DRA A;  5GXQ A;  1HQ3 B;  5AY8 C;  3AV2 A;  4Z2M G;  4WU9 D;  3AFA B;  5DNM D;  5GT0 B;  3W99 A;  3MNN D;  1AOI A;  3X1U A;  4R8P B;  5E5A D;  1M1A C;  3UT9 B;  3X1V B;  5AV8 C;  3B0C T;  3AZK A;  1M19 D;  3R45 B;  5DNN D;  1M18 B;  3AZN A;  3MGS C;  3AZE A;  1KX5 C;  4YS3 B;  4KUD B;  4E44 A;  3AZM D;  4Z66 D;  1P3P B;  3LJA D;  1U35 D;  3LZ0 A;  1ULY A;  5AV6 A;  5CPK D;  1WWI A;  5GSU D;  3KUY D;  3LEL D;  2FJ7 B;  5F99 D;  2NZD B;  1EQZ D;  3AN2 D;  3WAA B;  4LD9 B;  3WA9 D;  1P3F C;  1P3M A;  5B1M B; 
#chains in the Genus database with same CATH topology
 3AZG B;  2J8P A;  3UTA D;  1P3K A;  3REI C;  1P3I D;  3B6G B;  1TAF A;  3REH B;  3MGR C;  3AV1 B;  5AV5 B;  2L5A A;  1ID3 B;  2Y2P A;  4NE5 A;  5B31 A;  3AZJ A;  2JCH A;  4KGC C;  3W97 A;  1P3B D;  4KHA B;  1F66 B;  1P3L D;  3O62 A;  3X1T C;  4YM6 C;  3EPJ A;  3REK A;  1BH9 B;  3REJ C;  5AV9 C;  5KDM A;  1P3A C;  4EO5 C;  2HUE B;  1P3O B;  4WU8 B;  5B2J A;  2F8N H;  1P3G C;  5CP6 C;  3REL A;  1S32 C;  1KX4 A;  5CPI B;  2ZY4 A;  5C3I B;  3AZH C;  3KWQ D;  5AY8 B;  1B6W A;  4CSR A;  2VQR A;  1WWS A;  4XZQ C;  3AYW A;  5B40 D;  5BS7 A;  4XUJ A;  4AWL C;  5B32 B;  1M1A B;  2HIO A;  5AV8 B;  4Z5T C;  2PYO D;  1R4V A;  5AVC A;  3MGS B;  4WU9 A;  1KX5 B;  2NQB A;  4H9N A;  5GT3 C;  5DNM A;  5GT0 D;  3MNN A;  3TU4 C;  4R8P D;  3UT9 D;  3X1V D;  4E45 A;  1M19 A;  4NE3 A;  5DNN A;  2RVQ D;  4H9Q A;  3AV2 C;  1M18 D;  1ZLA C;  4YS3 D;  1KX3 C;  4Z66 A;  3MGP D;  5B32 G;  3LJA A;  3W99 C;  4J8X C;  1U35 A;  5B24 C;  3X1U C;  1N1J B;  4QLC C;  5CPK A;  4DQY B;  3AZK C;  3A6N C;  5GSU A;  3KUY A;  3LEL A;  4ZBJ C;  5F99 A;  3AZN C;  2FJ7 D;  2NZD D;  1P3F B;  3LZ1 C;  1EQZ A;  3AN2 A;  3WAA D;  4LD9 D;  5JRG C;  3KXB B;  1BH8 B;  5AV6 C;  5BT1 C;  3REI B;  1B67 A;  4G91 C;  3WTP D;  3MGR B;  3C1B C;  5B1M D;  2F8N G;  5B2I A;  3AZG D;  4KGC B;  4J8V A;  3EPH A;  4JJN C;  3VH6 T;  3UTA A;  1P3I A;  3B6G D;  3REH D;  5B33 A;  3V9R A;  4YM6 B;  4CAY A;  4J8W D;  3AV1 D;  2YFW A;  5AV5 D;  3X1T B;  1ID3 D;  3VH5 W;  3REJ B;  4H9O A;  4UUZ A;  5AV9 B;  