3AYWD

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywD00
1ZLAD 3KWQB 1P3FB 3AZIC 1KX5C 5BNVB 1AOIA 1P3KA 5F99C 4YS3D 5B40A 3REHB 3AZGC 1KX4D 3W98A 5AV5B 3C1CD 1ZLAC 2YFWB 5DNNB 1M19B 3AN2A 5AV9B 3B0DC 4QLCB 3REKB 1M1AA 4YS3C 3B0BA 5AVCB 4E44A 3LJAD 1KX4C 3VH5T 3REID 4WU8A 1P3GB 4R8PB 4DRAA 4H9SC 2NQBD 1P3BA 3LJAC 5B31G 3AZIB 4ZUXD 3KUYD 3REIC 1ID3D 2CWEA 3WTPA 3B0CT 5F99B 3TU4A 5E5AD 3AZGB 2NQBC 1ZLAB 2PYOD 4ZUXC 3KUYC 1ID3C 3B0DB 5G49B 5B1LD 4YS3B 5E5AC 2BYMA 1KX4B 5BNXB 3UT9A 2AROD 2PYOC 5B32D 5B24C 5KDMB 5CPKD 5B1LC 5GT3B 3UTBD 3LJAB 5GT0A 4J8VA 3WKJA 4J8XB 2CV5A 1P3AA 5AV8C 2AROC 4JJNA 2F8NK 5B32C 1P34D 5CPKC 4KGCA 5GXQA 3UTBC 2HUEC 5BO0B 3AFAA 4ZUXB 3NQJA 1ID3B 5AVBA 3A6ND 1TAFA 1F66D 1P34C 5E5AB 1S32D 3X1SA 2YFVB 2NZDB 2PYOB 3REJD 5B33D 5B24B 1BH8B 5B0YD 3A6NC 5B1LB 5B2IB 1F66C 4H9NB 4Z66A 1S32C 5FUGB 3MGPD 5AV8B 4XZQD 5BS7C 4G92B 3REJC 1U35A 5B32B 5B33C 4NFTA 4CAYB 5B0YC 5CPKB 4H9OA 3MGRA 3MGQC 2HUEB 5JRGA 3WA9A 3MVDD 3X1VD 2F8ND 3MGPC 3B6GA 5CPID 4XZQC 3AZHA 4YM6B 4XUJA 1P3OA 4X23A 4EO5C 1AOID 5CP6A 3MVDC 1P3KD 4KUDC 5B40D 5CPIC 3A6NB 1H3OA 1HTAA 3W98D 3X1UA 3W99A 1S32B 3AN2D 3REJB 1AOIC 1P3KC 1M1AD 5B33B 5B40C 3AZFA 3W98C 4H9PB 3MGQB 1P3MA 4WU8D 4WU9A 4Z5TA 5B2JD 3AN2C 3MGPB 4XZQB 3KXBA 3MGSA 4WNNB 1M1AC 3AZJA 5CPJB 3C1BA 4WU8C 3WTPD 3LELA 3MVDB 4KUDB 5B2JC 3TU4D 5CPIB 2IO5C 4H9QB 5JA4A 3AZMA 1N1JA 3B6FA 3WTPC 3R45A 3AZLA 1P3KB 3VH6T 3TU4C 2BYKA 3WAAA 4J8WA 5B1MA 3UT9D 5AV6A 5B0ZA 1M1AB 1TZYB 3UTAA 4J8VD 2CV5D 1P3AD 3UT9C 4WU8B 4JJND 4LD9A 1EQZA 5B2JB 4H9RA 1WWIA 2F8NH 1B6WA 4KGCD 5DNMA 3C1CC 4J8VC 3AFAD 3V9RB 2CV5C 5AVBD 5B31D 4HGAC 4ZBJC 3WTPB 4JJNC 1HQ3A 3X1TA 3TU4B 3AZNA 4KGCC 3X1SD 1P3ID 1KX5B 5AY8D 3KWQA 3AFAC 5AVBC 5B31C 5BNVA 2FJ7A 4Z66D 3LZ1D 3X1SC 1P3IC 5AY8C 5AV5A 3UT9B 1BH9B 5DNNA 1U35D 1M19A 3AV1A 4QLCA 3REKA 3RELD 5AVCA 3C1CB 4Z66C 5JRGD 3LZ1C 3B6GD 4HGAB 4JJNB 1U35C 3VH5A 4KGCB 3RELC 4XUJD 2L5AA 3LZ0D 4X23D 3REIB 1P3OD 5JRGC 5CP6D 3AFAB 3NQJB 5AVBB 5B31B 3B6GC 3AZED 2NQBB 3VH5W 4XUJC 3X1SB 1P3IB 4UUZB 5AY8B 3LZ0C 4CSRA 4X23C 3KUYB 1P3OC 1JFIB 5CP6C 3AZEC 4YS3A 2LY8A 4Z66B 4WU9D 3LZ1B 4Z5TD 5B32G 3MGSD 3MNNA 3KXBD 3NQUB 4H9OB 3RELB 3AZJD 5GT3A 2AROB 3LJAA 3C1BD 4WU9C 3LELD 4Z5TC 4J8XA 3MGSC 3KXBC 3UTBB 4XUJB 3AZMD 3W96A 3AZJC 3LZ0B 1P3OB 4X23B 3B6FD 5BO0A 3C1BC 3LELC 1P34B 3AZEB 3WAAD 5B1MD 4NE3A 3AZKA 5E5AA 3AZMC 3X1VC 4KHAA 5AV6D 3B6FC 2NZDA 1F66B 5B24A 1BH8A 3WAAC 5B1LA 5B1MC 5B2IA 2HIOA 4H9NA 4WU9B 3O62A 5FUGA 5AV6C 5AV8A 5B0YB 3KXBB 3MGSB 1WWSA 5DNMD 5B32A 4CAYA 5GSUA 3AZJB 3C1BB 4G91C 3LELB 1HQ3D 3AYWA 3X1TD 1P3BD 5DNMC 3KWQD 4YM6A 4EO5B 5JA4B 3AZMB 3X1VB 4AWLC 2F8NB 3B6FB 3W97A 1M18A 1HQ3C 3X1TC 2FJ7D 1ULYA 1P3BC 3A6NA 3WAAB 3KWQC 1S32A 1AOIB 1M19D 1P3PA 5B40B 3AV1D 5AV6B 1KX3A 5BS7A 3KSYA 3REJA 3W98B 1P3LA 2FJ7C 3AN2B 4H9PA 3MGQA 4G91B 1M19C 3AV1C 5GT0D 4XZQA 3AV2A 4WNNA 5DNMB 3WKJD 5CPJA 1HQ3B 4KUDA 3MVDA 4J8UA 5GXQD 3X1TB 2IO5B 1P3BB 5GT0C 3WKJC 2RVQD 1A7WA 1P3AC 4H9QA 4WZSB 5GXQC 2FJ7B 1P3FA 2RVQC 4WV4B 3MNND 3VH6A 3AV1B 3REHA 2BYMB 5GT3D 1TZYA 4M6BA 2YFWA 4J8XD 5AV9A 3MNNC 3VH6W 5B2JA 3MGRD 5GT0B 4J8VB 4Z2MH 3WKJB 3WA9D 3W96D 5GT3C 2CV5B 1P3AB 4ZBJB 3AZHD 4J8XC 1P3GA 3V9RA 4R8PA 5GXQB 3MGRC 3AZKD 3WA9C 3W96C 3AZIA 1KX5A 4CSRB 2NZDD 3AZHC 1TAFB 5F99A 5B24D 3W99D 3X1UD 5B2ID 3AZGA 3AZKC 1ZLAA 2HIOD 3O62D 5AV8D 1BH9A 3MNNB 2NZDC 1F1EA 4NE6A 5G49A 3AZFD 1P3MD 3W99C 3X1UC 5GSUD 5B2IC 4DRBA 1KX4A 3B0CW 5BNXA 3C1CA 2HIOC 3AYWD 3O62C 1U35B 5KDMA 4G92C 4H9SA 3AZFC 3MGRB 4YM6D 5C3IC 1P3MC 5JRGB 5GSUC 3WA9B 3W96B 3REIA 3B6GB 3W97D 3AZHB 3AYWC 1M18D 1BFMA 5B31A 3AZKB 2NQBA 4YM6C 5CP6B 3AZLD 4KHAB 1P3IA 4UUZA 5AY8A 5BT1D 4ZUXA 1B67A 3KUYA 1P3PD 1KX3D 1M18C 1ID3A 1JFIA 1H3OB 4J8WD 3W97C 1P3LD 4NE5A 3X1UB 3W99B 2YFVA 1KU5A 3MGQD 2HIOB 2PYOA 3O62B 5B0ZD 3LZ1A 3AZLC 1P3PC 5BT1C 1KX3C 3UTAD 3AV2D 4J8WC 3AZFB 1P3LC 3NQUA 1P3MB 5C3IB 4LD9D 5GSUB 3RELA 4Z5TB 1EQZD 5CPJD 2AROA 3AYWB 4KUDD 5B0ZC 4J8UD 2JSSA 3UTAC 4E45A 3AV2C 5CPKA 2F8NG 3UTBA 1R4VA 4LD9C 1EQZC 1Q9CA 3LZ0A 3W97B 5CPJC 3AZND 1M18B 4J8UC 1P34A 3AZEA 1P3FD 1N1JB 3R45B 3AZLB 1P3PB 3REHD 1KX3B 3AZNC 2BYKB 4J8WB 5B1MB 1F66A 1TZYD 1P3LB 5AV5D 1P3FC 5DNND 5AV9D 4QLCD 3REKD 5B0ZB 5B33A 5AVCD 3REHC 3UTAB 5B0YA 3AV2B 1TZYC 5AV5C 5DNNC 4LD9B 1P3GD 1EQZB 4H9RB 4Z2MG 5AV9C 4R8PD 3MGPA 4QLCC 3REKC 4J8UB 5AVCC 5CHLB 3WTPE 4AWLB 3AZID 1KX5D 1P3GC 3X1VA 5F99D 2F8NA 4R8PC 3AZNB 5CPIA 3AZGD
