1KX3D

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3D00
3W99C 3B6FA 5B24D 3MVDC 3MNNC 4XUJA 2F8NG 2NQBA 3KWQA 5G49B 5B31C 2F8NB 1P3KD 3AZKD 1M1AA 4J8UD 1HQ3B 3WA9B 3AZMB 5AVBC 1P3MC 3AZJD 2AROA 3B0BA 1F66C 3MGPA 3VH5A 3LELA 2PYOC 1P3FB 4XZQB 3REKD 3AYWD 2CWEA 4WU8B 1P3OB 1P3IA 5B0ZB 3O62A 3LZ1C 5B24A 1N1JA 3X1UB 3NQJB 5DNNB 1S32A 1ZLAD 5KDMB 3AZFC 1P3KA 3AZKA 4EO5C 5CP6B 4J8UA 2NZDC 1TZYB 3C1CB 4J8VD 5GT0D 4G92B 4KUDA 1Q9CA 4KHAA 3W96D 5AV6B 1R4VA 3AZIC 5AY8B 3AN2D 5C3IC 3WTPC 4H9PA 3KUYD 4ZUXC 3TU4C 1P34C 5AVCD 3KSYA 3AFAD 1EQZC 4J8WD 3UTBC 4QLCD 1B6WA 3B0CW 3AZHB 3W98A 3LJAA 4X23B 3MVDB 3REHB 5B33B 3UTAB 3W97C 4YM6D 5B2JC 5B32A 5B31D 4J8VA 3UT9C 5GT0A 5CPJC 1P3BD 3X1VD 1A7WA 1KX4A 3X1TB 2F8NH 3RELA 3AN2A 4Z2MH 5BNVA 3WKJD 5AVBD 1P3PD 3AFAA 4JJND 5E5AD 4J8WA 2PYOB 4ZBJB 1KX5A 5DNMD 3KXBA 4UUZB 3AZEB 4H9NB 3AZLD 5CPKA 4Z66C 3AZGD 5B1MB 3REID 1KX3D 1M19D 3MGSB 3W99A 3MNNA 5BO0B 3X1SD 5F99D 5B31A 2NZDB 1HQ3C 5B0YB 5AV5B 3MGQD 3B6GD 4E44A 3X1VA 1P3BA 4H9QB 5GXQD 4H9SC 1P34B 4ZUXB 5BS7A 5AVBA 3TU4B 3AV2C 1P3PA 4XZQC 4JJNA 1P3MA 1EQZB 4KGCD 4WU9D 1F66A 4NE3A 4WU8C 1P3OC 4LD9B 4NFTA 4R8PD 5B0ZC 1U35D 3AZGA 3X1UC 4XUJD 4H9OB 5AV9C 1M19A 5JRGB 3LZ1A 1P3GB 4DRBA 3AZND 3LZ0C 3C1CC 2LY8A 2YFWB 3UT9B 3AZFA 2F8NK 4G92C 1U35A 3C1BD 3MGQA 5B2JD 1P3AC 5AV8B 2AROD 5BNXA 4Z5TD 4WV4B 3LELD 3AZIA 3WTPA 3R45A 2HIOD 4WU9A 3VH6T 3AZHC 3UTBA 1P3ID 4R8PA 4Z66B 1B67A 1P3LC 4X23C 3REHC 3UTAC 5B33C 3MGRB 2CV5C 1S32D 4Z2MG 1ID3B 3AZNA 5CPIB 3W97A 2YFVA 2FJ7C 3C1BA 4KUDD 4WNNB 5B2JA 3X1TC 4YS3C 1HQ3D 3WA9D 3AZMD 5CPJA 4Z5TA 3B0DB 3O62B 3AV2B 2HIOA 4ZBJC 3AZEC 1P3FD 4XZQD 3V9RB 3W98D 3LJAD 5FUGB 5B1MC 4CAYB 5B0ZD 3MGSC 5AV9B 5DNND 3AZJB 1HTAA 3AV1B 5B32D 5G49A 4H9RB 3LZ0B 2F8NA 5B0YC 1F1EA 5CP6D 5AV5C 1TZYD 1P3AB 3REKB 1KX4D 3AYWB 5B1LC 3RELD 1HQ3A 4NE6A 1AOIB 3WA9A 3AZMA 3NQUB 5AV6D 5AY8D 1KX5D 4H9SA 3KXBD 1JFIB 1ZLAB 5CPKD 1BH8B 4XZQA 1P3FA 4LD9C 1P3LB 4WU8A 1P3OA 4AWLB 2CV5B 1TAFB 5B2IC 5B40C 3VH6W 5B0ZA 3W96B 3W99D 5JRGC 1P3GC 3X1UA 3MNND 3NQJA 5DNNA 3MVDD 2L5AA 3WTPE 3KUYB 1M18B 5AVCB 5KDMA 3A6NB 5CP6A 2FJ7B 5AV8C 2BYKA 1TZYA 5GSUC 3C1CA 4QLCB 4YS3B 3X1TD 5AV6A 3B6FC 5AY8A 1P3MD 3WAAB 5BT1C 1F66D 2PYOD 4CSRB 5B31G 4YM6B 3MGRC 3AZHA 1ID3C 4NE5A 3LZ1D 5B1MD 4X23A 3MVDA 3REHA 5B33A 3UTAA 5CPIC 3WKJB 3MGPC 3AZFD 5E5AB 4WZSB 2NZDD 4DRAA 5DNMB 5B0YD 5B1LB 3AZLB 3X1TA 3B0DC 3O62C 3AZID 5B24C 3WTPD 2HUEB 3REIB 1P34D 4ZUXD 1H3OA 3TU4D 2BYMB 1KX3B 1EQZD 5JA4B 1P3KC 5GT3B 3UTBD 2PYOA 3X1SB 4UUZA 5F99B 3AZEA 4H9NA 3B6GB 5B40B 5B2IB 5B1MA 3AZJC 3AV1C 5GXQB 4J8XB 3W97D 1BH9A 5BO0A 3REJB 3REKC 4KGCB 3AYWC 2NZDA 5GSUB 3UT9D 5B0YA 4HGAB 5AV5A 1AOIC 5CPJD 4H9QA 1U35B 3B6FB 4XUJB 2NQBB 1P34A 3KWQB 4ZUXA 3TU4A 1ZLAC 1EQZA 1M1AB 2IO5C 4J8VC 5GT0C 4AWLC 4LD9A 4Z66D 3W96C 4H9OA 2AROB 3KUYC 4Z5TB 1M18C 1ID3D 2F8ND 5AVCC 3AFAC 5JRGA 3A6NC 3MGPB 1P3GA 3LELB 4J8WC 5CPID 2YFWA 4QLCC 3UT9A 3VH6A 1P3IB 5AV8A 2JSSA 5B24B 1N1JB 3WAAC 1S32B 3VH5T 3AV2D 1BFMA 1P3KB 3AZKB 4J8UB 2RVQC 4YM6C 4WU8D 1P3OD 1P3BC 3X1VC 4Z66A 4KUDB 4KHAB 3X1UD 3MGRA 3WKJC 4H9PB 1ID3A 5BS7C 1P3PC 5AV9D 4JJNC 3AV1D 5E5AC 3LZ0D 5CPIA 5DNMC 3C1CD 3AZLC 4M6BA 4WNNA 1P3AD 3W98B 3LJAB 3AZGC 2HUEC 1AOID 3REIC 1KX3C 1M19C 3AV2A 5GT3C 5B32G 3X1SC 2IO5B 5B32B 5F99C 4J8VB 3V9RA 3AZHD 5GT0B 3MGQC 3B6GC 4G91B 2BYKB 5FUGA 1P3LD 1KX4B 1KU5A 4X23D 3REHD 4CAYA 5GXQC 5B33D 3RELB 3UTAD 5BNVB 3AN2B 4J8XC 2CV5D 5AV9A 3AFAB 3AV1A 3AZJA 4J8WB 3REJC 4KGCC 4WU9C 1M18D 4H9RA 3LZ0A 1KX5B 3KXBB 3A6ND 4HGAC 5CPKB 2FJ7D 4R8PC 1P3AA 3REKA 1U35C 3AYWA 4YS3D 1WWIA 4XUJC 1AOIA 2NQBC 3NQUA 3KWQC 1M1AC 3W99B 3WAAD 3MNNB 3AZNC 1JFIA 1ZLAA 5B31B 3AZED 1BH8A 3VH5W 3C1BC 2RVQD 1P3BB 3X1VB 1P3LA 2AROC 2CV5A 1TAFA 4Z5TC 3W96A 3MGSD 5AVBB 1P3PB 3LELC 4JJNB 2HIOC 1P3MB 3KUYA 1M18A 1H3OB 1F66B 5AVCA 3A6NA 5AV5D 1P3IC 2FJ7A 4QLCA 3AZGB 5B1LD 4YS3A 1S32C 4E45A 1M19B 3LZ1B 3AZKC 4J8UC 3WAAA 5GT3D 4CSRA 1BH9B 3AZFB 4LD9D 4KUDC 4EO5B 3MGQB 4YM6A 3WA9C 1WWSA 5BNXB 5B40D 5B2ID 3AZMC 1ULYA 3MGSA 5JRGD 1P3GD 3AZIB 3WTPB 3R45B 5C3IB 4J8XD 4WU9B 3WKJA 1P3FC 5E5AA 3REJD 3UTBB 5AV8D 3W98C 3LJAC 4R8PB 5GSUD 5DNMA 5B1LA 3AZLA 3B6FD 5DNNC 2NQBD 3REIA 3KWQD 5BT1D 5B32C 2BYMA 3AZNB 1KX3A 5JA4A 1M1AD 2YFVB 5GT3A 3W97B 5CP6C 4G91C 3C1BB 1TZYC 3X1SA 5B2JB 1KX4C 5F99A 3RELC 3AN2C 3MGRD 5CPJB 5B40A 5B2IA 3B6GA 5AV6C 5AY8C 5CHLB 5GXQA 2HIOB 1KX5C 3B0CT 3KXBC 4J8XA 3MGPD 5CPKC 3REJA 4KGCA 5GSUA 3O62D