1P3B A;  2Y2L A;  1P3A B;  4EO5 B;  1P3L A;  3KXB C;  1F66 D;  2G5I C;  5BO0 B;  2DF4 C;  3NQJ B;  1JFI B;  3WKJ C;  3MGQ C;  4H9P A;  5BNX B;  3W96 C;  4J8U D;  5CP6 B;  1S32 B;  1P3G B;  3W98 C;  3W97 C;  3AZH B;  1P3O D;  4XZQ B;  3UTB C;  5BNV B;  4AWL B;  5CPI D;  4ZUX C;  1HTA A;  2JSS A;  4Z5T B;  3KWQ A;  5AY8 D;  5JA4 A;  4M6B A;  5B2J C;  5GT3 B;  5B32 C;  3TU4 B;  1M1A D;  1KU5 A;  5AV8 D;  2PYO A;  5G49 B;  3AV2 B;  3MGS D;  1ZLA B;  1KX3 B;  3X1S C;  4R8P A;  4J8X B;  3W99 B;  3B6F D;  3AZL C;  5B24 B;  3X1U B;  3UT9 A;  1P34 D;  3X1V A;  4QLC B;  3R45 A;  3AZK B;  3A6N B;  1M18 A;  2Y2H A;  4ZBJ B;  4YS3 A;  5AVC C;  3AZN B;  2NQB C;  2BYK B;  3MGP A;  3A1I A;  3LZ1 B;  2DQN C;  1TZY C;  5JRG B;  5B0Z A;  5AV6 B;  2FJ7 A;  1T3U A;  2NZD A;  1P3F D;  4G91 B;  3LJA C;  5B0Y A;  3C1B B;  3KXB D;  3WTP E;  5CPK C;  4JJN B;  3AZF C;  3AZI C;  5GSU C;  3REI D;  5CPJ C;  3WTP A;  3MGR D;  2BG1 A;  3AZG A;  3B6G A;  3REH A;  3B0D C;  1TAF B;  3X1T D;  4YM6 D;  4J8W A;  3AV1 A;  3WKJ B;  5AV5 A;  3MGQ B;  3W96 B;  3REJ D;  5AV9 D;  5B2I C;  3W98 B;  2BYM A;  4J8V C;  1P3A D;  1F66 A;  3W97 B;  3P5J B;  2YFV B;  5B33 C;  1BH9 A;  4J8U A;  3UTB B;  4NE6 A;  5CP6 D;  5AVB C;  1S32 D;  2CWE A;  1P3G D;  4ZUX B;  5KDM B;  3AZH D;  1P3L C;  5B31 G;  5B2J B;  4XZQ D;  3MVD D;  2ARO D;  5B1L D;  5CPI A;  1HQ3 D;  3C1C C;  2CV5 C;  5FUG B;  4Z5T D;  5AY8 A;  3AFA D;  3EPK A;  4CSR B;  4X23 C;  4H9R A;  5E5A A;  5GT3 D;  4DRB A;  3X1S B;  1H3O B;  2Y2G A;  3AZL B;  5GXQ C;  5AV8 A;  3KWQ C;  3AZM A;  1P3P D;  4KUD D;  3AV2 D;  3MGS A;  2F2A C;  1ZLA D;  1KX3 D;  5AVC B;  1AOI C;  2NQB B;  4H9N B;  4J8X D;  3B6F A;  5B24 D;  3X1U D;  1P34 A;  1TZY B;  2F8N B;  4QLC D;  3AZE C;  3A6N D;  2PYO C;  3NQU B;  3LZ0 C;  3LZ1 D;  3LJA B;  1KX5 C;  5JRG D;  3WA9 A;  5BT1 D;  5CPK B;  2RVQ C;  3AZF B;  3AZI B;  5GSU B;  3KUY B;  1P3F A;  4WNN B;  5CPJ B;  3MGP C;  3C1B D;  3KXB A;  1BH8 A;  5B0Z C;  1A7W A;  4HGA C;  4JJN D;  3REI A;  1P3M C;  3B0D B;  3MGR A;  1Q9C A;  3VH5 T;  5B0Y C;  2IO5 C;  5B2I