chains in the Genus database with same CATH superfamily
1ZLAD 3KWQB 1P3FB 3AZIC 1KX5C 4WJ3C 5BNVB 1AOIA 1P3KA 5F99C 4YS3D 5B40A 3REHB 3AZGC 1KX4D 3W98A 5AV5B 3C1CD 1ZLAC 2YFWB 5DNNB 2W8SA 1M19B 3AN2A 4UPKA 5AV9B 3B0DC 4QLCB 3REKB 1M1AA 4YS3C 3B0BA 5AVCB 4E44A 3LJAD 1KX4C 3VH5T 3REID 4WU8A 1P3GB 4R8PB 4DRAA 3F6TA 4H9SC 2NQBD 1P3BA 3LJAC 5B31G 3AZIB 4ZUXD 3KUYD 3REIC 1ID3D 2CWEA 3WTPA 3B0CT 3KFUG 5F99B 3TU4A 5E5AD 3AZGB 2NQBC 1ZLAB 1PZRA 2PYOD 2FFFB 4ZUXC 3KUYC 1W2EA 1ID3C 3B0DB 5G49B 5B1LD 4YS3B 5E5AC 2BYMA 1KX4B 5BNXB 3UT9A 2AROD 2PYOC 5B32D 5B24C 5KDMB 5CPKD 5B1LC 5GT3B 3UTBD 3LJAB 5GT0A 4J8VA 3WKJA 4J8XB 2CV5A 1P3AA 5AV8C 2AROC 4JJNA 2F8NK 5B32C 1P34D 5CPKC 4KGCA 5GXQA 3UTBC 2HUEC 5BO0B 3AFAA 4ZUXB 3NQJA 1ID3B 5AVBA 3A6ND 1TAFA 1F66D 1P34C 5E5AB 1S32D 3X1SA 2YFVB 2NZDB 2PYOB 3REJD 5B33D 5B24B 1BH8B 5B0YD 3A6NC 5B1LB 5B2IB 1F66C 4H9NB 4Z66A 1S32C 5FUGB 3MGPD 5AV8B 4XZQD 5BS7C 4G92B 3REJC 1U35A 1Z2CB 5B32B 4NFTA 4CAYB 5B33C 5B0YC 5CPKB 4H9OA 2JE5A 3MGRA 3MGQC 2HUEB 5JRGA 3WA9A 3MVDD 3X1VD 2F8ND 3MGPC 3B6GA 5CPID 4XZQC 3AZHA 4YM6B 4XUJA 1P3OA 4X23A 4EO5C 1AOID 5CP6A 2F2AC 3MVDC 1P3KD 5B40D 4KUDC 5CPIC 3A6NB 1H3OA 1HTAA 2ZM5A 3W98D 3X1UA 3W99A 1S32B 3AN2D 3P5JB 3REJB 1AOIC 1P3KC 1M1AD 5B33B 5B40C 3AZFA 3W98C 4H9PB 2DF4C 3MGQB 1P3MA 4WU8D 4WU9A 4Z5TA 5B2JD 3AN2C 3MGPB 2Y2PA 4XZQB 3KXBA 3MGSA 4WNNB 1M1AC 3AZJA 5CPJB 3C1BA 4WU8C 3WTPD 3LELA 3MVDB 4KUDB 5B2JC 3TU4D 5CPIB 2IO5C 4H9QB 5JA4A 3AZMA 1N1JA 3B6FA 3WTPC 3R45A 3AZLA 1P3KB 3VH6T 3TU4C 2BYKA 3WAAA 4J8WA 5B1MA 3UT9D 5AV6A 5B0ZA 1M1AB 1TZYB 3UTAA 4J8VD 2CV5D 1P3AD 3UT9C 4WU8B 4JJND 4LD9A 4DQYB 1EQZA 5B2JB 4H9RA 1WWIA 2F8NH 1B6WA 4KGCD 5DNMA 3C1CC 4J8VC 3AFAD 3V9RB 2CV5C 5AVBD 5B31D 4HGAC 4ZBJC 3WTPB 4JJNC 1HQ3A 3X1TA 3TU4B 3AZNA 4KGCC 3X1SD 1P3ID 1KX5B 5AY8D 3KWQA 3AFAC 5AVBC 5B31C 5BNVA 2FJ7A 2Y2LA 4Z66D 3LZ1D 3X1SC 1P3IC 5AY8C 5AV5A 3UT9B 1BH9B 5DNNA 1U35D 1M19A 3AV1A 4QLCA 3REKA 3RELD 5AVCA 3C1CB 4Z66C 5JRGD 3LZ1C 3B6GD 4HGAB 4JJNB 1U35C 3VH5A 4KGCB 3RELC 4XUJD 2L5AA 3LZ0D 4X23D 3REIB 3EPJA 1P3OD 5JRGC 2J8PA 5CP6D 3AFAB 3NQJB 5AVBB 5B31B 3B6GC 3AZED 2NQBB 3VH5W 3EPLA 4XUJC 3X1SB 1P3IB 4UUZB 5AY8B 3LZ0C 4CSRA 4X23C 3KUYB 1P3OC 1JFIB 5CP6C 2ZY4A 3AZEC 4YS3A 2LY8A 2DQNC 4Z66B 4WU9D 2RIQA 3LZ1B 3IP4C 4Z5TD 5B32G 3MGSD 3MNNA 3KXBD 3A1KA 3NQUB 4H9OB 3RELB 3AZJD 5GT3A 2AROB 3LJAA 3C1BD 4WU9C 3LELD 4Z5TC 4J8XA 3MGSC 3KXBC 3UTBB 4XUJB 3AZMD 3W96A 3AZJC 3LZ0B 1P3OB 4X23B 3B6FD 5BO0A 3C1BC 3LELC 1P34B 3AZEB 3WAAD 5B1MD 4NE3A 3AZKA 5E5AA 3AZMC 3X1VC 4KHAA 2JCHA 5AV6D 3B6FC 2NZDA 2Y2MA 1F66B 5B24A 1BH8A 3EPHA 3WAAC 5B1LA 5B1MC 5B2IA 2HIOA 4H9NA 4WU9B 3O62A 5FUGA 5AV6C 5AV8A 5B0YB 3KXBB 3MGSB 2ZY2A 1WWSA 2ZY3A 5B32A 5DNMD 4CAYA 5GSUA 3AZJB 3FDDA 3C1BB 4G91C 3LELB 1HQ3D 3AYWA 3X1TD 1P3BD 3AL0C 3H0MC 5DNMC 2XD1A 3KWQD 4YM6A 4EO5B 5JA4B 3AZMB 3X1VB 4AWLC 2F8NB 3B6FB 3W97A 1M18A 1HQ3C 3X1TC 2FJ7D 1ULYA 1P3BC 3A6NA 3WAAB 3KWQC 2G5IC 1S32A 1AOIB 1M19D 1P3PA 5B40B 3AV1D 5AV6B 1KX3A 5BS7A 3KSYA 3REJA 3W98B 1P3LA 2FJ7C 3AN2B 4H9PA 3MGQA 4G91B 1M19C 3AV1C 5GT0D 4XZQA 3AV2A 4WNNA 5DNMB 3WKJD 3EPKA 5CPJA 1HQ3B 4KUDA 3MVDA 4J8UA 5GXQD 3X1TB 2IO5B 1P3BB 5GT0C 3WKJC 2RVQD 1A7WA 1P3AC 4H9QA 4WZSB 3EG5B 5GXQC 2FJ7B 1P3FA 2Y2HA 2RVQC 4WV4B 3MNND 3VH6A 3AV1B 3REHA 2BYMB 2Y2JA 2G5HC 5GT3D 1TZYA 4M6BA 2YFWA 4J8XD 5AV9A 3MNNC 3VH6W 5B2JA 3MGRD 5GT0B 4J8VB 4Z2MH 3WKJB 3WA9D 3W96D 5GT3C 2CV5B 1P3AB 4ZBJB 3AZHD 4J8XC 1P3GA 2Y2IA 3V9RA 2ZY5A 4R8PA 5GXQB 3MGRC 3AZKD 3WA9C 3W96C 3AZIA 1KX5A 2UWXA 4CSRB 2NZDD 3AZHC 1TAFB 2Y2NA 5F99A 5B24D 2Y2GA 2Y2KA 3W99D 3X1UD 5B2ID 3AZGA 3AZKC 1ZLAA 2HIOD 3O62D 1T3UA 5AV8D 1BH9A 3MNNB 2NZDC 1F1EA 4NE6A 5G49A 3AZFD 1P3MD 3W99C 3X1UC 5GSUD 2Y2QA 4DRBA 5B2IC 1KX4A 3B0CW 5BNXA 3C1CA 2HIOC 3AYWD 3O62C 2BG1A 1U35B 5KDMA 4G92C 4H9SA 3AZFC 3MGRB 4YM6D 5C3IC 1P3MC 5JRGB 5GSUC 3WA9B 3W96B 3REIA 3B6GB 3W97D 3AZHB 3AYWC 1M18D 1BFMA 5B31A 3AZKB 2NQBA 4YM6C 5CP6B 3AZLD 4KHAB 1P3IA 4UUZA 5AY8A 5BT1D 4ZUXA 1B67A 3KUYA 1P3PD 1KX3D 1M18C 1ID3A 1JFIA 1H3OB 4J8WD 3W97C 1P3LD 4NE5A 3X1UB 3W99B 2YFVA 1KU5A 3MGQD 2HIOB 2PYOA 3O62B 5B0ZD 3LZ1A 3AZLC 1P3PC 5BT1C 1KX3C 3UTAD 3AV2D 4J8WC 3AZFB 1P3LC 3NQUA 1P3MB 5C3IB 4LD9D 3A1IA 5GSUB 4Z5TB 3RELA 1EQZD 5CPJD 2AROA 3AYWB 4KUDD 5B0ZC 4J8UD 2JSSA 3UTAC 4E45A 3AV2C 5CPKA 2F8NG 3UTBA 1R4VA 4LD9C 2Y2OA 1EQZC 1Q9CA 3LZ0A 3W97B 5CPJC 3AZND 1M18B 4J8UC 3H0LC 1P34A 3AZEA 1P3FD 1N1JB 3R45B 3AZLB 1P3PB 3REHD 1KX3B 3AZNC 2BYKB 4J8WB 5B1MB 1F66A 1TZYD 1P3LB 5AV5D 1P3FC 5DNND 5AV9D 4QLCD 3REKD 5B0ZB 5B33A 5AVCD 3REHC 3UTAB 5B0YA 3AV2B 1TZYC 5AV5C 5DNNC 4LD9B 1P3GD 1EQZB 4H9RB 3H0RC 5AV9C 4Z2MG 4R8PD 3MGPA 4QLCC 3REKC 4J8UB 5AVCC 2VQRA 5CHLB 3WTPE 4AWLB 3AZID 1KX5D 1P3GC 3X1VA 5F99D 2F8NA 4R8PC 3AZNB 5CPIA 3AZGD 2XD5A