chains in the Genus database with same CATH superfamily
3W99C 3B6FA 5B24D 3MVDC 3MNNC 4XUJA 2F8NG 3KFUG 2NQBA 3KWQA 5G49B 5B31C 2F8NB 1P3KD 3AZKD 1M1AA 4J8UD 2G5HC 1HQ3B 3WA9B 3H0LC 3AZMB 5AVBC 1P3MC 3AZJD 2AROA 4WJ3C 3B0BA 1T3UA 3H0MC 1F66C 3MGPA 3VH5A 3LELA 2PYOC 1P3FB 4XZQB 3REKD 3AYWD 2CWEA 4WU8B 1P3OB 1P3IA 5B0ZB 3O62A 3LZ1C 5B24A 1N1JA 3X1UB 3NQJB 5DNNB 1S32A 1ZLAD 5KDMB 3AZFC 1P3KA 3AZKA 4EO5C 5CP6B 4J8UA 2NZDC 1TZYB 3C1CB 4J8VD 5GT0D 2G5IC 4G92B 4KUDA 1Q9CA 4KHAA 3W96D 5AV6B 1R4VA 3AZIC 2J8PA 3H0RC 5C3IC 5AY8B 3WTPC 3AN2D 4H9PA 3KUYD 4ZUXC 3TU4C 1P34C 5AVCD 3KSYA 3AFAD 1EQZC 4J8WD 3UTBC 4QLCD 1B6WA 3B0CW 3AZHB 3W98A 3LJAA 4X23B 3MVDB 3REHB 5B33B 3UTAB 3W97C 5B2JC 4YM6D 5B32A 5B31D 4J8VA 3UT9C 5GT0A 5CPJC 1P3BD 3X1VD 1A7WA 1KX4A 3X1TB 2F8NH 3RELA 3AN2A 4Z2MH 5BNVA 3WKJD 5AVBD 1P3PD 3AFAA 4JJND 5E5AD 4J8WA 2PYOB 2ZY5A 4ZBJB 1KX5A 5DNMD 3KXBA 4UUZB 3AZEB 4H9NB 3AZLD 5CPKA 4Z66C 3AZGD 2JCHA 5B1MB 3REID 1KX3D 1M19D 3MGSB 3W99A 3MNNA 5BO0B 3X1SD 5F99D 5B31A 3EPJA 2NZDB 1HQ3C 5B0YB 5AV5B 3MGQD 3B6GD 4E44A 3X1VA 1P3BA 4H9QB 5GXQD 4H9SC 1P34B 4ZUXB 5BS7A 5AVBA 3TU4B 3AV2C 1P3PA 4XZQC 4JJNA 1P3MA 1EQZB 4KGCD 4WU9D 1F66A 4NE3A 4WU8C 1P3OC 4LD9B 4NFTA 4R8PD 5B0ZC 1U35D 3AZGA 3X1UC 4XUJD 4H9OB 5AV9C 1M19A 5JRGB 3LZ1A 1PZRA 4DRBA 1P3GB 3AZND 3LZ0C 3C1CC 2LY8A 2YFWB 3UT9B 3AZFA 2F8NK 4G92C 1U35A 3C1BD 3MGQA 5B2JD 1P3AC 5AV8B 2AROD 5BNXA 4Z5TD 4WV4B 3LELD 3AZIA 3WTPA 3R45A 2HIOD 2UWXA 4WU9A 3FDDA 3VH6T 2BG1A 3AZHC 3UTBA 1P3ID 4R8PA 4Z66B 1B67A 1P3LC 4X23C 3REHC 3UTAC 5B33C 3MGRB 2CV5C 1S32D 4Z2MG 1ID3B 3AZNA 5CPIB 3W97A 2YFVA 2FJ7C 3C1BA 4KUDD 4WNNB 5B2JA 3X1TC 4YS3C 1HQ3D 3WA9D 3AZMD 5CPJA 4Z5TA 3B0DB 3O62B 3AV2B 3EPHA 2HIOA 4ZBJC 1W2EA 3AZEC 1P3FD 4XZQD 3V9RB 3W98D 3LJAD 5FUGB 5B1MC 4UPKA 4CAYB 5B0ZD 3MGSC 5AV9B 5DNND 3AZJB 1HTAA 3AV1B 5B32D 5G49A 4H9RB 3LZ0B 2F8NA 5B0YC 1F1EA 5CP6D 5AV5C 1TZYD 1P3AB 3REKB 1KX4D 3AYWB 5B1LC 3RELD 1HQ3A 4NE6A 1AOIB 3WA9A 3AZMA 3NQUB 5AV6D 2FFFB 5AY8D 1KX5D 4H9SA 3KXBD 1JFIB 1ZLAB 5CPKD 1BH8B 4XZQA 1P3FA 4LD9C 2Y2NA 1P3LB 4WU8A 1P3OA 4AWLB 2CV5B 1TAFB 5B2IC 5B40C 3VH6W 2Y2PA 5B0ZA 2XD1A 3W96B 3W99D 5JRGC 1P3GC 2Y2OA 3X1UA 3MNND 3NQJA 5DNNA 3MVDD 2L5AA 3WTPE 3KUYB 1M18B 5AVCB 5KDMA 3A6NB 5CP6A 2Y2KA 5AV8C 2BYKA 3EPLA 1TZYA 5GSUC 3C1CA 2FJ7B 4QLCB 4YS3B 3X1TD 5AV6A 3B6FC 5AY8A 1P3MD 3WAAB 5BT1C 2ZY4A 1F66D 2PYOD 4CSRB 5B31G 4YM6B 3MGRC 3AZHA 1ID3C 4NE5A 3LZ1D 5B1MD 4X23A 3MVDA 3REHA 5B33A 3UTAA 5CPIC 3WKJB 3MGPC 3AZFD 5E5AB 4WZSB 2NZDD 4DRAA 5DNMB 5B0YD 5B1LB 3AZLB 3X1TA 3B0DC 3O62C 3AZID 5B24C 3WTPD 2HUEB 3REIB 1P34D 4ZUXD 1H3OA 3TU4D 2BYMB 2JE5A 1KX3B 1EQZD 5JA4B 1P3KC 5GT3B 3UTBD 2PYOA 3X1SB 4UUZA 5F99B 3AZEA 4H9NA 3B6GB 5B40B 5B2IB 5B1MA 3AZJC 3AV1C 5GXQB 4J8XB 3W97D 1BH9A 5BO0A 3REJB 3REKC 4KGCB 3AYWC 2NZDA 5GSUB 3UT9D 5B0YA 4HGAB 5AV5A 1AOIC 5CPJD 4H9QA 1U35B 3B6FB 2ZY2A 2Y2LA 4XUJB 2NQBB 1P34A 3KWQB 4ZUXA 3TU4A 2Y2HA 1ZLAC 3P5JB 1EQZA 1M1AB 2IO5C 4J8VC 2ZY3A 5GT0C 4AWLC 4LD9A 4Z66D 3W96C 4H9OA 2AROB 3KUYC 4Z5TB 1M18C 1ID3D 2F8ND 5AVCC 3AFAC 5JRGA 3A6NC 3MGPB 1P3GA 3LELB 4J8WC 5CPID 2Y2MA 2YFWA 4QLCC 3UT9A 3VH6A 2DF4C 1P3IB 2DQNC 2JSSA 5AV8A 5B24B 1N1JB 3WAAC 1S32B 3VH5T 3AV2D 1BFMA 1P3KB 3AZKB 4J8UB 2RVQC 4YM6C 4WU8D 1P3OD 1P3BC 3EG5B 3X1VC 4Z66A 4KUDB 4KHAB 3EPKA 3X1UD 3A1IA 3MGRA 3WKJC 4H9PB 1ID3A 5BS7C 1P3PC 5AV9D 4JJNC 3AV1D 5E5AC 3LZ0D 5CPIA 5DNMC 3C1CD 2RIQA 3AZLC 4M6BA 4WNNA 1P3AD 3W98B 3LJAB 3AZGC 2HUEC 1AOID 3REIC 1KX3C 1M19C 3AV2A 5GT3C 3A1KA 2Y2IA 5B32G 3X1SC 2IO5B 5B32B 5F99C 3F6TA 4J8VB 3V9RA 3AZHD 5GT0B 3MGQC 3B6GC 4G91B 2BYKB 5FUGA 1P3LD 1KX4B 1KU5A 4X23D 3REHD 4CAYA 5GXQC 5B33D 2W8SA 3RELB 5BNVB 3UTAD 4J8XC 3AN2B 5AV9A 3AFAB 3AV1A 3AZJA 4J8WB 3REJC 4KGCC 4WU9C 1M18D 4H9RA 3LZ0A 1KX5B 3KXBB 3A6ND 4HGAC 5CPKB 2FJ7D 4R8PC 1P3AA 3REKA 1U35C 3AYWA 4YS3D 1WWIA 4XUJC 1AOIA 2NQBC 3AL0C 3NQUA 3KWQC 1M1AC 3W99B 3WAAD 3MNNB 3AZNC 1JFIA 1ZLAA 5B31B 3AZED 1BH8A 2CV5D 3VH5W 3C1BC 2RVQD 1P3BB 3X1VB 1P3LA 2AROC 2CV5A 1TAFA 4Z5TC 1Z2CB 3W96A 3MGSD 5AVBB 1P3PB 3LELC 4JJNB 2HIOC 1P3MB 3KUYA 2XD5A 1H3OB 1M18A 1F66B 5AVCA 3A6NA 5AV5D 1P3IC 2FJ7A 4QLCA 3IP4C 5B1LD 3AZGB 2F2AC 4YS3A 2Y2GA 1S32C 4E45A 1M19B 3LZ1B 3AZKC 4J8UC 3WAAA 2Y2JA 5GT3D 4CSRA 1BH9B 3AZFB 4LD9D 4KUDC 4EO5B 3MGQB 4YM6A 4DQYB 3WA9C 1WWSA 5BNXB 5B40D 5B2ID 3AZMC 1ULYA 3MGSA 5JRGD 1P3GD 3AZIB 3WTPB 3R45B 5C3IB 4J8XD 4WU9B 3WKJA 1P3FC 5E5AA 3REJD 3UTBB 5AV8D 3W98C 3LJAC 4R8PB 5GSUD 5DNMA 5B1LA 3AZLA 2VQRA 2Y2QA 3B6FD 5DNNC 2NQBD 3REIA 3KWQD 5BT1D 5B32C 2BYMA 3AZNB 1KX3A 5JA4A 1M1AD 2YFVB 5GT3A 2ZM5A 5CP6C 3W97B 4G91C 3C1BB 1TZYC 3X1SA 5B2JB 1KX4C 5F99A 3RELC 3AN2C 3MGRD 5CPJB 5B40A 5B2IA 3B6GA 5AV6C 5AY8C 5CHLB 5GXQA 2HIOB 1KX5C 3B0CT 3KXBC 4J8XA 3MGPD 5CPKC 3REJA 4KGCA 5GSUA 3O62D
