3AYWD

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 39
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywD00
4YS3B 3KXBB 3MGSC 2JSSA 4Z2MG 1HTAA 5JA4B 2HIOB 4LD9B 1ID3B 1P34C 5G49A 3LZ1B 1U35B 2L5AA 3UT9C 4UUZA 5B0YB 3AV2D 5F99B 1ZLAB 5AV9C 5GXQC 4CAYA 4WU9B 5B2IA 3AV2A 3AZJB 2YFWA 2AROC 3REKA 5B1LD 5CPJC 3W96D 1KU5A 3AZFD 5CPKB 1AOIC 3W96A 5B1LA 5B33B 5B0ZD 3UT9D 3AN2C 4G92C 3AZFA 2PYOC 5B0ZA 5AV9D 5B1MD 3UT9A 1R4VA 3RELA 1P3KC 4YS3C 3KXBC 3AZGA 5AV9A 5B1MA 5GT0A 3C1CB 4LD9C 3WA9A 2HIOC 4J8VB 1ID3C 3AZEB 3B6GC 1M19D 3MGPC 3UTBB 1U35C 1BH9B 3WTPB 1M1AD 5JRGC 4H9NA 4XUJD 3AZID 5DNMB 1M19A 3AYWB 2BYKA 1M1AA 3AV1B 1ZLAC 3B0DB 4XUJA 3AZIA 4YS3D 1H3OB 4WU9C 4ZUXD 3KXBD 3B6FC 3AZJC 1P3AB 3X1TD 3LELC 3AZKC 4J8WB 4LD9D 4CSRB 1M18C 4ZUXA 3WAAB 3WA9B 5AV8C 3X1TA 4LD9A 1BFMA 4R8PD 3LZ1D 5CPKC 1U35D 4HGAC 5B33C 5BO0B 4R8PA 3B0BA 5B0YD 3LZ1A 1U35A 4H9OB 5F99D 5G49B 1ZLAD 3V9RA 5B0YA 3X1VD 5F99A 5KDMB 5B40C 4DRBA 3X1VA 4KUDB 4KHAA 4ZBJB 5B2IB 3AV2B 5CPKD 2YFWB 5B33D 3WTPC 2BYMA 2YFVA 4G91B 1S32B 1KX5C 3C1BC 5AV5C 5DNMC 3REKB 5CPKA 1P3PD 5B33A 3AV1C 3AFAD 3B0DC 3AZND 1P3PA 1P3AC 4WNNB 3C1CD 1BH8A 4J8WC 3AFAA 5AY8D 4J8VD 3WAAC 3AZNA 1TZYA 3WA9C 3RELB 3AZED 3O62A 3C1CA 5BNXB 3REHD 3UTBD 5AY8A 5B32B 4J8VA 3AZGB 3WTPD 4Z66B 5GT0B 3AZEA 5DNMD 3REHA 3UTBA 3AYWD 5B2JD 3WTPA 3AZLA 1P3ID 3AV1D 2NZDB 5DNMA 3AYWA 5B2JA 1P3IA 1F1EA 4H9NB 4J8WD 3AV1A 3KSYA 5E5AB 4KUDC 4ZBJC 4Z2MH 4J8WA 4CSRA 1P3MD 4YM6D 5B32G 5B2IC 2RVQC 3AV2C 5CPIB 1P3MA 4YM6A 4ZUXB 2CWEA 3REKC 3X1TB 5BO0A 4H9PB 4H9OA 3W96C 5B1LC 4R8PB 4KGCB 1Q9CA 1JFIB 3AZFC 3WKJB 4KUDD 5B0ZC 5KDMA 4E45A 4WU8D 3RELC 5B2ID 2RVQD 3V9RB 1WWIA 4KUDA 3AZGC 4WU8A 5B1MC 5GT0C 1S32D 1P3OD 5AVCB 4AWLB 3REKD 3X1VB 4KHAB 5GSUB 4EO5C 1S32A 1P3OA 3MGQB 2BYMB 2YFVB 3MNNB 5AV6B 4X23D 1M19C 1M1AC 1B6WA 4WNNA 5BNVB 3RELD 2FJ7D 4XUJC 3AZIC 5AVBB 4X23A 5B32D 3AZGD 1P3PB 4Z66D 5GT0D 1BH8B 3AFAB 3VH5A 2FJ7A 5BNXA 3LZ0B 4ZUXC 5B32A 3AZNB 1TZYB 3X1TC 4Z66A 3O62B 2NZDD 3VH6T 5AY8B 3AZMB 5GT3D 4R8PC 3REHB 4KGCC 2NZDA 5E5AD 3W98B 5C3IB 3AZHD 3LZ1C 3AZLB 1P3FA 5GT3A 5E5AA 3MGRB 4JJNB 5B2JB 5B0YC 3AZHA 5F99C 1P3IB 3KUYB 5CPID 4AWLC 3X1VC 3REJB 1KX3D 5CPIA 4H9RB 3MGQC 3VH5W 1KX3A 4KGCD 4H9PA 4YM6B 1P3MB 5AV6C 3WKJD 4KGCA 1JFIA 5AVBC 3WKJA 3UTAD 1P3PC 3AFAC 2F8NK 5AVCD 3LZ0C 3AZNC 3UTAA 1TZYC 5GSUD 4WV4B 2F8NB 3O62C 3W99D 3C1CC 5AVCA 3MGQD 5AY8C 4J8VC 4WU8B 5GSUA 1N1JB 3MNND 3AZEC 5AV6D 4J8UB 3W99A 3REHC 3UTBC 3MGQA 1EQZB 3W98C 3AZLC 5B31B 3MNNA 4NE3A 5AV6A 1P3OB 5AVBD 3AYWC 3X1SB 5B2JC 1HQ3B 1P3IC 3W97D 5BNVA 5AVBA 3LZ0D 3X1UB 1TZYD 2F8NG 3W97A 3O62D 4X23B 1P3GB 3LZ0A 3KWQD 3AZMD 2NQBB 2FJ7B 1P3MC 4YM6C 3W98D 3KWQA 5B31G 4NFTA 3AZLD 3AZMA 4NE5A 3MGRD 3REIA 4JJND 1KX4B 3W98A 4DRAA 3KUYD 1F66D 3MGSB 3TU4A 3MGRA 4JJNA 3REJD 1P34B 1P3FB 3KUYA 5GT3B 1F66A 3AZHB 3REJA 4WU8C 4H9RA 4H9QB 1B67A 4G91C 5GXQB 1S32C 1P3OC 3X1SC 1KX3B 3MVDD 2AROB 3X1UC 5CPJB 2F8ND 4X23C 3MVDA 1P3GC 4M6BA 1WWSA 1AOIB 5BT1D 2NQBC 2F8NA 4J8UD 3AN2B 2FJ7C 4G92B 1EQZD 2LY8A 5B32C 3UTAB 2IO5B 4QLCD 5B31D 1N1JA 4Z66C 2HUEB 4J8UA 4Z5TB 1EQZA 1P3KB 3X1SD 1KX4C 4QLCA 1HQ3D 5B31A 1TAFB 3W99B 2NZDC 3X1UD 3X1SA 1HQ3A 1P3FC 3NQUB 5GT3C 1P3GD 3B6GB 5E5AC 3X1UA 3MGPB 3AZHC 2NQBD 4E44A 3A6NB 3LJAD 5JRGB 1P3GA 2NQBA 3W97B 3LJAA 5CPIC 1KX4D 5CP6B 4WZSB 3B6FB 4H9SA 1KX3C 3LELB 3MGSD 3AZKB 1P3BB 3KWQB 1M18B 3R45B 1KX4A 1P34D 1P3FD 4XZQB 4J8XB 5AV8B 3MGSA 3REIB 1A7WA 3WKJC 1P34A 4HGAB 3WTPE 3TU4B 3UTAC 2IO5C 1F66B 5GXQD 2HUEC 5FUGA 5AVCC 4Z5TC 5GSUC 4H9QA 5BS7C 3W99C 5GXQA 5B24B 5B40B 2AROD 5CHLB 5CPJD 3MNNC 2AROA 1AOID 5CPJA 3A6NC 3B0CT 3AN2D 1KX5B 3C1BB 5AV5B 2PYOD 1AOIA 3NQJA 5DNNB 3W97C 3AN2A 3MVDB 4Z5TD 2CV5B 1P3KD 5CP6C 2PYOA 4Z5TA 3KWQC 2HIOD 1P3KA 4YS3A 1P3BC 1ID3D 5BS7A 3KXBA 3AZMC 1P3LB 1TAFA 4XZQC 4J8XC 3VH6A 5JA4A 3REIC 3B6GD 2HIOA 5C3IC 3MGPD 4QLCB 2F8NH 3A6ND 1ID3A 3NQUA 5JRGD 3TU4C 3B6GA 3MGRC 4JJNC 3MGPA 3A6NA 3KUYC 1F66C 5JRGA 4WU9D 5CP6D 3REJC 3B6FD 3AZJD 3LELD 3AZKD 1ZLAA 1P3BD 1M18D 5B24C 4WU9A 5CP6A 4UUZB 3B6FA 3LJAB 4XZQD 4J8XD 5AV8D 3AZJA 3LELA 3AZKA 3REID 1P3BA 1M18A 4CAYB 3R45A 4XZQA 4J8XA 5AV8A 3TU4D 3VH6W 5DNNC 3MVDC 2CV5C 5B1LB 3W96B 5B24D 5B40D 4NE6A 3AZFB 5BT1C 5B0ZB 1P3LC 3UT9B 5FUGB 5B24A 5B40A 4J8UC 1EQZC 4QLCC 5B31C 5AV9B 5B1MB 1KX5D 3C1BD 5AV5D 1HQ3C 5DNND 1BH9A 4EO5B 2CV5D 3C1BA 5AV5A 1KX5A 5DNNA 1P3AD 1ULYA 2CV5A 1M19B 1H3OA 3B0CW 2BYKB 3NQJB 3WAAD 3WA9D 1P3LD 3LJAC 1P3AA 1M1AB 4XUJB 3VH5T 3AZIB 2PYOB 3WAAA 4H9SC 1P3LA