B;  1P3K C;  4J8V B;  1PZR A;  3X1T A;  3WKJ D;  3WTP C;  5B33 B;  5B31 C;  3V9R B;  3MGQ D;  4CAY B;  3AZJ C;  2YFW B;  3W96 D;  3REJ A;  5AVB B;  5AV9 A;  3W98 D;  3O62 C;  1P3A A;  3W97 D;  3AL0 C;  3VH6 A;  4WU8 D;  5BO0 A;  1P3L B;  3NQJ A;  1BFM A;  3VH6 W;  3REK C;  2XD1 A;  4J8W C;  3A1K A;  5BNX A;  4H9P B;  3H0R C;  3UTB D;  1P3G A;  1S32 A;  2Y2K A;  4ZUX D;  3C1C B;  2CV5 B;  3AZH A;  5CHL B;  4H9S A;  5B40 A;  4G92 C;  4X23 B;  5B2J D;  4XZQ A;  3REL C;  3MVD A;  1KX4 C;  5B32 D;  5BNV A;  2ARO A;  5B1L A;  4J8U C;  1HQ3 A;  5GXQ B;  4Z5T A;  1KX5 D;  2ZY3 A;  3AFA A;  3KWQ B;  5GT0 A;  3AYW C;  5GT3 A;  5BS7 C;  1AOI B;  4XUJ C;  3X1S D;  2HIO C;  3AZL D;  4KUD A;  4WU9 C;  1P3P A;  5G49 A;  3AZE B;  2PYO B;  5DNM C;  1ZLA A;  3MNN C;  1KX3 A;  5AVC D;  2NQB D;  3KSY A;  5E5A C;  3LZ0 B;  3EPL A;  4J8X A;  5B24 A;  1TZY D;  1M19 C;  2F8N D;  4QLC A;  5DNN C;  3B0C W;  3A6N A;  3AZM C;  4Z66 C;  3WAA A;  4LD9 A;  2BYK A;  1U35 C;  3LZ1 A;  3MGP B;  3B6F C;  5JRG A;  1P34 C;  5B0Z B;  3KUY C;  3LEL C;  4HGA B;  5F99 C;  3AZF D;  3AZI D;  1EQZ C;  3AN2 C;  5B1M A;  5CPJ D;  1P3M B;  3C1B A;  4KGC D;  5B0Y B;  3WA9 C;  2LY8 A;  2IO5 B;  4JJN A;  3FDD A;  1P3K B;  2W8S A;  2ZM5 A;  2Y2M A;  1ID3 A;  3WTP B;  5B31 B;  2JE5 A;  3AZJ B;  4KHA A;  3UTA C;  5B2I D;  1P3I C;  3O62 B;  4J8V D;  4WZS B;  3WKJ A;  3REK B;  5B33 D;  4WV4 B;  3MGQ A;  4J8W B;  3W96 A;  4NFT A;  1P3B C;  5AVB D;  3W98 A;  1P3O A;  4WU8 A;  2BYM B;  2YFV A;  4G92 B;  3B0B A;  3REL B;  3UTB A;  1KX4 B;  2Y2Q A;  4J8U B;  4ZUX A;  3C1C D;  2CV5 D;  1Z2C B;  3TU4 D;  3AYW B;  4X23 D;  5B32 A;  1M1A A;  4XUJ B;  2HIO B;  5GXQ D;  5FUG A;  1KX5 A;  2RIQ A;  4WU9 B;  4H9S C;  5DNM B;  5B40 C;  3W99 D;  3MNN B;  1AOI D;  3X1S A;  4H9R B;  5E5A B;  3MVD C;  1H3O A;  3AZL A;  2ARO C;  5B1L C;  2ZY2 A;  3AZK D;  1HQ3 C;  1M19 B;  5DNN B;  4H9Q B;  3AZN D;  3AZE D;  3AFA C;  3AZM B;  5GT0 C;  4Z66 B;  4R8P C;  1N1J A;  1U35 B;  3LZ0 D;  3UT9 C;  3X1V C;  5AV6 D;  3B6F B;  1TZY A;  1P34 B;  2F8N A;  1F1E A;  3F6T A;  1M18 