3TU4D

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4D00
1P3KA 4J8UD 4H9SA 3NQJB 3B0BA 3W99C 3AZHC 3LZ0A 3O62A 1N1JA 3LELA 1TZYB 1M18C 3LJAC 4CAYB 3C1BA 5B24D 3KWQC 5AV5C 4XZQD 3WTPD 5B2IB 4XUJB 3MGSB 1P3OC 2YFVB 4ZUXB 5AV6A 4QLCB 3MNNA 1S32C 5GXQC 3MGQA 5CPKB 5DNMD 3REHC 1P3IA 3AZFC 3B0CT 5BNVB 3AN2A 2BYMA 4E44A 1AOIB 4Z5TC 5FUGB 3X1TC 5GT0A 3REIB 3KXBC 3RELC 3MVDC 2CV5A 3X1SA 3AFAB 1P3MD 1HTAA 2AROC 1TZYA 2PYOC 4Z66C 3REKD 5DNNB 3R45B 4YM6D 1M19C 3WTPE 2HIOD 2RVQC 5B2JA 3TU4A 2YFVA 4QLCA 3W97B 3UTBB 1H3OB 4Z2MG 2FJ7A 3KSYA 5CPKA 1U35B 3MGRC 1ID3B 5BNVA 4CSRA 1R4VA 5B1MD 4Z2MH 1AOIA 3W98D 5FUGA 5AVBC 4X23D 3WAAC 4J8XB 3VH5A 3REIA 3AV2B 5CPJD 4J8UB 3AFAA 3UTAC 4R8PD 3AZKC 5GSUA 5B24B 1P3FA 5DNNA 1F1EA 3UT9C 1BH9B 4EO5C 3WA9D 4H9PB 3W97A 5AY8D 3UTBA 5C3IB 3AZED 5CPIC 3W99D 3AZHD 5KDMB 1M18D 5BT1C 4WU8A 3LJAD 3AV2A 4J8UA 1A7WA 3KWQD 3AV1B 1P3OD 3REKB 1S32D 5GXQD 1KX4B 5B24A 3REHD 4XZQA 3WTPA 5E5AC 5DNMC 4Z5TD 4J8VD 3X1TD 1M1AC 3KXBD 4H9PA 3MVDD 3V9RB 3W98B 5B33B 2AROD 1P3MC 2PYOD 5KDMA 1P34B 3WKJD 3B0DB 4Z66D 1M19D 1HQ3D 4DRBA 4YM6C 5BNXB 2RVQD 5AV8C 3LZ1B 5F99C 2HIOC 3REKA 4ZBJB 2L5AA 4WU9C 4YS3C 1P3LC 2NQBB 3AZNC 1P3KB 5AVBD 3WAAD 3LZ0B 5AY8B 4LD9C 5B1MC 4X23C 3AV2D 1P3AD 3W99B 3AZHB 3UTAD 5CPJC 1EQZC 1BFMA 1WWSA 5B33A 3W98A 3X1UC 1WWIA 5AV9D 4R8PC 5BS7C 1P34A 2IO5C 3KWQB 2HUEC 5AV5B 5JRGC 3UT9D 3MGQB 1P3OB 5B0YC 4G91C 2F8ND 4H9QB 1KX5C 3B6FB 2JSSA 4NFTA 4WZSB 5B40C 3AN2B 3B6GC 4KGCC 3WA9C 3AZFB 2NQBA 3X1SB 3X1TB 5GT3C 3AZEC 1KX3D 3RELB 5CP6B 3MVDB 5BT1D 5AY8A 5AVCC 3W99A 3AZHA 5B0ZC 3MGPC 2PYOB 1M18A 4Z66B 5B2JB 3LJAA 3TU4B 3W96C 3KWQA 5AV5A 2FJ7B 4KUDC 5E5AD 1B67A 1P3OA 1M1AD 5B32C 4H9QA 3B6FA 4CSRB 1ZLAC 1S32A 5GXQA 4J8VC 3REHA 3MGRB 4G92B 3AZFA 1P3BC 3AYWB 1P3PB 4Z5TA 3X1TA 3WAAB 5B1LD 3KXBA 4JJNC 3RELA 5CP6A 2LY8A 3MVDA 3UTAB 5GSUB 3WKJC 1P3FB 5AV6C 3AZMC 5AV8D 3KUYD 2AROA 1HQ3C 3AZKB 2PYOA 5F99D 4Z66A 1M19A 4WU9D 4YS3D 1P3LD 3UT9B 3AZND 4EO5B 2F8NB 5B31D 2CV5C 4LD9D 1F66D 5CPIB 4WU8B 3MGRA 1EQZD 3AYWA 1P3GD 1P3PA 3X1UD 1P3AC 5AVBA 3WAAA 3C1CC 2YFWB 5B2IC 4XUJC 5JRGD 5AV9C 3MGSC 3UTAA 4ZUXC 5B0YD 3AZJC 4XZQB 3WTPB 1KX5D 3AZKA 5B40D 3B6GD 2F8NK 4KGCD 3UT9A 5DNMB 5GT3D 3AZGC 1M1AB 2F8NA 1KX3C 5CPIA 5AVCD 5B0ZD 1P3MB 3MGPD 5DNNC 3W96D 2YFWA 4YM6B 4KUDD 5B32D 2HIOB 1ZLAD 4J8WC 2F8NG 1U35C 1P3LB 1ID3C 3O62D 1P3BD 5E5AA 5DNMA 4J8XC 1M1AA 3B0CW 4JJND 5B1MB 4X23B 5B1LC 5CPJB 1EQZB 3MNND 5AV6D 3AZMD 3X1UB 1P3MA 2NZDC 4R8PB 4AWLB 2IO5B 3AZIC 2HUEB 3KUYC 5GT0D 4YM6A 4H9RB 5B0YB 4G91B 3VH6A 5AV8A 2CV5D 5C3IC 2HIOA 3WA9B 5B31C 3VH5T 4WU9A 3A6NC 4YS3A 1P3LA 3AZNA 1F66C 3AZEB 5BO0B 4LD9A 3C1CD 1P3GC 3AV1C 5B1MA 4XUJD 5AVCB 5B2ID 4X23A 3LJAB 3MGSD 1M18B 5CPJA 1EQZA 4ZUXD 1BH8B 3AZJD 4H9OB 4E45A 3X1UA 1KX4C 5BS7A 4R8PA 3REJC 3W96B 5JRGA 1JFIB 1S32B 5GXQB 3REHB 4H9RA 5B0YA 3AZGD 5B32B 1KX5A 5B40A 3B6GA 4Z5TB 4J8VB 4KGCA 4DRAA 1Q9CA 5JA4B 3KXBB 3AFAD 3WA9A 5B33C 2CWEA 1KU5A 3AZEA 3B0DC 5BO0A 5DNND 3AZLC 2AROB 4HGAC 4WV4B 3WKJB 5AVCA 3AZMB 1M19B 3LZ1C 1HQ3B 5B0ZA 3MGPA 1BH8A 3W97D 4H9OA 4J8WD 1U35D 3X1VC 1ID3D 3W96A 1P3KC 4H9SC 1JFIA 4KUDA 4J8XD 3LZ0C 3O62C 3LELC 4M6BA 5B32A 3NQUA 1ZLAA 4J8VA 5CHLB 5AVBB 5JA4A 3C1BC 1P3BA 1P3AB 4JJNA 2NZDD 3C1CB 3MNNC 3AZID 5AV9B 3MGQC 3VH6T 3WKJA 1P3IC 3AZMA 3B6FC 3AZJB 4H9NB 3AN2C 1HQ3A 5GT0C 5B32G 3A6ND 3X1SC 4NE5A 3AZGB 5CP6C 1TZYC 3VH5W 3NQJA 3AV1D 1KX3B 5B2JC 4CAYA 3TU4C 1P3AA 1KX4D 3C1CA 4QLCC 3REJD 4XUJA 5B2IA 3MGSA 5AV9A 5CPKC 2FJ7C 4ZUXA 4WNNB 3AZJA 4H9NA 1AOIC 4J8WB 5E5AB 3REIC 4G92C 3AYWC 5B33D 1P3PC 3AFAC 3AZGA 1P34D 3AZLD 5GSUC 5B1LB 1P3FC 1KX3A 3LZ1D 2NZDB 3R45A 4KHAB 3AZIB 5AV8B 3KUYB 3X1VD 2NQBD 3W97C 3UTBC 4NE6A 5F99B 1P3KD 4WU9B 4YS3B 4WNNA 3LZ0D 3AZNB 3LELD 1H3OA 4J8WA 5B31B 1U35A 4WU8C 2F8NH 3AV2C 3A6NB 1ID3A 4LD9B 3C1BD 4J8UC 1F66B 4J8XA 4NE3A 1P3GB 5AV5D 5B1LA 5B24C 3MGQD 1P3ID 4XZQC 3WTPC 3B6FD 5JRGB 3AN2D 4UUZB 2NZDA 4KHAA 3REJB 3AZFD 3AZIA 1KX5B 3KUYA 3VH6W 3X1SD 5B40B 1BH9A 3B6GB 5F99A 4KGCB 3RELD 5CP6D 1TZYD 5GT3B 5B31A 3A6NA 1F66A 5B2JD 3TU4D 3AZLB 4HGAB 5G49B 4QLCD 5B0ZB 3MGPB 3REKC 3AV1A 1P3GA 2FJ7D 5CPKD 1AOID 4UUZA 1KX4A 2BYKB 3X1VB 4KUDB 3REID 1TAFB 3MGRD 3REJA 3AYWD 3NQUB 1ZLAB 5B31G 1P3PD 3O62B 1N1JB 3LELB 2CV5B 1P3BB 3W98C 5GT3A 1P34C 5GSUD 3C1BB 4JJNB 1P3FD 3V9RA 3AZKD 4AWLC 3MNNB 5AV6B 3AZLA 5G49A 1ULYA 4ZBJC 5BNXA 3UTBD 1P3IB 2NQBC 3LZ1A 1B6WA 2BYMB 5GT0B 5CPID 2BYKA 3X1VA 4WU8D 1TAFA 5AY8C
