1KX3D

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3D00
5GT0D 1KX5D 4WU9C 3B0CW 1TZYC 5AV8A 5AVBD 4KUDA 3WTPA 5FUGA 5AY8B 5B24A 2CWEA 4WNNB 3MNNB 5GT3C 4H9PA 3REKC 5B0ZB 3AZHB 5AV9D 5B33C 3B6GB 5B1MA 4G92C 3UTAB 2NZDB 5B0YA 5AV6A 1B67A 4LD9C 4YS3A 1P34D 3WKJD 3WTPE 5B32D 1U35C 5CPKB 5GSUB 3REID 3C1CD 3RELC 1M19A 3UT9A 2HUEC 2CV5A 1P3LA 3B0DC 2F8NA 2HIOA 5AV5C 3B6FC 5B40A 3W96A 4EO5B 1P3MD 3REHD 3A6ND 2PYOA 3VH5A 3VH6W 1R4VA 3AZMA 3AYWC 1P3ID 3B0DB 5B40C 2YFVB 5CP6D 1EQZA 3AV1A 3W99C 1TZYB 1P3FC 2NZDA 1P3KB 3AZLD 1P3KC 4KGCD 3REIA 1ID3B 4Z66A 4UUZA 4CAYB 5B33B 4R8PD 3REJC 1AOIB 2FJ7B 1P3BD 1HQ3D 4JJNA 1M19C 3REJB 1F66B 4WU8C 1M18A 3X1VB 4H9OB 4YM6D 5GXQA 3V9RB 3KWQA 1M1AD 3REKA 4WU9B 3NQUB 1P3PC 3WA9A 1A7WA 5GT0A 1KX5A 3W99B 3AZKC 5AY8A 3AZJD 4XUJD 3REKB 5B24D 1P3BC 3AZJC 4AWLC 1KX4D 1U35A 3O62D 3RELA 5B1MB 1P3OD 3B6FB 4G92B 5JRGD 1U35B 2BYMB 2AROC 5DNNB 1TAFA 4YS3C 1H3OB 5F99C 2F8NG 5C3IB 3TU4D 1S32C 3X1SA 3NQUA 4J8WA 3X1VA 5BNVB 3UTAC 3WA9D 1S32D 4JJNB 3R45B 3V9RA 3KWQB 3W96D 3LJAA 4J8XB 4KGCC 4KUDC 3W97B 3AZLC 5AY8C 3AV2D 3WAAC 5B1LB 1P3FD 4H9SA 5CPIB 1P3AB 5AVCA 5CPIA 5F99D 1P3AA 3AZLA 1KX3B 5DNMC 3AZGD 5AV6C 3KXBD 4ZBJC 3LZ1B 3X1TB 4ZBJB 1BFMA 1P3MC 4X23A 5E5AD 1F66A 1P3PD 4Z5TD 5BO0B 3UT9B 5GT0C 1KX5C 3W96C 5GSUA 1BH9B 4H9RB 1P34C 3LJAC 4Z2MG 1P3LB 2HIOB 3X1SB 4J8WB 4NE5A 5B0ZA 5BS7A 3MGQA 1ZLAA 5AY8D 4YM6C 5B0YD 3LJAB 4YS3B 5AV8B 3REIC 3RELD 5B0ZC 3B6GD 3UTAD 3AZMC 5CP6C 1P3GA 4H9PB 2L5AA 5CPKD 5GSUD 5DNNA 4CSRA 4XZQA 3X1UA 3C1CB 2RVQD 5B31D 5AV6B 1AOIA 2FJ7A 3AN2A 5CPJA 5C3IC 1P3OC 3UT9C 1BH9A 1P3MB 4DRAA 2AROB 3MGQD 1ZLAD 4WU8D 3AZKA 5AV9C 3KSYA 4KUDB 3A6NA 1HTAA 5KDMB 3NQJB 4Z66D 4X23C 3KWQC 4R8PA 1P3GD 1P3KD 3AZMB 5AV9A 4KGCB 5BT1C 1TZYA 5AV8C 5AVCC 3NQJA 3B0CT 4QLCA 1AOID 2FJ7D 1P3BB 5CPJB 1KU5A 1F66D 1TAFB 4ZUXD 3REJA 3AN2C 4J8WC 3KUYB 3X1SC 3AZED 5B33A 4WU8A 5CHLB 4YM6B 1M19B 4XUJA 3AV1D 4WU9D 3C1CC 2CV5D 3WAAB 3UTBA 3W99D 2F8NB 5B2JC 5B40D 4J8VC 5B1LA 2JSSA 5B24B 3MGPC 3LZ0D 2BYKB 5B32G 4ZUXC 3MGPD 4AWLB 5CPKC 1JFIB 3AZFB 3C1BA 4KGCA 3MGSC 3AZIC 3W98B 1AOIC 3C1BB 2FJ7C 3AYWB 3AFAA 3MVDC 3MGSB 3AZIB 5B2JD 1P3OB 5B1LC 3B6FD 5JRGB 3TU4A 3AFAB 2BYKA 1P3OA 1F66C 3AZND 1M18D 4DRBA 1WWIA 4H9SC 3AZFA 5CPKA 5BNXB 4CSRB 3MGSA 3AZIA 5DNMA 4XZQC 3X1UC 5B31C 4QLCB 3AZEC 3WA9B 1S32B 1HQ3A 4JJND 4NE3A 5GXQD 3KWQD 1P3MA 1M1AA 1S32A 3LZ0C 4JJNC 2F8NK 1ULYA 4WV4B 4J8VD 3MGRC 4J8XC 4J8UC 3W97D 4M6BA 5JA4B 4YM6A 5BT1D 5KDMA 3WTPD 1EQZD 3AZNC 4Z5TC 3LELD 1BH8A 3MVDD 3UTBB 3MGRA 4J8UA 1KX3D 5AVCB 3AZGB 3MGRB 4J8UB 5BO0A 3X1TD 3B0BA 3LZ1A 2NQBD 5DNMD 4WZSB 5E5AB 5B2IA 1P3BA 4X23B 5E5AA 4Z5TB 5B2IB 4XZQB 3X1UB 3KUYA 3C1CA 3UT9D 3AZEA 3AV2C 3LZ1C 5JRGC 4J8VA 5GT3A 5GSUC 5E5AC 4J8XA 3C1BC 3AZHC 3X1SD 4J8WD 2PYOD 3AV2A 1P3IA 3MVDA 2YFVA 5B0YB 3LJAD 4YS3D 5AV8D 5AVBA 3RELB 3W98A 2LY8A 2RVQC 3B6GA 4WNNA 5B31A 3AFAC 5B32A 4LD9B 3AZFC 5B31B 5AV6D 2PYOC 3AZKD 4QLCC 4KHAB 5CPJC 5GT3B 3REHA 4KHAA 2AROD 3UTBC 5AV5B 3MGQB 1ZLAB 4WU8B 3AN2B 1M1AC 1P3KA 5GT0B 1KX5B 4KUDD 5AVBB 3KXBC 1ID3C 4Z66B 4Z2MH 1P3GB 3MNND 3W98C 1N1JA 4NE6A 4XUJC 3AZMD 5B0ZD 3B6GC 3AZHD 1KX3A 3TU4C 5AV9B 3KXBA 4NFTA 3X1TA 2NZDD 3VH6T 1N1JB 5CPJD 1P34B 3WKJB 5B32B 4ZUXB 1H3OA 4G91B 3REIB 3KUYD 3AZEB 3WA9C 3AZGC 1Q9CA 3WKJA 4H9RA 3R45A 2NQBC 3REHB 1M19D 3AV1B 1B6WA 2CV5B 1KX4A 3WAAD 2F8ND 3MNNA 3A6NB 5B40B 5JA4A 1P3IB 2NZDC 5CP6B 1TZYD 3O62C 3LZ0B 4UUZB 4CAYA 3WTPC 3MGPB 3AZFD 3VH6A 3VH5W 3MNNC 3AZLB 3W98D 3C1BD 3AYWD 2IO5C 3MGSD 3AZID 5B2JB 2YFWB 3A6NC 3AFAD 1ID3D 3B6FA 5B33D 3O62A 4R8PB 3AZNB 5BNVA 1M18B 3KUYC 1HQ3B 4R8PC 3REJD 4LD9A 5JRGA 4H9NA 4QLCD 2BYMA 3WAAA 3AV1C 5B31G 3X1VD 5GXQB 3W99A 1KX4C 5AV5A 1M1AB 4WU9A 1HQ3C 4H9NB 4J8VB 1P3IC 3LZ0A 4HGAB 1KX3C 4H9OA 1JFIA 4HGAC 3AZJA 1F1EA 3WTPB 1EQZB 3AZJB 3AYWA 4XUJB 3REKD 2YFWA 3LELB 1KX4B 1ID3A 3MVDB 3UTBD 3O62B 3AZNA 5AVCD 3AZHA 3MGRD 5B1MD 4J8UD 5B2JA 3AZGA 2NQBB 5DNMB 1BH8B 5B24C 5B32C 1U35D 4H9QB 5F99A 4X23D 4Z66C 4E44A 3MGPA 5BNXA 3X1TC 5B2ID 5DNND 1P3LC 4ZUXA 3X1UD 4XZQD 1P3PA 5G49B 5B2IC 4G91C 3TU4B 3MGQC 1ZLAC 1M18C 3W96B 4EO5C 3WKJC 3VH5T 4J8XD 3W97C 2CV5C 2PYOB 3LELA 2HUEB 1P3FA 2HIOC 4E45A 5CP6A 3AV2B 1P3GC 5B1LD 1P3FB 5CPIC 1P3AC 3REHC 5DNNC 5CPID 1P3AD 3W97A 2IO5B 4H9QA 5F99B 3LELC 5AVBC 3KXBB 3LZ1D 3X1VC 5G49A 3UTAA 1EQZC 5B1MC 5B0YC 4Z5TA 4LD9D 1P3PB 1WWSA 2AROA 1P34A 3AZKB 5GXQC 2NQBA 5GT3D 2F8NH 1P3LD 5AV5D 5FUGB 3AN2D 2HIOD 5BS7C