C;  3LEL B;  4YS3 C;  5F99 B;  1P3P C;  4KUD C;  3NQU A;  1EQZ B;  3AN2 B;  2UWX A;  3IP4 C;  4Z2M H;  5B0Z D;  3WA9 B;  2FJ7 C;  3AZF A;  2XD5 A;  3AZI A;  2NZD C;  3WAA C;  4LD9 C;  4WNN A;  5CPJ A;  1P3M D;  4KGC A;  5B0Y D;  3UTA B;  1P3K D;  1P3I B;  4YM6 A;  5B1M C;  5B31 D;  3AZJ D;  3AZG C;  4H9O B;  4UUZ B;  1P3B B;  3O62 D;  3B6G C;  1JFI A;  3REH C;  3KFU G;  3AV1 C;  2F8N K;  5AV5 C;  3REK D;  1ID3 C;  5CP6 A;  3VH5 A;  5AVB A;  2Y2N A;  1F66 C;  2ZY5 A;  2Y2O A;  4WJ3 C;  3H0M C;  3REL D;  1KX4 D;  3H0L C;  2HUE C;  3C1C A;  2CV5 A;  1P3O C;  4WU8 C;  5JA4 B;  3TU4 A;  3AYW D;  4X23 A;  5B40 B;  3EG5 B;  4XUJ D;  5CPI C;  3MVD B;  2HIO D;  5C3I C;  2ARO B;  5B1L B;  4DRA A;  5GXQ A;  1HQ3 B;  5AY8 C;  3AV2 A;  4Z2M G;  4WU9 D;  3AFA B;  5DNM D;  5GT0 B;  3W99 A;  3MNN D;  1AOI A;  3X1U A;  4R8P B;  5E5A D;  1M1A C;  3UT9 B;  3X1V B;  5AV8 C;  3B0C T;  3AZK A;  1M19 D;  3R45 B;  5DNN D;  1M18 B;  3AZN A;  3MGS C;  2Y2I A;  2Y2J A;  3AZE A;  1W2E A;  4YS3 B;  2G5H C;  4E44 A;  4Z66 D;  3AZM D;  1P3P B;  4KUD B;  3LJA D;  1U35 D;  3LZ0 A;  2FFF B;  1ULY A;  5AV6 A;  5CPK D;  1WWI A;  5GSU D;  3KUY D;  3LEL D;  2FJ7 B;  5F99 D;  2NZD B;  1EQZ D;  3AN2 D;  3WAA B;  4LD9 B;  3WA9 D;  4UPK A;  1P3F C;  1P3M A;  5B1M B; 
#chains in the Genus database with same CATH homology
 3AZG B;  2J8P A;  3UTA D;  1P3K A;  3REI C;  1P3I D;  3B6G B;  1TAF A;  3REH B;  3MGR C;  3AV1 B;  5AV5 B;  2L5A A;  1ID3 B;  2Y2P A;  4NE5 A;  5B31 A;  3AZJ A;  2JCH A;  4KGC C;  3W97 A;  1P3B D;  4KHA B;  1F66 B;  1P3L D;  3O62 A;  3X1T C;  4YM6 C;  3EPJ A;  3REK A;  1BH9 B;  3REJ C;  5AV9 C;  5KDM A;  1P3A C;  4EO5 C;  2HUE B;  1P3O B;  4WU8 B;  5B2J A;  2F8N H;  1P3G C;  5CP6 C;  3REL A;  1S32 C;  1KX4 A;  5CPI B;  2ZY4 A;  5C3I B;  3AZH C;  3KWQ D;  5AY8 B;  1B6W A;  4CSR A;  2VQR A;  1WWS A;  4XZQ C;  3AYW A;  5B40 D;  5BS7 A;  4XUJ A;  4AWL C;  5B32 B;  1M1A B;  2HIO A;  5AV8 B;  4Z5T C;  2PYO D;  1R4V A;  5AVC A;  3MGS B;  4WU9 A;  1KX5 B;  2NQB A;  4H9N A;  5GT3 C;  5DNM A;  5GT0 D;  3MNN A;  3TU4 C;  4R8P