chains in the Genus database with same CATH topology
1ZLAD 3KWQB 1P3FB 3AZIC 1KX5C 4WJ3C 5BNVB 1AOIA 1P3KA 5F99C 4YS3D 5B40A 3REHB 3AZGC 1KX4D 3W98A 5AV5B 3C1CD 1ZLAC 2YFWB 5DNNB 2W8SA 1M19B 3AN2A 4UPKA 5AV9B 3B0DC 4QLCB 3REKB 1M1AA 4YS3C 3B0BA 5AVCB 4E44A 3LJAD 1KX4C 3VH5T 3REID 4WU8A 1P3GB 4R8PB 4DRAA 3F6TA 4H9SC 2NQBD 1P3BA 3LJAC 5B31G 3AZIB 4ZUXD 3KUYD 3REIC 1ID3D 2CWEA 3WTPA 3B0CT 3KFUG 5F99B 3TU4A 5E5AD 3AZGB 2NQBC 1ZLAB 1PZRA 2PYOD 2FFFB 4ZUXC 3KUYC 1W2EA 1ID3C 3B0DB 5G49B 5B1LD 4YS3B 5E5AC 2BYMA 1KX4B 5BNXB 3UT9A 2AROD 2PYOC 5B32D 5B24C 5KDMB 5CPKD 5B1LC 5GT3B 3UTBD 3LJAB 5GT0A 4J8VA 3WKJA 4J8XB 2CV5A 1P3AA 5AV8C 2AROC 4JJNA 2F8NK 5B32C 1P34D 5CPKC 4KGCA 5GXQA 3UTBC 2HUEC 5BO0B 3AFAA 4ZUXB 3NQJA 1ID3B 5AVBA 3A6ND 1TAFA 1F66D 1P34C 5E5AB 1S32D 3X1SA 2YFVB 2NZDB 2PYOB 3REJD 5B33D 5B24B 1BH8B 5B0YD 3A6NC 5B1LB 5B2IB 1F66C 4H9NB 4Z66A 1S32C 5FUGB 3MGPD 5AV8B 4XZQD 5BS7C 4G92B 3REJC 1U35A 1Z2CB 5B32B 4NFTA 4CAYB 5B33C 5B0YC 5CPKB 4H9OA 2JE5A 3MGRA 3MGQC 2HUEB 5JRGA 3WA9A 3MVDD 3X1VD 2F8ND 3MGPC 3B6GA 5CPID 4XZQC 3AZHA 4YM6B 4XUJA 1P3OA 4X23A 4EO5C 1AOID 5CP6A 2F2AC 3MVDC 1P3KD 5B40D 4KUDC 5CPIC 3A6NB 1H3OA 1HTAA 2ZM5A 3W98D 3X1UA 3W99A 1S32B 3AN2D 3P5JB 3REJB 1AOIC 1P3KC 1M1AD 5B33B 5B40C 3AZFA 3W98C 4H9PB 2DF4C 3MGQB 1P3MA 4WU8D 4WU9A 4Z5TA 5B2JD 3AN2C 3MGPB 2Y2PA 4XZQB 3KXBA 3MGSA 4WNNB 1M1AC 3AZJA 5CPJB 3C1BA 4WU8C 3WTPD 3LELA 3MVDB 4KUDB 5B2JC 3TU4D 5CPIB 2IO5C 4H9QB 5JA4A 3AZMA 1N1JA 3B6FA 3WTPC 3R45A 3AZLA 1P3KB 3VH6T 3TU4C 2BYKA 3WAAA 4J8WA 5B1MA 3UT9D 5AV6A 5B0ZA 1M1AB 1TZYB 3UTAA 4J8VD 2CV5D 1P3AD 3UT9C 4WU8B 4JJND 4LD9A 4DQYB 1EQZA 5B2JB 4H9RA 1WWIA 2F8NH 1B6WA 4KGCD 5DNMA 3C1CC 4J8VC 3AFAD 3V9RB 2CV5C 5AVBD 5B31D 4HGAC 4ZBJC 3WTPB 4JJNC 1HQ3A 3X1TA 3TU4B 3AZNA 4KGCC 3X1SD 1P3ID 1KX5B 5AY8D 3KWQA 3AFAC 5AVBC 5B31C 5BNVA 2FJ7A 2Y2LA 4Z66D 3LZ1D 3X1SC 1P3IC 5AY8C 5AV5A 3UT9B 1BH9B 5DNNA 1U35D 1M19A 3AV1A 4QLCA 3REKA 3RELD 5AVCA 3C1CB 4Z66C 5JRGD 3LZ1C 3B6GD 4HGAB 4JJNB 1U35C 3VH5A 4KGCB 3RELC 4XUJD 2L5AA 3LZ0D 4X23D 3REIB 3EPJA 1P3OD 5JRGC 2J8PA 5CP6D 3AFAB 3NQJB 5AVBB 5B31B 3B6GC 3AZED 2NQBB 3VH5W 3EPLA 4XUJC 3X1SB 1P3IB 4UUZB 5AY8B 3LZ0C 4CSRA 4X23C 3KUYB 1P3OC 1JFIB 5CP6C 2ZY4A 3AZEC 4YS3A 2LY8A 2DQNC 4Z66B 4WU9D 2RIQA 3LZ1B 3IP4C 4Z5TD 5B32G 3MGSD 3MNNA 3KXBD 3A1KA 3NQUB 4H9OB 3RELB 3AZJD 5GT3A 2AROB 3LJAA 3C1BD 4WU9C 3LELD 4Z5TC 4J8XA 3MGSC 3KXBC 3UTBB 4XUJB 3AZMD 3W96A 3AZJC 3LZ0B 1P3OB 4X23B 3B6FD 5BO0A 3C1BC 3LELC 1P34B 3AZEB 3WAAD 5B1MD 4NE3A 3AZKA 5E5AA 3AZMC 3X1VC 4KHAA 2JCHA 5AV6D 3B6FC 2NZDA 2Y2MA 1F66B 5B24A 1BH8A 3EPHA 3WAAC 5B1LA 5B1MC 5B2IA 2HIOA 4H9NA 4WU9B 3O62A 5FUGA 5AV6C 5AV8A 5B0YB 3KXBB 3MGSB 2ZY2A 1WWSA 2ZY3A 5B32A 5DNMD 4CAYA 5GSUA 3AZJB 3FDDA 3C1BB 4G91C 3LELB 1HQ3D 3AYWA 3X1TD 1P3BD 3AL0C 3H0MC 5DNMC 2XD1A 3KWQD 4YM6A 4EO5B 5JA4B 3AZMB 3X1VB 4AWLC 2F8NB 3B6FB 3W97A 1M18A 1HQ3C 3X1TC 2FJ7D 1ULYA 1P3BC 3A6NA 3WAAB 3KWQC 2G5IC 1S32A 1AOIB 1M19D 1P3PA 5B40B 3AV1D 5AV6B 1KX3A 5BS7A 3KSYA 3REJA 3W98B 1P3LA 2FJ7C 3AN2B 4H9PA 3MGQA 4G91B 1M19C 3AV1C 5GT0D 4XZQA 3AV2A 4WNNA 5DNMB 3WKJD 3EPKA 5CPJA 1HQ3B 4KUDA 3MVDA 4J8UA 5GXQD 3X1TB 2IO5B 1P3BB 5GT0C 3WKJC 2RVQD 1A7WA 1P3AC 4H9QA 4WZSB 3EG5B 5GXQC 2FJ7B 1P3FA 2Y2HA 2RVQC 4WV4B 3MNND 3VH6A 3AV1B 3REHA 2BYMB 2Y2JA 2G5HC 5GT3D 1TZYA 4M6BA 2YFWA 4J8XD 5AV9A 3MNNC 3VH6W 5B2JA 3MGRD 5GT0B 4J8VB 4Z2MH 3WKJB 3WA9D 3W96D 5GT3C 2CV5B 1P3AB 4ZBJB 3AZHD 4J8XC 1P3GA 2Y2IA 3V9RA 2ZY5A 4R8PA 5GXQB 3MGRC 3AZKD 3WA9C 3W96C 3AZIA 1KX5A 2UWXA 4CSRB 2NZDD 3AZHC 1TAFB 2Y2NA 5F99A 5B24D 2Y2GA 2Y2KA 3W99D 3X1UD 5B2ID 3AZGA 3AZKC 1ZLAA 2HIOD 3O62D 1T3UA 5AV8D 1BH9A 3MNNB 2NZDC 1F1EA 4NE6A 5G49A 3AZFD 1P3MD 3W99C 3X1UC 5GSUD 2Y2QA 4DRBA 5B2IC 1KX4A 3B0CW 5BNXA 3C1CA 2HIOC 3AYWD 3O62C 2BG1A 1U35B 5KDMA 4G92C 4H9SA 3AZFC 3MGRB 4YM6D 5C3IC 1P3MC 5JRGB 5GSUC 3WA9B 3W96B 3REIA 3B6GB 