chains in the Genus database with same CATH superfamily
1P3KA 4J8UD 4H9SA 3NQJB 3B0BA 3W99C 3AZHC 3LZ0A 3O62A 1N1JA 3LELA 1TZYB 1M18C 3LJAC 4CAYB 3C1BA 5B24D 3KWQC 5AV5C 4XZQD 3WTPD 5B2IB 4XUJB 3MGSB 1P3OC 2YFVB 1Z2CB 4ZUXB 5AV6A 4QLCB 3MNNA 1S32C 5GXQC 3MGQA 5CPKB 3A1KA 5DNMD 3REHC 1P3IA 3AZFC 3B0CT 5BNVB 3A1IA 3AN2A 2BYMA 4E44A 1AOIB 4Z5TC 5FUGB 3X1TC 2ZY5A 5GT0A 3REIB 3KXBC 3RELC 3MVDC 2CV5A 3X1SA 2ZY2A 3AFAB 1P3MD 1HTAA 1T3UA 2AROC 1TZYA 2PYOC 4Z66C 3REKD 5DNNB 3R45B 4YM6D 3EPKA 1M19C 3WTPE 2ZY3A 2HIOD 2RVQC 5B2JA 3TU4A 2YFVA 4QLCA 3W97B 3UTBB 1H3OB 4Z2MG 2FJ7A 3KSYA 5CPKA 1U35B 2Y2IA 3MGRC 1ID3B 5BNVA 4CSRA 1R4VA 5B1MD 4Z2MH 1AOIA 3W98D 5FUGA 5AVBC 4X23D 3WAAC 4J8XB 3VH5A 3REIA 3AV2B 5CPJD 4J8UB 3AFAA 3UTAC 4R8PD 3F6TA 3AZKC 5GSUA 5B24B 1P3FA 5DNNA 1F1EA 2JCHA 3UT9C 1BH9B 4EO5C 2F2AC 3WA9D 4H9PB 2Y2PA 3W97A 5AY8D 3UTBA 5C3IB 3AZED 5CPIC 3W99D 3AZHD 5KDMB 2VQRA 2J8PA 1M18D 5BT1C 4WU8A 3LJAD 3AV2A 4J8UA 1A7WA 3KWQD 3AV1B 2ZY4A 1P3OD 3H0RC 3REKB 1S32D 5GXQD 1KX4B 5B24A 3REHD 4XZQA 3WTPA 5E5AC 5DNMC 4Z5TD 4J8VD 3X1TD 1M1AC 3KXBD 4H9PA 3MVDD 2UWXA 2Y2LA 3V9RB 3W98B 5B33B 2AROD 1P3MC 2PYOD 5KDMA 1P34B 3WKJD 3B0DB 4Z66D 1M19D 1HQ3D 4DRBA 4YM6C 5BNXB 2RVQD 5AV8C 3LZ1B 2HIOC 5F99C 3REKA 4ZBJB 2L5AA 4WU9C 4YS3C 1P3LC 2NQBB 3AZNC 1P3KB 5AVBD 3WAAD 3LZ0B 5AY8B 4LD9C 5B1MC 4X23C 3AV2D 1P3AD 3W99B 3AZHB 3UTAD 5CPJC 1EQZC 1BFMA 1WWSA 5B33A 3W98A 3X1UC 1WWIA 5AV9D 4R8PC 5BS7C 1P34A 2IO5C 3KWQB 2HUEC 5AV5B 5JRGC 3UT9D 3MGQB 1P3OB 5B0YC 4G91C 2F8ND 4H9QB 1KX5C 3B6FB 2JSSA 4NFTA 4WZSB 5B40C 3AN2B 3B6GC 4KGCC 3WA9C 3AZFB 2NQBA 3X1SB 3X1TB 5GT3C 3AZEC 1KX3D 3RELB 5CP6B 3MVDB 5BT1D 2Y2NA 5AY8A 3EPHA 5AVCC 2Y2JA 3W99A 3AZHA 5B0ZC 3MGPC 2PYOB 1M18A 4Z66B 5B2JB 3LJAA 3TU4B 3W96C 3KWQA 5AV5A 2FJ7B 4KUDC 5E5AD 1B67A 1P3OA 1M1AD 5B32C 4H9QA 3B6FA 4CSRB 1ZLAC 1S32A 5GXQA 4J8VC 3REHA 3MGRB 4G92B 3AZFA 1P3BC 3AYWB 1P3PB 4Z5TA 3X1TA 3WAAB 5B1LD 3KXBA 4JJNC 3RELA 5CP6A 2LY8A 3MVDA 3UTAB 5GSUB 3WKJC 1P3FB 5AV6C 3AZMC 5AV8D 3KUYD 2AROA 1HQ3C 3AZKB 2PYOA 5F99D 4Z66A 1M19A 4WU9D 4YS3D 1P3LD 3UT9B 3AZND 4EO5B 2F8NB 5B31D 2CV5C 4LD9D 2W8SA 1F66D 5CPIB 4WU8B 3MGRA 1EQZD 3AYWA 1P3GD 1P3PA 3X1UD 1P3AC 5AVBA 4UPKA 3WAAA 3C1CC 2YFWB 5B2IC 4XUJC 5JRGD 5AV9C 3MGSC 3UTAA 2Y2HA 4ZUXC 5B0YD 3AZJC 4XZQB 3WTPB 1KX5D 3AZKA 5B40D 3B6GD 2F8NK 4KGCD 3UT9A 5DNMB 5GT3D 3AZGC 1M1AB 2F8NA 1PZRA 1KX3C 5CPIA 5AVCD 5B0ZD 1P3MB 3MGPD 5DNNC 2G5IC 3W96D 2YFWA 4YM6B 4KUDD 5B32D 2HIOB 2Y2KA 1ZLAD 4J8WC 2F8NG 1U35C 1P3LB 1ID3C 3O62D 1P3BD 5E5AA 5DNMA 4J8XC 1M1AA 3B0CW 4JJND 5B1MB 4X23B 5B1LC 5CPJB 1EQZB 3MNND 5AV6D 3AZMD 3X1UB 1P3MA 2NZDC 4R8PB 4AWLB 2IO5B 3AZIC 2HUEB 3KUYC 2Y2MA 5GT0D 4YM6A 4H9RB 5B0YB 4G91B 3VH6A 5AV8A 2CV5D 5C3IC 2HIOA 3WA9B 5B31C 3VH5T 4WU9A 3A6NC 4YS3A 1P3LA 3AZNA 2XD1A 1F66C 3AZEB 5BO0B 4LD9A 2G5HC 3C1CD 1P3GC 3AV1C 5B1MA 4XUJD 5AVCB 5B2ID 4X23A 3LJAB 3MGSD 1M18B 5CPJA 1EQZA 4ZUXD 1BH8B 3AZJD 4H9OB 4E45A 3X1UA 1KX4C 5BS7A 4R8PA 3REJC 3W96B 5JRGA 1JFIB 1S32B 5GXQB 3REHB 4H9RA 5B0YA 3AZGD 5B32B 1KX5A 2Y2GA 5B40A 3B6GA 4Z5TB 4J8VB 4KGCA 4DRAA 1Q9CA 5JA4B 3KXBB 3AFAD 3WA9A 5B33C 2CWEA 1KU5A 3AZEA 3B0DC 5BO0A 5DNND 3AZLC 2AROB 3EG5B 4HGAC 4WV4B 3WKJB 5AVCA 3AZMB 1M19B 2JE5A 3LZ1C 1HQ3B 5B0ZA 3MGPA 1BH8A 3W97D 4H9OA 4J8WD 1U35D 3X1VC 1ID3D 3W96A 1P3KC 4H9SC 1JFIA 4KUDA 4J8XD 3LZ0C 3O62C 3LELC 4M6BA 5B32A 3NQUA 1ZLAA 4J8VA 5CHLB 5AVBB 5JA4A 3C1BC 1P3BA 1P3AB 4JJNA 2NZDD 3C1CB 3MNNC 3AZID 5AV9B 3MGQC 3VH6T 3WKJA 1P3IC 3AZMA 3B6FC 3AZJB 2ZM5A 4H9NB 2FFFB 3AN2C 1HQ3A 5GT0C 5B32G 3A6ND 4DQYB 3X1SC 4NE5A 3AZGB 5CP6C 3H0MC 1TZYC 3VH5W 3NQJA 3AV1D 1KX3B 5B2JC 4CAYA 3TU4C 1P3AA 1KX4D 3C1CA 4QLCC 3REJD 4XUJA 5B2IA 3MGSA 5AV9A 5CPKC 2FJ7C 4ZUXA 4WNNB 3AZJA 4H9NA 1AOIC 4J8WB 3IP4C 2RIQA 5E5AB 3REIC 4G92C 2XD5A 3AYWC 2Y2QA 5B33D 1P3PC 3AFAC 3AZGA 1P34D 1W2EA 3AZLD 3AL0C 5GSUC 5B1LB 1P3FC 1KX3A 3LZ1D 2NZDB 3R45A 4KHAB 3AZIB 5AV8B 3KUYB 3X1VD 2NQBD 3W97C 3UTBC 4NE6A 5F99B 1P3KD 4WU9B 4YS3B 4WNNA 3LZ0D 3AZNB 2DF4C 3LELD 1H3OA 4J8WA 5B31B 1U35A 4WU8C 2F8NH 3AV2C 3A6NB 3H0LC 1ID3A 3P5JB 4LD9B 3C1BD 4J8UC 1F66B 4J8XA 4NE3A 1P3GB 5AV5D 5B1LA 5B24C 3MGQD 3KFUG 1P3ID 4XZQC 3WTPC 3B6FD 5JRGB 3AN2D 4UUZB 2NZDA 4KHAA 3REJB 3AZFD 3AZIA 1KX5B 3KUYA 3VH6W 3X1SD 5B40B 1BH9A 3B6GB 5F99A 4KGCB 3RELD 5CP6D 1TZYD 5GT3B 3EPJA 5B31A 3A6NA 1F66A 2BG1A 5B2JD 3TU4D 3AZLB 4HGAB 5G49B 4QLCD 5B0ZB 3MGPB 3EPLA 3REKC 3AV1A 1P3GA 2FJ7D 5CPKD 3FDDA 1AOID 4UUZA 1KX4A 2BYKB 3X1VB 4KUDB 3REID 1TAFB 2Y2OA 3MGRD 3REJA 3AYWD 3NQUB 1ZLAB 5B31G 1P3PD 4WJ3C 3O62B 1N1JB 3LELB 2CV5B 1P3BB 3W98C 5GT3A 1P34C 5GSUD 3C1BB 4JJNB 1P3FD 3V9RA 3AZKD 4AWLC 3MNNB 5AV6B 3AZLA 2DQNC 5G49A 1ULYA 4ZBJC 5BNXA 3UTBD 1P3IB 2NQBC 3LZ1A 1B6WA 2BYMB 5GT0B 5CPID 2BYKA 3X1VA 4WU8D 1TAFA 5AY8C