chains in the Genus database with same CATH superfamily
2FFFB 5GT0D 4WU9C 1KX5D 3B0CW 1TZYC 5AV8A 5AVBD 4KUDA 3WTPA 5FUGA 5AY8B 5B24A 2CWEA 4WNNB 3MNNB 5GT3C 4H9PA 3REKC 5B0ZB 3AZHB 5AV9D 5B33C 3B6GB 5B1MA 4G92C 3UTAB 1Z2CB 2NZDB 5B0YA 5AV6A 1B67A 4LD9C 4YS3A 1P34D 3WKJD 3WTPE 5B32D 1U35C 4WJ3C 5CPKB 5GSUB 3REID 3C1CD 3RELC 2VQRA 1M19A 3UT9A 2HUEC 2CV5A 1P3LA 3B0DC 2F8NA 2HIOA 5AV5C 3B6FC 4DQYB 5B40A 3W96A 4EO5B 1P3MD 3REHD 3A6ND 2PYOA 3VH5A 3VH6W 1R4VA 3AZMA 3AYWC 1P3ID 3B0DB 5B40C 2YFVB 5CP6D 1EQZA 3AV1A 3W99C 1TZYB 2JE5A 1P3FC 2NZDA 1P3KB 3AZLD 1P3KC 4KGCD 3REIA 1ID3B 4Z66A 4UUZA 4CAYB 5B33B 4R8PD 3REJC 2Y2PA 1AOIB 2G5HC 2FJ7B 1P3BD 1HQ3D 4JJNA 1M19C 3REJB 1F66B 4WU8C 1M18A 3X1VB 4H9OB 4YM6D 5GXQA 3V9RB 3KWQA 1M1AD 2Y2KA 3REKA 4WU9B 2Y2MA 3NQUB 1P3PC 3WA9A 1A7WA 5GT0A 1KX5A 3W99B 3AZKC 5AY8A 3AZJD 4XUJD 3REKB 5B24D 1P3BC 3AZJC 4AWLC 1KX4D 1U35A 3O62D 2ZY5A 3RELA 5B1MB 1P3OD 3B6FB 4G92B 5JRGD 1U35B 2BYMB 2AROC 5DNNB 1TAFA 4YS3C 1H3OB 2ZY4A 5F99C 2Y2JA 2F8NG 5C3IB 3TU4D 1S32C 3X1SA 3NQUA 4J8WA 3X1VA 5BNVB 3UTAC 3WA9D 1S32D 4JJNB 3R45B 3V9RA 3KWQB 3W96D 2Y2QA 3LJAA 4J8XB 4KGCC 4KUDC 3W97B 3AZLC 5AY8C 3AV2D 3WAAC 5B1LB 3IP4C 1P3FD 4H9SA 5CPIB 1P3AB 5AVCA 5CPIA 5F99D 1P3AA 3AZLA 1KX3B 5DNMC 3AZGD 5AV6C 3KXBD 4ZBJC 3LZ1B 3X1TB 2Y2LA 4ZBJB 1BFMA 1P3MC 4X23A 5E5AD 1F66A 1P3PD 4Z5TD 5BO0B 3UT9B 5GT0C 1KX5C 3W96C 5GSUA 1BH9B 4H9RB 1P34C 3LJAC 4Z2MG 1P3LB 3A1IA 2HIOB 2ZY2A 3X1SB 4J8WB 4NE5A 5B0ZA 5BS7A 3MGQA 1ZLAA 5AY8D 3A1KA 4YM6C 5B0YD 3LJAB 4YS3B 5AV8B 3REIC 3RELD 2Y2OA 5B0ZC 3B6GD 2Y2NA 3UTAD 3AZMC 5CP6C 1P3GA 4H9PB 2L5AA 2DF4C 5CPKD 5GSUD 5DNNA 4CSRA 4XZQA 3X1UA 3C1CB 2RVQD 5B31D 5AV6B 1AOIA 2FJ7A 3AN2A 5CPJA 5C3IC 1P3OC 3UT9C 1BH9A 1P3MB 4DRAA 2AROB 3MGQD 1ZLAD 4WU8D 3AZKA 5AV9C 3KSYA 4KUDB 3A6NA 1HTAA 5KDMB 3NQJB 4Z66D 4X23C 2G5IC 3KWQC 4R8PA 1P3GD 1P3KD 3AZMB 5AV9A 3FDDA 4KGCB 5BT1C 1TZYA 5AV8C 5AVCC 3NQJA 3B0CT 4QLCA 1AOID 2FJ7D 1P3BB 5CPJB 1KU5A 1F66D 1TAFB 4ZUXD 3REJA 2FJ7C 3AN2C 4J8WC 3KUYB 3X1SC 3AZED 5B33A 2ZM5A 4WU8A 2W8SA 5CHLB 4YM6B 3H0MC 3EPJA 3EPKA 1T3UA 1M19B 4XUJA 3AV1D 4WU9D 3C1CC 2CV5D 2ZY3A 3WAAB 3UTBA 3W99D 2F8NB 5B2JC 5B40D 4J8VC 5B1LA 2JSSA 5B24B 3MGPC 3LZ0D 2BYKB 5B32G 4ZUXC 3MGPD 4AWLB 5CPKC 1JFIB 3AZFB 3C1BA 4KGCA 3MGSC 3AZIC 3W98B 1AOIC 2DQNC 3C1BB 3AYWB 3AFAA 3MVDC 2XD5A 3MGSB 5B2JD 3AZIB 5B1LC 1P3OB 5JRGB 3TU4A 3AFAB 2BYKA 1P3OA 1F66C 3AZND 1M18D 4DRBA 1WWIA 4H9SC 3AZFA 5CPKA 5BNXB 4CSRB 3MGSA 3AZIA 5DNMA 4XZQC 3X1UC 5B31C 4QLCB 3AZEC 3WA9B 1S32B 1HQ3A 4JJND 4NE3A 5GXQD 3KWQD 1P3MA 1M1AA 1S32A 3LZ0C 4JJNC 2F8NK 1ULYA 4WV4B 4J8VD 2RIQA 3MGRC 4J8XC 4J8UC 3W97D 4M6BA 5JA4B 4YM6A 5BT1D 5KDMA 3WTPD 1EQZD 3AZNC 4Z5TC 3LELD 1BH8A 3MVDD 3UTBB 3MGRA 4J8UA 1KX3D 5AVCB 3AZGB 3MGRB 4J8UB 5BO0A 3X1TD 3B0BA 3LZ1A 2Y2IA 2NQBD 5DNMD 4WZSB 5E5AB 5B2IA 1P3BA 2BG1A 4X23B 5E5AA 4Z5TB 5B2IB 4XZQB 3X1UB 3KUYA 3C1CA 3H0RC 3UT9D 3AZEA 3AV2C 3LZ1C 5JRGC 4J8VA 5GT3A 5GSUC 5E5AC 4J8XA 3C1BC 3AZHC 3X1SD 4J8WD 2PYOD 3AV2A 1P3IA 3MVDA 2YFVA 3KFUG 5B0YB 3LJAD 4YS3D 5AV8D 5AVBA 3RELB 3W98A 2XD1A 2Y2GA 2LY8A 2RVQC 3B6GA 4WNNA 5B31A 3AFAC 5B32A 4LD9B 3AZFC 5B31B 5AV6D 2PYOC 3AZKD 4QLCC 4KHAB 5CPJC 5GT3B 3REHA 4KHAA 2AROD 3UTBC 5AV5B 3MGQB 1ZLAB 4WU8B 3AN2B 1M1AC 1P3KA 5GT0B 1KX5B 4KUDD 5AVBB 3KXBC 1ID3C 4Z66B 4Z2MH 1P3GB 3MNND 3W98C 1N1JA 4NE6A 4XUJC 3AZMD 5B0ZD 3B6GC 3AZHD 1KX3A 3TU4C 5AV9B 3KXBA 4NFTA 3X1TA 2NZDD 3VH6T 1N1JB 5CPJD 1P34B 2JCHA 3WKJB 5B32B 4ZUXB 3H0LC 1H3OA 4G91B 3REIB 3KUYD 3AZEB 3WA9C 3AZGC 1Q9CA 3WKJA 4H9RA 3R45A 2NQBC 3F6TA 3REHB 1M19D 3AV1B 1B6WA 2CV5B 1KX4A 3WAAD 2F8ND 3MNNA 3A6NB 5B40B 5JA4A 1P3IB 2NZDC 5CP6B 1TZYD 3O62C 3LZ0B 1P3LC 4UUZB 4CAYA 3WTPC 3MGPB 3AZFD 3VH6A 3VH5W 3MNNC 3AZLB 3W98D 3C1BD 3AYWD 2IO5C 3MGSD 3AZID 5B2JB 2YFWB 3A6NC 3AFAD 1ID3D 3B6FA 5B33D 3O62A 4R8PB 3AZNB 5BNVA 1M18B 3KUYC 1HQ3B 4R8PC 3REJD 4LD9A 5JRGA 3EG5B 4H9NA 4QLCD 2BYMA 3WAAA 3AV1C 5B31G 3X1VD 5GXQB 3W99A 1KX4C 5AV5A 1M1AB 4WU9A 1HQ3C 4H9NB 4J8VB 1P3IC 3LZ0A 4HGAB 1KX3C 4H9OA 1JFIA 4HGAC 3AZJA 1F1EA 3WTPB 1EQZB 3AZJB 2Y2HA 3AYWA 4XUJB 3REKD 2YFWA 3LELB 1KX4B 1ID3A 3MVDB 3UTBD 4UPKA 3O62B 3AZNA 5AVCD 3AZHA 3MGRD 5B1MD 4J8UD 5B2JA 3AZGA 2NQBB 5DNMB 1BH8B 5B24C 5B32C 1U35D 4H9QB 5F99A 4Z66C 2J8PA 4E44A 4X23D 5BNXA 3MGPA 2F2AC 5DNND 5B2ID 4ZUXA 3X1TC 3X1UD 4XZQD 1P3PA 5G49B 5B2IC 4G91C 3TU4B 3P5JB 3MGQC 1ZLAC 1M18C 3W96B 4EO5C 3WKJC 3VH5T 4J8XD 3W97C 2CV5C 2PYOB 3LELA 2HUEB 1P3FA 2HIOC 4E45A 5CP6A 3AV2B 1P3GC 5B1LD 3EPHA 1P3FB 5CPIC 1P3AC 3REHC 5DNNC 5CPID 1P3AD 3W97A 2IO5B 4H9QA 5F99B 3LELC 2UWXA 5AVBC 1PZRA 3KXBB 3LZ1D 3X1VC 5G49A 3UTAA 1EQZC 5B1MC 5B0YC 4Z5TA 4LD9D 1P3PB 3B6FD 1WWSA 2AROA 1P34A 3AZKB 5GXQC 2NQBA 3AL0C 5GT3D 3EPLA 2F8NH 1P3LD 5AV5D 5FUGB 3AN2D 2HIOD 1W2EA 5BS7C