3W97D 3AZHB 3AYWC 1M18D 1BFMA 5B31A 3AZKB 2NQBA 4YM6C 5CP6B 3AZLD 4KHAB 1P3IA 4UUZA 5AY8A 5BT1D 4ZUXA 1B67A 3KUYA 1P3PD 1KX3D 1M18C 1ID3A 1JFIA 1H3OB 4J8WD 3W97C 1P3LD 4NE5A 3X1UB 3W99B 2YFVA 1KU5A 3MGQD 2HIOB 2PYOA 3O62B 5B0ZD 3LZ1A 3AZLC 1P3PC 5BT1C 1KX3C 3UTAD 3AV2D 4J8WC 3AZFB 1P3LC 3NQUA 1P3MB 5C3IB 4LD9D 3A1IA 5GSUB 4Z5TB 3RELA 1EQZD 5CPJD 2AROA 3AYWB 4KUDD 5B0ZC 4J8UD 2JSSA 3UTAC 4E45A 3AV2C 5CPKA 2F8NG 3UTBA 1R4VA 4LD9C 2Y2OA 1EQZC 1Q9CA 3LZ0A 3W97B 5CPJC 3AZND 1M18B 4J8UC 3H0LC 1P34A 3AZEA 1P3FD 1N1JB 3R45B 3AZLB 1P3PB 3REHD 1KX3B 3AZNC 2BYKB 4J8WB 5B1MB 1F66A 1TZYD 1P3LB 5AV5D 1P3FC 5DNND 5AV9D 4QLCD 3REKD 5B0ZB 5B33A 5AVCD 3REHC 3UTAB 5B0YA 3AV2B 1TZYC 5AV5C 5DNNC 4LD9B 1P3GD 1EQZB 4H9RB 3H0RC 5AV9C 4Z2MG 4R8PD 3MGPA 4QLCC 3REKC 4J8UB 5AVCC 2VQRA 5CHLB 3WTPE 4AWLB 3AZID 1KX5D 1P3GC 3X1VA 5F99D 2F8NA 4R8PC 3AZNB 5CPIA 3AZGD 2XD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA D;  3KWQ B;  1P3F B;  3AZI C;  1KX5 C;  5BNV B;  1AOI A;  1P3K A;  5F99 C;  4YS3 D;  5B40 A;  3REH B;  3AZG C;  1KX4 D;  3W98 A;  5AV5 B;  3C1C D;  1ZLA C;  2YFW B;  5DNN B;  1M19 B;  3AN2 A;  5AV9 B;  3B0D C;  4QLC B;  3REK B;  1M1A A;  4YS3 C;  3B0B A;  5AVC B;  4E44 A;  3LJA D;  1KX4 C;  3VH5 T;  3REI D;  4WU8 A;  1P3G B;  4R8P B;  4DRA A;  4H9S C;  2NQB D;  1P3B A;  3LJA C;  5B31 G;  3AZI B;  4ZUX D;  3KUY D;  3REI C;  1ID3 D;  2CWE A;  3WTP A;  3B0C T;  5F99 B;  3TU4 A;  5E5A D;  3AZG B;  2NQB C;  1ZLA B;  2PYO D;  4ZUX C;  3KUY C;  1ID3 C;  3B0D B;  5G49 B;  5B1L D;  4YS3 B;  5E5A C;  2BYM A;  1KX4 B;  5BNX B;  3UT9 A;  2ARO D;  2PYO C;  5B32 D;  5B24 C;  5KDM B;  5CPK D;  5B1L C;  5GT3 B;  3UTB D;  3LJA B;  5GT0 A;  4J8V A;  3WKJ A;  4J8X B;  2CV5 A;  1P3A A;  5AV8 C;  2ARO C;  4JJN A;  2F8N K;  5B32 C;  1P34 D;  5CPK C;  4KGC A;  5GXQ A;  3UTB C;  2HUE C;  5BO0 B;  3AFA A;  4ZUX B;  3NQJ A;  1ID3 B;  5AVB A;  3A6N D;  1TAF A;  1F66 D;  1P34 C;  5E5A B;  1S32 D;  3X1S A;  2YFV B;  2NZD B;  2PYO B;  3REJ D;  5B33 D;  5B24 B;  1BH8 B;  5B0Y D;  3A6N C;  5B1L B;  5B2I B;  1F66 C;  4H9N B;  4Z66 A;  1S32 C;  5FUG B;  3MGP D;  5AV8 B;  4XZQ D;  5BS7 C;  4G92 B;  3REJ C;  1U35 A;  5B32 B;  5B33 C;  4NFT A;  4CAY B;  5B0Y C;  5CPK B;  4H9O A;  3MGR A;  3MGQ C;  2HUE B;  5JRG A;  3WA9 A;  3MVD D;  3X1V D;  2F8N D;  3MGP C;  3B6G A;  5CPI D;  4XZQ C;  3AZH A;  4YM6 B;  4XUJ A;  1P3O A;  4X23 A;  4EO5 C;  1AOI D;  5CP6 A;  3MVD C;  1P3K D;  4KUD C;  5B40 D;  5CPI C;  3A6N B;  1H3O A;  1HTA A;  3W98 D;  3X1U A;  3W99 A;  1S32 B;  3AN2 D;  3REJ B;  1AOI C;  1P3K C;  1M1A D;  5B33 B;  5B40 C;  3AZF A;  3W98 C;  4H9P B;  3MGQ B;  1P3M A;  4WU8 D;  4WU9 A;  4Z5T A;  5B2J D;  3AN2 C;  3MGP B;  4XZQ B;  3KXB A;  3MGS A;  4WNN B;  1M1A C;  3AZJ A;  5CPJ B;  3C1B A;  4WU8 C;  3WTP D;  3LEL A;  3MVD B;  4KUD B;  5B2J C;  3TU4 D;  5CPI B;  2IO5 C;  4H9Q B;  5JA4 A;  3AZM A;  1N1J A;  3B6F A;  3WTP C;  3R45 A;  3AZL A;  1P3K B;  3VH6 T;  3TU4 C;  2BYK A;  3WAA A;  4J8W A;  5B1M A;  3UT9 D;  5AV6 A;  5B0Z A;  1M1A B;  1TZY B;  3UTA A;  4J8V D;  2CV5 D;  1P3A D;  3UT9 C;  4WU8 B;  4JJN D;  4LD9 A;  1EQZ A;  5B2J B;  4H9R A;  1WWI A;  2F8N H;  1B6W A;  4KGC D;  5DNM A;  3C1C C;  4J8V C;  3AFA D;  3V9R B;  2CV5 C;  5AVB D;  5B31 D;  4HGA C;  4ZBJ C;  3WTP B;  4JJN C;  1HQ3 A;  3X1T A;  3TU4 B;  3AZN A;  4KGC C;  3X1S D;  1P3I D;  1KX5 B;  5AY8 D;  3KWQ A;  3AFA C;  5AVB C;  5B31 C;  5BNV A;  2FJ7 A;  4Z66 D;  3LZ1 D;  3X1S C;  1P3I C;  5AY8 C;  5AV5 A;  3UT9 B;  1BH9 B;  5DNN A;  1U35 D;  1M19 A;  3AV1 A;  4QLC A;  3REK A;  3REL D;  5AVC A;  3C1C B;  4Z66 C;  5JRG D;  3LZ1 C;  3B6G D;  4HGA B;  4JJN B;  1U35 C;  3VH5 A;  4KGC B;  3REL C;  4XUJ D;  2L5A A;  3LZ0 D;  4X23 D;  3REI B;  1P3O D;  5JRG C;  5CP6 D;  3AFA B;  3NQJ B;  5AVB B;  5B31 B;  3B6G C;  3AZE D;  2NQB B;  3VH5 W;  4XUJ C;  3X1S B;  1P3I B;  4UUZ B;  5AY8 B;  3LZ0 C;  4CSR A;  4X23 C;  3KUY B;  1P3O C;  1JFI B;  5CP6 C;  3AZE C;  4YS3 A;  2LY8 A;  4Z66 B;  4WU9 D;  3LZ1 B;  4Z5T D;  5B32 G;  3MGS D;  3MNN A;  3KXB D;  3NQU B;  4H9O B;  3REL B;  3AZJ D;  5GT3 A;  2ARO B;  3LJA A;  3C1B D;  4WU9 C;  3LEL D;  4Z5T C;  4J8X A;  3MGS C;  3KXB C;  3UTB B;  4XUJ B;  3AZM D;  3W96 A;  3AZJ C;  3LZ0 B;  1P3O B;  4X23 B;  3B6F D;  5BO0 A;  3C1B C;  3LEL C;  1P34 