chains in the Genus database with same CATH topology
3W99C 3B6FA 5B24D 3MVDC 3MNNC 4XUJA 2F8NG 3KFUG 2NQBA 3KWQA 5G49B 5B31C 2F8NB 1P3KD 3AZKD 1M1AA 4J8UD 2G5HC 1HQ3B 3WA9B 3H0LC 3AZMB 5AVBC 1P3MC 3AZJD 2AROA 4WJ3C 3B0BA 1T3UA 3H0MC 1F66C 3MGPA 3VH5A 3LELA 2PYOC 1P3FB 4XZQB 3REKD 3AYWD 2CWEA 4WU8B 1P3OB 1P3IA 5B0ZB 3O62A 3LZ1C 5B24A 1N1JA 3X1UB 3NQJB 5DNNB 1S32A 1ZLAD 5KDMB 3AZFC 1P3KA 3AZKA 4EO5C 5CP6B 4J8UA 2NZDC 1TZYB 3C1CB 4J8VD 5GT0D 2G5IC 4G92B 4KUDA 1Q9CA 4KHAA 3W96D 5AV6B 1R4VA 3AZIC 2J8PA 3H0RC 5C3IC 5AY8B 3WTPC 3AN2D 4H9PA 3KUYD 4ZUXC 3TU4C 1P34C 5AVCD 3KSYA 3AFAD 1EQZC 4J8WD 3UTBC 4QLCD 1B6WA 3B0CW 3AZHB 3W98A 3LJAA 4X23B 3MVDB 3REHB 5B33B 3UTAB 3W97C 5B2JC 4YM6D 5B32A 5B31D 4J8VA 3UT9C 5GT0A 5CPJC 1P3BD 3X1VD 1A7WA 1KX4A 3X1TB 2F8NH 3RELA 3AN2A 4Z2MH 5BNVA 3WKJD 5AVBD 1P3PD 3AFAA 4JJND 5E5AD 4J8WA 2PYOB 2ZY5A 4ZBJB 1KX5A 5DNMD 3KXBA 4UUZB 3AZEB 4H9NB 3AZLD 5CPKA 4Z66C 3AZGD 2JCHA 5B1MB 3REID 1KX3D 1M19D 3MGSB 3W99A 3MNNA 5BO0B 3X1SD 5F99D 5B31A 3EPJA 2NZDB 1HQ3C 5B0YB 5AV5B 3MGQD 3B6GD 4E44A 3X1VA 1P3BA 4H9QB 5GXQD 4H9SC 1P34B 4ZUXB 5BS7A 5AVBA 3TU4B 3AV2C 1P3PA 4XZQC 4JJNA 1P3MA 1EQZB 4KGCD 4WU9D 1F66A 4NE3A 4WU8C 1P3OC 4LD9B 4NFTA 4R8PD 5B0ZC 1U35D 3AZGA 3X1UC 4XUJD 4H9OB 5AV9C 1M19A 5JRGB 3LZ1A 1PZRA 4DRBA 1P3GB 3AZND 3LZ0C 3C1CC 2LY8A 2YFWB 3UT9B 3AZFA 2F8NK 4G92C 1U35A 3C1BD 3MGQA 5B2JD 1P3AC 5AV8B 2AROD 5BNXA 4Z5TD 4WV4B 3LELD 3AZIA 3WTPA 3R45A 2HIOD 2UWXA 4WU9A 3FDDA 3VH6T 2BG1A 3AZHC 3UTBA 1P3ID 4R8PA 4Z66B 1B67A 1P3LC 4X23C 3REHC 3UTAC 5B33C 3MGRB 2CV5C 1S32D 4Z2MG 1ID3B 3AZNA 5CPIB 3W97A 2YFVA 2FJ7C 3C1BA 4KUDD 4WNNB 5B2JA 3X1TC 4YS3C 1HQ3D 3WA9D 3AZMD 5CPJA 4Z5TA 3B0DB 3O62B 3AV2B 3EPHA 2HIOA 4ZBJC 1W2EA 3AZEC 1P3FD 4XZQD 3V9RB 3W98D 3LJAD 5FUGB 5B1MC 4UPKA 4CAYB 5B0ZD 3MGSC 5AV9B 5DNND 3AZJB 1HTAA 3AV1B 5B32D 5G49A 4H9RB 3LZ0B 2F8NA 5B0YC 1F1EA 5CP6D 5AV5C 1TZYD 1P3AB 3REKB 1KX4D 3AYWB 5B1LC 3RELD 1HQ3A 4NE6A 1AOIB 3WA9A 3AZMA 3NQUB 5AV6D 2FFFB 5AY8D 1KX5D 4H9SA 3KXBD 1JFIB 1ZLAB 5CPKD 1BH8B 4XZQA 1P3FA 4LD9C 2Y2NA 1P3LB 4WU8A 1P3OA 4AWLB 2CV5B 1TAFB 5B2IC 5B40C 3VH6W 2Y2PA 5B0ZA 2XD1A 3W96B 3W99D 5JRGC 1P3GC 2Y2OA 3X1UA 3MNND 3NQJA 5DNNA 3MVDD 2L5AA 3WTPE 3KUYB 1M18B 5AVCB 5KDMA 3A6NB 5CP6A 2Y2KA 5AV8C 2BYKA 3EPLA 1TZYA 5GSUC 3C1CA 2FJ7B 4QLCB 4YS3B 3X1TD 5AV6A 3B6FC 5AY8A 1P3MD 3WAAB 5BT1C 2ZY4A 1F66D 2PYOD 4CSRB 5B31G 4YM6B 3MGRC 3AZHA 1ID3C 4NE5A 3LZ1D 5B1MD 4X23A 3MVDA 3REHA 5B33A 3UTAA 5CPIC 3WKJB 3MGPC 3AZFD 5E5AB 4WZSB 2NZDD 4DRAA 5DNMB 5B0YD 5B1LB 3AZLB 3X1TA 3B0DC 3O62C 3AZID 5B24C 3WTPD 2HUEB 3REIB 1P34D 4ZUXD 1H3OA 3TU4D 2BYMB 2JE5A 1KX3B 1EQZD 5JA4B 1P3KC 5GT3B 3UTBD 2PYOA 3X1SB 4UUZA 5F99B 3AZEA 4H9NA 3B6GB 5B40B 5B2IB 5B1MA 3AZJC 3AV1C 5GXQB 4J8XB 3W97D 1BH9A 5BO0A 3REJB 3REKC 4KGCB 3AYWC 2NZDA 5GSUB 3UT9D 5B0YA 4HGAB 5AV5A 1AOIC 5CPJD 4H9QA 1U35B 3B6FB 2ZY2A 2Y2LA 4XUJB 2NQBB 1P34A 3KWQB 4ZUXA 3TU4A 2Y2HA 1ZLAC 3P5JB 1EQZA 1M1AB 2IO5C 4J8VC 2ZY3A 5GT0C 4AWLC 4LD9A 4Z66D 3W96C 4H9OA 2AROB 3KUYC 4Z5TB 1M18C 1ID3D 2F8ND 5AVCC 3AFAC 5JRGA 3A6NC 3MGPB 1P3GA 3LELB 4J8WC 5CPID 2Y2MA 2YFWA 4QLCC 3UT9A 3VH6A 2DF4C 1P3IB 2DQNC 2JSSA 5AV8A 5B24B 1N1JB 3WAAC 1S32B 3VH5T 3AV2D 1BFMA 1P3KB 3AZKB 4J8UB 2RVQC 4YM6C 4WU8D 1P3OD 1P3BC 3EG5B 3X1VC 4Z66A 4KUDB 4KHAB 3EPKA 3X1UD 3A1IA 3MGRA 3WKJC 4H9PB 1ID3A 5BS7C 1P3PC 5AV9D 4JJNC 3AV1D 5E5AC 3LZ0D 5CPIA 5DNMC 3C1CD 2RIQA 3AZLC 4M6BA 4WNNA 1P3AD 3W98B 3LJAB 3AZGC 2HUEC 1AOID 3REIC 1KX3C 1M19C 3AV2A 5GT3C 3A1KA 2Y2IA 5B32G 3X1SC 2IO5B 5B32B 5F99C 3F6TA 4J8VB 3V9RA 3AZHD 5GT0B 3MGQC 3B6GC 4G91B 2BYKB 5FUGA 1P3LD 1KX4B 1KU5A 4X23D 3REHD 4CAYA 5GXQC 5B33D 2W8SA 3RELB 5BNVB 3UTAD 4J8XC 3AN2B 5AV9A 3AFAB 3AV1A 3AZJA 4J8WB 3REJC 4KGCC 4WU9C 1M18D 4H9RA 3LZ0A 1KX5B 3KXBB 3A6ND 4HGAC 5CPKB 2FJ7D 4R8PC 1P3AA 3REKA 1U35C 3AYWA 4YS3D 1WWIA 4XUJC 1AOIA 2NQBC 3AL0C 3NQUA 3KWQC 