chains in the Genus database with same CATH topology
2FFFB 5GT0D 4WU9C 1KX5D 3B0CW 1TZYC 5AV8A 5AVBD 4KUDA 3WTPA 5FUGA 5AY8B 5B24A 2CWEA 4WNNB 3MNNB 5GT3C 4H9PA 3REKC 5B0ZB 3AZHB 5AV9D 5B33C 3B6GB 5B1MA 4G92C 3UTAB 1Z2CB 2NZDB 5B0YA 5AV6A 1B67A 4LD9C 4YS3A 1P34D 3WKJD 3WTPE 5B32D 1U35C 4WJ3C 5CPKB 5GSUB 3REID 3C1CD 3RELC 2VQRA 1M19A 3UT9A 2HUEC 2CV5A 1P3LA 3B0DC 2F8NA 2HIOA 5AV5C 3B6FC 4DQYB 5B40A 3W96A 4EO5B 1P3MD 3REHD 3A6ND 2PYOA 3VH5A 3VH6W 1R4VA 3AZMA 3AYWC 1P3ID 3B0DB 5B40C 2YFVB 5CP6D 1EQZA 3AV1A 3W99C 1TZYB 2JE5A 1P3FC 2NZDA 1P3KB 3AZLD 1P3KC 4KGCD 3REIA 1ID3B 4Z66A 4UUZA 4CAYB 5B33B 4R8PD 3REJC 2Y2PA 1AOIB 2G5HC 2FJ7B 1P3BD 1HQ3D 4JJNA 1M19C 3REJB 1F66B 4WU8C 1M18A 3X1VB 4H9OB 4YM6D 5GXQA 3V9RB 3KWQA 1M1AD 2Y2KA 3REKA 4WU9B 2Y2MA 3NQUB 1P3PC 3WA9A 1A7WA 5GT0A 1KX5A 3W99B 3AZKC 5AY8A 3AZJD 4XUJD 3REKB 5B24D 1P3BC 3AZJC 4AWLC 1KX4D 1U35A 3O62D 2ZY5A 3RELA 5B1MB 1P3OD 3B6FB 4G92B 5JRGD 1U35B 2BYMB 2AROC 5DNNB 1TAFA 4YS3C 1H3OB 2ZY4A 5F99C 2Y2JA 2F8NG 5C3IB 3TU4D 1S32C 3X1SA 3NQUA 4J8WA 3X1VA 5BNVB 3UTAC 3WA9D 1S32D 4JJNB 3R45B 3V9RA 3KWQB 3W96D 2Y2QA 3LJAA 4J8XB 4KGCC 4KUDC 3W97B 3AZLC 5AY8C 3AV2D 3WAAC 5B1LB 3IP4C 1P3FD 4H9SA 5CPIB 1P3AB 5AVCA 5CPIA 5F99D 1P3AA 3AZLA 1KX3B 5DNMC 3AZGD 5AV6C 3KXBD 4ZBJC 3LZ1B 3X1TB 2Y2LA 4ZBJB 1BFMA 1P3MC 4X23A 5E5AD 1F66A 1P3PD 4Z5TD 5BO0B 3UT9B 5GT0C 1KX5C 3W96C 5GSUA 1BH9B 4H9RB 1P34C 3LJAC 4Z2MG 1P3LB 3A1IA 2HIOB 2ZY2A 3X1SB 4J8WB 4NE5A 5B0ZA 5BS7A 3MGQA 1ZLAA 5AY8D 3A1KA 4YM6C 5B0YD 3LJAB 4YS3B 5AV8B 3REIC 3RELD 2Y2OA 5B0ZC 3B6GD 2Y2NA 3UTAD 3AZMC 5CP6C 1P3GA 4H9PB 2L5AA 2DF4C 5CPKD 5GSUD 5DNNA 4CSRA 4XZQA 3X1UA 3C1CB 2RVQD 5B31D 5AV6B 1AOIA 2FJ7A 3AN2A 5CPJA 5C3IC 1P3OC 3UT9C 1BH9A 1P3MB 4DRAA 2AROB 3MGQD 1ZLAD 4WU8D 3AZKA 5AV9C 3KSYA 4KUDB 3A6NA 1HTAA 5KDMB 3NQJB 4Z66D 4X23C 2G5IC 3KWQC 4R8PA 1P3GD 1P3KD 3AZMB 5AV9A 3FDDA 4KGCB 5BT1C 1TZYA 5AV8C 5AVCC 3NQJA 3B0CT 4QLCA 1AOID 2FJ7D 1P3BB 5CPJB 1KU5A 1F66D 1TAFB 4ZUXD 3REJA 2FJ7C 3AN2C 4J8WC 3KUYB 3X1SC 3AZED 5B33A 2ZM5A 4WU8A 2W8SA 5CHLB 4YM6B 3H0MC 3EPJA 3EPKA 1T3UA 1M19B 4XUJA 3AV1D 4WU9D 3C1CC 2CV5D 2ZY3A 3WAAB 3UTBA 3W99D 2F8NB 5B2JC 5B40D 4J8VC 5B1LA 2JSSA 5B24B 3MGPC 3LZ0D 2BYKB 5B32G 4ZUXC 3MGPD 4AWLB 5CPKC 1JFIB 3AZFB 3C1BA 4KGCA 3MGSC 3AZIC 3W98B 1AOIC 2DQNC 3C1BB 3AYWB 3AFAA 3MVDC 2XD5A 3MGSB 5B2JD 3AZIB 5B1LC 1P3OB 5JRGB 3TU4A 3AFAB 2BYKA 1P3OA 1F66C 3AZND 1M18D 4DRBA 1WWIA 4H9SC 3AZFA 5CPKA 5BNXB 4CSRB 3MGSA 3AZIA 5DNMA 4XZQC 3X1UC 5B31C 4QLCB 3AZEC 3WA9B 1S32B 1HQ3A 4JJND 4NE3A 5GXQD 3KWQD 1P3MA 1M1AA 1S32A 3LZ0C 4JJNC 2F8NK 1ULYA 4WV4B 4J8VD 2RIQA 3MGRC 4J8XC 4J8UC 3W97D 4M6BA 5JA4B 4YM6A 5BT1D 5KDMA 3WTPD 1EQZD 3AZNC 4Z5TC 3LELD 1BH8A 3MVDD 3UTBB 3MGRA 4J8UA 1KX3D 5AVCB 3AZGB 3MGRB 4J8UB 5BO0A 3X1TD 3B0BA 3LZ1A 2Y2IA 2NQBD 5DNMD 4WZSB 5E5AB 5B2IA 1P3BA 2BG1A 4X23B 5E5AA 4Z5TB 5B2IB 4XZQB 3X1UB 3KUYA 3C1CA 3H0RC 3UT9D 3AZEA 3AV2C 3LZ1C 5JRGC 4J8VA 5GT3A 5GSUC 5E5AC 4J8XA 3C1BC 3AZHC 3X1SD 4J8WD 2PYOD 3AV2A 1P3IA 3MVDA 2YFVA 3KFUG 5B0YB 3LJAD 4YS3D 5AV8D 5AVBA 3RELB 3W98A 2XD1A 2Y2GA 2LY8A 2RVQC 3B6GA 4WNNA 5B31A 3AFAC 5B32A 4LD9B 3AZFC 5B31B 5AV6D 2PYOC 3AZKD 4QLCC 4KHAB 5CPJC 5GT3B 3REHA 4KHAA 2AROD 3UTBC 5AV5B 3MGQB 1ZLAB 4WU8B 3AN2B 1M1AC 1P3KA 5GT0B 1KX5B 4KUDD 5AVBB 3KXBC 1ID3C 4Z66B 4Z2MH 1P3GB 3MNND 3W98C 1N1JA 4NE6A 4XUJC 3AZMD 5B0ZD 3B6GC 3AZHD 1KX3A 3TU4C 5AV9B 3KXBA 4NFTA 3X1TA 2NZDD 3VH6T 1N1JB 5CPJD 1P34B 2JCHA 3WKJB 5B32B 4ZUXB 3H0LC 1H3OA 4G91B 3REIB 3KUYD 3AZEB 3WA9C 3AZGC 1Q9CA 3WKJA 4H9RA 3R45A 2NQBC 3F6TA 3REHB 1M19D 3AV1B 1B6WA 2CV5B 1KX4A 3WAAD 2F8ND 3MNNA 3A6NB 5B40B 5JA4A 1P3IB 2NZDC 5CP6B 1TZYD 3O62C 3LZ0B 1P3LC 4UUZB 4CAYA 3WTPC 3MGPB 3AZFD 3VH6A 3VH5W 3MNNC 3AZLB 3W98D 3C1BD 3AYWD 2IO5C 3MGSD 3AZID 5B2JB 2YFWB 3A6NC 3AFAD 1ID3D 3B6FA 5B33D 3O62A 4R8PB 3AZNB 5BNVA 1M18B 3KUYC 1HQ3B 4R8PC 3REJD 4LD9A 