B;  3AZE B;  3WAA D;  5B1M D;  4NE3 A;  3AZK A;  5E5A A;  3AZM C;  3X1V C;  4KHA A;  5AV6 D;  3B6F C;  2NZD A;  1F66 B;  5B24 A;  1BH8 A;  3WAA C;  5B1L A;  5B1M C;  5B2I A;  2HIO A;  4H9N A;  4WU9 B;  3O62 A;  5FUG A;  5AV6 C;  5AV8 A;  5B0Y B;  3KXB B;  3MGS B;  1WWS A;  5DNM D;  5B32 A;  4CAY A;  5GSU A;  3AZJ B;  3C1B B;  4G91 C;  3LEL B;  1HQ3 D;  3AYW A;  3X1T D;  1P3B D;  5DNM C;  3KWQ D;  4YM6 A;  4EO5 B;  5JA4 B;  3AZM B;  3X1V B;  4AWL C;  2F8N B;  3B6F B;  3W97 A;  1M18 A;  1HQ3 C;  3X1T C;  2FJ7 D;  1ULY A;  1P3B C;  3A6N A;  3WAA B;  3KWQ C;  1S32 A;  1AOI B;  1M19 D;  1P3P A;  5B40 B;  3AV1 D;  5AV6 B;  1KX3 A;  5BS7 A;  3KSY A;  3REJ A;  3W98 B;  1P3L A;  2FJ7 C;  3AN2 B;  4H9P A;  3MGQ A;  4G91 B;  1M19 C;  3AV1 C;  5GT0 D;  4XZQ A;  3AV2 A;  4WNN A;  5DNM B;  3WKJ D;  5CPJ A;  1HQ3 B;  4KUD A;  3MVD A;  4J8U A;  5GXQ D;  3X1T B;  2IO5 B;  1P3B B;  5GT0 C;  3WKJ C;  2RVQ D;  1A7W A;  1P3A C;  4H9Q A;  4WZS B;  5GXQ C;  2FJ7 B;  1P3F A;  2RVQ C;  4WV4 B;  3MNN D;  3VH6 A;  3AV1 B;  3REH A;  2BYM B;  5GT3 D;  1TZY A;  4M6B A;  2YFW A;  4J8X D;  5AV9 A;  3MNN C;  3VH6 W;  5B2J A;  3MGR D;  5GT0 B;  4J8V B;  4Z2M H;  3WKJ B;  3WA9 D;  3W96 D;  5GT3 C;  2CV5 B;  1P3A B;  4ZBJ B;  3AZH D;  4J8X C;  1P3G A;  3V9R A;  4R8P A;  5GXQ B;  3MGR C;  3AZK D;  3WA9 C;  3W96 C;  3AZI A;  1KX5 A;  4CSR B;  2NZD D;  3AZH C;  1TAF B;  5F99 A;  5B24 D;  3W99 D;  3X1U D;  5B2I D;  3AZG A;  3AZK C;  1ZLA A;  2HIO D;  3O62 D;  5AV8 D;  1BH9 A;  3MNN B;  2NZD C;  1F1E A;  4NE6 A;  5G49 A;  3AZF D;  1P3M D;  3W99 C;  3X1U C;  5GSU D;  5B2I C;  4DRB A;  1KX4 A;  3B0C W;  5BNX A;  3C1C A;  2HIO C;  3AYW D;  3O62 C;  1U35 B;  5KDM A;  4G92 C;  4H9S A;  3AZF C;  3MGR B;  4YM6 D;  5C3I C;  1P3M C;  5JRG B;  5GSU C;  3WA9 B;  3W96 B;  3REI A;  3B6G B;  3W97 D;  3AZH B;  3AYW C;  1M18 D;  1BFM A;  5B31 A;  3AZK B;  2NQB A;  4YM6 C;  5CP6 B;  3AZL D;  4KHA B;  1P3I A;  4UUZ A;  5AY8 A;  5BT1 D;  4ZUX A;  1B67 A;  3KUY A;  1P3P D;  1KX3 D;  1M18 C;  1ID3 A;  1JFI A;  1H3O B;  4J8W D;  3W97 C;  1P3L D;  4NE5 A;  3X1U B;  3W99 B;  2YFV A;  1KU5 A;  3MGQ D;  2HIO B;  2PYO A;  3O62 B;  5B0Z D;  3LZ1 A;  3AZL C;  1P3P C;  5BT1 C;  1KX3 C;  3UTA D;  3AV2 D;  4J8W C;  3AZF B;  1P3L C;  3NQU A;  1P3M B;  5C3I B;  4LD9 D;  5GSU B;  3REL A;  4Z5T B;  1EQZ D;  5CPJ D;  2ARO A;  3AYW B;  4KUD D;  5B0Z C;  4J8U D;  2JSS A;  3UTA C;  4E45 A;  3AV2 C;  5CPK A;  2F8N G;  3UTB A;  1R4V A;  4LD9 C;  1EQZ C;  1Q9C A;  3LZ0 A;  3W97 B;  5CPJ C;  3AZN D;  1M18 B;  4J8U C;  1P34 A;  3AZE A;  1P3F D;  1N1J B;  3R45 B;  3AZL B;  1P3P B;  3REH D;  1KX3 B;  3AZN C;  2BYK B;  4J8W B;  5B1M B;  1F66 A;  1TZY D;  1P3L B;  5AV5 D;  1P3F C;  5DNN D;  5AV9 D;  4QLC D;  3REK D;  5B0Z B;  5B33 A;  5AVC D;  3REH C;  3UTA B;  5B0Y A;  3AV2 B;  1TZY C;  5AV5 C;  5DNN C;  4LD9 B;  1P3G D;  1EQZ B;  4H9R B;  4Z2M G;  5AV9 C;  4R8P D;  3MGP A;  4QLC C;  3REK C;  4J8U B;  5AVC C;  5CHL B;  3WTP E;  4AWL B;  3AZI D;  1KX5 D;  1P3G C;  3X1V A;  5F99 D;  2F8N A;  4R8P C;  3AZN B;  5CPI A;  3AZG D; 
#chains in the Genus database with same CATH topology
 1ZLA D;  3KWQ B;  1P3F B;  3AZI C;  1KX5 C;  4WJ3 C;  5BNV B;  1AOI A;  1P3K A;  5F99 C;  4YS3 D;  5B40 A;  3REH B;  3AZG C;  1KX4 D;  3W98 A;  5AV5 B;  3C1C D;  1ZLA C;  2YFW B;  5DNN B;  2W8S A;  1M19 B;  3AN2 A;  4UPK A;  5AV9 B;  3B0D C;  4QLC B;  3REK B;  1M1A A;  4YS3 C;  3B0B A;  5AVC B;  4E44 A;  3LJA D;  1KX4 C;  3VH5 T;  3REI D;  4WU8 A;  1P3G B;  4R8P B;  4DRA A;  3F6T A;  4H9S C;  2NQB D;  1P3B A;  3LJA C;  5B31 G;  3AZI B;  4ZUX D;  3KUY D;  3REI C;  1ID3 D;  2CWE A;  3WTP A;  3B0C T;  3KFU G;  5F99 B;  3TU4 A;  5E5A D;  3AZG B;  2NQB C;  1ZLA B;  1PZR A;  2PYO D;  2FFF B;  4ZUX C;  3KUY C;  1W2E A;  1ID3 C;  3B0D B;  5G49 B;  5B1L D;  4YS3 B;  5E5A C;  2BYM A;  1KX4 B;  5BNX B;  3UT9 A;  2ARO D;  2PYO C;  5B32 D;  5B24 C;  5KDM B;  5CPK D;  5B1L C;  5GT3 B;  3UTB D;  3LJA B;  5GT0 A;  4J8V A;  3WKJ A;  4J8X B;  2CV5 A;  1P3A A;  5AV8 C;  2ARO C;  4JJN A;  2F8N K;  5B32 C;  1P34 D;  5CPK C;  4KGC A;  5GXQ A;  3UTB C;  2HUE C;  5BO0 B;  3AFA A;  4ZUX B;  3NQJ A;  1ID3 B;  5AVB A;  3A6N D;  1TAF A;  1F66 D;  1P34 C;  5E5A B;  1S32 D;  3X1S A;  2YFV B;  2NZD B;  2PYO B;  3REJ D;  5B33 D;  