1KX3D

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3D00
1WWIA 5AV8B 3LZ1B 3VH5A 3AZIA 1Q9CA 3B6GB 3REID 5B2JD 5B31B 5DNNA 4ZBJB 3UTAB 1P3FB 1ID3A 4QLCA 2YFVB 3W98A 4H9SC 5GXQA 4DRAA 5B33C 1KX4D 3C1BA 5E5AA 1ZLAA 4CSRB 4H9NB 4XZQC 3W99B 3KWQD 5CPJA 5FUGB 3AZIC 4EO5C 3WTPE 4WNNA 3REKC 5DNNC 4E44A 1P3AA 5CPKB 3C1CD 4JJNA 1KX5A 4J8UB 1M18B 3AZLB 1ZLAC 3NQUB 5AV5A 3AZMD 3AZEA 1P34D 3TU4C 1HQ3A 4KHAA 5B2IB 5AVCA 2F8NG 4Z5TA 5B32G 3AZKA 4WU9B 1M19D 1KX5C 3W96A 4LD9A 3MGSB 3LELD 4X23D 1HQ3C 3B0DC 5B31C 1U35B 4ZBJC 1P3FC 4NE5A 4Z5TC 3WA9B 5B32D 3W96C 4J8WB 4Z2MG 3LJAA 1TZYD 2NZDB 3AFAC 3A6NB 3LZ0A 1P3GA 3AZHB 3VH6T 2AROA 3AZID 5JRGA 2BYKB 5G49B 5CPKC 5AV9C 5DNND 3W98D 1M18C 4QLCD 1ID3D 5GXQD 3MVDA 3C1BD 5E5AD 3WKJA 1F1EA 2AROC 5B24A 1N1JA 5CPJD 3REIB 1P3AD 5B2JB 5B0ZB 4JJND 1P3PA 3WKJC 3RELB 1KX4B 5AV5D 3AZED 3MNND 4J8VC 3AZFA 1P3BB 4H9OB 3KWQB 3WA9C 3AN2B 5AVCD 5DNMA 3AZKD 3C1CB 1P3PC 1M1AC 4LD9D 5BNXB 3AZMB 3AZFC 1BFMA 1KX3D 4WZSB 3R45B 1P34B 4YS3B 1JFIA 3REHD 3MGPA 1WWSA 5AV6A 3VH6A 4CAYA 3X1UC 1TAFB 1AOIB 5B0YB 3VH5T 1P3MB 3LJAD 1M19B 2IO5B 1EQZD 1KU5A 3NQJA 3LZ0D 1P3GD 5B1MD 1B67A 5JRGD 2BYMB 5B2JC 3MGPC 3AZND 4NE6A 3W97A 3V9RA 1KX4C 4KUDD 3MVDD 5B33B 1S32A 5B24D 2F8NH 4H9PA 5BS7C 3AZIB 4EO5B 3UT9D 5DNNB 2L5AA 3W98B 4QLCB 5GXQB 3AZMC 3WAAD 5KDMA 3C1BB 5E5AB 4WU8D 1P3OD 1ZLAB 5CPJB 2F8NA 4WNNB 4J8XD 4Z2MH 5B32A 5DNMD 1TZYA 1KX5B 3LELC 4X23C 5AV5B 1H3OA 3AZEB 4KGCD 1ULYA 1HQ3B 3B0DB 3MGPD 4KHAB 3AV2A 5AV6D 5AVCB 5B32C 5B40A 4Z5TB 1TZYC 3W96B 5BT1C 5AVBD 3AFAB 3AV2C 3AZJD 3W98C 1ID3C 4QLCC 5AV9B 3W97D 5AY8D 5GXQC 5B40C 3C1BC 5E5AC 4G91C 5CPID 1S32D 3MNNA 2RVQD 5CPJC 1P3GB 4E45A 2AROB 5JRGB 1P3AC 4JJNC 4H9RA 4G92C 1P3LA 5AV5C 