5JRGA 3EG5B 4H9NA 4QLCD 2BYMA 3WAAA 3AV1C 5B31G 3X1VD 5GXQB 3W99A 1KX4C 5AV5A 1M1AB 4WU9A 1HQ3C 4H9NB 4J8VB 1P3IC 3LZ0A 4HGAB 1KX3C 4H9OA 1JFIA 4HGAC 3AZJA 1F1EA 3WTPB 1EQZB 3AZJB 2Y2HA 3AYWA 4XUJB 3REKD 2YFWA 3LELB 1KX4B 1ID3A 3MVDB 3UTBD 4UPKA 3O62B 3AZNA 5AVCD 3AZHA 3MGRD 5B1MD 4J8UD 5B2JA 3AZGA 2NQBB 5DNMB 1BH8B 5B24C 5B32C 1U35D 4H9QB 5F99A 4Z66C 2J8PA 4E44A 4X23D 5BNXA 3MGPA 2F2AC 5DNND 5B2ID 4ZUXA 3X1TC 3X1UD 4XZQD 1P3PA 5G49B 5B2IC 4G91C 3TU4B 3P5JB 3MGQC 1ZLAC 1M18C 3W96B 4EO5C 3WKJC 3VH5T 4J8XD 3W97C 2CV5C 2PYOB 3LELA 2HUEB 1P3FA 2HIOC 4E45A 5CP6A 3AV2B 1P3GC 5B1LD 3EPHA 1P3FB 5CPIC 1P3AC 3REHC 5DNNC 5CPID 1P3AD 3W97A 2IO5B 4H9QA 5F99B 3LELC 2UWXA 5AVBC 1PZRA 3KXBB 3LZ1D 3X1VC 5G49A 3UTAA 1EQZC 5B1MC 5B0YC 4Z5TA 4LD9D 1P3PB 3B6FD 1WWSA 2AROA 1P34A 3AZKB 5GXQC 2NQBA 3AL0C 5GT3D 3EPLA 2F8NH 1P3LD 5AV5D 5FUGB 3AN2D 2HIOD 1W2EA 5BS7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 D;  1KX5 D;  4WU9 C;  3B0C W;  1TZY C;  5AV8 A;  5AVB D;  4KUD A;  3WTP A;  5FUG A;  5AY8 B;  5B24 A;  2CWE A;  4WNN B;  3MNN B;  5GT3 C;  4H9P A;  3REK C;  5B0Z B;  3AZH B;  5AV9 D;  5B33 C;  3B6G B;  5B1M A;  4G92 C;  3UTA B;  2NZD B;  5B0Y A;  5AV6 A;  1B67 A;  4LD9 C;  4YS3 A;  1P34 D;  3WKJ D;  3WTP E;  5B32 D;  1U35 C;  5CPK B;  5GSU B;  3REI D;  3C1C D;  3REL C;  1M19 A;  3UT9 A;  2HUE C;  2CV5 A;  1P3L A;  3B0D C;  2F8N A;  2HIO A;  5AV5 C;  3B6F C;  5B40 A;  3W96 A;  4EO5 B;  1P3M D;  3REH D;  3A6N D;  2PYO A;  3VH5 A;  3VH6 W;  1R4V A;  3AZM A;  3AYW C;  1P3I D;  3B0D B;  5B40 C;  2YFV B;  5CP6 D;  1EQZ A;  3AV1 A;  3W99 C;  1TZY B;  1P3F C;  2NZD A;  1P3K B;  3AZL D;  1P3K C;  4KGC D;  3REI A;  1ID3 B;  4Z66 A;  4UUZ A;  4CAY B;  5B33 B;  4R8P D;  3REJ C;  1AOI B;  2FJ7 B;  1P3B D;  1HQ3 D;  4JJN A;  1M19 C;  3REJ B;  1F66 B;  4WU8 C;  1M18 A;  3X1V B;  4H9O B;  4YM6 D;  5GXQ A;  3V9R B;  3KWQ A;  1M1A D;  3REK A;  4WU9 B;  3NQU B;  1P3P C;  3WA9 A;  1A7W A;  5GT0 A;  1KX5 A;  3W99 B;  3AZK C;  5AY8 A;  3AZJ D;  4XUJ D;  3REK B;  5B24 D;  1P3B C;  3AZJ C;  4AWL C;  1KX4 D;  1U35 A;  3O62 D;  3REL A;  5B1M B;  1P3O D;  3B6F B;  4G92 B;  5JRG D;  1U35 B;  2BYM B;  2ARO C;  5DNN B;  1TAF A;  4YS3 C;  1H3O B;  5F99 C;  2F8N G;  5C3I B;  3TU4 D;  1S32 C;  3X1S A;  3NQU A;  4J8W A;  3X1V A;  5BNV B;  3UTA C;  3WA9 D;  1S32 D;  4JJN B;  3R45 B;  3V9R A;  3KWQ B;  3W96 D;  3LJA A;  4J8X B;  4KGC C;  4KUD C;  3W97 B;  3AZL C;  5AY8 C;  3AV2 D;  3WAA C;  5B1L B;  1P3F D;  4H9S A;  5CPI B;  1P3A B;  5AVC A;  5CPI A;  5F99 D;  1P3A A;  3AZL A;  1KX3 B;  5DNM C;  3AZG D;  5AV6 C;  3KXB D;  4ZBJ C;  3LZ1 B;  3X1T B;  4ZBJ B;  1BFM A;  1P3M C;  4X23 A;  5E5A D;  1F66 A;  1P3P D;  4Z5T D;  5BO0 B;  3UT9 B;  5GT0 C;  1KX5 C;  3W96 C;  5GSU A;  1BH9 B;  4H9R B;  1P34 C;  3LJA C;  4Z2M G;  1P3L B;  2HIO B;  3X1S B;  4J8W B;  4NE5 A;  5B0Z A;  5BS7 A;  3MGQ A;  1ZLA A;  5AY8 D;  4YM6 C;  5B0Y D;  3LJA B;  4YS3 B;  5AV8 B;  3REI C;  3REL D;  5B0Z C;  3B6G D;  3UTA D;  3AZM C;  5CP6 C;  1P3G A;  4H9P B;  2L5A A;  5CPK D;  5GSU D;  5DNN A;  4CSR A;  4XZQ A;  3X1U A;  3C1C B;  2RVQ D;  5B31 D;  5AV6 B;  1AOI A;  2FJ7 A;  3AN2 A;  5CPJ A;  5C3I C;  1P3O C;  3UT9 C;  1BH9 A;  1P3M B;  4DRA A;  2ARO B;  3MGQ D;  1ZLA D;  4WU8 D;  3AZK A;  5AV9 C;  3KSY A;  4KUD B;  3A6N A;  1HTA A;  5KDM B;  3NQJ B;  4Z66 D;  4X23 C;  3KWQ C;  4R8P A;  1P3G D;  1P3K D;  3AZM B;  5AV9 A;  4KGC B;  5BT1 C;  1TZY A;  5AV8 C;  5AVC C;  3NQJ A;  3B0C T;  4QLC A;  1AOI D;  2FJ7 D;  1P3B B;  5CPJ B;  1KU5 A;  1F66 D;  1TAF B;  4ZUX D;  3REJ A;  3AN2 C;  4J8W C;  3KUY B;  3X1S C;  3AZE D;  5B33 A;  4WU8 A;  5CHL B;  4YM6 B;  1M19 B;  4XUJ A;  3AV1 D;  4WU9 D;  3C1C C;  2CV5 D;  3WAA B;  3UTB A;  3W99 D;  2F8N B;  5B2J C;  5B40 D;  4J8V C;  5B1L A;  2JSS A;  5B24 B;  3MGP C;  3LZ0 D;  2BYK B;  5B32 G;  4ZUX C;  3MGP D;  4AWL B;  5CPK C;  1JFI B;  3AZF B;  3C1B A;  4KGC A;  3MGS C;  3AZI C;  3W98 B;  1AOI C;  3C1B B;  2FJ7 C;  3AYW B;  3AFA A;  3MVD C;  3MGS B;  3AZI B;  5B2J D;  1P3O B;  5B1L C;  3B6F D;  5JRG B;  3TU4 A;  3AFA B;  2BYK A;  1P3O A;  1F66 C;  3AZN D;  1M18 D;  4DRB A;  1WWI A;  4H9S C;  3AZF A;  5CPK A;  5BNX B;  4CSR B;  3MGS A;  3AZI A;  5DNM A;  4XZQ C;  3X1U C;  5B31 C;  4QLC B;  3AZE C;  3WA9 B;  1S32 B;  1HQ3 A;  4JJN