1M1AC 3W99B 3WAAD 3MNNB 3AZNC 1JFIA 1ZLAA 5B31B 3AZED 1BH8A 2CV5D 3VH5W 3C1BC 2RVQD 1P3BB 3X1VB 1P3LA 2AROC 2CV5A 1TAFA 4Z5TC 1Z2CB 3W96A 3MGSD 5AVBB 1P3PB 3LELC 4JJNB 2HIOC 1P3MB 3KUYA 2XD5A 1H3OB 1M18A 1F66B 5AVCA 3A6NA 5AV5D 1P3IC 2FJ7A 4QLCA 3IP4C 5B1LD 3AZGB 2F2AC 4YS3A 2Y2GA 1S32C 4E45A 1M19B 3LZ1B 3AZKC 4J8UC 3WAAA 2Y2JA 5GT3D 4CSRA 1BH9B 3AZFB 4LD9D 4KUDC 4EO5B 3MGQB 4YM6A 4DQYB 3WA9C 1WWSA 5BNXB 5B40D 5B2ID 3AZMC 1ULYA 3MGSA 5JRGD 1P3GD 3AZIB 3WTPB 3R45B 5C3IB 4J8XD 4WU9B 3WKJA 1P3FC 5E5AA 3REJD 3UTBB 5AV8D 3W98C 3LJAC 4R8PB 5GSUD 5DNMA 5B1LA 3AZLA 2VQRA 2Y2QA 3B6FD 5DNNC 2NQBD 3REIA 3KWQD 5BT1D 5B32C 2BYMA 3AZNB 1KX3A 5JA4A 1M1AD 2YFVB 5GT3A 2ZM5A 5CP6C 3W97B 4G91C 3C1BB 1TZYC 3X1SA 5B2JB 1KX4C 5F99A 3RELC 3AN2C 3MGRD 5CPJB 5B40A 5B2IA 3B6GA 5AV6C 5AY8C 5CHLB 5GXQA 2HIOB 1KX5C 3B0CT 3KXBC 4J8XA 3MGPD 5CPKC 3REJA 4KGCA 5GSUA 3O62D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 C;  3B6F A;  5B24 D;  3MVD C;  3MNN C;  4XUJ A;  2F8N G;  2NQB A;  3KWQ A;  5G49 B;  5B31 C;  2F8N B;  1P3K D;  3AZK D;  1M1A A;  4J8U D;  1HQ3 B;  3WA9 B;  3AZM B;  5AVB C;  1P3M C;  3AZJ D;  2ARO A;  3B0B A;  1F66 C;  3MGP A;  3VH5 A;  3LEL A;  2PYO C;  1P3F B;  4XZQ B;  3REK D;  3AYW D;  2CWE A;  4WU8 B;  1P3O B;  1P3I A;  5B0Z B;  3O62 A;  3LZ1 C;  5B24 A;  1N1J A;  3X1U B;  3NQJ B;  5DNN B;  1S32 A;  1ZLA D;  5KDM B;  3AZF C;  1P3K A;  3AZK A;  4EO5 C;  5CP6 B;  4J8U A;  2NZD C;  1TZY B;  3C1C B;  4J8V D;  5GT0 D;  4G92 B;  4KUD A;  1Q9C A;  4KHA A;  3W96 D;  5AV6 B;  1R4V A;  3AZI C;  5AY8 B;  3AN2 D;  5C3I C;  3WTP C;  4H9P A;  3KUY D;  4ZUX C;  3TU4 C;  1P34 C;  5AVC D;  3KSY A;  3AFA D;  1EQZ C;  4J8W D;  3UTB C;  4QLC D;  1B6W A;  3B0C W;  3AZH B;  3W98 A;  3LJA A;  4X23 B;  3MVD B;  3REH B;  5B33 B;  3UTA B;  3W97 C;  4YM6 D;  5B2J C;  5B32 A;  5B31 D;  4J8V A;  3UT9 C;  5GT0 A;  5CPJ C;  1P3B D;  3X1V D;  1A7W A;  1KX4 A;  3X1T B;  2F8N H;  3REL A;  3AN2 A;  4Z2M H;  5BNV A;  3WKJ D;  5AVB D;  1P3P D;  3AFA A;  4JJN D;  5E5A D;  4J8W A;  2PYO B;  4ZBJ B;  1KX5 A;  5DNM D;  3KXB A;  4UUZ B;  3AZE B;  4H9N B;  3AZL D;  5CPK A;  4Z66 C;  3AZG D;  5B1M B;  3REI D;  1KX3 D;  1M19 D;  3MGS B;  3W99 A;  3MNN A;  5BO0 B;  3X1S D;  5F99 D;  5B31 A;  2NZD B;  1HQ3 C;  5B0Y B;  5AV5 B;  3MGQ D;  3B6G D;  4E44 A;  3X1V A;  1P3B A;  4H9Q B;  5GXQ D;  4H9S C;  1P34 B;  4ZUX B;  5BS7 A;  5AVB A;  3TU4 B;  3AV2 C;  1P3P A;  4XZQ C;  4JJN A;  1P3M A;  1EQZ B;  4KGC D;  4WU9 D;  1F66 A;  4NE3 A;  4WU8 C;  1P3O C;  4LD9 B;  4NFT A;  4R8P D;  5B0Z C;  1U35 D;  3AZG A;  3X1U C;  4XUJ D;  4H9O B;  5AV9 C;  1M19 A;  5JRG B;  3LZ1 A;  1P3G B;  4DRB A;  3AZN D;  3LZ0 C;  3C1C C;  2LY8 A;  2YFW B;  3UT9 B;  3AZF A;  2F8N K;  4G92 C;  1U35 A;  3C1B D;  3MGQ A;  5B2J D;  1P3A C;  5AV8 B;  2ARO D;  5BNX A;  4Z5T D;  4WV4 B;  3LEL D;  3AZI A;  3WTP A;  3R45 A;  2HIO D;  4WU9 A;  3VH6 T;  3AZH C;  3UTB A;  1P3I D;  4R8P A;  4Z66 B;  1B67 A;  1P3L C;  4X23 C;  3REH C;  3UTA C;  5B33 C;  3MGR B;  2CV5 C;  1S32 D;  4Z2M G;  1ID3 B;  3AZN A;  5CPI B;  3W97 A;  2YFV A;  2FJ7 C;  3C1B A;  4KUD D;  4WNN B;  5B2J A;  3X1T C;  4YS3 C;  1HQ3 D;  3WA9 D;  3AZM D;  5CPJ A;  4Z5T A;  3B0D B;  3O62 B;  3AV2 B;  2HIO A;  4ZBJ C;  3AZE C;  1P3F D;  4XZQ D;  3V9R B;  3W98 D;  3LJA D;  5FUG B;  5B1M C;  4CAY B;  5B0Z D;  3MGS C;  5AV9 B;  5DNN D;  3AZJ B;  1HTA A;  3AV1 B;  5B32 D;  5G49 A;  4H9R B;  3LZ0 B;  2F8N A;  5B0Y C;  1F1E A;  5CP6 D;  5AV5 C;  1TZY D;  1P3A B;  3REK B;  1KX4 D;  3AYW B;  5B1L C;  3REL D;  1HQ3 A;  4NE6 A;  1AOI B;  3WA9 A;  3AZM A;  3NQU B;  5AV6 D;  5AY8 D;  1KX5 D;  4H9S A;  3KXB D;  1JFI B;  1ZLA B;  5CPK D;  1BH8 B;  4XZQ A;  1P3F A;  4LD9 C;  1P3L B;  4WU8 A;  1P3O A;  4AWL B;  2CV5 B;  1TAF B;  5B2I C;  5B40 C;  3VH6 W;  5B0Z A;  3W96 B;  3W99 D;  5JRG C;  1P3G C;  3X1U A;  3MNN D;  3NQJ A;  5DNN A;  3MVD D;  2L5A A;  3WTP E;  3KUY B;  1M18 B;  5AVC B;  5KDM A;  3A6N B;  5CP6 A;  2FJ7 B;  5AV8 C;  2BYK A;  1TZY A;  5GSU C;  3C1C A;  4QLC B;  4YS3 B;  3X1T D;  5AV6 A;  3B6F C;  5AY8 A;  1P3M D;  3WAA B;  5BT1 C;  1F66 D;  2PYO D;  4CSR B;  5B31 G;  4YM6 B;  3MGR C;  3AZH A;  1ID3 C;  4NE5 A;  3LZ1 D;  5B1M D;  4X23 A;  3MVD A;  3REH A;  5B33 A;  3UTA A;  5CPI C;  3WKJ B;  3MGP C;  3AZF D;  5E5A B;  4WZS