5B24 B;  1BH8 B;  5B0Y D;  3A6N C;  5B1L B;  5B2I B;  1F66 C;  4H9N B;  4Z66 A;  1S32 C;  5FUG B;  3MGP D;  5AV8 B;  4XZQ D;  5BS7 C;  4G92 B;  3REJ C;  1U35 A;  1Z2C B;  5B32 B;  4NFT A;  4CAY B;  5B33 C;  5B0Y C;  5CPK B;  4H9O A;  2JE5 A;  3MGR A;  3MGQ C;  2HUE B;  5JRG A;  3WA9 A;  3MVD D;  3X1V D;  2F8N D;  3MGP C;  3B6G A;  5CPI D;  4XZQ C;  3AZH A;  4YM6 B;  4XUJ A;  1P3O A;  4X23 A;  4EO5 C;  1AOI D;  5CP6 A;  2F2A C;  3MVD C;  1P3K D;  5B40 D;  4KUD C;  5CPI C;  3A6N B;  1H3O A;  1HTA A;  2ZM5 A;  3W98 D;  3X1U A;  3W99 A;  1S32 B;  3AN2 D;  3P5J B;  3REJ B;  1AOI C;  1P3K C;  1M1A D;  5B33 B;  5B40 C;  3AZF A;  3W98 C;  4H9P B;  2DF4 C;  3MGQ B;  1P3M A;  4WU8 D;  4WU9 A;  4Z5T A;  5B2J D;  3AN2 C;  3MGP B;  2Y2P A;  4XZQ B;  3KXB A;  3MGS A;  4WNN B;  1M1A C;  3AZJ A;  5CPJ B;  3C1B A;  4WU8 C;  3WTP D;  3LEL A;  3MVD B;  4KUD B;  5B2J C;  3TU4 D;  5CPI B;  2IO5 C;  4H9Q B;  5JA4 A;  3AZM A;  1N1J A;  3B6F A;  3WTP C;  3R45 A;  3AZL A;  1P3K B;  3VH6 T;  3TU4 C;  2BYK A;  3WAA A;  4J8W A;  5B1M A;  3UT9 D;  5AV6 A;  5B0Z A;  1M1A B;  1TZY B;  3UTA A;  4J8V D;  2CV5 D;  1P3A D;  3UT9 C;  4WU8 B;  4JJN D;  4LD9 A;  4DQY B;  1EQZ A;  5B2J B;  4H9R A;  1WWI A;  2F8N H;  1B6W A;  4KGC D;  5DNM A;  3C1C C;  4J8V C;  3AFA D;  3V9R B;  2CV5 C;  5AVB D;  5B31 D;  4HGA C;  4ZBJ C;  3WTP B;  4JJN C;  1HQ3 A;  3X1T A;  3TU4 B;  3AZN A;  4KGC C;  3X1S D;  1P3I D;  1KX5 B;  5AY8 D;  3KWQ A;  3AFA C;  5AVB C;  5B31 C;  5BNV A;  2FJ7 A;  2Y2L A;  4Z66 D;  3LZ1 D;  3X1S C;  1P3I C;  5AY8 C;  5AV5 A;  3UT9 B;  1BH9 B;  5DNN A;  1U35 D;  1M19 A;  3AV1 A;  4QLC A;  3REK A;  3REL D;  5AVC A;  3C1C B;  4Z66 C;  5JRG D;  3LZ1 C;  3B6G D;  4HGA B;  4JJN B;  1U35 C;  3VH5 A;  4KGC B;  3REL C;  4XUJ D;  2L5A A;  3LZ0 D;  4X23 D;  3REI B;  3EPJ A;  1P3O D;  5JRG C;  2J8P A;  5CP6 D;  3AFA B;  3NQJ B;  5AVB B;  5B31 B;  3B6G C;  3AZE D;  2NQB B;  3VH5 W;  3EPL A;  4XUJ C;  3X1S B;  1P3I B;  4UUZ B;  5AY8 B;  3LZ0 C;  4CSR A;  4X23 C;  3KUY B;  1P3O C;  1JFI B;  5CP6 C;  2ZY4 A;  3AZE C;  4YS3 A;  2LY8 A;  2DQN C;  4Z66 B;  4WU9 D;  2RIQ A;  3LZ1 B;  3IP4 C;  4Z5T D;  5B32 G;  3MGS D;  3MNN A;  3KXB D;  3A1K A;  3NQU B;  4H9O B;  3REL B;  3AZJ D;  5GT3 A;  2ARO B;  3LJA A;  3C1B D;  4WU9 C;  3LEL D;  4Z5T C;  4J8X A;  3MGS C;  3KXB C;  3UTB B;  4XUJ B;  3AZM D;  3W96 A;  3AZJ C;  3LZ0 B;  1P3O B;  4X23 B;  3B6F D;  5BO0 A;  3C1B C;  3LEL C;  1P34 B;  3AZE B;  3WAA D;  5B1M D;  4NE3 A;  3AZK A;  5E5A A;  3AZM C;  3X1V C;  4KHA A;  2JCH A;  5AV6 D;  3B6F C;  2NZD A;  2Y2M A;  1F66 B;  5B24 A;  1BH8 A;  3EPH A;  3WAA C;  5B1L A;  5B1M C;  5B2I A;  2HIO A;  4H9N A;  4WU9 B;  3O62 A;  5FUG A;  5AV6 C;  5AV8 A;  5B0Y B;  3KXB B;  3MGS B;  2ZY2 A;  1WWS A;  2ZY3 A;  5B32 A;  5DNM D;  4CAY A;  5GSU A;  3AZJ B;  3FDD A;  3C1B B;  4G91 C;  3LEL B;  1HQ3 D;  3AYW A;  3X1T D;  1P3B D;  3AL0 C;  3H0M C;  5DNM C;  2XD1 A;  3KWQ D;  4YM6 A;  4EO5 B;  5JA4 B;  3AZM B;  3X1V B;  4AWL C;  2F8N B;  3B6F B;  3W97 A;  1M18 A;  1HQ3 C;  3X1T C;  2FJ7 D;  1ULY A;  1P3B C;  3A6N A;  3WAA B;  3KWQ C;  2G5I C;  1S32 A;  1AOI B;  1M19 D;  1P3P A;  5B40 B;  3AV1 D;  5AV6 B;  1KX3 A;  5BS7 A;  3KSY A;  3REJ A;  3W98 B;  1P3L A;  2FJ7 C;  3AN2 B;  4H9P A;  3MGQ A;  4G91 B;  1M19 C;  3AV1 C;  5GT0 D;  4XZQ A;  3AV2 A;  4WNN A;  5DNM B;  3WKJ D;  3EPK A;  5CPJ A;  1HQ3 B;  4KUD A;  3MVD A;  4J8U A;  5GXQ D;  3X1T B;  2IO5 B;  1P3B B;  5GT0 C;  3WKJ C;  2RVQ D;  1A7W A;  1P3A C;  4H9Q A;  4WZS B;  3EG5 B;  5GXQ C;  2FJ7 B;  1P3F A;  2Y2H A;  2RVQ C;  4WV4 B;  3MNN D;  3VH6 A;  3AV1 B;  3REH A;  2BYM B;  2Y2J A;  2G5H C;  5GT3 D;  1TZY A;  4M6B A;  2YFW A;  4J8X D;  5AV9 A;  3MNN C;  3VH6 W;  5B2J A;  3MGR D;  5GT0 B;  4J8V B;  4Z2M H;  3WKJ B;  3WA9 D;  3W96 D;  5GT3 C;  2CV5 B;  1P3A B;  4ZBJ B;  3AZH D;  4J8X C;  1P3G A;  2Y2I A;  3V9R A;  2ZY5 A;  4R8P A;  5GXQ B;  3MGR C;  3AZK D;  3WA9 C;  3W96 C;  3AZI A;  1KX5 A;  2UWX A;  4CSR B;  2NZD D;  3AZH C;  1TAF B;  2Y2N A;  5F99 A;  5B24 D;  2Y2G A;  2Y2K A;  3W99 D;  3X1U D;  5B2I D;  3AZG A;  3AZK C;  1ZLA A;  2HIO D;  3O62 D;  1T3U A;  5AV8 D;  1BH9 A;  3MNN B;  2NZD C;  1F1E A;  4NE6 A;  5G49 A;  3AZF D;  1P3M D;  3W99 C;  3X1U C;  5GSU D;  2Y2Q A;  4DRB A;  5B2I C;  1KX4 A;  3B0C