chains in the Genus database with same CATH superfamily
4YS3B 3KXBB 3MGSC 2JSSA 4Z2MG 1HTAA 5JA4B 2HIOB 4LD9B 2DQNC 1ID3B 1P34C 5G49A 2Y2PA 3LZ1B 1U35B 2L5AA 3F6TA 3UT9C 4UUZA 5B0YB 3AV2D 5F99B 1ZLAB 5AV9C 5GXQC 3EG5B 1W2EA 4CAYA 4WU9B 5B2IA 3AV2A 3AZJB 2YFWA 2AROC 3REKA 5B1LD 5CPJC 3W96D 2Y2NA 1KU5A 3AZFD 5CPKB 1AOIC 3W96A 5B1LA 5B33B 5B0ZD 3UT9D 3AN2C 4G92C 3AZFA 2PYOC 5B0ZA 5AV9D 5B1MD 3UT9A 1R4VA 3RELA 1P3KC 4YS3C 2Y2KA 3KXBC 3AZGA 5AV9A 5B1MA 5GT0A 3C1CB 4LD9C 3WA9A 2HIOC 4J8VB 1ID3C 3AZEB 3B6GC 1M19D 3MGPC 3UTBB 1PZRA 1U35C 1BH9B 3WTPB 1M1AD 5JRGC 4H9NA 4XUJD 3AZID 5DNMB 1M19A 3AYWB 2BYKA 1M1AA 3AV1B 1ZLAC 3B0DB 2JCHA 2Y2JA 4XUJA 1H3OB 4YS3D 3AZIA 4WU9C 4ZUXD 3KXBD 3B6FC 3AZJC 1P3AB 3X1TD 3LELC 3EPKA 4J8WB 3AZKC 4LD9D 4CSRB 1M18C 4ZUXA 3WAAB 3WA9B 5AV8C 3X1TA 4LD9A 1BFMA 4R8PD 3LZ1D 5CPKC 1U35D 4HGAC 5B33C 5BO0B 4R8PA 3B0BA 2J8PA 5B0YD 3LZ1A 1U35A 4H9OB 5F99D 5G49B 1ZLAD 3V9RA 5B0YA 3X1VD 5F99A 5KDMB 5B40C 2XD5A 4DRBA 3X1VA 4KUDB 4KHAA 4ZBJB 5B2IB 3AV2B 5CPKD 2YFWB 5B33D 3WTPC 2BYMA 2YFVA 4G91B 1S32B 1KX5C 3C1BC 5AV5C 5DNMC 3REKB 5CPKA 1P3PD 5B33A 3AV1C 3AFAD 3B0DC 3AZND 3H0RC 1P3AC 1P3PA 4WNNB 3C1CD 1BH8A 4J8WC 3AFAA 5AY8D 4J8VD 3WAAC 3AZNA 1TZYA 3WA9C 3RELB 3AZED 3O62A 3C1CA 5BNXB 3REHD 3UTBD 5AY8A 5B32B 4J8VA 3AZGB 3WTPD 4Z66B 5GT0B 3AZEA 5DNMD 3REHA 3UTBA 3AYWD 1Z2CB 5B2JD 3WTPA 3AZLA 1P3ID 3AV1D 2Y2HA 2NZDB 5DNMA 3AYWA 5B2JA 1P3IA 1F1EA 4H9NB 4J8WD 3AV1A 3KSYA 5E5AB 4KUDC 4ZBJC 4Z2MH 4J8WA 4CSRA 1P3MD 4YM6D 5B32G 5B2IC 2RVQC 3AV2C 5CPIB 1P3MA 4YM6A 4ZUXB 2CWEA 3REKC 2XD1A 3X1TB 5BO0A 4H9PB 4H9OA 3W96C 5B1LC 2Y2QA 4R8PB 4KGCB 1Q9CA 1JFIB 3AZFC 3WKJB 4KUDD 5B0ZC 5KDMA 4E45A 4WU8D 3RELC 5B2ID 2RVQD 3V9RB 1WWIA 4KUDA 3AZGC 4WU8A 5B1MC 5GT0C 3EPHA 1S32D 1P3OD 5AVCB 4AWLB 3REKD 3X1VB 4KHAB 5GSUB 4EO5C 1S32A 1P3OA 2DF4C 3MGQB 2BYMB 2YFVB 3MNNB 5AV6B 4X23D 1M19C 3H0LC 1M1AC 1B6WA 4WNNA 5BNVB 3RELD 2FJ7D 4XUJC 2ZM5A 3AZIC 5AVBB 4X23A 5B32D 3AZGD 1P3PB 4Z66D 5GT0D 1BH8B 3AFAB 3VH5A 2FJ7A 5BNXA 3LZ0B 4ZUXC 5B32A 3AZNB 1TZYB 2Y2MA 3X1TC 4Z66A 3O62B 2NZDD 3VH6T 5AY8B 2UWXA 3AZMB 5GT3D 4R8PC 3REHB 4KGCC 2NZDA 5E5AD 3W98B 5C3IB 3AZHD 3LZ1C 3AZLB 1P3FA 5GT3A 5E5AA 3MGRB 4JJNB 5B2JB 5B0YC 3AZHA 5F99C 1P3IB 3KUYB 5CPID 3IP4C 3EPLA 4AWLC 3X1VC 3REJB 1KX3D 5CPIA 2VQRA 4H9RB 3MGQC 4WJ3C 3VH5W 1KX3A 4KGCD 4H9PA 2Y2OA 4YM6B 5AV6C 1P3MB 3WKJD 4KGCA 1JFIA 5AVBC 3WKJA 3UTAD 3FDDA 1P3PC 3AFAC 2F8NK 5AVCD 3LZ0C 3AZNC 3UTAA 1TZYC 5GSUD 4WV4B 2F8NB 3O62C 3W99D 3C1CC 5AVCA 3MGQD 5AY8C 4J8VC 4WU8B 5GSUA 1N1JB 3MNND 3AZEC 5AV6D 4J8UB 3W99A 2ZY5A 3REHC 3UTBC 3MGQA 1EQZB 3W98C 3AZLC 5B31B 3MNNA 4NE3A 5AV6A 1P3OB 5AVBD 3AYWC 3X1SB 5B2JC 1HQ3B 1P3IC 3W97D 5BNVA 2FFFB 5AVBA 3LZ0D 3X1UB 1TZYD 2F8NG 3W97A 3O62D 4X23B 1P3GB 3LZ0A 3KWQD 3AZMD 2NQBB 2FJ7B 1P3MC 4YM6C 3W98D 3KWQA 5B31G 4NFTA 3AZLD 3AZMA 4NE5A 3MGRD 3REIA 4JJND 3EPJA 1KX4B 3W98A 3H0MC 4DRAA 3KUYD 1F66D 3MGSB 3TU4A 3MGRA 4JJNA 3REJD 1P34B 1P3FB 3KUYA 5GT3B 1F66A 3AZHB 3REJA 2JE5A 4WU8C 2Y2GA 4H9RA 4H9QB 1B67A 4G91C 5GXQB 1S32C 1P3OC 3X1SC 1KX3B 3MVDD 2G5HC 2AROB 3X1UC 5CPJB 2F8ND 4X23C 3MVDA 1P3GC 4M6BA 1WWSA 1AOIB 5BT1D 3A1KA 2F8NA 2NQBC 4J8UD 3AN2B 2FJ7C 4G92B 1EQZD 2LY8A 5B32C 3UTAB 2IO5B 4QLCD 2ZY2A 5B31D 1N1JA 4Z66C 2HUEB 4J8UA 2ZY4A 4Z5TB 1EQZA 1P3KB 3X1SD 1KX4C 4QLCA 1HQ3D 5B31A 1TAFB 3W99B 2NZDC 3X1UD 3X1SA 1HQ3A 1P3FC 3NQUB 5GT3C 1P3GD 3B6GB 5E5AC 3X1UA 3MGPB 3AZHC 2NQBD 4E44A 3A6NB 3LJAD 2G5IC 5JRGB 1P3GA 2NQBA 3W97B 3LJAA 2Y2LA 5CPIC 1KX4D 5CP6B 4WZSB 3B6FB 4H9SA 3KFUG 2F2AC 1KX3C 3LELB 3MGSD 3AZKB 1P3BB 3KWQB 1M18B 3R45B 1KX4A 1P34D 1P3FD 4XZQB 4J8XB 5AV8B 3MGSA 3REIB 1A7WA 3WKJC 1P34A 4HGAB 3WTPE 3TU4B 3UTAC 2IO5C 1F66B 5GXQD 2ZY3A 2HUEC 5FUGA 5AVCC 4Z5TC 5GSUC 4H9QA 5BS7C 3W99C 5GXQA 5B24B 5B40B 2AROD 5CHLB 5CPJD 3MNNC 2AROA 1AOID 5CPJA 3A6NC 3B0CT 3AN2D 1KX5B 3C1BB 5AV5B 2PYOD 1AOIA 3NQJA 5DNNB 3W97C 3AN2A 3MVDB 4Z5TD 2CV5B 1P3KD 5CP6C 2PYOA 2RIQA 3P5JB 4Z5TA 2HIOD 3KWQC 4YS3A 1P3KA 1P3BC 1ID3D 5BS7A 3KXBA 3AZMC 1P3LB 1TAFA 2BG1A 4XZQC 4J8XC 3VH6A 5JA4A 3REIC 3B6GD 2HIOA 5C3IC 3MGPD 4QLCB 2F8NH 3A6ND 1ID3A 3NQUA 5JRGD 3TU4C 3B6GA 2W8SA 3MGRC 4JJNC 3MGPA 3A6NA 3KUYC 1F66C 4UPKA 5JRGA 4WU9D 5CP6D 3REJC 3B6FD 3AZJD 3LELD 3AZKD 1ZLAA 1P3BD 1M18D 5B24C 4WU9A 5CP6A 4UUZB 3B6FA 3LJAB 4XZQD 4J8XD 5AV8D 3AZJA 3LELA 3AZKA 3REID 4DQYB 1P3BA 4CAYB 1M18A 3R45A 4XZQA 4J8XA 5AV8A 3AL0C 3TU4D 3VH6W 5DNNC 3MVDC 2CV5C 1T3UA 5B1LB 3W96B 5B24D 5B40D 4NE6A 3AZFB 3A1IA 5BT1C 5B0ZB 1P3LC 3UT9B 5FUGB 5B24A 5B40A 4J8UC 1EQZC 4QLCC 5B31C 5AV9B 5B1MB 1KX5D 3C1BD 5AV5D 2Y2IA 1HQ3C 5DNND 1BH9A 4EO5B 2CV5D 3C1BA 5AV5A 1KX5A 5DNNA 1P3AD 1ULYA 2CV5A 1M19B 1H3OA 3B0CW 2BYKB 3NQJB 3WAAD 3WA9D 1P3LD 3LJAC 1P3AA 1M1AB 4XUJB 3VH5T 3AZIB 2PYOB 3WAAA 4H9SC 1P3LA