chains in the Genus database with same CATH topology
1P3KA 4J8UD 4H9SA 3NQJB 3B0BA 3W99C 3AZHC 3LZ0A 3O62A 1N1JA 3LELA 1TZYB 1M18C 3LJAC 4CAYB 3C1BA 5B24D 3KWQC 5AV5C 4XZQD 3WTPD 5B2IB 4XUJB 3MGSB 1P3OC 2YFVB 1Z2CB 4ZUXB 5AV6A 4QLCB 3MNNA 1S32C 5GXQC 3MGQA 5CPKB 3A1KA 5DNMD 3REHC 1P3IA 3AZFC 3B0CT 5BNVB 3A1IA 3AN2A 2BYMA 4E44A 1AOIB 4Z5TC 5FUGB 3X1TC 2ZY5A 5GT0A 3REIB 3KXBC 3RELC 3MVDC 2CV5A 3X1SA 2ZY2A 3AFAB 1P3MD 1HTAA 1T3UA 2AROC 1TZYA 2PYOC 4Z66C 3REKD 5DNNB 3R45B 4YM6D 3EPKA 1M19C 3WTPE 2ZY3A 2HIOD 2RVQC 5B2JA 3TU4A 2YFVA 4QLCA 3W97B 3UTBB 1H3OB 4Z2MG 2FJ7A 3KSYA 5CPKA 1U35B 2Y2IA 3MGRC 1ID3B 5BNVA 4CSRA 1R4VA 5B1MD 4Z2MH 1AOIA 3W98D 5FUGA 5AVBC 4X23D 3WAAC 4J8XB 3VH5A 3REIA 3AV2B 5CPJD 4J8UB 3AFAA 3UTAC 4R8PD 3F6TA 3AZKC 5GSUA 5B24B 1P3FA 5DNNA 1F1EA 2JCHA 3UT9C 1BH9B 4EO5C 2F2AC 3WA9D 4H9PB 2Y2PA 3W97A 5AY8D 3UTBA 5C3IB 3AZED 5CPIC 3W99D 3AZHD 5KDMB 2VQRA 2J8PA 1M18D 5BT1C 4WU8A 3LJAD 3AV2A 4J8UA 1A7WA 3KWQD 3AV1B 2ZY4A 1P3OD 3H0RC 3REKB 1S32D 5GXQD 1KX4B 5B24A 3REHD 4XZQA 3WTPA 5E5AC 5DNMC 4Z5TD 4J8VD 3X1TD 1M1AC 3KXBD 4H9PA 3MVDD 2UWXA 2Y2LA 3V9RB 3W98B 5B33B 2AROD 1P3MC 2PYOD 5KDMA 1P34B 3WKJD 3B0DB 4Z66D 1M19D 1HQ3D 4DRBA 4YM6C 5BNXB 2RVQD 5AV8C 3LZ1B 2HIOC 5F99C 3REKA 4ZBJB 2L5AA 4WU9C 4YS3C 1P3LC 2NQBB 3AZNC 1P3KB 5AVBD 3WAAD 3LZ0B 5AY8B 4LD9C 5B1MC 4X23C 3AV2D 1P3AD 3W99B 3AZHB 3UTAD 5CPJC 1EQZC 1BFMA 1WWSA 5B33A 3W98A 3X1UC 1WWIA 5AV9D 4R8PC 5BS7C 1P34A 2IO5C 3KWQB 2HUEC 5AV5B 5JRGC 3UT9D 3MGQB 1P3OB 5B0YC 4G91C 2F8ND 4H9QB 1KX5C 3B6FB 2JSSA 4NFTA 4WZSB 5B40C 3AN2B 3B6GC 4KGCC 3WA9C 3AZFB 2NQBA 3X1SB 3X1TB 5GT3C 3AZEC 1KX3D 3RELB 5CP6B 3MVDB 5BT1D 2Y2NA 5AY8A 3EPHA 5AVCC 2Y2JA 3W99A 3AZHA 5B0ZC 3MGPC 2PYOB 1M18A 4Z66B 5B2JB 3LJAA 3TU4B 3W96C 3KWQA 5AV5A 2FJ7B 4KUDC 5E5AD 1B67A 1P3OA 1M1AD 5B32C 4H9QA 3B6FA 4CSRB 1ZLAC 1S32A 5GXQA 4J8VC 3REHA 3MGRB 4G92B 3AZFA 1P3BC 3AYWB 1P3PB 4Z5TA 3X1TA 3WAAB 5B1LD 3KXBA 4JJNC 3RELA 5CP6A 2LY8A 3MVDA 3UTAB 5GSUB 3WKJC 1P3FB 5AV6C 3AZMC 5AV8D 3KUYD 2AROA 1HQ3C 3AZKB 2PYOA 5F99D 4Z66A 1M19A 4WU9D 4YS3D 1P3LD 3UT9B 3AZND 4EO5B 2F8NB 5B31D 2CV5C 4LD9D 2W8SA 1F66D 5CPIB 4WU8B 3MGRA 1EQZD 3AYWA 1P3GD 1P3PA 3X1UD 1P3AC 5AVBA 4UPKA 3WAAA 3C1CC 2YFWB 5B2IC 4XUJC 5JRGD 5AV9C 3MGSC 3UTAA 2Y2HA 4ZUXC 5B0YD 3AZJC 4XZQB 3WTPB 1KX5D 3AZKA 5B40D 3B6GD 2F8NK 4KGCD 3UT9A 5DNMB 5GT3D 3AZGC 1M1AB 2F8NA 1PZRA 1KX3C 5CPIA 5AVCD 5B0ZD 1P3MB 3MGPD 5DNNC 2G5IC 3W96D 2YFWA 4YM6B 4KUDD 5B32D 2HIOB 2Y2KA 1ZLAD 4J8WC 2F8NG 1U35C 1P3LB 1ID3C 3O62D 1P3BD 5E5AA 5DNMA 4J8XC 1M1AA 3B0CW 4JJND 5B1MB 4X23B 5B1LC 5CPJB 1EQZB 3MNND 5AV6D 3AZMD 3X1UB 1P3MA 2NZDC 4R8PB 4AWLB 2IO5B 3AZIC 2HUEB 3KUYC 2Y2MA 5GT0D 4YM6A 4H9RB 5B0YB 4G91B 3VH6A 5AV8A 2CV5D 5C3IC 2HIOA 3WA9B 5B31C 3VH5T 4WU9A 3A6NC 4YS3A 1P3LA 3AZNA 2XD1A 1F66C 3AZEB 5BO0B 4LD9A 2G5HC 3C1CD 1P3GC 3AV1C 5B1MA 4XUJD 5AVCB 5B2ID 4X23A 3LJAB 3MGSD 1M18B 5CPJA 1EQZA 4ZUXD 1BH8B 3AZJD 4H9OB 4E45A 3X1UA 1KX4C 5BS7A 4R8PA 3REJC 3W96B 5JRGA 1JFIB 1S32B 5GXQB 3REHB 4H9RA 5B0YA 3AZGD 5B32B 1KX5A 2Y2GA 5B40A 3B6GA 4Z5TB 4J8VB 4KGCA 4DRAA 1Q9CA 5JA4B 3KXBB 3AFAD 3WA9A 5B33C 2CWEA 1KU5A 3AZEA 3B0DC 5BO0A 5DNND 3AZLC 2AROB 3EG5B 4HGAC 4WV4B 3WKJB 5AVCA 3AZMB 1M19B 2JE5A 3LZ1C 1HQ3B 5B0ZA 3MGPA 1BH8A 3W97D 4H9OA 4J8WD 1U35D 3X1VC 1ID3D 3W96A 1P3KC 4H9SC 1JFIA 4KUDA 4J8XD 3LZ0C 3O62C 3LELC 4M6BA 5B32A 3NQUA 1ZLAA 4J8VA 5CHLB 5AVBB 5JA4A 3C1BC 1P3BA 1P3AB 4JJNA 2NZDD 3C1CB 3MNNC 3AZID 5AV9B 3MGQC 3VH6T 3WKJA 1P3IC 3AZMA 3B6FC 3AZJB 2ZM5A 4H9NB 2FFFB 3AN2C 1HQ3A 5GT0C 5B32G 3A6ND 4DQYB 3X1SC 4NE5A 3AZGB 5CP6C 3H0MC 1TZYC 3VH5W 3NQJA 3AV1D 1KX3B 5B2JC 4CAYA 3TU4C 1P3AA 1KX4D 3C1CA 4QLCC 3REJD 4XUJA 5B2IA 3MGSA 5AV9A 5CPKC 2FJ7C 4ZUXA 4WNNB 3AZJA 4H9NA 1AOIC 4J8WB 3IP4C 2RIQA 5E5AB 3REIC 4G92C 2XD5A 3AYWC 2Y2QA 5B33D 1P3PC 3AFAC 3AZGA 1P34D 1W2EA 3AZLD 3AL0C 5GSUC 5B1LB 1P3FC 1KX3A 