W;  5BNX A;  3C1C A;  2HIO C;  3AYW D;  3O62 C;  2BG1 A;  1U35 B;  5KDM A;  4G92 C;  4H9S A;  3AZF C;  3MGR B;  4YM6 D;  5C3I C;  1P3M C;  5JRG B;  5GSU C;  3WA9 B;  3W96 B;  3REI A;  3B6G B;  3W97 D;  3AZH B;  3AYW C;  1M18 D;  1BFM A;  5B31 A;  3AZK B;  2NQB A;  4YM6 C;  5CP6 B;  3AZL D;  4KHA B;  1P3I A;  4UUZ A;  5AY8 A;  5BT1 D;  4ZUX A;  1B67 A;  3KUY A;  1P3P D;  1KX3 D;  1M18 C;  1ID3 A;  1JFI A;  1H3O B;  4J8W D;  3W97 C;  1P3L D;  4NE5 A;  3X1U B;  3W99 B;  2YFV A;  1KU5 A;  3MGQ D;  2HIO B;  2PYO A;  3O62 B;  5B0Z D;  3LZ1 A;  3AZL C;  1P3P C;  5BT1 C;  1KX3 C;  3UTA D;  3AV2 D;  4J8W C;  3AZF B;  1P3L C;  3NQU A;  1P3M B;  5C3I B;  4LD9 D;  3A1I A;  5GSU B;  4Z5T B;  3REL A;  1EQZ D;  5CPJ D;  2ARO A;  3AYW B;  4KUD D;  5B0Z C;  4J8U D;  2JSS A;  3UTA C;  4E45 A;  3AV2 C;  5CPK A;  2F8N G;  3UTB A;  1R4V A;  4LD9 C;  2Y2O A;  1EQZ C;  1Q9C A;  3LZ0 A;  3W97 B;  5CPJ C;  3AZN D;  1M18 B;  4J8U C;  3H0L C;  1P34 A;  3AZE A;  1P3F D;  1N1J B;  3R45 B;  3AZL B;  1P3P B;  3REH D;  1KX3 B;  3AZN C;  2BYK B;  4J8W B;  5B1M B;  1F66 A;  1TZY D;  1P3L B;  5AV5 D;  1P3F C;  5DNN D;  5AV9 D;  4QLC D;  3REK D;  5B0Z B;  5B33 A;  5AVC D;  3REH C;  3UTA B;  5B0Y A;  3AV2 B;  1TZY C;  5AV5 C;  5DNN C;  4LD9 B;  1P3G D;  1EQZ B;  4H9R B;  3H0R C;  5AV9 C;  4Z2M G;  4R8P D;  3MGP A;  4QLC C;  3REK C;  4J8U B;  5AVC C;  2VQR A;  5CHL B;  3WTP E;  4AWL B;  3AZI D;  1KX5 D;  1P3G C;  3X1V A;  5F99 D;  2F8N A;  4R8P C;  3AZN B;  5CPI A;  3AZG D;  2XD5 A; 
#chains in the Genus database with same CATH homology
 1ZLA D;  3KWQ B;  1P3F B;  3AZI C;  1KX5 C;  4WJ3 C;  5BNV B;  1AOI A;  1P3K A;  5F99 C;  4YS3 D;  5B40 A;  3REH B;  3AZG C;  1KX4 D;  3W98 A;  5AV5 B;  3C1C D;  1ZLA C;  2YFW B;  5DNN B;  2W8S A;  1M19 B;  3AN2 A;  4UPK A;  5AV9 B;  3B0D C;  4QLC B;  3REK B;  1M1A A;  4YS3 C;  3B0B A;  5AVC B;  4E44 A;  3LJA D;  1KX4 C;  3VH5 T;  3REI D;  4WU8 A;  1P3G B;  4R8P B;  4DRA A;  3F6T A;  4H9S C;  2NQB D;  1P3B A;  3LJA C;  5B31 G;  3AZI B;  4ZUX D;  3KUY D;  3REI C;  1ID3 D;  2CWE A;  3WTP A;  3B0C T;  3KFU G;  5F99 B;  3TU4 A;  5E5A D;  3AZG B;  2NQB C;  1ZLA B;  1PZR A;  2PYO D;  2FFF B;  4ZUX C;  3KUY C;  1W2E A;  1ID3 C;  3B0D B;  5G49 B;  5B1L D;  4YS3 B;  5E5A C;  2BYM A;  1KX4 B;  5BNX B;  3UT9 A;  2ARO D;  2PYO C;  5B32 D;  5B24 C;  5KDM B;  5CPK D;  5B1L C;  5GT3 B;  3UTB D;  3LJA B;  5GT0 A;  4J8V A;  3WKJ A;  4J8X B;  2CV5 A;  1P3A A;  5AV8 C;  2ARO C;  4JJN A;  2F8N K;  5B32 C;  1P34 D;  5CPK C;  4KGC A;  5GXQ A;  3UTB C;  2HUE C;  5BO0 B;  3AFA A;  4ZUX B;  3NQJ A;  1ID3 B;  5AVB A;  3A6N D;  1TAF A;  1F66 D;  1P34 C;  5E5A B;  1S32 D;  3X1S A;  2YFV B;  2NZD B;  2PYO B;  3REJ D;  5B33 D;  5B24 B;  1BH8 B;  5B0Y D;  3A6N C;  5B1L B;  5B2I B;  1F66 C;  4H9N B;  4Z66 A;  1S32 C;  5FUG B;  3MGP D;  5AV8 B;  4XZQ D;  5BS7 C;  4G92 B;  3REJ C;  1U35 A;  1Z2C B;  5B32 B;  4NFT A;  4CAY B;  5B33 C;  5B0Y C;  5CPK B;  4H9O A;  2JE5 A;  3MGR A;  3MGQ C;  2HUE B;  5JRG A;  3WA9 A;  3MVD D;  3X1V D;  2F8N D;  3MGP C;  3B6G A;  5CPI D;  4XZQ C;  3AZH A;  4YM6 B;  4XUJ A;  1P3O A;  4X23 A;  4EO5 C;  1AOI D;  5CP6 A;  2F2A C;  3MVD C;  1P3K D;  5B40 D;  4KUD C;  5CPI C;  3A6N B;  1H3O A;  1HTA A;  2ZM5 A;  3W98 D;  3X1U A;  3W99 A;  1S32 B;  3AN2 D;  3P5J B;  3REJ B;  1AOI C;  1P3K C;  1M1A D;  5B33 B;  5B40 C;  3AZF A;  3W98 C;  4H9P B;  2DF4 C;  3MGQ B;  1P3M A;  4WU8 D;  4WU9 A;  4Z5T A;  5B2J D;  3AN2 C;  3MGP B;  2Y2P A;  4XZQ B;  3KXB A;  3MGS A;  4WNN B;  1M1A C;  3AZJ A;  5CPJ B;  3C1B A;  4WU8 C;  3WTP D;  3LEL A;  3MVD B;  4KUD B;  5B2J C;  3TU4 D;  5CPI B;  2IO5 C;  4H9Q B;  5JA4 A;  3AZM A;  1N1J A;  3B6F A;  3WTP C;  3R45 A;  3AZL A;  1P3K B;  3VH6 T;  3TU4 C;  2BYK A;  3WAA A;  4J8W A;  5B1M A;  3UT9 D;  5AV6 A;  5B0Z A;  1M1A B;  1TZY B;  3UTA A;  4J8V D;  2CV5 D;  1P3A D;  3UT9 C;  4WU8 B;  4JJN D;  4LD9 A;  4DQY B;  1EQZ A;  5B2J B;  4H9R A;  1WWI A;  2F8N H;  1B6W A;  4KGC D;  5DNM A;  3C1C C;  4J8V C;  3AFA D;  3V9R B;  2CV5 C;  5AVB D;  5B31 D;  4HGA C;  4ZBJ C;  3WTP B;  4JJN C;  1HQ3 A;  3X1T A;  3TU4 B;  3AZN A;  4KGC C;  3X1S D;  1P3I D;  1KX5 B;  5AY8 D;  3KWQ A;  3AFA C;  5AVB C;  5B31 C;  5BNV A;  2FJ7 A;  2Y2L A;  4Z66 D;  3LZ1 D;  3X1S C;  1P3I C;  5AY8 C;  5AV5 A;  