chains in the Genus database with same CATH topology
4YS3B 3KXBB 3MGSC 2JSSA 4Z2MG 1HTAA 5JA4B 2HIOB 4LD9B 2DQNC 1ID3B 1P34C 5G49A 2Y2PA 3LZ1B 1U35B 2L5AA 3F6TA 3UT9C 4UUZA 5B0YB 3AV2D 5F99B 1ZLAB 5AV9C 5GXQC 3EG5B 1W2EA 4CAYA 4WU9B 5B2IA 3AV2A 3AZJB 2YFWA 2AROC 3REKA 5B1LD 5CPJC 3W96D 2Y2NA 1KU5A 3AZFD 5CPKB 1AOIC 3W96A 5B1LA 5B33B 5B0ZD 3UT9D 3AN2C 4G92C 3AZFA 2PYOC 5B0ZA 5AV9D 5B1MD 3UT9A 1R4VA 3RELA 1P3KC 4YS3C 2Y2KA 3KXBC 3AZGA 5AV9A 5B1MA 5GT0A 3C1CB 4LD9C 3WA9A 2HIOC 4J8VB 1ID3C 3AZEB 3B6GC 1M19D 3MGPC 3UTBB 1PZRA 1U35C 1BH9B 3WTPB 1M1AD 5JRGC 4H9NA 4XUJD 3AZID 5DNMB 1M19A 3AYWB 2BYKA 1M1AA 3AV1B 1ZLAC 3B0DB 2JCHA 2Y2JA 4XUJA 1H3OB 4YS3D 3AZIA 4WU9C 4ZUXD 3KXBD 3B6FC 3AZJC 1P3AB 3X1TD 3LELC 3EPKA 4J8WB 3AZKC 4LD9D 4CSRB 1M18C 4ZUXA 3WAAB 3WA9B 5AV8C 3X1TA 4LD9A 1BFMA 4R8PD 3LZ1D 5CPKC 1U35D 4HGAC 5B33C 5BO0B 4R8PA 3B0BA 2J8PA 5B0YD 3LZ1A 1U35A 4H9OB 5F99D 5G49B 1ZLAD 3V9RA 5B0YA 3X1VD 5F99A 5KDMB 5B40C 2XD5A 4DRBA 3X1VA 4KUDB 4KHAA 4ZBJB 5B2IB 3AV2B 5CPKD 2YFWB 5B33D 3WTPC 2BYMA 2YFVA 4G91B 1S32B 1KX5C 3C1BC 5AV5C 5DNMC 3REKB 5CPKA 1P3PD 5B33A 3AV1C 3AFAD 3B0DC 3AZND 3H0RC 1P3AC 1P3PA 4WNNB 3C1CD 1BH8A 4J8WC 3AFAA 5AY8D 4J8VD 3WAAC 3AZNA 1TZYA 3WA9C 3RELB 3AZED 3O62A 3C1CA 5BNXB 3REHD 3UTBD 5AY8A 5B32B 4J8VA 3AZGB 3WTPD 4Z66B 5GT0B 3AZEA 5DNMD 3REHA 3UTBA 3AYWD 1Z2CB 5B2JD 3WTPA 3AZLA 1P3ID 3AV1D 2Y2HA 2NZDB 5DNMA 3AYWA 5B2JA 1P3IA 1F1EA 4H9NB 4J8WD 3AV1A 3KSYA 5E5AB 4KUDC 4ZBJC 4Z2MH 4J8WA 4CSRA 1P3MD 4YM6D 5B32G 5B2IC 2RVQC 3AV2C 5CPIB 1P3MA 4YM6A 4ZUXB 2CWEA 3REKC 2XD1A 3X1TB 5BO0A 4H9PB 4H9OA 3W96C 5B1LC 2Y2QA 4R8PB 4KGCB 1Q9CA 1JFIB 3AZFC 3WKJB 4KUDD 5B0ZC 5KDMA 4E45A 4WU8D 3RELC 5B2ID 2RVQD 3V9RB 1WWIA 4KUDA 3AZGC 4WU8A 5B1MC 5GT0C 3EPHA 1S32D 1P3OD 5AVCB 4AWLB 3REKD 3X1VB 4KHAB 5GSUB 4EO5C 1S32A 1P3OA 2DF4C 3MGQB 2BYMB 2YFVB 3MNNB 5AV6B 4X23D 1M19C 3H0LC 1M1AC 1B6WA 4WNNA 5BNVB 3RELD 2FJ7D 4XUJC 2ZM5A 3AZIC 5AVBB 4X23A 5B32D 3AZGD 1P3PB 4Z66D 5GT0D 1BH8B 3AFAB 3VH5A 2FJ7A 5BNXA 3LZ0B 4ZUXC 5B32A 3AZNB 1TZYB 2Y2MA 3X1TC 4Z66A 3O62B 2NZDD 3VH6T 5AY8B 2UWXA 3AZMB 5GT3D 4R8PC 3REHB 4KGCC 2NZDA 5E5AD 3W98B 5C3IB 3AZHD 3LZ1C 3AZLB 1P3FA 5GT3A 5E5AA 3MGRB 4JJNB 5B2JB 5B0YC 3AZHA 5F99C 1P3IB 3KUYB 5CPID 3IP4C 3EPLA 4AWLC 3X1VC 3REJB 1KX3D 5CPIA 2VQRA 4H9RB 3MGQC 4WJ3C 3VH5W 1KX3A 4KGCD 4H9PA 2Y2OA 4YM6B 5AV6C 1P3MB 3WKJD 4KGCA 1JFIA 5AVBC 3WKJA 3UTAD 3FDDA 1P3PC 3AFAC 2F8NK 5AVCD 3LZ0C 3AZNC 3UTAA 1TZYC 5GSUD 4WV4B 2F8NB 3O62C 3W99D 3C1CC 5AVCA 3MGQD 5AY8C 4J8VC 4WU8B 5GSUA 1N1JB 3MNND 3AZEC 5AV6D 4J8UB 3W99A 2ZY5A 3REHC 3UTBC 3MGQA 1EQZB 3W98C 3AZLC 5B31B 3MNNA 4NE3A 5AV6A 1P3OB 5AVBD 3AYWC 3X1SB 5B2JC 1HQ3B 1P3IC 3W97D 5BNVA 2FFFB 5AVBA 3LZ0D 3X1UB 1TZYD 2F8NG 3W97A 3O62D 4X23B 1P3GB 3LZ0A 3KWQD 3AZMD 2NQBB 2FJ7B 1P3MC 4YM6C 3W98D 3KWQA 5B31G 4NFTA 3AZLD 3AZMA 4NE5A 3MGRD 3REIA 4JJND 3EPJA 1KX4B 3W98A 3H0MC 4DRAA 3KUYD 1F66D 3MGSB 3TU4A 3MGRA 4JJNA 3REJD 1P34B 1P3FB 3KUYA 5GT3B 1F66A 3AZHB 3REJA 2JE5A 4WU8C 2Y2GA 4H9RA 4H9QB 1B67A 4G91C 5GXQB 1S32C 1P3OC 3X1SC 1KX3B 3MVDD 2G5HC 2AROB 3X1UC 5CPJB 2F8ND 4X23C 3MVDA 1P3GC 4M6BA 1WWSA 1AOIB 5BT1D 3A1KA 2F8NA 2NQBC 4J8UD 3AN2B 2FJ7C 4G92B 1EQZD 2LY8A 5B32C 3UTAB 2IO5B 4QLCD 2ZY2A 5B31D 1N1JA 4Z66C 2HUEB 4J8UA 2ZY4A 4Z5TB 1EQZA 1P3KB 3X1SD 1KX4C 4QLCA 1HQ3D 5B31A 1TAFB 3W99B 2NZDC 3X1UD 3X1SA 1HQ3A 1P3FC 3NQUB 5GT3C 1P3GD 3B6GB 5E5AC 3X1UA 3MGPB 3AZHC 2NQBD 4E44A 3A6NB 3LJAD 2G5IC 5JRGB 1P3GA 2NQBA 3W97B 3LJAA 2Y2LA 5CPIC 1KX4D 5CP6B 4WZSB 3B6FB 4H9SA 3KFUG 2F2AC 1KX3C 3LELB 3MGSD 3AZKB 1P3BB 3KWQB 1M18B 3R45B 1KX4A 1P34D 1P3FD 4XZQB 4J8XB 5AV8B 3MGSA 3REIB 1A7WA 3WKJC 1P34A 4HGAB 3WTPE 3TU4B 3UTAC 2IO5C 1F66B 5GXQD 2ZY3A 2HUEC 5FUGA 5AVCC 4Z5TC 5GSUC 4H9QA 5BS7C 3W99C 5GXQA 5B24B 5B40B 2AROD 5CHLB 5CPJD 3MNNC 2AROA 1AOID 5CPJA 3A6NC 3B0CT 3AN2D 