D;  3UT9 D;  3X1V D;  4E45 A;  1M19 A;  4NE3 A;  5DNN A;  2RVQ D;  4H9Q A;  3AV2 C;  1M18 D;  1ZLA C;  4YS3 D;  1KX3 C;  4Z66 A;  3MGP D;  5B32 G;  3LJA A;  3W99 C;  4J8X C;  1U35 A;  5B24 C;  3X1U C;  1N1J B;  4QLC C;  5CPK A;  4DQY B;  3AZK C;  3A6N C;  5GSU A;  3KUY A;  3LEL A;  4ZBJ C;  5F99 A;  3AZN C;  2FJ7 D;  2NZD D;  1P3F B;  3LZ1 C;  1EQZ A;  3AN2 A;  3WAA D;  4LD9 D;  5JRG C;  3KXB B;  1BH8 B;  5AV6 C;  5BT1 C;  3REI B;  1B67 A;  4G91 C;  3WTP D;  3MGR B;  3C1B C;  5B1M D;  2F8N G;  5B2I A;  3AZG D;  4KGC B;  4J8V A;  3EPH A;  4JJN C;  3VH6 T;  3UTA A;  1P3I A;  3B6G D;  3REH D;  5B33 A;  3V9R A;  4YM6 B;  4CAY A;  4J8W D;  3AV1 D;  2YFW A;  5AV5 D;  3X1T B;  1ID3 D;  3VH5 W;  3REJ B;  4H9O A;  4UUZ A;  5AV9 B;  1P3B A;  2Y2L A;  1P3A B;  4EO5 B;  1P3L A;  3KXB C;  1F66 D;  2G5I C;  5BO0 B;  2DF4 C;  3NQJ B;  1JFI B;  3WKJ C;  3MGQ C;  4H9P A;  5BNX B;  3W96 C;  4J8U D;  5CP6 B;  1S32 B;  1P3G B;  3W98 C;  3W97 C;  3AZH B;  1P3O D;  4XZQ B;  3UTB C;  5BNV B;  4AWL B;  5CPI D;  4ZUX C;  1HTA A;  2JSS A;  4Z5T B;  3KWQ A;  5AY8 D;  5JA4 A;  4M6B A;  5B2J C;  5GT3 B;  5B32 C;  3TU4 B;  1M1A D;  1KU5 A;  5AV8 D;  2PYO A;  5G49 B;  3AV2 B;  3MGS D;  1ZLA B;  1KX3 B;  3X1S C;  4R8P A;  4J8X B;  3W99 B;  3B6F D;  3AZL C;  5B24 B;  3X1U B;  3UT9 A;  1P34 D;  3X1V A;  4QLC B;  3R45 A;  3AZK B;  3A6N B;  1M18 A;  2Y2H A;  4ZBJ B;  4YS3 A;  5AVC C;  3AZN B;  2NQB C;  2BYK B;  3MGP A;  3A1I A;  3LZ1 B;  2DQN C;  1TZY C;  5JRG B;  5B0Z A;  5AV6 B;  2FJ7 A;  1T3U A;  2NZD A;  1P3F D;  4G91 B;  3LJA C;  5B0Y A;  3C1B B;  3KXB D;  3WTP E;  5CPK C;  4JJN B;  3AZF C;  3AZI C;  5GSU C;  3REI D;  5CPJ C;  3WTP A;  3MGR D;  2BG1 A;  3AZG A;  3B6G A;  3REH A;  3B0D C;  1TAF B;  3X1T D;  4YM6 D;  4J8W A;  3AV1 A;  3WKJ B;  5AV5 A;  3MGQ B;  3W96 B;  3REJ D;  5AV9 D;  5B2I C;  3W98 B;  2BYM A;  4J8V C;  1P3A D;  1F66 A;  3W97 B;  3P5J B;  2YFV B;  5B33 C;  1BH9 A;  4J8U A;  3UTB B;  4NE6 A;  5CP6 D;  5AVB C;  1S32 D;  2CWE A;  1P3G D;  4ZUX B;  5KDM B;  3AZH D;  1P3L C;  5B31 G;  5B2J B;  4XZQ D;  