B;  2NZD D;  4DRA A;  5DNM B;  5B0Y D;  5B1L B;  3AZL B;  3X1T A;  3B0D C;  3O62 C;  3AZI D;  5B24 C;  3WTP D;  2HUE B;  3REI B;  1P34 D;  4ZUX D;  1H3O A;  3TU4 D;  2BYM B;  1KX3 B;  1EQZ D;  5JA4 B;  1P3K C;  5GT3 B;  3UTB D;  2PYO A;  3X1S B;  4UUZ A;  5F99 B;  3AZE A;  4H9N A;  3B6G B;  5B40 B;  5B2I B;  5B1M A;  3AZJ C;  3AV1 C;  5GXQ B;  4J8X B;  3W97 D;  1BH9 A;  5BO0 A;  3REJ B;  3REK C;  4KGC B;  3AYW C;  2NZD A;  5GSU B;  3UT9 D;  5B0Y A;  4HGA B;  5AV5 A;  1AOI C;  5CPJ D;  4H9Q A;  1U35 B;  3B6F B;  4XUJ B;  2NQB B;  1P34 A;  3KWQ B;  4ZUX A;  3TU4 A;  1ZLA C;  1EQZ A;  1M1A B;  2IO5 C;  4J8V C;  5GT0 C;  4AWL C;  4LD9 A;  4Z66 D;  3W96 C;  4H9O A;  2ARO B;  3KUY C;  4Z5T B;  1M18 C;  1ID3 D;  2F8N D;  5AVC C;  3AFA C;  5JRG A;  3A6N C;  3MGP B;  1P3G A;  3LEL B;  4J8W C;  5CPI D;  2YFW A;  4QLC C;  3UT9 A;  3VH6 A;  1P3I B;  5AV8 A;  2JSS A;  5B24 B;  1N1J B;  3WAA C;  1S32 B;  3VH5 T;  3AV2 D;  1BFM A;  1P3K B;  3AZK B;  4J8U B;  2RVQ C;  4YM6 C;  4WU8 D;  1P3O D;  1P3B C;  3X1V C;  4Z66 A;  4KUD B;  4KHA B;  3X1U D;  3MGR A;  3WKJ C;  4H9P B;  1ID3 A;  5BS7 C;  1P3P C;  5AV9 D;  4JJN C;  3AV1 D;  5E5A C;  3LZ0 D;  5CPI A;  5DNM C;  3C1C D;  3AZL C;  4M6B A;  4WNN A;  1P3A D;  3W98 B;  3LJA B;  3AZG C;  2HUE C;  1AOI D;  3REI C;  1KX3 C;  1M19 C;  3AV2 A;  5GT3 C;  5B32 G;  3X1S C;  2IO5 B;  5B32 B;  5F99 C;  4J8V B;  3V9R A;  3AZH D;  5GT0 B;  3MGQ C;  3B6G C;  4G91 B;  2BYK B;  5FUG A;  1P3L D;  1KX4 B;  1KU5 A;  4X23 D;  3REH D;  4CAY A;  5GXQ C;  5B33 D;  3REL B;  3UTA D;  5BNV B;  3AN2 B;  4J8X C;  2CV5 D;  5AV9 A;  3AFA B;  3AV1 A;  3AZJ A;  4J8W B;  3REJ C;  4KGC C;  4WU9 C;  1M18 D;  4H9R A;  3LZ0 A;  1KX5 B;  3KXB B;  3A6N D;  4HGA C;  5CPK B;  2FJ7 D;  4R8P C;  1P3A A;  3REK A;  1U35 C;  3AYW A;  4YS3 D;  1WWI A;  4XUJ C;  1AOI A;  2NQB C;  3NQU A;  3KWQ C;  1M1A C;  3W99 B;  3WAA D;  3MNN B;  3AZN C;  1JFI A;  1ZLA A;  5B31 B;  3AZE D;  1BH8 A;  3VH5 W;  3C1B C;  2RVQ D;  1P3B B;  3X1V B;  1P3L A;  2ARO C;  2CV5 A;  1TAF A;  4Z5T C;  3W96 A;  3MGS D;  5AVB B;  1P3P B;  3LEL C;  4JJN B;  2HIO C;  1P3M B;  3KUY A;  1M18 A;  1H3O B;  1F66 B;  5AVC A;  3A6N A;  5AV5 D;  1P3I C;  2FJ7 A;  4QLC A;  3AZG B;  5B1L D;  4YS3 A;  1S32 C;  4E45 A;  1M19 B;  3LZ1 B;  3AZK C;  4J8U C;  3WAA A;  5GT3 D;  4CSR A;  1BH9 B;  3AZF B;  4LD9 D;  4KUD C;  4EO5 B;  3MGQ B;  4YM6 A;  3WA9 C;  1WWS A;  5BNX B;  5B40 D;  5B2I D;  3AZM C;  1ULY A;  3MGS A;  5JRG D;  1P3G D;  3AZI B;  3WTP B;  3R45 B;  5C3I B;  4J8X D;  4WU9 B;  3WKJ A;  1P3F C;  5E5A A;  3REJ D;  3UTB B;  5AV8 D;  3W98 C;  3LJA C;  4R8P B;  5GSU D;  5DNM A;  5B1L A;  3AZL A;  3B6F D;  5DNN C;  2NQB D;  3REI A;  3KWQ D;  5BT1 D;  5B32 C;  2BYM A;  3AZN B;  1KX3 A;  5JA4 A;  1M1A D;  2YFV B;  5GT3 A;  3W97 B;  5CP6 C;  4G91 C;  3C1B B;  1TZY C;  3X1S A;  5B2J B;  1KX4 C;  5F99 A;  3REL C;  3AN2 C;  3MGR D;  5CPJ B;  5B40 A;  5B2I A;  3B6G A;  5AV6 C;  5AY8 C;  5CHL B;  5GXQ A;  2HIO B;  1KX5 C;  3B0C T;  3KXB C;  4J8X A;  3MGP D;  5CPK C;  3REJ A;  4KGC A;  5GSU A;  3O62 D; 
#chains in the Genus database with same CATH topology
 3W99 C;  3B6F A;  5B24 D;  3MVD C;  3MNN C;  4XUJ A;  2F8N G;  3KFU G;  2NQB A;  3KWQ A;  5G49 B;  5B31 C;  2F8N B;  1P3K D;  3AZK D;  1M1A A;  4J8U D;  2G5H C;  1HQ3 B;  3WA9 B;  3H0L C;  3AZM B;  5AVB C;  1P3M C;  3AZJ D;  2ARO A;  4WJ3 C;  3B0B A;  1T3U A;  3H0M C;  1F66 C;  3MGP A;  3VH5 A;  3LEL A;  2PYO C;  1P3F B;  4XZQ B;  3REK D;  3AYW D;  2CWE A;  4WU8 B;  1P3O B;  1P3I A;  5B0Z B;  3O62 A;  3LZ1 C;  5B24 A;  1N1J A;  3X1U B;  3NQJ B;  5DNN B;  1S32 A;  1ZLA D;  5KDM B;  3AZF C;  1P3K A;  3AZK A;  4EO5 C;  5CP6 B;  4J8U A;  2NZD C;  1TZY B;  3C1C B;  4J8V D;  5GT0 D;  2G5I C;  4G92 B;  4KUD A;  1Q9C A;  4KHA A;  3W96 D;  5AV6 B;  1R4V A;  3AZI C;  2J8P A;  3H0R C;  5C3I C;  5AY8 B;  3WTP C;  3AN2 D;  4H9P A;  3KUY D;  4ZUX C;  3TU4 C;  1P34 C;  5AVC D;  3KSY A;  3AFA D;  1EQZ C;  4J8W D;  3UTB C;  4QLC D;  1B6W A;  3B0C W;  3AZH B;  3W98 A;  3LJA A;  4X23 B;  3MVD B;  3REH B;  5B33 B;  3UTA B;  3W97 C;  5B2J C;  4YM6 D;  5B32 A;  5B31 D;  4J8V A;  3UT9 C;  5GT0 A;  5CPJ C;  1P3B D;  3X1V D;  1A7W A;  1KX4 A;  3X1T B;  2F8N H;  3REL A;  3AN2 A;  4Z2M H;  5BNV A;  3WKJ D;  5AVB D;  1P3P D;  