1KX5B 3C1BB 5AV5B 2PYOD 1AOIA 3NQJA 5DNNB 3W97C 3AN2A 3MVDB 4Z5TD 2CV5B 1P3KD 5CP6C 2PYOA 2RIQA 3P5JB 4Z5TA 2HIOD 3KWQC 4YS3A 1P3KA 1P3BC 1ID3D 5BS7A 3KXBA 3AZMC 1P3LB 1TAFA 2BG1A 4XZQC 4J8XC 3VH6A 5JA4A 3REIC 3B6GD 2HIOA 5C3IC 3MGPD 4QLCB 2F8NH 3A6ND 1ID3A 3NQUA 5JRGD 3TU4C 3B6GA 2W8SA 3MGRC 4JJNC 3MGPA 3A6NA 3KUYC 1F66C 4UPKA 5JRGA 4WU9D 5CP6D 3REJC 3B6FD 3AZJD 3LELD 3AZKD 1ZLAA 1P3BD 1M18D 5B24C 4WU9A 5CP6A 4UUZB 3B6FA 3LJAB 4XZQD 4J8XD 5AV8D 3AZJA 3LELA 3AZKA 3REID 4DQYB 1P3BA 4CAYB 1M18A 3R45A 4XZQA 4J8XA 5AV8A 3AL0C 3TU4D 3VH6W 5DNNC 3MVDC 2CV5C 1T3UA 5B1LB 3W96B 5B24D 5B40D 4NE6A 3AZFB 3A1IA 5BT1C 5B0ZB 1P3LC 3UT9B 5FUGB 5B24A 5B40A 4J8UC 1EQZC 4QLCC 5B31C 5AV9B 5B1MB 1KX5D 3C1BD 5AV5D 2Y2IA 1HQ3C 5DNND 1BH9A 4EO5B 2CV5D 3C1BA 5AV5A 1KX5A 5DNNA 1P3AD 1ULYA 2CV5A 1M19B 1H3OA 3B0CW 2BYKB 3NQJB 3WAAD 3WA9D 1P3LD 3LJAC 1P3AA 1M1AB 4XUJB 3VH5T 3AZIB 2PYOB 3WAAA 4H9SC 1P3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS3 B;  3KXB B;  3MGS C;  2JSS A;  4Z2M G;  1HTA A;  5JA4 B;  2HIO B;  4LD9 B;  1ID3 B;  1P34 C;  5G49 A;  3LZ1 B;  1U35 B;  2L5A A;  3UT9 C;  4UUZ A;  5B0Y B;  3AV2 D;  5F99 B;  1ZLA B;  5AV9 C;  5GXQ C;  4CAY A;  4WU9 B;  5B2I A;  3AV2 A;  3AZJ B;  2YFW A;  2ARO C;  3REK A;  5B1L D;  5CPJ C;  3W96 D;  1KU5 A;  3AZF D;  5CPK B;  1AOI C;  3W96 A;  5B1L A;  5B33 B;  5B0Z D;  3UT9 D;  3AN2 C;  4G92 C;  3AZF A;  2PYO C;  5B0Z A;  5AV9 D;  5B1M D;  3UT9 A;  1R4V A;  3REL A;  1P3K C;  4YS3 C;  3KXB C;  3AZG A;  5AV9 A;  5B1M A;  5GT0 A;  3C1C B;  4LD9 C;  3WA9 A;  2HIO C;  4J8V B;  1ID3 C;  3AZE B;  3B6G C;  1M19 D;  3MGP C;  3UTB B;  1U35 C;  1BH9 B;  3WTP B;  1M1A D;  5JRG C;  4H9N A;  4XUJ D;  3AZI D;  5DNM B;  1M19 A;  3AYW B;  2BYK A;  1M1A A;  3AV1 B;  1ZLA C;  3B0D B;  4XUJ A;  3AZI A;  4YS3 D;  1H3O B;  4WU9 C;  4ZUX D;  3KXB D;  3B6F C;  3AZJ C;  1P3A B;  3X1T D;  3LEL C;  3AZK C;  4J8W B;  4LD9 D;  4CSR B;  1M18 C;  4ZUX A;  3WAA B;  3WA9 B;  5AV8 C;  3X1T A;  4LD9 A;  1BFM A;  4R8P D;  3LZ1 D;  5CPK C;  1U35 D;  4HGA C;  5B33 C;  5BO0 B;  4R8P A;  3B0B A;  5B0Y D;  3LZ1 A;  1U35 A;  4H9O B;  5F99 D;  5G49 B;  1ZLA D;  3V9R A;  5B0Y A;  3X1V D;  5F99 A;  5KDM B;  5B40 C;  4DRB A;  3X1V A;  4KUD B;  4KHA A;  4ZBJ B;  5B2I B;  3AV2 B;  5CPK D;  2YFW B;  5B33 D;  3WTP C;  2BYM A;  2YFV A;  4G91 B;  1S32 B;  1KX5 C;  3C1B C;  5AV5 C;  5DNM C;  3REK B;  5CPK A;  1P3P D;  5B33 A;  3AV1 C;  3AFA D;  3B0D C;  3AZN D;  1P3P A;  1P3A C;  4WNN B;  3C1C D;  1BH8 A;  4J8W C;  3AFA A;  5AY8 D;  4J8V D;  3WAA C;  3AZN A;  1TZY A;  3WA9 C;  3REL B;  3AZE D;  3O62 A;  3C1C A;  5BNX B;  3REH D;  3UTB D;  5AY8 A;  5B32 B;  4J8V A;  3AZG B;  3WTP D;  4Z66 B;  5GT0 B;  3AZE A;  5DNM D;  3REH A;  3UTB A;  3AYW D;  5B2J D;  3WTP A;  3AZL A;  1P3I D;  3AV1 D;  2NZD B;  5DNM A;  3AYW A;  5B2J A;  1P3I A;  1F1E A;  4H9N B;  4J8W D;  3AV1 A;  3KSY A;  5E5A B;  4KUD C;  4ZBJ C;  4Z2M H;  4J8W A;  4CSR A;  1P3M D;  4YM6 D;  5B32 G;  5B2I C;  2RVQ C;  3AV2 C;  5CPI B;  1P3M A;  4YM6 A;  4ZUX B;  2CWE A;  3REK C;  3X1T B;  5BO0 A;  4H9P B;  4H9O A;  3W96 C;  5B1L C;  4R8P B;  4KGC B;  1Q9C A;  1JFI B;  3AZF C;  3WKJ B;  4KUD D;  5B0Z C;  5KDM A;  4E45 A;  4WU8 D;  3REL C;  5B2I D;  2RVQ D;  3V9R B;  1WWI A;  4KUD A;  3AZG C;  4WU8 A;  5B1M C;  5GT0 C;  1S32 D;  1P3O D;  5AVC B;  4AWL B;  3REK D;  3X1V B;  4KHA B;  5GSU B;  4EO5 C;  1S32 A;  1P3O A;  3MGQ B;  2BYM B;  2YFV B;  3MNN B;  5AV6 B;  4X23 D;  1M19 C;  1M1A C;  1B6W A;  4WNN A;  5BNV B;  3REL D;  2FJ7 D;  4XUJ C;  3AZI C;  5AVB B;  4X23 A;  5B32 D;  3AZG D;  1P3P B;  4Z66 D;  5GT0 D;  1BH8 B;  3AFA B;  3VH5 A;  2FJ7 A;  5BNX A;  3LZ0 B;  4ZUX C;  5B32 A;  3AZN B;  1TZY B;  3X1T C;  4Z66 A;  3O62 B;  2NZD D;  3VH6 T;  5AY8 B;  3AZM B;  5GT3 D;  4R8P C;  3REH B;  4KGC C;  2NZD A;  5E5A D;  3W98 B;  5C3I B;  3AZH D;  3LZ1 C;  3AZL B;  1P3F A;  5GT3 A;  5E5A A;  3MGR B;  4JJN B;  5B2J B;  5B0Y C;  3AZH A;  5F99 C;  1P3I B;  3KUY B;  5CPI D;  4AWL C;  3X1V C;  3REJ B;  1KX3 D;  5CPI A;  4H9R B;  3MGQ C;  3VH5 W;  1KX3 A;  4KGC D;  4H9P A;  4YM6 B;  1P3M B;  5AV6 C;  3WKJ D;  4KGC A;  1JFI A;  5AVB C;  3WKJ A;  3UTA D;  1P3P C;  3AFA C;  2F8N K;  5AVC D;  3LZ0 C;  3AZN C;  3UTA A;  1TZY C;  5GSU D;  4WV4 B;  2F8N B;  3O62 C;  3W99 D;  3C1C C;  