D;  4NE3 A;  5GXQ D;  3KWQ D;  1P3M A;  1M1A A;  1S32 A;  3LZ0 C;  4JJN C;  2F8N K;  1ULY A;  4WV4 B;  4J8V D;  3MGR C;  4J8X C;  4J8U C;  3W97 D;  4M6B A;  5JA4 B;  4YM6 A;  5BT1 D;  5KDM A;  3WTP D;  1EQZ D;  3AZN C;  4Z5T C;  3LEL D;  1BH8 A;  3MVD D;  3UTB B;  3MGR A;  4J8U A;  1KX3 D;  5AVC B;  3AZG B;  3MGR B;  4J8U B;  5BO0 A;  3X1T D;  3B0B A;  3LZ1 A;  2NQB D;  5DNM D;  4WZS B;  5E5A B;  5B2I A;  1P3B A;  4X23 B;  5E5A A;  4Z5T B;  5B2I B;  4XZQ B;  3X1U B;  3KUY A;  3C1C A;  3UT9 D;  3AZE A;  3AV2 C;  3LZ1 C;  5JRG C;  4J8V A;  5GT3 A;  5GSU C;  5E5A C;  4J8X A;  3C1B C;  3AZH C;  3X1S D;  4J8W D;  2PYO D;  3AV2 A;  1P3I A;  3MVD A;  2YFV A;  5B0Y B;  3LJA D;  4YS3 D;  5AV8 D;  5AVB A;  3REL B;  3W98 A;  2LY8 A;  2RVQ C;  3B6G A;  4WNN A;  5B31 A;  3AFA C;  5B32 A;  4LD9 B;  3AZF C;  5B31 B;  5AV6 D;  2PYO C;  3AZK D;  4QLC C;  4KHA B;  5CPJ C;  5GT3 B;  3REH A;  4KHA A;  2ARO D;  3UTB C;  5AV5 B;  3MGQ B;  1ZLA B;  4WU8 B;  3AN2 B;  1M1A C;  1P3K A;  5GT0 B;  1KX5 B;  4KUD D;  5AVB B;  3KXB C;  1ID3 C;  4Z66 B;  4Z2M H;  1P3G B;  3MNN D;  3W98 C;  1N1J A;  4NE6 A;  4XUJ C;  3AZM D;  5B0Z D;  3B6G C;  3AZH D;  1KX3 A;  3TU4 C;  5AV9 B;  3KXB A;  4NFT A;  3X1T A;  2NZD D;  3VH6 T;  1N1J B;  5CPJ D;  1P34 B;  3WKJ B;  5B32 B;  4ZUX B;  1H3O A;  4G91 B;  3REI B;  3KUY D;  3AZE B;  3WA9 C;  3AZG C;  1Q9C A;  3WKJ A;  4H9R A;  3R45 A;  2NQB C;  3REH B;  1M19 D;  3AV1 B;  1B6W A;  2CV5 B;  1KX4 A;  3WAA D;  2F8N D;  3MNN A;  3A6N B;  5B40 B;  5JA4 A;  1P3I B;  2NZD C;  5CP6 B;  1TZY D;  3O62 C;  3LZ0 B;  4UUZ B;  4CAY A;  3WTP C;  3MGP B;  3AZF D;  3VH6 A;  3VH5 W;  3MNN C;  3AZL B;  3W98 D;  3C1B D;  3AYW D;  2IO5 C;  3MGS D;  3AZI D;  5B2J B;  2YFW B;  3A6N C;  3AFA D;  1ID3 D;  3B6F A;  5B33 D;  3O62 A;  4R8P B;  3AZN B;  5BNV A;  1M18 B;  3KUY C;  1HQ3 B;  4R8P C;  3REJ D;  4LD9 A;  5JRG A;  4H9N A;  4QLC D;  2BYM A;  3WAA A;  3AV1 C;  5B31 G;  3X1V D;  5GXQ B;  3W99 A;  1KX4 C;  5AV5 A;  1M1A B;  4WU9 A;  1HQ3 C;  4H9N B;  4J8V B;  1P3I C;  3LZ0 A;  4HGA B;  1KX3 C;  4H9O A;  1JFI A;  4HGA C;  3AZJ A;  1F1E A;  3WTP B;  1EQZ B;  3AZJ B;  3AYW A;  4XUJ B;  3REK D;  2YFW A;  3LEL B;  1KX4 B;  1ID3 A;  3MVD B;  3UTB D;  3O62 B;  3AZN A;  5AVC D;  3AZH A;  3MGR D;  5B1M D;  4J8U D;  5B2J A;  3AZG A;  2NQB B;  5DNM B;  1BH8 B;  5B24 C;  5B32 C;  1U35 D;  4H9Q B;  5F99 A;  4X23 D;  4Z66 C;  4E44 A;  3MGP A;  5BNX A;  3X1T C;  5B2I D;  5DNN D;  1P3L C;  4ZUX A;  3X1U D;  4XZQ D;  1P3P A;  5G49 B;  5B2I C;  4G91 C;  3TU4 B;  3MGQ C;  1ZLA C;  1M18 C;  3W96 B;  4EO5 C;  3WKJ C;  3VH5 T;  4J8X D;  3W97 C;  2CV5 C;  2PYO B;  3LEL A;  2HUE B;  1P3F A;  2HIO C;  4E45 A;  5CP6 A;  3AV2 B;  1P3G C;  5B1L D;  1P3F B;  5CPI C;  1P3A C;  3REH C;  5DNN C;  5CPI D;  1P3A D;  3W97 A;  2IO5 B;  4H9Q A;  5F99 B;  3LEL C;  5AVB C;  3KXB B;  3LZ1 D;  3X1V C;  5G49 A;  3UTA A;  1EQZ C;  5B1M C;  5B0Y C;  4Z5T A;  4LD9 D;  1P3P B;  1WWS A;  2ARO A;  1P34 A;  3AZK B;  5GXQ C;  2NQB A;  5GT3 D;  2F8N H;  1P3L D;  5AV5 D;  5FUG B;  3AN2 D;  2HIO D;  5BS7 C; 
#chains in the Genus database with same CATH topology
 2FFF B;  5GT0 D;  4WU9 C;  1KX5 D;  3B0C W;  1TZY C;  5AV8 A;  5AVB D;  4KUD A;  3WTP A;  5FUG A;  5AY8 B;  5B24 A;  2CWE A;  4WNN B;  3MNN B;  5GT3 C;  4H9P A;  3REK C;  5B0Z B;  3AZH B;  5AV9 D;  5B33 C;  3B6G B;  5B1M A;  4G92 C;  3UTA B;  1Z2C B;  2NZD B;  5B0Y A;  5AV6 A;  1B67 A;  4LD9 C;  4YS3 A;  1P34 D;  3WKJ D;  3WTP E;  5B32 D;  1U35 C;  4WJ3 C;  5CPK B;  5GSU B;  3REI D;  3C1C D;  3REL C;  2VQR A;  1M19 A;  3UT9 A;  2HUE C;  2CV5 A;  1P3L A;  3B0D C;  2F8N A;  2HIO A;  5AV5 C;  3B6F C;  4DQY B;  5B40 A;  3W96 A;  4EO5 B;  1P3M D;  3REH D;  3A6N D;  2PYO A;  3VH5 A;  3VH6 W;  1R4V A;  3AZM A;  3AYW C;  1P3I D;  3B0D B;  5B40 C;  2YFV B;  5CP6 D;  1EQZ A;  3AV1 A;  3W99 C;  1TZY B;  2JE5 A;  1P3F C;  2NZD A;  1P3K B;  3AZL D;  1P3K C;  4KGC D;  3REI A;  1ID3 B;  4Z66 A;  4UUZ A;  4CAY B;  5B33 B;  4R8P D;  3REJ C;  2Y2P A;  1AOI B;  2G5H C;  2FJ7 B;  1P3B D;  1HQ3 D;  4JJN A;  1M19 C;  3REJ B;  1F66 B;  4WU8 C;  1M18 A;  3X1V B;  4H9O B;  4YM6 D;  5GXQ A;  3V9R B;  3KWQ A;  1M1A D;  2Y2K A;  3REK A;  4WU9 B;  2Y2M A;  3NQU B;  1P3P C;  3WA9 A;  1A7W A;  5GT0 A;  1KX5 A;  3W99 B;  3AZK C;  