3LZ1D 2NZDB 3R45A 4KHAB 3AZIB 5AV8B 3KUYB 3X1VD 2NQBD 3W97C 3UTBC 4NE6A 5F99B 1P3KD 4WU9B 4YS3B 4WNNA 3LZ0D 3AZNB 2DF4C 3LELD 1H3OA 4J8WA 5B31B 1U35A 4WU8C 2F8NH 3AV2C 3A6NB 3H0LC 1ID3A 3P5JB 4LD9B 3C1BD 4J8UC 1F66B 4J8XA 4NE3A 1P3GB 5AV5D 5B1LA 5B24C 3MGQD 3KFUG 1P3ID 4XZQC 3WTPC 3B6FD 5JRGB 3AN2D 4UUZB 2NZDA 4KHAA 3REJB 3AZFD 3AZIA 1KX5B 3KUYA 3VH6W 3X1SD 5B40B 1BH9A 3B6GB 5F99A 4KGCB 3RELD 5CP6D 1TZYD 5GT3B 3EPJA 5B31A 3A6NA 1F66A 2BG1A 5B2JD 3TU4D 3AZLB 4HGAB 5G49B 4QLCD 5B0ZB 3MGPB 3EPLA 3REKC 3AV1A 1P3GA 2FJ7D 5CPKD 3FDDA 1AOID 4UUZA 1KX4A 2BYKB 3X1VB 4KUDB 3REID 1TAFB 2Y2OA 3MGRD 3REJA 3AYWD 3NQUB 1ZLAB 5B31G 1P3PD 4WJ3C 3O62B 1N1JB 3LELB 2CV5B 1P3BB 3W98C 5GT3A 1P34C 5GSUD 3C1BB 4JJNB 1P3FD 3V9RA 3AZKD 4AWLC 3MNNB 5AV6B 3AZLA 2DQNC 5G49A 1ULYA 4ZBJC 5BNXA 3UTBD 1P3IB 2NQBC 3LZ1A 1B6WA 2BYMB 5GT0B 5CPID 2BYKA 3X1VA 4WU8D 1TAFA 5AY8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K A;  4J8U D;  4H9S A;  3NQJ B;  3B0B A;  3W99 C;  3AZH C;  3LZ0 A;  3O62 A;  1N1J A;  3LEL A;  1TZY B;  1M18 C;  3LJA C;  4CAY B;  3C1B A;  5B24 D;  3KWQ C;  5AV5 C;  4XZQ D;  3WTP D;  5B2I B;  4XUJ B;  3MGS B;  1P3O C;  2YFV B;  4ZUX B;  5AV6 A;  4QLC B;  3MNN A;  1S32 C;  5GXQ C;  3MGQ A;  5CPK B;  5DNM D;  3REH C;  1P3I A;  3AZF C;  3B0C T;  5BNV B;  3AN2 A;  2BYM A;  4E44 A;  1AOI B;  4Z5T C;  5FUG B;  3X1T C;  5GT0 A;  3REI B;  3KXB C;  3REL C;  3MVD C;  2CV5 A;  3X1S A;  3AFA B;  1P3M D;  1HTA A;  2ARO C;  1TZY A;  2PYO C;  4Z66 C;  3REK D;  5DNN B;  3R45 B;  4YM6 D;  1M19 C;  3WTP E;  2HIO D;  2RVQ C;  5B2J A;  3TU4 A;  2YFV A;  4QLC A;  3W97 B;  3UTB B;  1H3O B;  4Z2M G;  2FJ7 A;  3KSY A;  5CPK A;  1U35 B;  3MGR C;  1ID3 B;  5BNV A;  4CSR A;  1R4V A;  5B1M D;  4Z2M H;  1AOI A;  3W98 D;  5FUG A;  5AVB C;  4X23 D;  3WAA C;  4J8X B;  3VH5 A;  3REI A;  3AV2 B;  5CPJ D;  4J8U B;  3AFA A;  3UTA C;  4R8P D;  3AZK C;  5GSU A;  5B24 B;  1P3F A;  5DNN A;  1F1E A;  3UT9 C;  1BH9 B;  4EO5 C;  3WA9 D;  4H9P B;  3W97 A;  5AY8 D;  3UTB A;  5C3I B;  3AZE D;  5CPI C;  3W99 D;  3AZH D;  5KDM B;  1M18 D;  5BT1 C;  4WU8 A;  3LJA D;  3AV2 A;  4J8U A;  1A7W A;  3KWQ D;  3AV1 B;  1P3O D;  3REK B;  1S32 D;  5GXQ D;  1KX4 B;  5B24 A;  3REH D;  4XZQ A;  3WTP A;  5E5A C;  5DNM C;  4Z5T D;  4J8V D;  3X1T D;  1M1A C;  3KXB D;  4H9P A;  3MVD D;  3V9R B;  3W98 B;  5B33 B;  2ARO D;  1P3M C;  2PYO D;  5KDM A;  1P34 B;  3WKJ D;  3B0D B;  4Z66 D;  1M19 D;  1HQ3 D;  4DRB A;  4YM6 C;  5BNX B;  2RVQ D;  5AV8 C;  3LZ1 B;  5F99 C;  2HIO C;  3REK A;  4ZBJ B;  2L5A A;  4WU9 C;  4YS3 C;  1P3L C;  2NQB B;  3AZN C;  1P3K B;  5AVB D;  3WAA D;  3LZ0 B;  5AY8 B;  4LD9 C;  5B1M C;  4X23 C;  3AV2 D;  1P3A D;  3W99 B;  3AZH B;  3UTA D;  5CPJ C;  1EQZ C;  1BFM A;  1WWS A;  5B33 A;  3W98 A;  3X1U C;  1WWI A;  5AV9 D;  4R8P C;  5BS7 C;  1P34 A;  2IO5 C;  3KWQ B;  2HUE C;  5AV5 B;  5JRG C;  3UT9 D;  3MGQ B;  1P3O B;  5B0Y C;  4G91 C;  2F8N D;  4H9Q B;  1KX5 C;  3B6F B;  2JSS A;  4NFT A;  4WZS B;  5B40 C;  3AN2 B;  3B6G C;  4KGC C;  3WA9 C;  3AZF B;  2NQB A;  3X1S B;  3X1T B;  5GT3 C;  3AZE C;  1KX3 D;  3REL B;  5CP6 B;  3MVD B;  5BT1 D;  5AY8 A;  5AVC C;  3W99 A;  3AZH A;  5B0Z C;  3MGP C;  2PYO B;  1M18 A;  4Z66 B;  5B2J B;  3LJA A;  3TU4 B;  3W96 C;  3KWQ A;  5AV5 A;  2FJ7 B;  4KUD C;  5E5A D;  1B67 A;  1P3O A;  1M1A D;  5B32 C;  4H9Q A;  3B6F A;  4CSR B;  1ZLA C;  1S32 A;  5GXQ A;  4J8V C;  3REH A;  3MGR B;  4G92 B;  3AZF A;  1P3B C;  3AYW B;  1P3P B;  4Z5T A;  3X1T A;  3WAA B;  5B1L D;  3KXB A;  4JJN C;  3REL A;  5CP6 A;  2LY8 A;  3MVD A;  3UTA B;  5GSU B;  3WKJ C;  1P3F B;  5AV6 C;  3AZM C;  5AV8 D;  3KUY D;  2ARO A;  1HQ3 C;  3AZK B;  2PYO A;  5F99 D;  4Z66 A;  1M19 A;  4WU9 D;  4YS3 D;  1P3L D;  3UT9 B;  3AZN D;  4EO5 B;  2F8N B;  5B31 D;  2CV5 C;  4LD9 D;  1F66 D;  5CPI B;  4WU8 B;  3MGR A;  1EQZ D;  3AYW A;  1P3G D;  1P3P A;  3X1U D;  1P3A C;  5AVB A;  3WAA A;  3C1C C;  2YFW B;  5B2I C;  4XUJ C;  5JRG D;  5AV9 C;  3MGS C;  3UTA A;  4ZUX C;  5B0Y D;  3AZJ C;  4XZQ B;  3WTP B;  1KX5 D;  3AZK A;  5B40 D;  3B6G D;  2F8N K;  4KGC D;  3UT9 A;  5DNM B;  5GT3 D;  3AZG C;  1M1A B;  2F8N A;  1KX3 C;  5CPI A;  5AVC D;  5B0Z D;  1P3M B;  3MGP D;  5DNN C;  3W96 D;  2YFW A;  4YM6 B;  4KUD D;  5B32 D;  2HIO B;  1ZLA D;  4J8W C;  2F8N G;  1U35 C;  1P3L