5AVC A;  3MGQ D;  5AY8 C;  4J8V C;  4WU8 B;  5GSU A;  1N1J B;  3MNN D;  3AZE C;  5AV6 D;  4J8U B;  3W99 A;  3REH C;  3UTB C;  3MGQ A;  1EQZ B;  3W98 C;  3AZL C;  5B31 B;  3MNN A;  4NE3 A;  5AV6 A;  1P3O B;  5AVB D;  3AYW C;  3X1S B;  5B2J C;  1HQ3 B;  1P3I C;  3W97 D;  5BNV A;  5AVB A;  3LZ0 D;  3X1U B;  1TZY D;  2F8N G;  3W97 A;  3O62 D;  4X23 B;  1P3G B;  3LZ0 A;  3KWQ D;  3AZM D;  2NQB B;  2FJ7 B;  1P3M C;  4YM6 C;  3W98 D;  3KWQ A;  5B31 G;  4NFT A;  3AZL D;  3AZM A;  4NE5 A;  3MGR D;  3REI A;  4JJN D;  1KX4 B;  3W98 A;  4DRA A;  3KUY D;  1F66 D;  3MGS B;  3TU4 A;  3MGR A;  4JJN A;  3REJ D;  1P34 B;  1P3F B;  3KUY A;  5GT3 B;  1F66 A;  3AZH B;  3REJ A;  4WU8 C;  4H9R A;  4H9Q B;  1B67 A;  4G91 C;  5GXQ B;  1S32 C;  1P3O C;  3X1S C;  1KX3 B;  3MVD D;  2ARO B;  3X1U C;  5CPJ B;  2F8N D;  4X23 C;  3MVD A;  1P3G C;  4M6B A;  1WWS A;  1AOI B;  5BT1 D;  2NQB C;  2F8N A;  4J8U D;  3AN2 B;  2FJ7 C;  4G92 B;  1EQZ D;  2LY8 A;  5B32 C;  3UTA B;  2IO5 B;  4QLC D;  5B31 D;  1N1J A;  4Z66 C;  2HUE B;  4J8U A;  4Z5T B;  1EQZ A;  1P3K B;  3X1S D;  1KX4 C;  4QLC A;  1HQ3 D;  5B31 A;  1TAF B;  3W99 B;  2NZD C;  3X1U D;  3X1S A;  1HQ3 A;  1P3F C;  3NQU B;  5GT3 C;  1P3G D;  3B6G B;  5E5A C;  3X1U A;  3MGP B;  3AZH C;  2NQB D;  4E44 A;  3A6N B;  3LJA D;  5JRG B;  1P3G A;  2NQB A;  3W97 B;  3LJA A;  5CPI C;  1KX4 D;  5CP6 B;  4WZS B;  3B6F B;  4H9S A;  1KX3 C;  3LEL B;  3MGS D;  3AZK B;  1P3B B;  3KWQ B;  1M18 B;  3R45 B;  1KX4 A;  1P34 D;  1P3F D;  4XZQ B;  4J8X B;  5AV8 B;  3MGS A;  3REI B;  1A7W A;  3WKJ C;  1P34 A;  4HGA B;  3WTP E;  3TU4 B;  3UTA C;  2IO5 C;  1F66 B;  5GXQ D;  2HUE C;  5FUG A;  5AVC C;  4Z5T C;  5GSU C;  4H9Q A;  5BS7 C;  3W99 C;  5GXQ A;  5B24 B;  5B40 B;  2ARO D;  5CHL B;  5CPJ D;  3MNN C;  2ARO A;  1AOI D;  5CPJ A;  3A6N C;  3B0C T;  3AN2 D;  1KX5 B;  3C1B B;  5AV5 B;  2PYO D;  1AOI A;  3NQJ A;  5DNN B;  3W97 C;  3AN2 A;  3MVD B;  4Z5T D;  2CV5 B;  1P3K D;  5CP6 C;  2PYO A;  4Z5T A;  3KWQ C;  2HIO D;  1P3K A;  4YS3 A;  1P3B C;  1ID3 D;  5BS7 A;  3KXB A;  3AZM C;  1P3L B;  1TAF A;  4XZQ C;  4J8X C;  3VH6 A;  5JA4 A;  3REI C;  3B6G D;  2HIO A;  5C3I C;  3MGP D;  4QLC B;  2F8N H;  3A6N D;  1ID3 A;  3NQU A;  5JRG D;  3TU4 C;  3B6G A;  3MGR C;  4JJN C;  3MGP A;  3A6N A;  3KUY C;  1F66 C;  5JRG A;  4WU9 D;  5CP6 D;  3REJ C;  3B6F D;  3AZJ D;  3LEL D;  3AZK D;  1ZLA A;  1P3B D;  1M18 D;  5B24 C;  4WU9 A;  5CP6 A;  4UUZ B;  3B6F A;  3LJA B;  4XZQ D;  4J8X D;  5AV8 D;  3AZJ A;  3LEL A;  3AZK A;  3REI D;  1P3B A;  1M18 A;  4CAY B;  3R45 A;  4XZQ A;  4J8X A;  5AV8 A;  3TU4 D;  3VH6 W;  5DNN C;  3MVD C;  2CV5 C;  5B1L B;  3W96 B;  5B24 D;  5B40 D;  4NE6 A;  3AZF B;  5BT1 C;  5B0Z B;  1P3L C;  3UT9 B;  5FUG B;  5B24 A;  5B40 A;  4J8U C;  1EQZ C;  4QLC C;  5B31 C;  5AV9 B;  5B1M B;  1KX5 D;  3C1B D;  5AV5 D;  1HQ3 C;  5DNN D;  1BH9 A;  4EO5 B;  2CV5 D;  3C1B A;  5AV5 A;  1KX5 A;  5DNN A;  1P3A D;  1ULY A;  2CV5 A;  1M19 B;  1H3O A;  3B0C W;  2BYK B;  3NQJ B;  3WAA D;  3WA9 D;  1P3L D;  3LJA C;  1P3A A;  1M1A B;  4XUJ B;  3VH5 T;  3AZI B;  2PYO B;  3WAA A;  4H9S C;  1P3L A; 
#chains in the Genus database with same CATH topology
 4YS3 B;  3KXB B;  3MGS C;  2JSS A;  4Z2M G;  1HTA A;  5JA4 B;  2HIO B;  4LD9 B;  2DQN C;  1ID3 B;  1P34 C;  5G49 A;  2Y2P A;  3LZ1 B;  1U35 B;  2L5A A;  3F6T A;  3UT9 C;  4UUZ A;  5B0Y B;  3AV2 D;  5F99 B;  1ZLA B;  5AV9 C;  5GXQ C;  3EG5 B;  1W2E A;  4CAY A;  4WU9 B;  5B2I A;  3AV2 A;  3AZJ B;  2YFW A;  2ARO C;  3REK A;  5B1L D;  5CPJ C;  3W96 D;  2Y2N A;  1KU5 A;  3AZF D;  5CPK B;  1AOI C;  3W96 A;  5B1L A;  5B33 B;  5B0Z D;  3UT9 D;  3AN2 C;  4G92 C;  3AZF A;  2PYO C;  5B0Z A;  5AV9 D;  5B1M D;  3UT9 A;  1R4V A;  3REL A;  1P3K C;  4YS3 C;  2Y2K A;  3KXB C;  3AZG A;  5AV9 A;  5B1M A;  5GT0 A;  3C1C B;  4LD9 C;  3WA9 A;  2HIO C;  4J8V B;  1ID3 C;  3AZE B;  3B6G C;  1M19 D;  3MGP C;  3UTB B;  1PZR A;  1U35 C;  1BH9 B;  3WTP B;  1M1A D;  5JRG C;  4H9N A;  4XUJ D;  3AZI D;  5DNM B;  1M19 A;  3AYW B;  2BYK A;  1M1A A;  3AV1 B;  1ZLA C;  3B0D B;  2JCH A;  2Y2J A;  4XUJ A;  1H3O B;  4YS3 D;  3AZI A;  4WU9 C;  4ZUX D;  3KXB D;  3B6F C;  3AZJ C;  1P3A B;  3X1T D;  3LEL C;  3EPK A;  4J8W B;  3AZK C;  4LD9 D;  4CSR B;  1M18 C;  4ZUX A;  3WAA B;  3WA9 B;  5AV8 C;  3X1T A;  4LD9 A;  1BFM