3AFA A;  4JJN D;  5E5A D;  4J8W A;  2PYO B;  2ZY5 A;  4ZBJ B;  1KX5 A;  5DNM D;  3KXB A;  4UUZ B;  3AZE B;  4H9N B;  3AZL D;  5CPK A;  4Z66 C;  3AZG D;  2JCH A;  5B1M B;  3REI D;  1KX3 D;  1M19 D;  3MGS B;  3W99 A;  3MNN A;  5BO0 B;  3X1S D;  5F99 D;  5B31 A;  3EPJ A;  2NZD B;  1HQ3 C;  5B0Y B;  5AV5 B;  3MGQ D;  3B6G D;  4E44 A;  3X1V A;  1P3B A;  4H9Q B;  5GXQ D;  4H9S C;  1P34 B;  4ZUX B;  5BS7 A;  5AVB A;  3TU4 B;  3AV2 C;  1P3P A;  4XZQ C;  4JJN A;  1P3M A;  1EQZ B;  4KGC D;  4WU9 D;  1F66 A;  4NE3 A;  4WU8 C;  1P3O C;  4LD9 B;  4NFT A;  4R8P D;  5B0Z C;  1U35 D;  3AZG A;  3X1U C;  4XUJ D;  4H9O B;  5AV9 C;  1M19 A;  5JRG B;  3LZ1 A;  1PZR A;  4DRB A;  1P3G B;  3AZN D;  3LZ0 C;  3C1C C;  2LY8 A;  2YFW B;  3UT9 B;  3AZF A;  2F8N K;  4G92 C;  1U35 A;  3C1B D;  3MGQ A;  5B2J D;  1P3A C;  5AV8 B;  2ARO D;  5BNX A;  4Z5T D;  4WV4 B;  3LEL D;  3AZI A;  3WTP A;  3R45 A;  2HIO D;  2UWX A;  4WU9 A;  3FDD A;  3VH6 T;  2BG1 A;  3AZH C;  3UTB A;  1P3I D;  4R8P A;  4Z66 B;  1B67 A;  1P3L C;  4X23 C;  3REH C;  3UTA C;  5B33 C;  3MGR B;  2CV5 C;  1S32 D;  4Z2M G;  1ID3 B;  3AZN A;  5CPI B;  3W97 A;  2YFV A;  2FJ7 C;  3C1B A;  4KUD D;  4WNN B;  5B2J A;  3X1T C;  4YS3 C;  1HQ3 D;  3WA9 D;  3AZM D;  5CPJ A;  4Z5T A;  3B0D B;  3O62 B;  3AV2 B;  3EPH A;  2HIO A;  4ZBJ C;  1W2E A;  3AZE C;  1P3F D;  4XZQ D;  3V9R B;  3W98 D;  3LJA D;  5FUG B;  5B1M C;  4UPK A;  4CAY B;  5B0Z D;  3MGS C;  5AV9 B;  5DNN D;  3AZJ B;  1HTA A;  3AV1 B;  5B32 D;  5G49 A;  4H9R B;  3LZ0 B;  2F8N A;  5B0Y C;  1F1E A;  5CP6 D;  5AV5 C;  1TZY D;  1P3A B;  3REK B;  1KX4 D;  3AYW B;  5B1L C;  3REL D;  1HQ3 A;  4NE6 A;  1AOI B;  3WA9 A;  3AZM A;  3NQU B;  5AV6 D;  2FFF B;  5AY8 D;  1KX5 D;  4H9S A;  3KXB D;  1JFI B;  1ZLA B;  5CPK D;  1BH8 B;  4XZQ A;  1P3F A;  4LD9 C;  2Y2N A;  1P3L B;  4WU8 A;  1P3O A;  4AWL B;  2CV5 B;  1TAF B;  5B2I C;  5B40 C;  3VH6 W;  2Y2P A;  5B0Z A;  2XD1 A;  3W96 B;  3W99 D;  5JRG C;  1P3G C;  2Y2O A;  3X1U A;  3MNN D;  3NQJ A;  5DNN A;  3MVD D;  2L5A A;  3WTP E;  3KUY B;  1M18 B;  5AVC B;  5KDM A;  3A6N B;  5CP6 A;  2Y2K A;  5AV8 C;  2BYK A;  3EPL A;  1TZY A;  5GSU C;  3C1C A;  2FJ7 B;  4QLC B;  4YS3 B;  3X1T D;  5AV6 A;  3B6F C;  5AY8 A;  1P3M D;  3WAA B;  5BT1 C;  2ZY4 A;  1F66 D;  2PYO D;  4CSR B;  5B31 G;  4YM6 B;  3MGR C;  3AZH A;  1ID3 C;  4NE5 A;  3LZ1 D;  5B1M D;  4X23 A;  3MVD A;  3REH A;  5B33 A;  3UTA A;  5CPI C;  3WKJ B;  3MGP C;  3AZF D;  5E5A B;  4WZS B;  2NZD D;  4DRA A;  5DNM B;  5B0Y D;  5B1L B;  3AZL B;  3X1T A;  3B0D C;  3O62 C;  3AZI D;  5B24 C;  3WTP D;  2HUE B;  3REI B;  1P34 D;  4ZUX D;  1H3O A;  3TU4 D;  2BYM B;  2JE5 A;  1KX3 B;  1EQZ D;  5JA4 B;  1P3K C;  5GT3 B;  3UTB D;  2PYO A;  3X1S B;  4UUZ A;  5F99 B;  3AZE A;  4H9N A;  3B6G B;  5B40 B;  5B2I B;  5B1M A;  3AZJ C;  3AV1 C;  5GXQ B;  4J8X B;  3W97 D;  1BH9 A;  5BO0 A;  3REJ B;  3REK C;  4KGC B;  3AYW C;  2NZD A;  5GSU B;  3UT9 D;  5B0Y A;  4HGA B;  5AV5 A;  1AOI C;  5CPJ D;  4H9Q A;  1U35 B;  3B6F B;  2ZY2 A;  2Y2L A;  4XUJ B;  2NQB B;  1P34 A;  3KWQ B;  4ZUX A;  3TU4 A;  2Y2H A;  1ZLA C;  3P5J B;  1EQZ A;  1M1A B;  2IO5 C;  4J8V C;  2ZY3 A;  5GT0 C;  4AWL C;  4LD9 A;  4Z66 D;  3W96 C;  4H9O A;  2ARO B;  3KUY C;  4Z5T B;  1M18 C;  1ID3 D;  2F8N D;  5AVC C;  3AFA C;  5JRG A;  3A6N C;  3MGP B;  1P3G A;  3LEL B;  4J8W C;  5CPI D;  2Y2M A;  2YFW A;  4QLC C;  3UT9 A;  3VH6 A;  2DF4 C;  1P3I B;  2DQN C;  2JSS A;  5AV8 A;  5B24 B;  1N1J B;  3WAA C;  1S32 B;  3VH5 T;  3AV2 D;  1BFM A;  1P3K B;  3AZK B;  4J8U B;  2RVQ C;  4YM6 C;  4WU8 D;  1P3O D;  1P3B C;  3EG5 B;  3X1V C;  4Z66 A;  4KUD B;  4KHA B;  3EPK A;  3X1U D;  3A1I A;  3MGR A;  3WKJ C;  4H9P B;  1ID3 A;  5BS7 C;  1P3P C;  5AV9 D;  4JJN C;  3AV1 D;  5E5A C;  3LZ0 D;  5CPI A;  5DNM C;  3C1C D;  2RIQ A;  3AZL C;  4M6B A;  4WNN A;  1P3A D;  3W98 B;  3LJA B;  3AZG C;  2HUE C;  1AOI D;  3REI C;  1KX3 C;  1M19 C;  3AV2 A;  5GT3 C;  3A1K A;  2Y2I A;  5B32 G;  3X1S C;  2IO5 B;  5B32 B;  5F99 C;  3F6T A;  4J8V B;  3V9R A;  3AZH D;  5GT0 B;  3MGQ C;  3B6G C;  4G91 B;  2BYK B;  5FUG A;  1P3L D;  1KX4 B;  1KU5 A;  4X23 D;  3REH D;  4CAY A;  5GXQ C;  5B33 D;  2W8S A;  3REL B;  5BNV B;  3UTA D;  4J8X C;  3AN2 B;  5AV9 A;  3AFA B;  3AV1 A;  3AZJ A;  4J8W B;  3REJ C;  4KGC C;  4WU9 C;  1M18 