B;  1ID3 C;  3O62 D;  1P3B D;  5E5A A;  5DNM A;  4J8X C;  1M1A A;  3B0C W;  4JJN D;  5B1M B;  4X23 B;  5B1L C;  5CPJ B;  1EQZ B;  3MNN D;  5AV6 D;  3AZM D;  3X1U B;  1P3M A;  2NZD C;  4R8P B;  4AWL B;  2IO5 B;  3AZI C;  2HUE B;  3KUY C;  5GT0 D;  4YM6 A;  4H9R B;  5B0Y B;  4G91 B;  3VH6 A;  5AV8 A;  2CV5 D;  5C3I C;  2HIO A;  3WA9 B;  5B31 C;  3VH5 T;  4WU9 A;  3A6N C;  4YS3 A;  1P3L A;  3AZN A;  1F66 C;  3AZE B;  5BO0 B;  4LD9 A;  3C1C D;  1P3G C;  3AV1 C;  5B1M A;  4XUJ D;  5AVC B;  5B2I D;  4X23 A;  3LJA B;  3MGS D;  1M18 B;  5CPJ A;  1EQZ A;  4ZUX D;  1BH8 B;  3AZJ D;  4H9O B;  4E45 A;  3X1U A;  1KX4 C;  5BS7 A;  4R8P A;  3REJ C;  3W96 B;  5JRG A;  1JFI B;  1S32 B;  5GXQ B;  3REH B;  4H9R A;  5B0Y A;  3AZG D;  5B32 B;  1KX5 A;  5B40 A;  3B6G A;  4Z5T B;  4J8V B;  4KGC A;  4DRA A;  1Q9C A;  5JA4 B;  3KXB B;  3AFA D;  3WA9 A;  5B33 C;  2CWE A;  1KU5 A;  3AZE A;  3B0D C;  5BO0 A;  5DNN D;  3AZL C;  2ARO B;  4HGA C;  4WV4 B;  3WKJ B;  5AVC A;  3AZM B;  1M19 B;  3LZ1 C;  1HQ3 B;  5B0Z A;  3MGP A;  1BH8 A;  3W97 D;  4H9O A;  4J8W D;  1U35 D;  3X1V C;  1ID3 D;  3W96 A;  1P3K C;  4H9S C;  1JFI A;  4KUD A;  4J8X D;  3LZ0 C;  3O62 C;  3LEL C;  4M6B A;  5B32 A;  3NQU A;  1ZLA A;  4J8V A;  5CHL B;  5AVB B;  5JA4 A;  3C1B C;  1P3B A;  1P3A B;  4JJN A;  2NZD D;  3C1C B;  3MNN C;  3AZI D;  5AV9 B;  3MGQ C;  3VH6 T;  3WKJ A;  1P3I C;  3AZM A;  3B6F C;  3AZJ B;  4H9N B;  3AN2 C;  1HQ3 A;  5GT0 C;  5B32 G;  3A6N D;  3X1S C;  4NE5 A;  3AZG B;  5CP6 C;  1TZY C;  3VH5 W;  3NQJ A;  3AV1 D;  1KX3 B;  5B2J C;  4CAY A;  3TU4 C;  1P3A A;  1KX4 D;  3C1C A;  4QLC C;  3REJ D;  4XUJ A;  5B2I A;  3MGS A;  5AV9 A;  5CPK C;  2FJ7 C;  4ZUX A;  4WNN B;  3AZJ A;  4H9N A;  1AOI C;  4J8W B;  5E5A B;  3REI C;  4G92 C;  3AYW C;  5B33 D;  1P3P C;  3AFA C;  3AZG A;  1P34 D;  3AZL D;  5GSU C;  5B1L B;  1P3F C;  1KX3 A;  3LZ1 D;  2NZD B;  3R45 A;  4KHA B;  3AZI B;  5AV8 B;  3KUY B;  3X1V D;  2NQB D;  3W97 C;  3UTB C;  4NE6 A;  5F99 B;  1P3K D;  4WU9 B;  4YS3 B;  4WNN A;  3LZ0 D;  3AZN B;  3LEL D;  1H3O A;  4J8W A;  5B31 B;  1U35 A;  4WU8 C;  2F8N H;  3AV2 C;  3A6N B;  1ID3 A;  4LD9 B;  3C1B D;  4J8U C;  1F66 B;  4J8X A;  4NE3 A;  1P3G B;  5AV5 D;  5B1L A;  5B24 C;  3MGQ D;  1P3I D;  4XZQ C;  3WTP C;  3B6F D;  5JRG B;  3AN2 D;  4UUZ B;  2NZD A;  4KHA A;  3REJ B;  3AZF D;  3AZI A;  1KX5 B;  3KUY A;  3VH6 W;  3X1S D;  5B40 B;  1BH9 A;  3B6G B;  5F99 A;  4KGC B;  3REL D;  5CP6 D;  1TZY D;  5GT3 B;  5B31 A;  3A6N A;  1F66 A;  5B2J D;  3TU4 D;  3AZL B;  4HGA B;  5G49 B;  4QLC D;  5B0Z B;  3MGP B;  3REK C;  3AV1 A;  1P3G A;  2FJ7 D;  5CPK D;  1AOI D;  4UUZ A;  1KX4 A;  2BYK B;  3X1V B;  4KUD B;  3REI D;  1TAF B;  3MGR D;  3REJ A;  3AYW D;  3NQU B;  1ZLA B;  5B31 G;  1P3P D;  3O62 B;  1N1J B;  3LEL B;  2CV5 B;  1P3B B;  3W98 C;  5GT3 A;  1P34 C;  5GSU D;  3C1B B;  4JJN B;  1P3F D;  3V9R A;  3AZK D;  4AWL C;  3MNN B;  5AV6 B;  3AZL A;  5G49 A;  1ULY A;  4ZBJ C;  5BNX A;  3UTB D;  1P3I B;  2NQB C;  3LZ1 A;  1B6W A;  2BYM B;  5GT0 B;  5CPI D;  2BYK A;  3X1V A;  4WU8 D;  1TAF A;  5AY8 C; 
#chains in the Genus database with same CATH topology
 1P3K A;  4J8U D;  4H9S A;  3NQJ B;  3B0B A;  3W99 C;  3AZH C;  3LZ0 A;  3O62 A;  1N1J A;  3LEL A;  1TZY B;  1M18 C;  3LJA C;  4CAY B;  3C1B A;  5B24 D;  3KWQ C;  5AV5 C;  4XZQ D;  3WTP D;  5B2I B;  4XUJ B;  3MGS B;  1P3O C;  2YFV B;  1Z2C B;  4ZUX B;  5AV6 A;  4QLC B;  3MNN A;  1S32 C;  5GXQ C;  3MGQ A;  5CPK B;  3A1K A;  5DNM D;  3REH C;  1P3I A;  3AZF C;  3B0C T;  5BNV B;  3A1I A;  3AN2 A;  2BYM A;  4E44 A;  1AOI B;  4Z5T C;  5FUG B;  3X1T C;  2ZY5 A;  5GT0 A;  3REI B;  3KXB C;  3REL C;  3MVD C;  2CV5 A;  3X1S A;  2ZY2 A;  3AFA B;  1P3M D;  1HTA A;  1T3U A;  2ARO C;  1TZY A;  2PYO C;  4Z66 C;  3REK D;  5DNN B;  3R45 B;  4YM6 D;  3EPK A;  1M19 C;  3WTP E;  2ZY3 A;  2HIO D;  2RVQ C;  5B2J A;  3TU4 A;  2YFV A;  4QLC A;  3W97 B;  3UTB B;  1H3O B;  4Z2M G;  2FJ7 A;  3KSY A;  5CPK A;  1U35 B;  2Y2I A;  3MGR C;  1ID3 B;  5BNV A;  4CSR A;  1R4V A;  5B1M D;  4Z2M H;  1AOI A;  3W98 D;  5FUG A;  5AVB C;  4X23 D;  3WAA C;  4J8X B;  3VH5 A;  3REI A;  3AV2 B;  5CPJ D;  4J8U B;  3AFA A;  3UTA C;  4R8P D;  3F6T A;  3AZK C;  5GSU A;  5B24 B;  1P3F A;  5DNN A;  1F1E A;  2JCH A;  3UT9 C;  1BH9 B;  4EO5 C;  2F2A C;  