3UT9 B;  1BH9 B;  5DNN A;  1U35 D;  1M19 A;  3AV1 A;  4QLC A;  3REK A;  3REL D;  5AVC A;  3C1C B;  4Z66 C;  5JRG D;  3LZ1 C;  3B6G D;  4HGA B;  4JJN B;  1U35 C;  3VH5 A;  4KGC B;  3REL C;  4XUJ D;  2L5A A;  3LZ0 D;  4X23 D;  3REI B;  3EPJ A;  1P3O D;  5JRG C;  2J8P A;  5CP6 D;  3AFA B;  3NQJ B;  5AVB B;  5B31 B;  3B6G C;  3AZE D;  2NQB B;  3VH5 W;  3EPL A;  4XUJ C;  3X1S B;  1P3I B;  4UUZ B;  5AY8 B;  3LZ0 C;  4CSR A;  4X23 C;  3KUY B;  1P3O C;  1JFI B;  5CP6 C;  2ZY4 A;  3AZE C;  4YS3 A;  2LY8 A;  2DQN C;  4Z66 B;  4WU9 D;  2RIQ A;  3LZ1 B;  3IP4 C;  4Z5T D;  5B32 G;  3MGS D;  3MNN A;  3KXB D;  3A1K A;  3NQU B;  4H9O B;  3REL B;  3AZJ D;  5GT3 A;  2ARO B;  3LJA A;  3C1B D;  4WU9 C;  3LEL D;  4Z5T C;  4J8X A;  3MGS C;  3KXB C;  3UTB B;  4XUJ B;  3AZM D;  3W96 A;  3AZJ C;  3LZ0 B;  1P3O B;  4X23 B;  3B6F D;  5BO0 A;  3C1B C;  3LEL C;  1P34 B;  3AZE B;  3WAA D;  5B1M D;  4NE3 A;  3AZK A;  5E5A A;  3AZM C;  3X1V C;  4KHA A;  2JCH A;  5AV6 D;  3B6F C;  2NZD A;  2Y2M A;  1F66 B;  5B24 A;  1BH8 A;  3EPH A;  3WAA C;  5B1L A;  5B1M C;  5B2I A;  2HIO A;  4H9N A;  4WU9 B;  3O62 A;  5FUG A;  5AV6 C;  5AV8 A;  5B0Y B;  3KXB B;  3MGS B;  2ZY2 A;  1WWS A;  2ZY3 A;  5B32 A;  5DNM D;  4CAY A;  5GSU A;  3AZJ B;  3FDD A;  3C1B B;  4G91 C;  3LEL B;  1HQ3 D;  3AYW A;  3X1T D;  1P3B D;  3AL0 C;  3H0M C;  5DNM C;  2XD1 A;  3KWQ D;  4YM6 A;  4EO5 B;  5JA4 B;  3AZM B;  3X1V B;  4AWL C;  2F8N B;  3B6F B;  3W97 A;  1M18 A;  1HQ3 C;  3X1T C;  2FJ7 D;  1ULY A;  1P3B C;  3A6N A;  3WAA B;  3KWQ C;  2G5I C;  1S32 A;  1AOI B;  1M19 D;  1P3P A;  5B40 B;  3AV1 D;  5AV6 B;  1KX3 A;  5BS7 A;  3KSY A;  3REJ A;  3W98 B;  1P3L A;  2FJ7 C;  3AN2 B;  4H9P A;  3MGQ A;  4G91 B;  1M19 C;  3AV1 C;  5GT0 D;  4XZQ A;  3AV2 A;  4WNN A;  5DNM B;  3WKJ D;  3EPK A;  5CPJ A;  1HQ3 B;  4KUD A;  3MVD A;  4J8U A;  5GXQ D;  3X1T B;  2IO5 B;  1P3B B;  5GT0 C;  3WKJ C;  2RVQ D;  1A7W A;  1P3A C;  4H9Q A;  4WZS B;  3EG5 B;  5GXQ C;  2FJ7 B;  1P3F A;  2Y2H A;  2RVQ C;  4WV4 B;  3MNN D;  3VH6 A;  3AV1 B;  3REH A;  2BYM B;  2Y2J A;  2G5H C;  5GT3 D;  1TZY A;  4M6B A;  2YFW A;  4J8X D;  5AV9 A;  3MNN C;  3VH6 W;  5B2J A;  3MGR D;  5GT0 B;  4J8V B;  4Z2M H;  3WKJ B;  3WA9 D;  3W96 D;  5GT3 C;  2CV5 B;  1P3A B;  4ZBJ B;  3AZH D;  4J8X C;  1P3G A;  2Y2I A;  3V9R A;  2ZY5 A;  4R8P A;  5GXQ B;  3MGR C;  3AZK D;  3WA9 C;  3W96 C;  3AZI A;  1KX5 A;  2UWX A;  4CSR B;  2NZD D;  3AZH C;  1TAF B;  2Y2N A;  5F99 A;  5B24 D;  2Y2G A;  2Y2K A;  3W99 D;  3X1U D;  5B2I D;  3AZG A;  3AZK C;  1ZLA A;  2HIO D;  3O62 D;  1T3U A;  5AV8 D;  1BH9 A;  3MNN B;  2NZD C;  1F1E A;  4NE6 A;  5G49 A;  3AZF D;  1P3M D;  3W99 C;  3X1U C;  5GSU D;  2Y2Q A;  4DRB A;  5B2I C;  1KX4 A;  3B0C W;  5BNX A;  3C1C A;  2HIO C;  3AYW D;  3O62 C;  2BG1 A;  1U35 B;  5KDM A;  4G92 C;  4H9S A;  3AZF C;  3MGR B;  4YM6 D;  5C3I C;  1P3M C;  5JRG B;  5GSU C;  3WA9 B;  3W96 B;  3REI A;  3B6G B;  3W97 D;  3AZH B;  3AYW C;  1M18 D;  1BFM A;  5B31 A;  3AZK B;  2NQB A;  4YM6 C;  5CP6 B;  3AZL D;  4KHA B;  1P3I A;  4UUZ A;  5AY8 A;  5BT1 D;  4ZUX A;  1B67 A;  3KUY A;  1P3P D;  1KX3 D;  1M18 C;  1ID3 A;  1JFI A;  1H3O B;  4J8W D;  3W97 C;  1P3L D;  4NE5 A;  3X1U B;  3W99 B;  2YFV A;  1KU5 A;  3MGQ D;  2HIO B;  2PYO A;  3O62 B;  5B0Z D;  3LZ1 A;  3AZL C;  1P3P C;  5BT1 C;  1KX3 C;  3UTA D;  3AV2 D;  4J8W C;  3AZF B;  1P3L C;  3NQU A;  1P3M B;  5C3I B;  4LD9 D;  3A1I A;  5GSU B;  4Z5T B;  3REL A;  1EQZ D;  5CPJ D;  2ARO A;  3AYW B;  4KUD D;  5B0Z C;  4J8U D;  2JSS A;  3UTA C;  4E45 A;  3AV2 C;  5CPK A;  2F8N G;  3UTB A;  1R4V A;  4LD9 C;  2Y2O A;  1EQZ C;  1Q9C A;  3LZ0 A;  3W97 B;  5CPJ C;  3AZN D;  1M18 B;  4J8U C;  3H0L C;  1P34 A;  3AZE A;  1P3F D;  1N1J B;  3R45 B;  3AZL B;  1P3P B;  3REH D;  1KX3 B;  3AZN C;  2BYK B;  4J8W B;  5B1M B;  1F66 A;  1TZY D;  1P3L B;  5AV5 D;  1P3F C;  5DNN D;  5AV9 D;  4QLC D;  3REK D;  5B0Z B;  5B33 A;  5AVC D;  3REH C;  3UTA B;  5B0Y A;  3AV2 B;  1TZY C;  5AV5 C;  5DNN C;  4LD9 B;  1P3G D;  1EQZ B;  4H9R B;  3H0R C;  5AV9 C;  4Z2M G;  4R8P D;  3MGP A;  4QLC C;  3REK C;  4J8U B;  5AVC C;  2VQR A;  5CHL B;  3WTP E;  4AWL B;  3AZI D;  1KX5 D;  1P3G C;  3X1V A;  5F99 D;  2F8N A;  4R8P C;  3AZN B;  5CPI A;  3AZG D;  2XD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...