D;  4H9R A;  3LZ0 A;  1KX5 B;  3KXB B;  3A6N D;  4HGA C;  5CPK B;  2FJ7 D;  4R8P C;  1P3A A;  3REK A;  1U35 C;  3AYW A;  4YS3 D;  1WWI A;  4XUJ C;  1AOI A;  2NQB C;  3AL0 C;  3NQU A;  3KWQ C;  1M1A C;  3W99 B;  3WAA D;  3MNN B;  3AZN C;  1JFI A;  1ZLA A;  5B31 B;  3AZE D;  1BH8 A;  2CV5 D;  3VH5 W;  3C1B C;  2RVQ D;  1P3B B;  3X1V B;  1P3L A;  2ARO C;  2CV5 A;  1TAF A;  4Z5T C;  1Z2C B;  3W96 A;  3MGS D;  5AVB B;  1P3P B;  3LEL C;  4JJN B;  2HIO C;  1P3M B;  3KUY A;  2XD5 A;  1H3O B;  1M18 A;  1F66 B;  5AVC A;  3A6N A;  5AV5 D;  1P3I C;  2FJ7 A;  4QLC A;  3IP4 C;  5B1L D;  3AZG B;  2F2A C;  4YS3 A;  2Y2G A;  1S32 C;  4E45 A;  1M19 B;  3LZ1 B;  3AZK C;  4J8U C;  3WAA A;  2Y2J A;  5GT3 D;  4CSR A;  1BH9 B;  3AZF B;  4LD9 D;  4KUD C;  4EO5 B;  3MGQ B;  4YM6 A;  4DQY B;  3WA9 C;  1WWS A;  5BNX B;  5B40 D;  5B2I D;  3AZM C;  1ULY A;  3MGS A;  5JRG D;  1P3G D;  3AZI B;  3WTP B;  3R45 B;  5C3I B;  4J8X D;  4WU9 B;  3WKJ A;  1P3F C;  5E5A A;  3REJ D;  3UTB B;  5AV8 D;  3W98 C;  3LJA C;  4R8P B;  5GSU D;  5DNM A;  5B1L A;  3AZL A;  2VQR A;  2Y2Q A;  3B6F D;  5DNN C;  2NQB D;  3REI A;  3KWQ D;  5BT1 D;  5B32 C;  2BYM A;  3AZN B;  1KX3 A;  5JA4 A;  1M1A D;  2YFV B;  5GT3 A;  2ZM5 A;  5CP6 C;  3W97 B;  4G91 C;  3C1B B;  1TZY C;  3X1S A;  5B2J B;  1KX4 C;  5F99 A;  3REL C;  3AN2 C;  3MGR D;  5CPJ B;  5B40 A;  5B2I A;  3B6G A;  5AV6 C;  5AY8 C;  5CHL B;  5GXQ A;  2HIO B;  1KX5 C;  3B0C T;  3KXB C;  4J8X A;  3MGP D;  5CPK C;  3REJ A;  4KGC A;  5GSU A;  3O62 D; 
#chains in the Genus database with same CATH homology
 3W99 C;  3B6F A;  5B24 D;  3MVD C;  3MNN C;  4XUJ A;  2F8N G;  3KFU G;  2NQB A;  3KWQ A;  5G49 B;  5B31 C;  2F8N B;  1P3K D;  3AZK D;  1M1A A;  4J8U D;  2G5H C;  1HQ3 B;  3WA9 B;  3H0L C;  3AZM B;  5AVB C;  1P3M C;  3AZJ D;  2ARO A;  4WJ3 C;  3B0B A;  1T3U A;  3H0M C;  1F66 C;  3MGP A;  3VH5 A;  3LEL A;  2PYO C;  1P3F B;  4XZQ B;  3REK D;  3AYW D;  2CWE A;  4WU8 B;  1P3O B;  1P3I A;  5B0Z B;  3O62 A;  3LZ1 C;  5B24 A;  1N1J A;  3X1U B;  3NQJ B;  5DNN B;  1S32 A;  1ZLA D;  5KDM B;  3AZF C;  1P3K A;  3AZK A;  4EO5 C;  5CP6 B;  4J8U A;  2NZD C;  1TZY B;  3C1C B;  4J8V D;  5GT0 D;  2G5I C;  4G92 B;  4KUD A;  1Q9C A;  4KHA A;  3W96 D;  5AV6 B;  1R4V A;  3AZI C;  2J8P A;  3H0R C;  5C3I C;  5AY8 B;  3WTP C;  3AN2 D;  4H9P A;  3KUY D;  4ZUX C;  3TU4 C;  1P34 C;  5AVC D;  3KSY A;  3AFA D;  1EQZ C;  4J8W D;  3UTB C;  4QLC D;  1B6W A;  3B0C W;  3AZH B;  3W98 A;  3LJA A;  4X23 B;  3MVD B;  3REH B;  5B33 B;  3UTA B;  3W97 C;  5B2J C;  4YM6 D;  5B32 A;  5B31 D;  4J8V A;  3UT9 C;  5GT0 A;  5CPJ C;  1P3B D;  3X1V D;  1A7W A;  1KX4 A;  3X1T B;  2F8N H;  3REL A;  3AN2 A;  4Z2M H;  5BNV A;  3WKJ D;  5AVB D;  1P3P D;  3AFA A;  4JJN D;  5E5A D;  4J8W A;  2PYO B;  2ZY5 A;  4ZBJ B;  1KX5 A;  5DNM D;  3KXB A;  4UUZ B;  3AZE B;  4H9N B;  3AZL D;  5CPK A;  4Z66 C;  3AZG D;  2JCH A;  5B1M B;  3REI D;  1KX3 D;  1M19 D;  3MGS B;  3W99 A;  3MNN A;  5BO0 B;  3X1S D;  5F99 D;  5B31 A;  3EPJ A;  2NZD B;  1HQ3 C;  5B0Y B;  5AV5 B;  3MGQ D;  3B6G D;  4E44 A;  3X1V A;  1P3B A;  4H9Q B;  5GXQ D;  4H9S C;  1P34 B;  4ZUX B;  5BS7 A;  5AVB A;  3TU4 B;  3AV2 C;  1P3P A;  4XZQ C;  4JJN A;  1P3M A;  1EQZ B;  4KGC D;  4WU9 D;  1F66 A;  4NE3 A;  4WU8 C;  1P3O C;  4LD9 B;  4NFT A;  4R8P D;  5B0Z C;  1U35 D;  3AZG A;  3X1U C;  4XUJ D;  4H9O B;  5AV9 C;  1M19 A;  5JRG B;  3LZ1 A;  1PZR A;  4DRB A;  1P3G B;  3AZN D;  3LZ0 C;  3C1C C;  2LY8 A;  2YFW B;  3UT9 B;  3AZF A;  2F8N K;  4G92 C;  1U35 A;  3C1B D;  3MGQ A;  5B2J D;  1P3A C;  5AV8 B;  2ARO D;  5BNX A;  4Z5T D;  4WV4 B;  3LEL D;  3AZI A;  3WTP A;  3R45 A;  2HIO D;  2UWX A;  4WU9 A;  3FDD A;  3VH6 T;  2BG1 A;  3AZH C;  3UTB A;  1P3I D;  4R8P A;  4Z66 B;  1B67 A;  1P3L C;  4X23 C;  3REH C;  3UTA C;  5B33 C;  3MGR B;  2CV5 C;  1S32 D;  4Z2M G;  1ID3 B;  3AZN A;  5CPI B;  3W97 A;  2YFV A;  2FJ7 C;  3C1B A;  4KUD D;  4WNN B;  5B2J A;  3X1T C;  4YS3 C;  1HQ3 D;  3WA9 D;  3AZM D;  5CPJ A;  4Z5T A;  3B0D B;  3O62 B;  3AV2 B;  3EPH A;  2HIO A;  4ZBJ C;  1W2E A;  3AZE C;  1P3F D;  4XZQ D;  3V9R B;  3W98 D;  3LJA D;  5FUG B;  5B1M C;  4UPK A;  4CAY B;  5B0Z D;  3MGS C;  5AV9 B;  5DNN D;  3AZJ B;  1HTA A;  3AV1 B;  5B32 D;  5G49 A;  4H9R B;  3LZ0 B;  2F8N A;  5B0Y C;  1F1E A;  5CP6 D;  5AV5 C;  