3WA9 D;  4H9P B;  2Y2P A;  3W97 A;  5AY8 D;  3UTB A;  5C3I B;  3AZE D;  5CPI C;  3W99 D;  3AZH D;  5KDM B;  2VQR A;  2J8P A;  1M18 D;  5BT1 C;  4WU8 A;  3LJA D;  3AV2 A;  4J8U A;  1A7W A;  3KWQ D;  3AV1 B;  2ZY4 A;  1P3O D;  3H0R C;  3REK B;  1S32 D;  5GXQ D;  1KX4 B;  5B24 A;  3REH D;  4XZQ A;  3WTP A;  5E5A C;  5DNM C;  4Z5T D;  4J8V D;  3X1T D;  1M1A C;  3KXB D;  4H9P A;  3MVD D;  2UWX A;  2Y2L A;  3V9R B;  3W98 B;  5B33 B;  2ARO D;  1P3M C;  2PYO D;  5KDM A;  1P34 B;  3WKJ D;  3B0D B;  4Z66 D;  1M19 D;  1HQ3 D;  4DRB A;  4YM6 C;  5BNX B;  2RVQ D;  5AV8 C;  3LZ1 B;  2HIO C;  5F99 C;  3REK A;  4ZBJ B;  2L5A A;  4WU9 C;  4YS3 C;  1P3L C;  2NQB B;  3AZN C;  1P3K B;  5AVB D;  3WAA D;  3LZ0 B;  5AY8 B;  4LD9 C;  5B1M C;  4X23 C;  3AV2 D;  1P3A D;  3W99 B;  3AZH B;  3UTA D;  5CPJ C;  1EQZ C;  1BFM A;  1WWS A;  5B33 A;  3W98 A;  3X1U C;  1WWI A;  5AV9 D;  4R8P C;  5BS7 C;  1P34 A;  2IO5 C;  3KWQ B;  2HUE C;  5AV5 B;  5JRG C;  3UT9 D;  3MGQ B;  1P3O B;  5B0Y C;  4G91 C;  2F8N D;  4H9Q B;  1KX5 C;  3B6F B;  2JSS A;  4NFT A;  4WZS B;  5B40 C;  3AN2 B;  3B6G C;  4KGC C;  3WA9 C;  3AZF B;  2NQB A;  3X1S B;  3X1T B;  5GT3 C;  3AZE C;  1KX3 D;  3REL B;  5CP6 B;  3MVD B;  5BT1 D;  2Y2N A;  5AY8 A;  3EPH A;  5AVC C;  2Y2J A;  3W99 A;  3AZH A;  5B0Z C;  3MGP C;  2PYO B;  1M18 A;  4Z66 B;  5B2J B;  3LJA A;  3TU4 B;  3W96 C;  3KWQ A;  5AV5 A;  2FJ7 B;  4KUD C;  5E5A D;  1B67 A;  1P3O A;  1M1A D;  5B32 C;  4H9Q A;  3B6F A;  4CSR B;  1ZLA C;  1S32 A;  5GXQ A;  4J8V C;  3REH A;  3MGR B;  4G92 B;  3AZF A;  1P3B C;  3AYW B;  1P3P B;  4Z5T A;  3X1T A;  3WAA B;  5B1L D;  3KXB A;  4JJN C;  3REL A;  5CP6 A;  2LY8 A;  3MVD A;  3UTA B;  5GSU B;  3WKJ C;  1P3F B;  5AV6 C;  3AZM C;  5AV8 D;  3KUY D;  2ARO A;  1HQ3 C;  3AZK B;  2PYO A;  5F99 D;  4Z66 A;  1M19 A;  4WU9 D;  4YS3 D;  1P3L D;  3UT9 B;  3AZN D;  4EO5 B;  2F8N B;  5B31 D;  2CV5 C;  4LD9 D;  2W8S A;  1F66 D;  5CPI B;  4WU8 B;  3MGR A;  1EQZ D;  3AYW A;  1P3G D;  1P3P A;  3X1U D;  1P3A C;  5AVB A;  4UPK A;  3WAA A;  3C1C C;  2YFW B;  5B2I C;  4XUJ C;  5JRG D;  5AV9 C;  3MGS C;  3UTA A;  2Y2H A;  4ZUX C;  5B0Y D;  3AZJ C;  4XZQ B;  3WTP B;  1KX5 D;  3AZK A;  5B40 D;  3B6G D;  2F8N K;  4KGC D;  3UT9 A;  5DNM B;  5GT3 D;  3AZG C;  1M1A B;  2F8N A;  1PZR A;  1KX3 C;  5CPI A;  5AVC D;  5B0Z D;  1P3M B;  3MGP D;  5DNN C;  2G5I C;  3W96 D;  2YFW A;  4YM6 B;  4KUD D;  5B32 D;  2HIO B;  2Y2K A;  1ZLA D;  4J8W C;  2F8N G;  1U35 C;  1P3L B;  1ID3 C;  3O62 D;  1P3B D;  5E5A A;  5DNM A;  4J8X C;  1M1A A;  3B0C W;  4JJN D;  5B1M B;  4X23 B;  5B1L C;  5CPJ B;  1EQZ B;  3MNN D;  5AV6 D;  3AZM D;  3X1U B;  1P3M A;  2NZD C;  4R8P B;  4AWL B;  2IO5 B;  3AZI C;  2HUE B;  3KUY C;  2Y2M A;  5GT0 D;  4YM6 A;  4H9R B;  5B0Y B;  4G91 B;  3VH6 A;  5AV8 A;  2CV5 D;  5C3I C;  2HIO A;  3WA9 B;  5B31 C;  3VH5 T;  4WU9 A;  3A6N C;  4YS3 A;  1P3L A;  3AZN A;  2XD1 A;  1F66 C;  3AZE B;  5BO0 B;  4LD9 A;  2G5H C;  3C1C D;  1P3G C;  3AV1 C;  5B1M A;  4XUJ D;  5AVC B;  5B2I D;  4X23 A;  3LJA B;  3MGS D;  1M18 B;  5CPJ A;  1EQZ A;  4ZUX D;  1BH8 B;  3AZJ D;  4H9O B;  4E45 A;  3X1U A;  1KX4 C;  5BS7 A;  4R8P A;  3REJ C;  3W96 B;  5JRG A;  1JFI B;  1S32 B;  5GXQ B;  3REH B;  4H9R A;  5B0Y A;  3AZG D;  5B32 B;  1KX5 A;  2Y2G A;  5B40 A;  3B6G A;  4Z5T B;  4J8V B;  4KGC A;  4DRA A;  1Q9C A;  5JA4 B;  3KXB B;  3AFA D;  3WA9 A;  5B33 C;  2CWE A;  1KU5 A;  3AZE A;  3B0D C;  5BO0 A;  5DNN D;  3AZL C;  2ARO B;  3EG5 B;  4HGA C;  4WV4 B;  3WKJ B;  5AVC A;  3AZM B;  1M19 B;  2JE5 A;  3LZ1 C;  1HQ3 B;  5B0Z A;  3MGP A;  1BH8 A;  3W97 D;  4H9O A;  4J8W D;  1U35 D;  3X1V C;  1ID3 D;  3W96 A;  1P3K C;  4H9S C;  1JFI A;  4KUD A;  4J8X D;  3LZ0 C;  3O62 C;  3LEL C;  4M6B A;  5B32 A;  3NQU A;  1ZLA A;  4J8V A;  5CHL B;  5AVB B;  5JA4 A;  3C1B C;  1P3B A;  1P3A B;  4JJN A;  2NZD D;  3C1C B;  3MNN C;  3AZI D;  5AV9 B;  3MGQ C;  3VH6 T;  3WKJ A;  1P3I C;  3AZM A;  3B6F C;  3AZJ B;  2ZM5 A;  4H9N B;  2FFF B;  3AN2 C;  1HQ3 A;  5GT0 C;  5B32 G;  3A6N D;  4DQY B;  3X1S C;  4NE5 A;  3AZG B;  5CP6 C;  3H0M C;  1TZY C;  3VH5 W;  3NQJ A;  3AV1 D;  1KX3 B;  5B2J C;  4CAY A;  3TU4 C;  1P3A A;  1KX4 D;  3C1C A;  4QLC C;  3REJ D;  4XUJ A;  5B2I A;  3MGS A;  5AV9 A;  5CPK C;  2FJ7 C;  4ZUX A;  4WNN B;  3AZJ A;  4H9N A;  1AOI