A;  4R8P D;  3LZ1 D;  5CPK C;  1U35 D;  4HGA C;  5B33 C;  5BO0 B;  4R8P A;  3B0B A;  2J8P A;  5B0Y D;  3LZ1 A;  1U35 A;  4H9O B;  5F99 D;  5G49 B;  1ZLA D;  3V9R A;  5B0Y A;  3X1V D;  5F99 A;  5KDM B;  5B40 C;  2XD5 A;  4DRB A;  3X1V A;  4KUD B;  4KHA A;  4ZBJ B;  5B2I B;  3AV2 B;  5CPK D;  2YFW B;  5B33 D;  3WTP C;  2BYM A;  2YFV A;  4G91 B;  1S32 B;  1KX5 C;  3C1B C;  5AV5 C;  5DNM C;  3REK B;  5CPK A;  1P3P D;  5B33 A;  3AV1 C;  3AFA D;  3B0D C;  3AZN D;  3H0R C;  1P3A C;  1P3P A;  4WNN B;  3C1C D;  1BH8 A;  4J8W C;  3AFA A;  5AY8 D;  4J8V D;  3WAA C;  3AZN A;  1TZY A;  3WA9 C;  3REL B;  3AZE D;  3O62 A;  3C1C A;  5BNX B;  3REH D;  3UTB D;  5AY8 A;  5B32 B;  4J8V A;  3AZG B;  3WTP D;  4Z66 B;  5GT0 B;  3AZE A;  5DNM D;  3REH A;  3UTB A;  3AYW D;  1Z2C B;  5B2J D;  3WTP A;  3AZL A;  1P3I D;  3AV1 D;  2Y2H A;  2NZD B;  5DNM A;  3AYW A;  5B2J A;  1P3I A;  1F1E A;  4H9N B;  4J8W D;  3AV1 A;  3KSY A;  5E5A B;  4KUD C;  4ZBJ C;  4Z2M H;  4J8W A;  4CSR A;  1P3M D;  4YM6 D;  5B32 G;  5B2I C;  2RVQ C;  3AV2 C;  5CPI B;  1P3M A;  4YM6 A;  4ZUX B;  2CWE A;  3REK C;  2XD1 A;  3X1T B;  5BO0 A;  4H9P B;  4H9O A;  3W96 C;  5B1L C;  2Y2Q A;  4R8P B;  4KGC B;  1Q9C A;  1JFI B;  3AZF C;  3WKJ B;  4KUD D;  5B0Z C;  5KDM A;  4E45 A;  4WU8 D;  3REL C;  5B2I D;  2RVQ D;  3V9R B;  1WWI A;  4KUD A;  3AZG C;  4WU8 A;  5B1M C;  5GT0 C;  3EPH A;  1S32 D;  1P3O D;  5AVC B;  4AWL B;  3REK D;  3X1V B;  4KHA B;  5GSU B;  4EO5 C;  1S32 A;  1P3O A;  2DF4 C;  3MGQ B;  2BYM B;  2YFV B;  3MNN B;  5AV6 B;  4X23 D;  1M19 C;  3H0L C;  1M1A C;  1B6W A;  4WNN A;  5BNV B;  3REL D;  2FJ7 D;  4XUJ C;  2ZM5 A;  3AZI C;  5AVB B;  4X23 A;  5B32 D;  3AZG D;  1P3P B;  4Z66 D;  5GT0 D;  1BH8 B;  3AFA B;  3VH5 A;  2FJ7 A;  5BNX A;  3LZ0 B;  4ZUX C;  5B32 A;  3AZN B;  1TZY B;  2Y2M A;  3X1T C;  4Z66 A;  3O62 B;  2NZD D;  3VH6 T;  5AY8 B;  2UWX A;  3AZM B;  5GT3 D;  4R8P C;  3REH B;  4KGC C;  2NZD A;  5E5A D;  3W98 B;  5C3I B;  3AZH D;  3LZ1 C;  3AZL B;  1P3F A;  5GT3 A;  5E5A A;  3MGR B;  4JJN B;  5B2J B;  5B0Y C;  3AZH A;  5F99 C;  1P3I B;  3KUY B;  5CPI D;  3IP4 C;  3EPL A;  4AWL C;  3X1V C;  3REJ B;  1KX3 D;  5CPI A;  2VQR A;  4H9R B;  3MGQ C;  4WJ3 C;  3VH5 W;  1KX3 A;  4KGC D;  4H9P A;  2Y2O A;  4YM6 B;  5AV6 C;  1P3M B;  3WKJ D;  4KGC A;  1JFI A;  5AVB C;  3WKJ A;  3UTA D;  3FDD A;  1P3P C;  3AFA C;  2F8N K;  5AVC D;  3LZ0 C;  3AZN C;  3UTA A;  1TZY C;  5GSU D;  4WV4 B;  2F8N B;  3O62 C;  3W99 D;  3C1C C;  5AVC A;  3MGQ D;  5AY8 C;  4J8V C;  4WU8 B;  5GSU A;  1N1J B;  3MNN D;  3AZE C;  5AV6 D;  4J8U B;  3W99 A;  2ZY5 A;  3REH C;  3UTB C;  3MGQ A;  1EQZ B;  3W98 C;  3AZL C;  5B31 B;  3MNN A;  4NE3 A;  5AV6 A;  1P3O B;  5AVB D;  3AYW C;  3X1S B;  5B2J C;  1HQ3 B;  1P3I C;  3W97 D;  5BNV A;  2FFF B;  5AVB A;  3LZ0 D;  3X1U B;  1TZY D;  2F8N G;  3W97 A;  3O62 D;  4X23 B;  1P3G B;  3LZ0 A;  3KWQ D;  3AZM D;  2NQB B;  2FJ7 B;  1P3M C;  4YM6 C;  3W98 D;  3KWQ A;  5B31 G;  4NFT A;  3AZL D;  3AZM A;  4NE5 A;  3MGR D;  3REI A;  4JJN D;  3EPJ A;  1KX4 B;  3W98 A;  3H0M C;  4DRA A;  3KUY D;  1F66 D;  3MGS B;  3TU4 A;  3MGR A;  4JJN A;  3REJ D;  1P34 B;  1P3F B;  3KUY A;  5GT3 B;  1F66 A;  3AZH B;  3REJ A;  2JE5 A;  4WU8 C;  2Y2G A;  4H9R A;  4H9Q B;  1B67 A;  4G91 C;  5GXQ B;  1S32 C;  1P3O C;  3X1S C;  1KX3 B;  3MVD D;  2G5H C;  2ARO B;  3X1U C;  5CPJ B;  2F8N D;  4X23 C;  3MVD A;  1P3G C;  4M6B A;  1WWS A;  1AOI B;  5BT1 D;  3A1K A;  2F8N A;  2NQB C;  4J8U D;  3AN2 B;  2FJ7 C;  4G92 B;  1EQZ D;  2LY8 A;  5B32 C;  3UTA B;  2IO5 B;  4QLC D;  2ZY2 A;  5B31 D;  1N1J A;  4Z66 C;  2HUE B;  4J8U A;  2ZY4 A;  4Z5T B;  1EQZ A;  1P3K B;  3X1S D;  1KX4 C;  4QLC A;  1HQ3 D;  5B31 A;  1TAF B;  3W99 B;  2NZD C;  3X1U D;  3X1S A;  1HQ3 A;  1P3F C;  3NQU B;  5GT3 C;  1P3G D;  3B6G B;  5E5A C;  3X1U A;  3MGP B;  3AZH C;  2NQB D;  4E44 A;  3A6N B;  3LJA D;  2G5I C;  5JRG B;  1P3G A;  2NQB A;  3W97 B;  3LJA A;  2Y2L A;  5CPI C;  1KX4 D;  5CP6 B;  4WZS B;  3B6F B;  4H9S A;  3KFU G;  2F2A C;  1KX3 C;  3LEL B;  3MGS D;  3AZK B;  1P3B B;  3KWQ B;  1M18 B;  3R45 B;  1KX4 A;  1P34 D;  1P3F D;  4XZQ B;  4J8X B;  5AV8 B;  3MGS A;  3REI B;  1A7W A;  3WKJ C;  1P34 A;  4HGA B;  3WTP E;  3TU4 B;  3UTA C;  2IO5 C;  1F66 B;  5GXQ D;  2ZY3 A;  2HUE C;  5FUG A;  5AVC C;  4Z5T C;  