3MVD D;  2ARO D;  5B1L D;  5CPI A;  1HQ3 D;  3C1C C;  2CV5 C;  5FUG B;  4Z5T D;  5AY8 A;  3AFA D;  3EPK A;  4CSR B;  4X23 C;  4H9R A;  5E5A A;  5GT3 D;  4DRB A;  3X1S B;  1H3O B;  2Y2G A;  3AZL B;  5GXQ C;  5AV8 A;  3KWQ C;  3AZM A;  1P3P D;  4KUD D;  3AV2 D;  3MGS A;  2F2A C;  1ZLA D;  1KX3 D;  5AVC B;  1AOI C;  2NQB B;  4H9N B;  4J8X D;  3B6F A;  5B24 D;  3X1U D;  1P34 A;  1TZY B;  2F8N B;  4QLC D;  3AZE C;  3A6N D;  2PYO C;  3NQU B;  3LZ0 C;  3LZ1 D;  3LJA B;  1KX5 C;  5JRG D;  3WA9 A;  5BT1 D;  5CPK B;  2RVQ C;  3AZF B;  3AZI B;  5GSU B;  3KUY B;  1P3F A;  4WNN B;  5CPJ B;  3MGP C;  3C1B D;  3KXB A;  1BH8 A;  5B0Z C;  1A7W A;  4HGA C;  4JJN D;  3REI A;  1P3M C;  3B0D B;  3MGR A;  1Q9C A;  3VH5 T;  5B0Y C;  2IO5 C;  5B2I B;  1P3K C;  4J8V B;  1PZR A;  3X1T A;  3WKJ D;  3WTP C;  5B33 B;  5B31 C;  3V9R B;  3MGQ D;  4CAY B;  3AZJ C;  2YFW B;  3W96 D;  3REJ A;  5AVB B;  5AV9 A;  3W98 D;  3O62 C;  1P3A A;  3W97 D;  3AL0 C;  3VH6 A;  4WU8 D;  5BO0 A;  1P3L B;  3NQJ A;  1BFM A;  3VH6 W;  3REK C;  2XD1 A;  4J8W C;  3A1K A;  5BNX A;  4H9P B;  3H0R C;  3UTB D;  1P3G A;  1S32 A;  2Y2K A;  4ZUX D;  3C1C B;  2CV5 B;  3AZH A;  5CHL B;  4H9S A;  5B40 A;  4G92 C;  4X23 B;  5B2J D;  4XZQ A;  3REL C;  3MVD A;  1KX4 C;  5B32 D;  5BNV A;  2ARO A;  5B1L A;  4J8U C;  1HQ3 A;  5GXQ B;  4Z5T A;  1KX5 D;  2ZY3 A;  3AFA A;  3KWQ B;  5GT0 A;  3AYW C;  5GT3 A;  5BS7 C;  1AOI B;  4XUJ C;  3X1S D;  2HIO C;  3AZL D;  4KUD A;  4WU9 C;  1P3P A;  5G49 A;  3AZE B;  2PYO B;  5DNM C;  1ZLA A;  3MNN C;  1KX3 A;  5AVC D;  2NQB D;  3KSY A;  5E5A C;  3LZ0 B;  3EPL A;  4J8X A;  5B24 A;  1TZY D;  1M19 C;  2F8N D;  4QLC A;  5DNN C;  3B0C W;  3A6N A;  3AZM C;  4Z66 C;  3WAA A;  4LD9 A;  2BYK A;  1U35 C;  3LZ1 A;  3MGP B;  3B6F C;  5JRG A;  1P34 C;  5B0Z B;  3KUY C;  3LEL C;  4HGA B;  5F99 C;  3AZF D;  3AZI D;  1EQZ C;  3AN2 C;  5B1M A;  5CPJ D;  1P3M B;  3C1B A;  4KGC D;  5B0Y B;  3WA9 C;  2LY8 A;  2IO5 B;  4JJN A;  3FDD A;  1P3K B;  2W8S A;  2ZM5 A;  2Y2M A;  1ID3 A;  3WTP B;  5B31 B;  2JE5 A;  3AZJ B;  4KHA A;  3UTA C;  5B2I D;  