5AY8 A;  3AZJ D;  4XUJ D;  3REK B;  5B24 D;  1P3B C;  3AZJ C;  4AWL C;  1KX4 D;  1U35 A;  3O62 D;  2ZY5 A;  3REL A;  5B1M B;  1P3O D;  3B6F B;  4G92 B;  5JRG D;  1U35 B;  2BYM B;  2ARO C;  5DNN B;  1TAF A;  4YS3 C;  1H3O B;  2ZY4 A;  5F99 C;  2Y2J A;  2F8N G;  5C3I B;  3TU4 D;  1S32 C;  3X1S A;  3NQU A;  4J8W A;  3X1V A;  5BNV B;  3UTA C;  3WA9 D;  1S32 D;  4JJN B;  3R45 B;  3V9R A;  3KWQ B;  3W96 D;  2Y2Q A;  3LJA A;  4J8X B;  4KGC C;  4KUD C;  3W97 B;  3AZL C;  5AY8 C;  3AV2 D;  3WAA C;  5B1L B;  3IP4 C;  1P3F D;  4H9S A;  5CPI B;  1P3A B;  5AVC A;  5CPI A;  5F99 D;  1P3A A;  3AZL A;  1KX3 B;  5DNM C;  3AZG D;  5AV6 C;  3KXB D;  4ZBJ C;  3LZ1 B;  3X1T B;  2Y2L A;  4ZBJ B;  1BFM A;  1P3M C;  4X23 A;  5E5A D;  1F66 A;  1P3P D;  4Z5T D;  5BO0 B;  3UT9 B;  5GT0 C;  1KX5 C;  3W96 C;  5GSU A;  1BH9 B;  4H9R B;  1P34 C;  3LJA C;  4Z2M G;  1P3L B;  3A1I A;  2HIO B;  2ZY2 A;  3X1S B;  4J8W B;  4NE5 A;  5B0Z A;  5BS7 A;  3MGQ A;  1ZLA A;  5AY8 D;  3A1K A;  4YM6 C;  5B0Y D;  3LJA B;  4YS3 B;  5AV8 B;  3REI C;  3REL D;  2Y2O A;  5B0Z C;  3B6G D;  2Y2N A;  3UTA D;  3AZM C;  5CP6 C;  1P3G A;  4H9P B;  2L5A A;  2DF4 C;  5CPK D;  5GSU D;  5DNN A;  4CSR A;  4XZQ A;  3X1U A;  3C1C B;  2RVQ D;  5B31 D;  5AV6 B;  1AOI A;  2FJ7 A;  3AN2 A;  5CPJ A;  5C3I C;  1P3O C;  3UT9 C;  1BH9 A;  1P3M B;  4DRA A;  2ARO B;  3MGQ D;  1ZLA D;  4WU8 D;  3AZK A;  5AV9 C;  3KSY A;  4KUD B;  3A6N A;  1HTA A;  5KDM B;  3NQJ B;  4Z66 D;  4X23 C;  2G5I C;  3KWQ C;  4R8P A;  1P3G D;  1P3K D;  3AZM B;  5AV9 A;  3FDD A;  4KGC B;  5BT1 C;  1TZY A;  5AV8 C;  5AVC C;  3NQJ A;  3B0C T;  4QLC A;  1AOI D;  2FJ7 D;  1P3B B;  5CPJ B;  1KU5 A;  1F66 D;  1TAF B;  4ZUX D;  3REJ A;  2FJ7 C;  3AN2 C;  4J8W C;  3KUY B;  3X1S C;  3AZE D;  5B33 A;  2ZM5 A;  4WU8 A;  2W8S A;  5CHL B;  4YM6 B;  3H0M C;  3EPJ A;  3EPK A;  1T3U A;  1M19 B;  4XUJ A;  3AV1 D;  4WU9 D;  3C1C C;  2CV5 D;  2ZY3 A;  3WAA B;  3UTB A;  3W99 D;  2F8N B;  5B2J C;  5B40 D;  4J8V C;  5B1L A;  2JSS A;  5B24 B;  3MGP C;  3LZ0 D;  2BYK B;  5B32 G;  4ZUX C;  3MGP D;  4AWL B;  5CPK C;  1JFI B;  3AZF B;  3C1B A;  4KGC A;  3MGS C;  3AZI C;  3W98 B;  1AOI C;  2DQN C;  3C1B B;  3AYW B;  3AFA A;  3MVD C;  2XD5 A;  3MGS B;  5B2J D;  3AZI B;  5B1L C;  1P3O B;  5JRG B;  3TU4 A;  3AFA B;  2BYK A;  1P3O A;  1F66 C;  3AZN D;  1M18 D;  4DRB A;  1WWI A;  4H9S C;  3AZF A;  5CPK A;  5BNX B;  4CSR B;  3MGS A;  3AZI A;  5DNM A;  4XZQ C;  3X1U C;  5B31 C;  4QLC B;  3AZE C;  3WA9 B;  1S32 B;  1HQ3 A;  4JJN D;  4NE3 A;  5GXQ D;  3KWQ D;  1P3M A;  1M1A A;  1S32 A;  3LZ0 C;  4JJN C;  2F8N K;  1ULY A;  4WV4 B;  4J8V D;  2RIQ A;  3MGR C;  4J8X C;  4J8U C;  3W97 D;  4M6B A;  5JA4 B;  4YM6 A;  5BT1 D;  5KDM A;  3WTP D;  1EQZ D;  3AZN C;  4Z5T C;  3LEL D;  1BH8 A;  3MVD D;  3UTB B;  3MGR A;  4J8U A;  1KX3 D;  5AVC B;  3AZG B;  3MGR B;  4J8U B;  5BO0 A;  3X1T D;  3B0B A;  3LZ1 A;  2Y2I A;  2NQB D;  5DNM D;  4WZS B;  5E5A B;  5B2I A;  1P3B A;  2BG1 A;  4X23 B;  5E5A A;  4Z5T B;  5B2I B;  4XZQ B;  3X1U B;  3KUY A;  3C1C A;  3H0R C;  3UT9 D;  3AZE A;  3AV2 C;  3LZ1 C;  5JRG C;  4J8V A;  5GT3 A;  5GSU C;  5E5A C;  4J8X A;  3C1B C;  3AZH C;  3X1S D;  4J8W D;  2PYO D;  3AV2 A;  1P3I A;  3MVD A;  2YFV A;  3KFU G;  5B0Y B;  3LJA D;  4YS3 D;  5AV8 D;  5AVB A;  3REL B;  3W98 A;  2XD1 A;  2Y2G A;  2LY8 A;  2RVQ C;  3B6G A;  4WNN A;  5B31 A;  3AFA C;  5B32 A;  4LD9 B;  3AZF C;  5B31 B;  5AV6 D;  2PYO C;  3AZK D;  4QLC C;  4KHA B;  5CPJ C;  5GT3 B;  3REH A;  4KHA A;  2ARO D;  3UTB C;  5AV5 B;  3MGQ B;  1ZLA B;  4WU8 B;  3AN2 B;  1M1A C;  1P3K A;  5GT0 B;  1KX5 B;  4KUD D;  5AVB B;  3KXB C;  1ID3 C;  4Z66 B;  4Z2M H;  1P3G B;  3MNN D;  3W98 C;  1N1J A;  4NE6 A;  4XUJ C;  3AZM D;  5B0Z D;  3B6G C;  3AZH D;  1KX3 A;  3TU4 C;  5AV9 B;  3KXB A;  4NFT A;  3X1T A;  2NZD D;  3VH6 T;  1N1J B;  5CPJ D;  1P34 B;  2JCH A;  3WKJ B;  5B32 B;  4ZUX B;  3H0L C;  1H3O A;  4G91 B;  3REI B;  3KUY D;  3AZE B;  3WA9 C;  3AZG C;  1Q9C A;  3WKJ A;  4H9R A;  3R45 A;  2NQB C;  3F6T A;  3REH B;  1M19 D;  3AV1 B;  1B6W A;  2CV5 B;  1KX4 A;  3WAA D;  2F8N D;  3MNN A;  3A6N B;  5B40 B;  5JA4 A;  1P3I B;  2NZD C;  5CP6 B;  1TZY D;  3O62 C;  3LZ0 B;  1P3L C;  4UUZ B;  4CAY A;  3WTP C;  3MGP B;  3AZF D;  3VH6 A;  3VH5 W;  3MNN C;  3AZL B;  3W98 D;  3C1B