C;  4J8W B;  3IP4 C;  2RIQ A;  5E5A B;  3REI C;  4G92 C;  2XD5 A;  3AYW C;  2Y2Q A;  5B33 D;  1P3P C;  3AFA C;  3AZG A;  1P34 D;  1W2E A;  3AZL D;  3AL0 C;  5GSU C;  5B1L B;  1P3F C;  1KX3 A;  3LZ1 D;  2NZD B;  3R45 A;  4KHA B;  3AZI B;  5AV8 B;  3KUY B;  3X1V D;  2NQB D;  3W97 C;  3UTB C;  4NE6 A;  5F99 B;  1P3K D;  4WU9 B;  4YS3 B;  4WNN A;  3LZ0 D;  3AZN B;  2DF4 C;  3LEL D;  1H3O A;  4J8W A;  5B31 B;  1U35 A;  4WU8 C;  2F8N H;  3AV2 C;  3A6N B;  3H0L C;  1ID3 A;  3P5J B;  4LD9 B;  3C1B D;  4J8U C;  1F66 B;  4J8X A;  4NE3 A;  1P3G B;  5AV5 D;  5B1L A;  5B24 C;  3MGQ D;  3KFU G;  1P3I D;  4XZQ C;  3WTP C;  3B6F D;  5JRG B;  3AN2 D;  4UUZ B;  2NZD A;  4KHA A;  3REJ B;  3AZF D;  3AZI A;  1KX5 B;  3KUY A;  3VH6 W;  3X1S D;  5B40 B;  1BH9 A;  3B6G B;  5F99 A;  4KGC B;  3REL D;  5CP6 D;  1TZY D;  5GT3 B;  3EPJ A;  5B31 A;  3A6N A;  1F66 A;  2BG1 A;  5B2J D;  3TU4 D;  3AZL B;  4HGA B;  5G49 B;  4QLC D;  5B0Z B;  3MGP B;  3EPL A;  3REK C;  3AV1 A;  1P3G A;  2FJ7 D;  5CPK D;  3FDD A;  1AOI D;  4UUZ A;  1KX4 A;  2BYK B;  3X1V B;  4KUD B;  3REI D;  1TAF B;  2Y2O A;  3MGR D;  3REJ A;  3AYW D;  3NQU B;  1ZLA B;  5B31 G;  1P3P D;  4WJ3 C;  3O62 B;  1N1J B;  3LEL B;  2CV5 B;  1P3B B;  3W98 C;  5GT3 A;  1P34 C;  5GSU D;  3C1B B;  4JJN B;  1P3F D;  3V9R A;  3AZK D;  4AWL C;  3MNN B;  5AV6 B;  3AZL A;  2DQN C;  5G49 A;  1ULY A;  4ZBJ C;  5BNX A;  3UTB D;  1P3I B;  2NQB C;  3LZ1 A;  1B6W A;  2BYM B;  5GT0 B;  5CPI D;  2BYK A;  3X1V A;  4WU8 D;  1TAF A;  5AY8 C; 
#chains in the Genus database with same CATH homology
 1P3K A;  4J8U D;  4H9S A;  3NQJ B;  3B0B A;  3W99 C;  3AZH C;  3LZ0 A;  3O62 A;  1N1J A;  3LEL A;  1TZY B;  1M18 C;  3LJA C;  4CAY B;  3C1B A;  5B24 D;  3KWQ C;  5AV5 C;  4XZQ D;  3WTP D;  5B2I B;  4XUJ B;  3MGS B;  1P3O C;  2YFV B;  1Z2C B;  4ZUX B;  5AV6 A;  4QLC B;  3MNN A;  1S32 C;  5GXQ C;  3MGQ A;  5CPK B;  3A1K A;  5DNM D;  3REH C;  1P3I A;  3AZF C;  3B0C T;  5BNV B;  3A1I A;  3AN2 A;  2BYM A;  4E44 A;  1AOI B;  4Z5T C;  5FUG B;  3X1T C;  2ZY5 A;  5GT0 A;  3REI B;  3KXB C;  3REL C;  3MVD C;  2CV5 A;  3X1S A;  2ZY2 A;  3AFA B;  1P3M D;  1HTA A;  1T3U A;  2ARO C;  1TZY A;  2PYO C;  4Z66 C;  3REK D;  5DNN B;  3R45 B;  4YM6 D;  3EPK A;  1M19 C;  3WTP E;  2ZY3 A;  2HIO D;  2RVQ C;  5B2J A;  3TU4 A;  2YFV A;  4QLC A;  3W97 B;  3UTB B;  1H3O B;  4Z2M G;  2FJ7 A;  3KSY A;  5CPK A;  1U35 B;  2Y2I A;  3MGR C;  1ID3 B;  5BNV A;  4CSR A;  1R4V A;  5B1M D;  4Z2M H;  1AOI A;  3W98 D;  5FUG A;  5AVB C;  4X23 D;  3WAA C;  4J8X B;  3VH5 A;  3REI A;  3AV2 B;  5CPJ D;  4J8U B;  3AFA A;  3UTA C;  4R8P D;  3F6T A;  3AZK C;  5GSU A;  5B24 B;  1P3F A;  5DNN A;  1F1E A;  2JCH A;  3UT9 C;  1BH9 B;  4EO5 C;  2F2A C;  3WA9 D;  4H9P B;  2Y2P A;  3W97 A;  5AY8 D;  3UTB A;  5C3I B;  3AZE D;  5CPI C;  3W99 D;  3AZH D;  5KDM B;  2VQR A;  2J8P A;  1M18 D;  5BT1 C;  4WU8 A;  3LJA D;  3AV2 A;  4J8U A;  1A7W A;  3KWQ D;  3AV1 B;  2ZY4 A;  1P3O D;  3H0R C;  3REK B;  1S32 D;  5GXQ D;  1KX4 B;  5B24 A;  3REH D;  4XZQ A;  3WTP A;  5E5A C;  5DNM C;  4Z5T D;  4J8V D;  3X1T D;  1M1A C;  3KXB D;  4H9P A;  3MVD D;  2UWX A;  2Y2L A;  3V9R B;  3W98 B;  5B33 B;  2ARO D;  1P3M C;  2PYO D;  5KDM A;  1P34 B;  3WKJ D;  3B0D B;  4Z66 D;  1M19 D;  1HQ3 D;  4DRB A;  4YM6 C;  5BNX B;  2RVQ D;  5AV8 C;  3LZ1 B;  2HIO C;  5F99 C;  3REK A;  4ZBJ B;  2L5A A;  4WU9 C;  4YS3 C;  1P3L C;  2NQB B;  3AZN C;  1P3K B;  5AVB D;  3WAA D;  3LZ0 B;  5AY8 B;  4LD9 C;  5B1M C;  4X23 C;  3AV2 D;  1P3A D;  3W99 B;  3AZH B;  3UTA D;  5CPJ C;  1EQZ C;  1BFM A;  1WWS A;  5B33 A;  3W98 A;  3X1U C;  1WWI A;  5AV9 D;  4R8P C;  5BS7 C;  1P34 A;  2IO5 C;  3KWQ B;  2HUE C;  5AV5 B;  5JRG C;  3UT9 D;  3MGQ B;  1P3O B;  5B0Y C;  4G91 C;  2F8N D;  4H9Q B;  1KX5 C;  3B6F B;  2JSS A;  4NFT A;  4WZS B;  5B40 C;  3AN2 B;  3B6G C;  4KGC C;  3WA9 C;  3AZF B;  2NQB A;  3X1S B;  3X1T B;  5GT3 C;  3AZE C;  1KX3 D;  3REL B;  5CP6 B;  3MVD B;  5BT1 D;  2Y2N A;  5AY8 A;  3EPH A;  5AVC C;  2Y2J A;  3W99 A;  3AZH A;  5B0Z C;  3MGP C;  2PYO B;  1M18 A;  4Z66 B;  5B2J B;  3LJA A;  3TU4 B;  3W96 C;  3KWQ A;  5AV5 A;  2FJ7 B;  4KUD C;  5E5A D;  1B67 A;  1P3O A;  1M1A D;  5B32 C;  4H9Q A;  3B6F A;  4CSR B;  1ZLA C;  1S32 A;  5GXQ A;  4J8V C;  3REH A;  3MGR B;  4G92 B;  3AZF A;  1P3B C;  