5GSU C;  4H9Q A;  5BS7 C;  3W99 C;  5GXQ A;  5B24 B;  5B40 B;  2ARO D;  5CHL B;  5CPJ D;  3MNN C;  2ARO A;  1AOI D;  5CPJ A;  3A6N C;  3B0C T;  3AN2 D;  1KX5 B;  3C1B B;  5AV5 B;  2PYO D;  1AOI A;  3NQJ A;  5DNN B;  3W97 C;  3AN2 A;  3MVD B;  4Z5T D;  2CV5 B;  1P3K D;  5CP6 C;  2PYO A;  2RIQ A;  3P5J B;  4Z5T A;  2HIO D;  3KWQ C;  4YS3 A;  1P3K A;  1P3B C;  1ID3 D;  5BS7 A;  3KXB A;  3AZM C;  1P3L B;  1TAF A;  2BG1 A;  4XZQ C;  4J8X C;  3VH6 A;  5JA4 A;  3REI C;  3B6G D;  2HIO A;  5C3I C;  3MGP D;  4QLC B;  2F8N H;  3A6N D;  1ID3 A;  3NQU A;  5JRG D;  3TU4 C;  3B6G A;  2W8S A;  3MGR C;  4JJN C;  3MGP A;  3A6N A;  3KUY C;  1F66 C;  4UPK A;  5JRG A;  4WU9 D;  5CP6 D;  3REJ C;  3B6F D;  3AZJ D;  3LEL D;  3AZK D;  1ZLA A;  1P3B D;  1M18 D;  5B24 C;  4WU9 A;  5CP6 A;  4UUZ B;  3B6F A;  3LJA B;  4XZQ D;  4J8X D;  5AV8 D;  3AZJ A;  3LEL A;  3AZK A;  3REI D;  4DQY B;  1P3B A;  4CAY B;  1M18 A;  3R45 A;  4XZQ A;  4J8X A;  5AV8 A;  3AL0 C;  3TU4 D;  3VH6 W;  5DNN C;  3MVD C;  2CV5 C;  1T3U A;  5B1L B;  3W96 B;  5B24 D;  5B40 D;  4NE6 A;  3AZF B;  3A1I A;  5BT1 C;  5B0Z B;  1P3L C;  3UT9 B;  5FUG B;  5B24 A;  5B40 A;  4J8U C;  1EQZ C;  4QLC C;  5B31 C;  5AV9 B;  5B1M B;  1KX5 D;  3C1B D;  5AV5 D;  2Y2I A;  1HQ3 C;  5DNN D;  1BH9 A;  4EO5 B;  2CV5 D;  3C1B A;  5AV5 A;  1KX5 A;  5DNN A;  1P3A D;  1ULY A;  2CV5 A;  1M19 B;  1H3O A;  3B0C W;  2BYK B;  3NQJ B;  3WAA D;  3WA9 D;  1P3L D;  3LJA C;  1P3A A;  1M1A B;  4XUJ B;  3VH5 T;  3AZI B;  2PYO B;  3WAA A;  4H9S C;  1P3L A; 
#chains in the Genus database with same CATH homology
 4YS3 B;  3KXB B;  3MGS C;  2JSS A;  4Z2M G;  1HTA A;  5JA4 B;  2HIO B;  4LD9 B;  2DQN C;  1ID3 B;  1P34 C;  5G49 A;  2Y2P A;  3LZ1 B;  1U35 B;  2L5A A;  3F6T A;  3UT9 C;  4UUZ A;  5B0Y B;  3AV2 D;  5F99 B;  1ZLA B;  5AV9 C;  5GXQ C;  3EG5 B;  1W2E A;  4CAY A;  4WU9 B;  5B2I A;  3AV2 A;  3AZJ B;  2YFW A;  2ARO C;  3REK A;  5B1L D;  5CPJ C;  3W96 D;  2Y2N A;  1KU5 A;  3AZF D;  5CPK B;  1AOI C;  3W96 A;  5B1L A;  5B33 B;  5B0Z D;  3UT9 D;  3AN2 C;  4G92 C;  3AZF A;  2PYO C;  5B0Z A;  5AV9 D;  5B1M D;  3UT9 A;  1R4V A;  3REL A;  1P3K C;  4YS3 C;  2Y2K A;  3KXB C;  3AZG A;  5AV9 A;  5B1M A;  5GT0 A;  3C1C B;  4LD9 C;  3WA9 A;  2HIO C;  4J8V B;  1ID3 C;  3AZE B;  3B6G C;  1M19 D;  3MGP C;  3UTB B;  1PZR A;  1U35 C;  1BH9 B;  3WTP B;  1M1A D;  5JRG C;  4H9N A;  4XUJ D;  3AZI D;  5DNM B;  1M19 A;  3AYW B;  2BYK A;  1M1A A;  3AV1 B;  1ZLA C;  3B0D B;  2JCH A;  2Y2J A;  4XUJ A;  1H3O B;  4YS3 D;  3AZI A;  4WU9 C;  4ZUX D;  3KXB D;  3B6F C;  3AZJ C;  1P3A B;  3X1T D;  3LEL C;  3EPK A;  4J8W B;  3AZK C;  4LD9 D;  4CSR B;  1M18 C;  4ZUX A;  3WAA B;  3WA9 B;  5AV8 C;  3X1T A;  4LD9 A;  1BFM A;  4R8P D;  3LZ1 D;  5CPK C;  1U35 D;  4HGA C;  5B33 C;  5BO0 B;  4R8P A;  3B0B A;  2J8P A;  5B0Y D;  3LZ1 A;  1U35 A;  4H9O B;  5F99 D;  5G49 B;  1ZLA D;  3V9R A;  5B0Y A;  3X1V D;  5F99 A;  5KDM B;  5B40 C;  2XD5 A;  4DRB A;  3X1V A;  4KUD B;  4KHA A;  4ZBJ B;  5B2I B;  3AV2 B;  5CPK D;  2YFW B;  5B33 D;  3WTP C;  2BYM A;  2YFV A;  4G91 B;  1S32 B;  1KX5 C;  3C1B C;  5AV5 C;  5DNM C;  3REK B;  5CPK A;  1P3P D;  5B33 A;  3AV1 C;  3AFA D;  3B0D C;  3AZN D;  3H0R C;  1P3A C;  1P3P A;  4WNN B;  3C1C D;  1BH8 A;  4J8W C;  3AFA A;  5AY8 D;  4J8V D;  3WAA C;  3AZN A;  1TZY A;  3WA9 C;  3REL B;  3AZE D;  3O62 A;  3C1C A;  5BNX B;  3REH D;  3UTB D;  5AY8 A;  5B32 B;  4J8V A;  3AZG B;  3WTP D;  4Z66 B;  5GT0 B;  3AZE A;  5DNM D;  3REH A;  3UTB A;  3AYW D;  1Z2C B;  5B2J D;  3WTP A;  3AZL A;  1P3I D;  3AV1 D;  2Y2H A;  2NZD B;  5DNM A;  3AYW A;  5B2J A;  1P3I A;  1F1E A;  4H9N B;  4J8W D;  3AV1 A;  3KSY A;  5E5A B;  4KUD C;  4ZBJ C;  4Z2M H;  4J8W A;  4CSR A;  1P3M D;  4YM6 D;  5B32 G;  5B2I C;  2RVQ C;  3AV2 C;  5CPI B;  1P3M A;  4YM6 A;  4ZUX B;  2CWE A;  3REK C;  2XD1 A;  3X1T B;  5BO0 A;  4H9P B;  4H9O A;  3W96 C;  5B1L C;  2Y2Q A;  4R8P B;  4KGC B;  1Q9C A;  1JFI B;  3AZF C;  3WKJ B;  4KUD D;  5B0Z C;  5KDM A;  4E45 A;  4WU8 D;  3REL C;  5B2I D;  2RVQ D;  3V9R B;  1WWI A;  4KUD A;  3AZG C;  4WU8 A;  5B1M C;  5GT0 C;  3EPH A;  1S32 D;  1P3O D;  5AVC B;  4AWL B;  3REK D;  3X1V B;  4KHA B;  5GSU B;  4EO5 C;  1S32 A;  1P3O A;  2DF4 C;  3MGQ B;  2BYM B;  2YFV B;  3MNN B;  5AV6 B;  4X23 D;  1M19 C;  3H0L C;  1M1A C;  