1P3I C;  3O62 B;  4J8V D;  4WZS B;  3WKJ A;  3REK B;  5B33 D;  4WV4 B;  3MGQ A;  4J8W B;  3W96 A;  4NFT A;  1P3B C;  5AVB D;  3W98 A;  1P3O A;  4WU8 A;  2BYM B;  2YFV A;  4G92 B;  3B0B A;  3REL B;  3UTB A;  1KX4 B;  2Y2Q A;  4J8U B;  4ZUX A;  3C1C D;  2CV5 D;  1Z2C B;  3TU4 D;  3AYW B;  4X23 D;  5B32 A;  1M1A A;  4XUJ B;  2HIO B;  5GXQ D;  5FUG A;  1KX5 A;  2RIQ A;  4WU9 B;  4H9S C;  5DNM B;  5B40 C;  3W99 D;  3MNN B;  1AOI D;  3X1S A;  4H9R B;  5E5A B;  3MVD C;  1H3O A;  3AZL A;  2ARO C;  5B1L C;  2ZY2 A;  3AZK D;  1HQ3 C;  1M19 B;  5DNN B;  4H9Q B;  3AZN D;  3AZE D;  3AFA C;  3AZM B;  5GT0 C;  4Z66 B;  4R8P C;  1N1J A;  1U35 B;  3LZ0 D;  3UT9 C;  3X1V C;  5AV6 D;  3B6F B;  1TZY A;  1P34 B;  2F8N A;  1F1E A;  3F6T A;  1M18 C;  3LEL B;  4YS3 C;  5F99 B;  1P3P C;  4KUD C;  3NQU A;  1EQZ B;  3AN2 B;  2UWX A;  3IP4 C;  4Z2M H;  5B0Z D;  3WA9 B;  2FJ7 C;  3AZF A;  2XD5 A;  3AZI A;  2NZD C;  3WAA C;  4LD9 C;  4WNN A;  5CPJ A;  1P3M D;  4KGC A;  5B0Y D;  3UTA B;  1P3K D;  1P3I B;  4YM6 A;  5B1M C;  5B31 D;  3AZJ D;  3AZG C;  4H9O B;  4UUZ B;  1P3B B;  3O62 D;  3B6G C;  1JFI A;  3REH C;  3KFU G;  3AV1 C;  2F8N K;  5AV5 C;  3REK D;  1ID3 C;  5CP6 A;  3VH5 A;  5AVB A;  2Y2N A;  1F66 C;  2ZY5 A;  2Y2O A;  4WJ3 C;  3H0M C;  3REL D;  1KX4 D;  3H0L C;  2HUE C;  3C1C A;  2CV5 A;  1P3O C;  4WU8 C;  5JA4 B;  3TU4 A;  3AYW D;  4X23 A;  5B40 B;  3EG5 B;  4XUJ D;  5CPI C;  3MVD B;  2HIO D;  5C3I C;  2ARO B;  5B1L B;  4DRA A;  5GXQ A;  1HQ3 B;  5AY8 C;  3AV2 A;  4Z2M G;  4WU9 D;  3AFA B;  5DNM D;  5GT0 B;  3W99 A;  3MNN D;  1AOI A;  3X1U A;  4R8P B;  5E5A D;  1M1A C;  3UT9 B;  3X1V B;  5AV8 C;  3B0C T;  3AZK A;  1M19 D;  3R45 B;  5DNN D;  1M18 B;  3AZN A;  3MGS C;  2Y2I A;  2Y2J A;  3AZE A;  1W2E A;  4YS3 B;  2G5H C;  4E44 A;  4Z66 D;  3AZM D;  1P3P B;  4KUD B;  3LJA D;  1U35 D;  3LZ0 A;  2FFF B;  1ULY A;  5AV6 A;  5CPK D;  1WWI A;  5GSU D;  3KUY D;  3LEL D;  2FJ7 B;  5F99 D;  2NZD B;  1EQZ D;  3AN2 D;  3WAA B;  4LD9 B;  3WA9 D;  4UPK A;  1P3F C;  1P3M A;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...