D;  3AYW D;  2IO5 C;  3MGS D;  3AZI D;  5B2J B;  2YFW B;  3A6N C;  3AFA D;  1ID3 D;  3B6F A;  5B33 D;  3O62 A;  4R8P B;  3AZN B;  5BNV A;  1M18 B;  3KUY C;  1HQ3 B;  4R8P C;  3REJ D;  4LD9 A;  5JRG A;  3EG5 B;  4H9N A;  4QLC D;  2BYM A;  3WAA A;  3AV1 C;  5B31 G;  3X1V D;  5GXQ B;  3W99 A;  1KX4 C;  5AV5 A;  1M1A B;  4WU9 A;  1HQ3 C;  4H9N B;  4J8V B;  1P3I C;  3LZ0 A;  4HGA B;  1KX3 C;  4H9O A;  1JFI A;  4HGA C;  3AZJ A;  1F1E A;  3WTP B;  1EQZ B;  3AZJ B;  2Y2H A;  3AYW A;  4XUJ B;  3REK D;  2YFW A;  3LEL B;  1KX4 B;  1ID3 A;  3MVD B;  3UTB D;  4UPK A;  3O62 B;  3AZN A;  5AVC D;  3AZH A;  3MGR D;  5B1M D;  4J8U D;  5B2J A;  3AZG A;  2NQB B;  5DNM B;  1BH8 B;  5B24 C;  5B32 C;  1U35 D;  4H9Q B;  5F99 A;  4Z66 C;  2J8P A;  4E44 A;  4X23 D;  5BNX A;  3MGP A;  2F2A C;  5DNN D;  5B2I D;  4ZUX A;  3X1T C;  3X1U D;  4XZQ D;  1P3P A;  5G49 B;  5B2I C;  4G91 C;  3TU4 B;  3P5J B;  3MGQ C;  1ZLA C;  1M18 C;  3W96 B;  4EO5 C;  3WKJ C;  3VH5 T;  4J8X D;  3W97 C;  2CV5 C;  2PYO B;  3LEL A;  2HUE B;  1P3F A;  2HIO C;  4E45 A;  5CP6 A;  3AV2 B;  1P3G C;  5B1L D;  3EPH A;  1P3F B;  5CPI C;  1P3A C;  3REH C;  5DNN C;  5CPI D;  1P3A D;  3W97 A;  2IO5 B;  4H9Q A;  5F99 B;  3LEL C;  2UWX A;  5AVB C;  1PZR A;  3KXB B;  3LZ1 D;  3X1V C;  5G49 A;  3UTA A;  1EQZ C;  5B1M C;  5B0Y C;  4Z5T A;  4LD9 D;  1P3P B;  3B6F D;  1WWS A;  2ARO A;  1P34 A;  3AZK B;  5GXQ C;  2NQB A;  3AL0 C;  5GT3 D;  3EPL A;  2F8N H;  1P3L D;  5AV5 D;  5FUG B;  3AN2 D;  2HIO D;  1W2E A;  5BS7 C; 
#chains in the Genus database with same CATH homology
 2FFF B;  5GT0 D;  4WU9 C;  1KX5 D;  3B0C W;  1TZY C;  5AV8 A;  5AVB D;  4KUD A;  3WTP A;  5FUG A;  5AY8 B;  5B24 A;  2CWE A;  4WNN B;  3MNN B;  5GT3 C;  4H9P A;  3REK C;  5B0Z B;  3AZH B;  5AV9 D;  5B33 C;  3B6G B;  5B1M A;  4G92 C;  3UTA B;  1Z2C B;  2NZD B;  5B0Y A;  5AV6 A;  1B67 A;  4LD9 C;  4YS3 A;  1P34 D;  3WKJ D;  3WTP E;  5B32 D;  1U35 C;  4WJ3 C;  5CPK B;  5GSU B;  3REI D;  3C1C D;  3REL C;  2VQR A;  1M19 A;  3UT9 A;  2HUE C;  2CV5 A;  1P3L A;  3B0D C;  2F8N A;  2HIO A;  5AV5 C;  3B6F C;  4DQY B;  5B40 A;  3W96 A;  4EO5 B;  1P3M D;  3REH D;  3A6N D;  2PYO A;  3VH5 A;  3VH6 W;  1R4V A;  3AZM A;  3AYW C;  1P3I D;  3B0D B;  5B40 C;  2YFV B;  5CP6 D;  1EQZ A;  3AV1 A;  3W99 C;  1TZY B;  2JE5 A;  1P3F C;  2NZD A;  1P3K B;  3AZL D;  1P3K C;  4KGC D;  3REI A;  1ID3 B;  4Z66 A;  4UUZ A;  4CAY B;  5B33 B;  4R8P D;  3REJ C;  2Y2P A;  1AOI B;  2G5H C;  2FJ7 B;  1P3B D;  1HQ3 D;  4JJN A;  1M19 C;  3REJ B;  1F66 B;  4WU8 C;  1M18 A;  3X1V B;  4H9O B;  4YM6 D;  5GXQ A;  3V9R B;  3KWQ A;  1M1A D;  2Y2K A;  3REK A;  4WU9 B;  2Y2M A;  3NQU B;  1P3P C;  3WA9 A;  1A7W A;  5GT0 A;  1KX5 A;  3W99 B;  3AZK C;  5AY8 A;  3AZJ D;  4XUJ D;  3REK B;  5B24 D;  1P3B C;  3AZJ C;  4AWL C;  1KX4 D;  1U35 A;  3O62 D;  2ZY5 A;  3REL A;  5B1M B;  1P3O D;  3B6F B;  4G92 B;  5JRG D;  1U35 B;  2BYM B;  2ARO C;  5DNN B;  1TAF A;  4YS3 C;  1H3O B;  2ZY4 A;  5F99 C;  2Y2J A;  2F8N G;  5C3I B;  3TU4 D;  1S32 C;  3X1S A;  3NQU A;  4J8W A;  3X1V A;  5BNV B;  3UTA C;  3WA9 D;  1S32 D;  4JJN B;  3R45 B;  3V9R A;  3KWQ B;  3W96 D;  2Y2Q A;  3LJA A;  4J8X B;  4KGC C;  4KUD C;  3W97 B;  3AZL C;  5AY8 C;  3AV2 D;  3WAA C;  5B1L B;  3IP4 C;  1P3F D;  4H9S A;  5CPI B;  1P3A B;  5AVC A;  5CPI A;  5F99 D;  1P3A A;  3AZL A;  1KX3 B;  5DNM C;  3AZG D;  5AV6 C;  3KXB D;  4ZBJ C;  3LZ1 B;  3X1T B;  2Y2L A;  4ZBJ B;  1BFM A;  1P3M C;  4X23 A;  5E5A D;  1F66 A;  1P3P D;  4Z5T D;  5BO0 B;  3UT9 B;  5GT0 C;  1KX5 C;  3W96 C;  5GSU A;  1BH9 B;  4H9R B;  1P34 C;  3LJA C;  4Z2M G;  1P3L B;  3A1I A;  2HIO B;  2ZY2 A;  3X1S B;  4J8W B;  4NE5 A;  5B0Z A;  5BS7 A;  3MGQ A;  1ZLA A;  5AY8 D;  3A1K A;  4YM6 C;  5B0Y D;  3LJA B;  4YS3 B;  5AV8 B;  3REI C;  3REL D;  2Y2O A;  5B0Z C;  3B6G D;  2Y2N A;  3UTA D;  3AZM C;  5CP6 C;  1P3G A;  4H9P B;  2L5A A;  2DF4 C;  5CPK D;  5GSU D;  5DNN A;  4CSR A;  4XZQ A;  3X1U A;  3C1C B;  2RVQ D;  5B31 D;  5AV6 B;  1AOI A;  2FJ7 A;  3AN2 A;  5CPJ A;  5C3I C;  1P3O C;  3UT9 C;  1BH9 A;  1P3M B;  4DRA A;  2ARO B;  3MGQ D;  1ZLA D;  4WU8 D;  3AZK A;  5AV9 C;  3KSY A;  4KUD B;  3A6N A;  1HTA A;  5KDM B;  3NQJ B;  4Z66 D;  4X23 C;  2G5I C;  3KWQ C;  4R8P A;  1P3G D;  1P3K D;  3AZM B;  5AV9 A;  3FDD A;  4KGC B;  5BT1 C;  