3AYW B;  1P3P B;  4Z5T A;  3X1T A;  3WAA B;  5B1L D;  3KXB A;  4JJN C;  3REL A;  5CP6 A;  2LY8 A;  3MVD A;  3UTA B;  5GSU B;  3WKJ C;  1P3F B;  5AV6 C;  3AZM C;  5AV8 D;  3KUY D;  2ARO A;  1HQ3 C;  3AZK B;  2PYO A;  5F99 D;  4Z66 A;  1M19 A;  4WU9 D;  4YS3 D;  1P3L D;  3UT9 B;  3AZN D;  4EO5 B;  2F8N B;  5B31 D;  2CV5 C;  4LD9 D;  2W8S A;  1F66 D;  5CPI B;  4WU8 B;  3MGR A;  1EQZ D;  3AYW A;  1P3G D;  1P3P A;  3X1U D;  1P3A C;  5AVB A;  4UPK A;  3WAA A;  3C1C C;  2YFW B;  5B2I C;  4XUJ C;  5JRG D;  5AV9 C;  3MGS C;  3UTA A;  2Y2H A;  4ZUX C;  5B0Y D;  3AZJ C;  4XZQ B;  3WTP B;  1KX5 D;  3AZK A;  5B40 D;  3B6G D;  2F8N K;  4KGC D;  3UT9 A;  5DNM B;  5GT3 D;  3AZG C;  1M1A B;  2F8N A;  1PZR A;  1KX3 C;  5CPI A;  5AVC D;  5B0Z D;  1P3M B;  3MGP D;  5DNN C;  2G5I C;  3W96 D;  2YFW A;  4YM6 B;  4KUD D;  5B32 D;  2HIO B;  2Y2K A;  1ZLA D;  4J8W C;  2F8N G;  1U35 C;  1P3L B;  1ID3 C;  3O62 D;  1P3B D;  5E5A A;  5DNM A;  4J8X C;  1M1A A;  3B0C W;  4JJN D;  5B1M B;  4X23 B;  5B1L C;  5CPJ B;  1EQZ B;  3MNN D;  5AV6 D;  3AZM D;  3X1U B;  1P3M A;  2NZD C;  4R8P B;  4AWL B;  2IO5 B;  3AZI C;  2HUE B;  3KUY C;  2Y2M A;  5GT0 D;  4YM6 A;  4H9R B;  5B0Y B;  4G91 B;  3VH6 A;  5AV8 A;  2CV5 D;  5C3I C;  2HIO A;  3WA9 B;  5B31 C;  3VH5 T;  4WU9 A;  3A6N C;  4YS3 A;  1P3L A;  3AZN A;  2XD1 A;  1F66 C;  3AZE B;  5BO0 B;  4LD9 A;  2G5H C;  3C1C D;  1P3G C;  3AV1 C;  5B1M A;  4XUJ D;  5AVC B;  5B2I D;  4X23 A;  3LJA B;  3MGS D;  1M18 B;  5CPJ A;  1EQZ A;  4ZUX D;  1BH8 B;  3AZJ D;  4H9O B;  4E45 A;  3X1U A;  1KX4 C;  5BS7 A;  4R8P A;  3REJ C;  3W96 B;  5JRG A;  1JFI B;  1S32 B;  5GXQ B;  3REH B;  4H9R A;  5B0Y A;  3AZG D;  5B32 B;  1KX5 A;  2Y2G A;  5B40 A;  3B6G A;  4Z5T B;  4J8V B;  4KGC A;  4DRA A;  1Q9C A;  5JA4 B;  3KXB B;  3AFA D;  3WA9 A;  5B33 C;  2CWE A;  1KU5 A;  3AZE A;  3B0D C;  5BO0 A;  5DNN D;  3AZL C;  2ARO B;  3EG5 B;  4HGA C;  4WV4 B;  3WKJ B;  5AVC A;  3AZM B;  1M19 B;  2JE5 A;  3LZ1 C;  1HQ3 B;  5B0Z A;  3MGP A;  1BH8 A;  3W97 D;  4H9O A;  4J8W D;  1U35 D;  3X1V C;  1ID3 D;  3W96 A;  1P3K C;  4H9S C;  1JFI A;  4KUD A;  4J8X D;  3LZ0 C;  3O62 C;  3LEL C;  4M6B A;  5B32 A;  3NQU A;  1ZLA A;  4J8V A;  5CHL B;  5AVB B;  5JA4 A;  3C1B C;  1P3B A;  1P3A B;  4JJN A;  2NZD D;  3C1C B;  3MNN C;  3AZI D;  5AV9 B;  3MGQ C;  3VH6 T;  3WKJ A;  1P3I C;  3AZM A;  3B6F C;  3AZJ B;  2ZM5 A;  4H9N B;  2FFF B;  3AN2 C;  1HQ3 A;  5GT0 C;  5B32 G;  3A6N D;  4DQY B;  3X1S C;  4NE5 A;  3AZG B;  5CP6 C;  3H0M C;  1TZY C;  3VH5 W;  3NQJ A;  3AV1 D;  1KX3 B;  5B2J C;  4CAY A;  3TU4 C;  1P3A A;  1KX4 D;  3C1C A;  4QLC C;  3REJ D;  4XUJ A;  5B2I A;  3MGS A;  5AV9 A;  5CPK C;  2FJ7 C;  4ZUX A;  4WNN B;  3AZJ A;  4H9N A;  1AOI C;  4J8W B;  3IP4 C;  2RIQ A;  5E5A B;  3REI C;  4G92 C;  2XD5 A;  3AYW C;  2Y2Q A;  5B33 D;  1P3P C;  3AFA C;  3AZG A;  1P34 D;  1W2E A;  3AZL D;  3AL0 C;  5GSU C;  5B1L B;  1P3F C;  1KX3 A;  3LZ1 D;  2NZD B;  3R45 A;  4KHA B;  3AZI B;  5AV8 B;  3KUY B;  3X1V D;  2NQB D;  3W97 C;  3UTB C;  4NE6 A;  5F99 B;  1P3K D;  4WU9 B;  4YS3 B;  4WNN A;  3LZ0 D;  3AZN B;  2DF4 C;  3LEL D;  1H3O A;  4J8W A;  5B31 B;  1U35 A;  4WU8 C;  2F8N H;  3AV2 C;  3A6N B;  3H0L C;  1ID3 A;  3P5J B;  4LD9 B;  3C1B D;  4J8U C;  1F66 B;  4J8X A;  4NE3 A;  1P3G B;  5AV5 D;  5B1L A;  5B24 C;  3MGQ D;  3KFU G;  1P3I D;  4XZQ C;  3WTP C;  3B6F D;  5JRG B;  3AN2 D;  4UUZ B;  2NZD A;  4KHA A;  3REJ B;  3AZF D;  3AZI A;  1KX5 B;  3KUY A;  3VH6 W;  3X1S D;  5B40 B;  1BH9 A;  3B6G B;  5F99 A;  4KGC B;  3REL D;  5CP6 D;  1TZY D;  5GT3 B;  3EPJ A;  5B31 A;  3A6N A;  1F66 A;  2BG1 A;  5B2J D;  3TU4 D;  3AZL B;  4HGA B;  5G49 B;  4QLC D;  5B0Z B;  3MGP B;  3EPL A;  3REK C;  3AV1 A;  1P3G A;  2FJ7 D;  5CPK D;  3FDD A;  1AOI D;  4UUZ A;  1KX4 A;  2BYK B;  3X1V B;  4KUD B;  3REI D;  1TAF B;  2Y2O A;  3MGR D;  3REJ A;  3AYW D;  3NQU B;  1ZLA B;  5B31 G;  1P3P D;  4WJ3 C;  3O62 B;  1N1J B;  3LEL B;  2CV5 B;  1P3B B;  3W98 C;  5GT3 A;  1P34 C;  5GSU D;  3C1B B;  4JJN B;  1P3F D;  3V9R A;  3AZK D;  4AWL C;  3MNN B;  5AV6 B;  3AZL A;  2DQN C;  5G49 A;  1ULY A;  4ZBJ C;  5BNX A;  3UTB D;  1P3I B;  2NQB C;  3LZ1 A;  1B6W A;  2BYM B;  5GT0 B;  5CPI D;  2BYK A;  3X1V A;  4WU8 D;  1TAF A;  5AY8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...