1TZY D;  1P3A B;  3REK B;  1KX4 D;  3AYW B;  5B1L C;  3REL D;  1HQ3 A;  4NE6 A;  1AOI B;  3WA9 A;  3AZM A;  3NQU B;  5AV6 D;  2FFF B;  5AY8 D;  1KX5 D;  4H9S A;  3KXB D;  1JFI B;  1ZLA B;  5CPK D;  1BH8 B;  4XZQ A;  1P3F A;  4LD9 C;  2Y2N A;  1P3L B;  4WU8 A;  1P3O A;  4AWL B;  2CV5 B;  1TAF B;  5B2I C;  5B40 C;  3VH6 W;  2Y2P A;  5B0Z A;  2XD1 A;  3W96 B;  3W99 D;  5JRG C;  1P3G C;  2Y2O A;  3X1U A;  3MNN D;  3NQJ A;  5DNN A;  3MVD D;  2L5A A;  3WTP E;  3KUY B;  1M18 B;  5AVC B;  5KDM A;  3A6N B;  5CP6 A;  2Y2K A;  5AV8 C;  2BYK A;  3EPL A;  1TZY A;  5GSU C;  3C1C A;  2FJ7 B;  4QLC B;  4YS3 B;  3X1T D;  5AV6 A;  3B6F C;  5AY8 A;  1P3M D;  3WAA B;  5BT1 C;  2ZY4 A;  1F66 D;  2PYO D;  4CSR B;  5B31 G;  4YM6 B;  3MGR C;  3AZH A;  1ID3 C;  4NE5 A;  3LZ1 D;  5B1M D;  4X23 A;  3MVD A;  3REH A;  5B33 A;  3UTA A;  5CPI C;  3WKJ B;  3MGP C;  3AZF D;  5E5A B;  4WZS B;  2NZD D;  4DRA A;  5DNM B;  5B0Y D;  5B1L B;  3AZL B;  3X1T A;  3B0D C;  3O62 C;  3AZI D;  5B24 C;  3WTP D;  2HUE B;  3REI B;  1P34 D;  4ZUX D;  1H3O A;  3TU4 D;  2BYM B;  2JE5 A;  1KX3 B;  1EQZ D;  5JA4 B;  1P3K C;  5GT3 B;  3UTB D;  2PYO A;  3X1S B;  4UUZ A;  5F99 B;  3AZE A;  4H9N A;  3B6G B;  5B40 B;  5B2I B;  5B1M A;  3AZJ C;  3AV1 C;  5GXQ B;  4J8X B;  3W97 D;  1BH9 A;  5BO0 A;  3REJ B;  3REK C;  4KGC B;  3AYW C;  2NZD A;  5GSU B;  3UT9 D;  5B0Y A;  4HGA B;  5AV5 A;  1AOI C;  5CPJ D;  4H9Q A;  1U35 B;  3B6F B;  2ZY2 A;  2Y2L A;  4XUJ B;  2NQB B;  1P34 A;  3KWQ B;  4ZUX A;  3TU4 A;  2Y2H A;  1ZLA C;  3P5J B;  1EQZ A;  1M1A B;  2IO5 C;  4J8V C;  2ZY3 A;  5GT0 C;  4AWL C;  4LD9 A;  4Z66 D;  3W96 C;  4H9O A;  2ARO B;  3KUY C;  4Z5T B;  1M18 C;  1ID3 D;  2F8N D;  5AVC C;  3AFA C;  5JRG A;  3A6N C;  3MGP B;  1P3G A;  3LEL B;  4J8W C;  5CPI D;  2Y2M A;  2YFW A;  4QLC C;  3UT9 A;  3VH6 A;  2DF4 C;  1P3I B;  2DQN C;  2JSS A;  5AV8 A;  5B24 B;  1N1J B;  3WAA C;  1S32 B;  3VH5 T;  3AV2 D;  1BFM A;  1P3K B;  3AZK B;  4J8U B;  2RVQ C;  4YM6 C;  4WU8 D;  1P3O D;  1P3B C;  3EG5 B;  3X1V C;  4Z66 A;  4KUD B;  4KHA B;  3EPK A;  3X1U D;  3A1I A;  3MGR A;  3WKJ C;  4H9P B;  1ID3 A;  5BS7 C;  1P3P C;  5AV9 D;  4JJN C;  3AV1 D;  5E5A C;  3LZ0 D;  5CPI A;  5DNM C;  3C1C D;  2RIQ A;  3AZL C;  4M6B A;  4WNN A;  1P3A D;  3W98 B;  3LJA B;  3AZG C;  2HUE C;  1AOI D;  3REI C;  1KX3 C;  1M19 C;  3AV2 A;  5GT3 C;  3A1K A;  2Y2I A;  5B32 G;  3X1S C;  2IO5 B;  5B32 B;  5F99 C;  3F6T A;  4J8V B;  3V9R A;  3AZH D;  5GT0 B;  3MGQ C;  3B6G C;  4G91 B;  2BYK B;  5FUG A;  1P3L D;  1KX4 B;  1KU5 A;  4X23 D;  3REH D;  4CAY A;  5GXQ C;  5B33 D;  2W8S A;  3REL B;  5BNV B;  3UTA D;  4J8X C;  3AN2 B;  5AV9 A;  3AFA B;  3AV1 A;  3AZJ A;  4J8W B;  3REJ C;  4KGC C;  4WU9 C;  1M18 D;  4H9R A;  3LZ0 A;  1KX5 B;  3KXB B;  3A6N D;  4HGA C;  5CPK B;  2FJ7 D;  4R8P C;  1P3A A;  3REK A;  1U35 C;  3AYW A;  4YS3 D;  1WWI A;  4XUJ C;  1AOI A;  2NQB C;  3AL0 C;  3NQU A;  3KWQ C;  1M1A C;  3W99 B;  3WAA D;  3MNN B;  3AZN C;  1JFI A;  1ZLA A;  5B31 B;  3AZE D;  1BH8 A;  2CV5 D;  3VH5 W;  3C1B C;  2RVQ D;  1P3B B;  3X1V B;  1P3L A;  2ARO C;  2CV5 A;  1TAF A;  4Z5T C;  1Z2C B;  3W96 A;  3MGS D;  5AVB B;  1P3P B;  3LEL C;  4JJN B;  2HIO C;  1P3M B;  3KUY A;  2XD5 A;  1H3O B;  1M18 A;  1F66 B;  5AVC A;  3A6N A;  5AV5 D;  1P3I C;  2FJ7 A;  4QLC A;  3IP4 C;  5B1L D;  3AZG B;  2F2A C;  4YS3 A;  2Y2G A;  1S32 C;  4E45 A;  1M19 B;  3LZ1 B;  3AZK C;  4J8U C;  3WAA A;  2Y2J A;  5GT3 D;  4CSR A;  1BH9 B;  3AZF B;  4LD9 D;  4KUD C;  4EO5 B;  3MGQ B;  4YM6 A;  4DQY B;  3WA9 C;  1WWS A;  5BNX B;  5B40 D;  5B2I D;  3AZM C;  1ULY A;  3MGS A;  5JRG D;  1P3G D;  3AZI B;  3WTP B;  3R45 B;  5C3I B;  4J8X D;  4WU9 B;  3WKJ A;  1P3F C;  5E5A A;  3REJ D;  3UTB B;  5AV8 D;  3W98 C;  3LJA C;  4R8P B;  5GSU D;  5DNM A;  5B1L A;  3AZL A;  2VQR A;  2Y2Q A;  3B6F D;  5DNN C;  2NQB D;  3REI A;  3KWQ D;  5BT1 D;  5B32 C;  2BYM A;  3AZN B;  1KX3 A;  5JA4 A;  1M1A D;  2YFV B;  5GT3 A;  2ZM5 A;  5CP6 C;  3W97 B;  4G91 C;  3C1B B;  1TZY C;  3X1S A;  5B2J B;  1KX4 C;  5F99 A;  3REL C;  3AN2 C;  3MGR D;  5CPJ B;  5B40 A;  5B2I A;  3B6G A;  5AV6 C;  5AY8 C;  5CHL B;  5GXQ A;  2HIO B;  1KX5 C;  3B0C T;  3KXB C;  4J8X A;  3MGP D;  5CPK C;  3REJ A;  4KGC A;  5GSU A;  3O62 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...