1TZY A;  5AV8 C;  5AVC C;  3NQJ A;  3B0C T;  4QLC A;  1AOI D;  2FJ7 D;  1P3B B;  5CPJ B;  1KU5 A;  1F66 D;  1TAF B;  4ZUX D;  3REJ A;  2FJ7 C;  3AN2 C;  4J8W C;  3KUY B;  3X1S C;  3AZE D;  5B33 A;  2ZM5 A;  4WU8 A;  2W8S A;  5CHL B;  4YM6 B;  3H0M C;  3EPJ A;  3EPK A;  1T3U A;  1M19 B;  4XUJ A;  3AV1 D;  4WU9 D;  3C1C C;  2CV5 D;  2ZY3 A;  3WAA B;  3UTB A;  3W99 D;  2F8N B;  5B2J C;  5B40 D;  4J8V C;  5B1L A;  2JSS A;  5B24 B;  3MGP C;  3LZ0 D;  2BYK B;  5B32 G;  4ZUX C;  3MGP D;  4AWL B;  5CPK C;  1JFI B;  3AZF B;  3C1B A;  4KGC A;  3MGS C;  3AZI C;  3W98 B;  1AOI C;  2DQN C;  3C1B B;  3AYW B;  3AFA A;  3MVD C;  2XD5 A;  3MGS B;  5B2J D;  3AZI B;  5B1L C;  1P3O B;  5JRG B;  3TU4 A;  3AFA B;  2BYK A;  1P3O A;  1F66 C;  3AZN D;  1M18 D;  4DRB A;  1WWI A;  4H9S C;  3AZF A;  5CPK A;  5BNX B;  4CSR B;  3MGS A;  3AZI A;  5DNM A;  4XZQ C;  3X1U C;  5B31 C;  4QLC B;  3AZE C;  3WA9 B;  1S32 B;  1HQ3 A;  4JJN D;  4NE3 A;  5GXQ D;  3KWQ D;  1P3M A;  1M1A A;  1S32 A;  3LZ0 C;  4JJN C;  2F8N K;  1ULY A;  4WV4 B;  4J8V D;  2RIQ A;  3MGR C;  4J8X C;  4J8U C;  3W97 D;  4M6B A;  5JA4 B;  4YM6 A;  5BT1 D;  5KDM A;  3WTP D;  1EQZ D;  3AZN C;  4Z5T C;  3LEL D;  1BH8 A;  3MVD D;  3UTB B;  3MGR A;  4J8U A;  1KX3 D;  5AVC B;  3AZG B;  3MGR B;  4J8U B;  5BO0 A;  3X1T D;  3B0B A;  3LZ1 A;  2Y2I A;  2NQB D;  5DNM D;  4WZS B;  5E5A B;  5B2I A;  1P3B A;  2BG1 A;  4X23 B;  5E5A A;  4Z5T B;  5B2I B;  4XZQ B;  3X1U B;  3KUY A;  3C1C A;  3H0R C;  3UT9 D;  3AZE A;  3AV2 C;  3LZ1 C;  5JRG C;  4J8V A;  5GT3 A;  5GSU C;  5E5A C;  4J8X A;  3C1B C;  3AZH C;  3X1S D;  4J8W D;  2PYO D;  3AV2 A;  1P3I A;  3MVD A;  2YFV A;  3KFU G;  5B0Y B;  3LJA D;  4YS3 D;  5AV8 D;  5AVB A;  3REL B;  3W98 A;  2XD1 A;  2Y2G A;  2LY8 A;  2RVQ C;  3B6G A;  4WNN A;  5B31 A;  3AFA C;  5B32 A;  4LD9 B;  3AZF C;  5B31 B;  5AV6 D;  2PYO C;  3AZK D;  4QLC C;  4KHA B;  5CPJ C;  5GT3 B;  3REH A;  4KHA A;  2ARO D;  3UTB C;  5AV5 B;  3MGQ B;  1ZLA B;  4WU8 B;  3AN2 B;  1M1A C;  1P3K A;  5GT0 B;  1KX5 B;  4KUD D;  5AVB B;  3KXB C;  1ID3 C;  4Z66 B;  4Z2M H;  1P3G B;  3MNN D;  3W98 C;  1N1J A;  4NE6 A;  4XUJ C;  3AZM D;  5B0Z D;  3B6G C;  3AZH D;  1KX3 A;  3TU4 C;  5AV9 B;  3KXB A;  4NFT A;  3X1T A;  2NZD D;  3VH6 T;  1N1J B;  5CPJ D;  1P34 B;  2JCH A;  3WKJ B;  5B32 B;  4ZUX B;  3H0L C;  1H3O A;  4G91 B;  3REI B;  3KUY D;  3AZE B;  3WA9 C;  3AZG C;  1Q9C A;  3WKJ A;  4H9R A;  3R45 A;  2NQB C;  3F6T A;  3REH B;  1M19 D;  3AV1 B;  1B6W A;  2CV5 B;  1KX4 A;  3WAA D;  2F8N D;  3MNN A;  3A6N B;  5B40 B;  5JA4 A;  1P3I B;  2NZD C;  5CP6 B;  1TZY D;  3O62 C;  3LZ0 B;  1P3L C;  4UUZ B;  4CAY A;  3WTP C;  3MGP B;  3AZF D;  3VH6 A;  3VH5 W;  3MNN C;  3AZL B;  3W98 D;  3C1B D;  3AYW D;  2IO5 C;  3MGS D;  3AZI D;  5B2J B;  2YFW B;  3A6N C;  3AFA D;  1ID3 D;  3B6F A;  5B33 D;  3O62 A;  4R8P B;  3AZN B;  5BNV A;  1M18 B;  3KUY C;  1HQ3 B;  4R8P C;  3REJ D;  4LD9 A;  5JRG A;  3EG5 B;  4H9N A;  4QLC D;  2BYM A;  3WAA A;  3AV1 C;  5B31 G;  3X1V D;  5GXQ B;  3W99 A;  1KX4 C;  5AV5 A;  1M1A B;  4WU9 A;  1HQ3 C;  4H9N B;  4J8V B;  1P3I C;  3LZ0 A;  4HGA B;  1KX3 C;  4H9O A;  1JFI A;  4HGA C;  3AZJ A;  1F1E A;  3WTP B;  1EQZ B;  3AZJ B;  2Y2H A;  3AYW A;  4XUJ B;  3REK D;  2YFW A;  3LEL B;  1KX4 B;  1ID3 A;  3MVD B;  3UTB D;  4UPK A;  3O62 B;  3AZN A;  5AVC D;  3AZH A;  3MGR D;  5B1M D;  4J8U D;  5B2J A;  3AZG A;  2NQB B;  5DNM B;  1BH8 B;  5B24 C;  5B32 C;  1U35 D;  4H9Q B;  5F99 A;  4Z66 C;  2J8P A;  4E44 A;  4X23 D;  5BNX A;  3MGP A;  2F2A C;  5DNN D;  5B2I D;  4ZUX A;  3X1T C;  3X1U D;  4XZQ D;  1P3P A;  5G49 B;  5B2I C;  4G91 C;  3TU4 B;  3P5J B;  3MGQ C;  1ZLA C;  1M18 C;  3W96 B;  4EO5 C;  3WKJ C;  3VH5 T;  4J8X D;  3W97 C;  2CV5 C;  2PYO B;  3LEL A;  2HUE B;  1P3F A;  2HIO C;  4E45 A;  5CP6 A;  3AV2 B;  1P3G C;  5B1L D;  3EPH A;  1P3F B;  5CPI C;  1P3A C;  3REH C;  5DNN C;  5CPI D;  1P3A D;  3W97 A;  2IO5 B;  4H9Q A;  5F99 B;  3LEL C;  2UWX A;  5AVB C;  1PZR A;  3KXB B;  3LZ1 D;  3X1V C;  5G49 A;  3UTA A;  1EQZ C;  5B1M C;  5B0Y C;  4Z5T A;  4LD9 D;  1P3P B;  3B6F D;  1WWS A;  2ARO A;  1P34 A;  3AZK B;  5GXQ C;  2NQB A;  3AL0 C;  5GT3 D;  3EPL A;  2F8N H;  1P3L D;  5AV5 D;  5FUG B;  3AN2 D;  2HIO D;  1W2E A;  5BS7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...