1B6W A;  4WNN A;  5BNV B;  3REL D;  2FJ7 D;  4XUJ C;  2ZM5 A;  3AZI C;  5AVB B;  4X23 A;  5B32 D;  3AZG D;  1P3P B;  4Z66 D;  5GT0 D;  1BH8 B;  3AFA B;  3VH5 A;  2FJ7 A;  5BNX A;  3LZ0 B;  4ZUX C;  5B32 A;  3AZN B;  1TZY B;  2Y2M A;  3X1T C;  4Z66 A;  3O62 B;  2NZD D;  3VH6 T;  5AY8 B;  2UWX A;  3AZM B;  5GT3 D;  4R8P C;  3REH B;  4KGC C;  2NZD A;  5E5A D;  3W98 B;  5C3I B;  3AZH D;  3LZ1 C;  3AZL B;  1P3F A;  5GT3 A;  5E5A A;  3MGR B;  4JJN B;  5B2J B;  5B0Y C;  3AZH A;  5F99 C;  1P3I B;  3KUY B;  5CPI D;  3IP4 C;  3EPL A;  4AWL C;  3X1V C;  3REJ B;  1KX3 D;  5CPI A;  2VQR A;  4H9R B;  3MGQ C;  4WJ3 C;  3VH5 W;  1KX3 A;  4KGC D;  4H9P A;  2Y2O A;  4YM6 B;  5AV6 C;  1P3M B;  3WKJ D;  4KGC A;  1JFI A;  5AVB C;  3WKJ A;  3UTA D;  3FDD A;  1P3P C;  3AFA C;  2F8N K;  5AVC D;  3LZ0 C;  3AZN C;  3UTA A;  1TZY C;  5GSU D;  4WV4 B;  2F8N B;  3O62 C;  3W99 D;  3C1C C;  5AVC A;  3MGQ D;  5AY8 C;  4J8V C;  4WU8 B;  5GSU A;  1N1J B;  3MNN D;  3AZE C;  5AV6 D;  4J8U B;  3W99 A;  2ZY5 A;  3REH C;  3UTB C;  3MGQ A;  1EQZ B;  3W98 C;  3AZL C;  5B31 B;  3MNN A;  4NE3 A;  5AV6 A;  1P3O B;  5AVB D;  3AYW C;  3X1S B;  5B2J C;  1HQ3 B;  1P3I C;  3W97 D;  5BNV A;  2FFF B;  5AVB A;  3LZ0 D;  3X1U B;  1TZY D;  2F8N G;  3W97 A;  3O62 D;  4X23 B;  1P3G B;  3LZ0 A;  3KWQ D;  3AZM D;  2NQB B;  2FJ7 B;  1P3M C;  4YM6 C;  3W98 D;  3KWQ A;  5B31 G;  4NFT A;  3AZL D;  3AZM A;  4NE5 A;  3MGR D;  3REI A;  4JJN D;  3EPJ A;  1KX4 B;  3W98 A;  3H0M C;  4DRA A;  3KUY D;  1F66 D;  3MGS B;  3TU4 A;  3MGR A;  4JJN A;  3REJ D;  1P34 B;  1P3F B;  3KUY A;  5GT3 B;  1F66 A;  3AZH B;  3REJ A;  2JE5 A;  4WU8 C;  2Y2G A;  4H9R A;  4H9Q B;  1B67 A;  4G91 C;  5GXQ B;  1S32 C;  1P3O C;  3X1S C;  1KX3 B;  3MVD D;  2G5H C;  2ARO B;  3X1U C;  5CPJ B;  2F8N D;  4X23 C;  3MVD A;  1P3G C;  4M6B A;  1WWS A;  1AOI B;  5BT1 D;  3A1K A;  2F8N A;  2NQB C;  4J8U D;  3AN2 B;  2FJ7 C;  4G92 B;  1EQZ D;  2LY8 A;  5B32 C;  3UTA B;  2IO5 B;  4QLC D;  2ZY2 A;  5B31 D;  1N1J A;  4Z66 C;  2HUE B;  4J8U A;  2ZY4 A;  4Z5T B;  1EQZ A;  1P3K B;  3X1S D;  1KX4 C;  4QLC A;  1HQ3 D;  5B31 A;  1TAF B;  3W99 B;  2NZD C;  3X1U D;  3X1S A;  1HQ3 A;  1P3F C;  3NQU B;  5GT3 C;  1P3G D;  3B6G B;  5E5A C;  3X1U A;  3MGP B;  3AZH C;  2NQB D;  4E44 A;  3A6N B;  3LJA D;  2G5I C;  5JRG B;  1P3G A;  2NQB A;  3W97 B;  3LJA A;  2Y2L A;  5CPI C;  1KX4 D;  5CP6 B;  4WZS B;  3B6F B;  4H9S A;  3KFU G;  2F2A C;  1KX3 C;  3LEL B;  3MGS D;  3AZK B;  1P3B B;  3KWQ B;  1M18 B;  3R45 B;  1KX4 A;  1P34 D;  1P3F D;  4XZQ B;  4J8X B;  5AV8 B;  3MGS A;  3REI B;  1A7W A;  3WKJ C;  1P34 A;  4HGA B;  3WTP E;  3TU4 B;  3UTA C;  2IO5 C;  1F66 B;  5GXQ D;  2ZY3 A;  2HUE C;  5FUG A;  5AVC C;  4Z5T C;  5GSU C;  4H9Q A;  5BS7 C;  3W99 C;  5GXQ A;  5B24 B;  5B40 B;  2ARO D;  5CHL B;  5CPJ D;  3MNN C;  2ARO A;  1AOI D;  5CPJ A;  3A6N C;  3B0C T;  3AN2 D;  1KX5 B;  3C1B B;  5AV5 B;  2PYO D;  1AOI A;  3NQJ A;  5DNN B;  3W97 C;  3AN2 A;  3MVD B;  4Z5T D;  2CV5 B;  1P3K D;  5CP6 C;  2PYO A;  2RIQ A;  3P5J B;  4Z5T A;  2HIO D;  3KWQ C;  4YS3 A;  1P3K A;  1P3B C;  1ID3 D;  5BS7 A;  3KXB A;  3AZM C;  1P3L B;  1TAF A;  2BG1 A;  4XZQ C;  4J8X C;  3VH6 A;  5JA4 A;  3REI C;  3B6G D;  2HIO A;  5C3I C;  3MGP D;  4QLC B;  2F8N H;  3A6N D;  1ID3 A;  3NQU A;  5JRG D;  3TU4 C;  3B6G A;  2W8S A;  3MGR C;  4JJN C;  3MGP A;  3A6N A;  3KUY C;  1F66 C;  4UPK A;  5JRG A;  4WU9 D;  5CP6 D;  3REJ C;  3B6F D;  3AZJ D;  3LEL D;  3AZK D;  1ZLA A;  1P3B D;  1M18 D;  5B24 C;  4WU9 A;  5CP6 A;  4UUZ B;  3B6F A;  3LJA B;  4XZQ D;  4J8X D;  5AV8 D;  3AZJ A;  3LEL A;  3AZK A;  3REI D;  4DQY B;  1P3B A;  4CAY B;  1M18 A;  3R45 A;  4XZQ A;  4J8X A;  5AV8 A;  3AL0 C;  3TU4 D;  3VH6 W;  5DNN C;  3MVD C;  2CV5 C;  1T3U A;  5B1L B;  3W96 B;  5B24 D;  5B40 D;  4NE6 A;  3AZF B;  3A1I A;  5BT1 C;  5B0Z B;  1P3L C;  3UT9 B;  5FUG B;  5B24 A;  5B40 A;  4J8U C;  1EQZ C;  4QLC C;  5B31 C;  5AV9 B;  5B1M B;  1KX5 D;  3C1B D;  5AV5 D;  2Y2I A;  1HQ3 C;  5DNN D;  1BH9 A;  4EO5 B;  2CV5 D;  3C1B A;  5AV5 A;  1KX5 A;  5DNN A;  1P3A D;  1ULY A;  2CV5 A;  1M19 B;  1H3O A;  3B0C W;  2BYK B;  3NQJ B;  3WAA D;  3WA9 D;  1P3L D;  3LJA C;  1P3A A;  1M1A B;  4XUJ B;  3VH5 T;  3AZI B;  2PYO B;  3WAA A;  4H9S C;  1P3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...