5GT0D 3AZEC 3MNNC 3MVDB 3WKJB 1KX3A 3X1TA 5B24B 1N1JB 2YFWA 4J8VB 3REHA 5AVCC 2FJ7D 2F8ND 2HIOA 3AZKC 4LD9C 1EQZA 1P3PB 5BT1D 5B1MA 1M1AB 1KX3C 3X1TC 3B0CT 3O62A 3REHC 3UTBA 3AZFB 3AZNA 3AV2D 2HIOC 4HGAC 4KUDA 5B40D 5F99D 3LJAC 1EQZC 3X1UB 3LZ0C 1P3GC 5B1MC 3AZGD 2CV5A 3O62C 5JRGC 1P3IA 5B1LA 3AZNC 3MGRD 1JFIB 4YM6D 4M6BA 3UT9A 2F8NK 3MGPB 3KXBA 4KUDC 3X1VD 3MVDC 4CAYB 3WAAA 5C3IC 4WU8A 1P3OA 5B24C 3NQJB 2CV5C 3AV1A 5B1LC 4WV4B 5GT3A 4DRBA 3UT9C 4J8XA 3KXBC 2NQBA 1P3LD 3V9RB 4AWLC 5GSUD 3W97B 3WAAC 2LY8A 5B31G 4WU8C 1P3OC 1S32B 3AV1C 3X1TD 4KGCA 4XUJD 1P3KA 4H9PB 1F66A 3WTPD 2HIOD 3KUYA 3A6NA 4H9QA 5DNMC 4J8XC 2NQBC 5AV8D 3LZ1D 3B6GD 5G49A 5AVBA 3UTAD 4KGCC 3LELB 3O62D 4X23B 3UTBD 5AV6C 3AYWA 3AZJA 3KUYC 1B6WA 5AY8A 3W99D 2F8NB 5B32B 5CPIA 1TZYB 5AVBC 2CV5D 1P3ID 5B1LD 1H3OB 3AZJC 3AZLD 3RELA 3W97C 3KXBD 5AY8C 3AV2B 1ID3B 5GT0A 5CPIC 5B40B 3MGQA 1S32C 2RVQC 5BNVA 4G91B 5CP6A 3AV1D 4ZUXA 4WU9D 5GT3D 2FJ7A 2NQBD 5JA4A 1P3AB 5GT0C 4UUZA 4JJNB 3B6FA 4NE3A 4G92B 5CP6C 3MNNB 2FJ7C 4R8PA 4J8WD 4NFTA 1P3KD 1F66D 3X1SA 3A6ND 3KUYD 5F99A 3AZKB 3B6FC 4H9RB 1P3LB 3AZGA 4LD9B 2JSSA 1KX3B 3X1TB 3MGRA 3AYWD 4YM6A 3B0BA 3REHB 3X1SC 2HIOB 4HGAB 5F99C 3X1VA 4XZQA 1BH9A 3LJAB 3AZGC 1EQZB 3LZ0B 3REJA 3REKA 5B0ZD 2PYOA 5B1MB 3MGRC 3O62B 4YM6C 3UTBB 1BH8A 3RELD 3AZNB 3VH5W 5BO0A 3X1VC 5GSUA 4KUDB 1P3BD 3MGQD 3TU4A 3AN2D 5CP6D 3REJC 4Z66A 2PYOC 5C3IB 2CV5B 4ZUXD 4XUJA 1P3IB 5B1LB 2HUEC 3WTPA 5AV8A 3UT9B 1P3LC 5GSUC 3KXBB 3LZ1A 3B6GA 3B6FD 4YS3D 4AWLB 5B31A 3WAAB 4Z66C 3UTAA 4WU8B 1P3FA 1P3OB 2YFVA 5CHLB 4XUJC 5B0YD 4R8PD 3AV1B 3WTPC 1P3MD 1AOID 5GT3B 3X1SD 4CSRA 4H9NA 5AV8C 4J8XB 3LZ1C 3W99A 3AFAA 1HTAA 5FUGA 5DNMB 3B6GC 2NQBB 3UTAC 5CPKA 5AV9A 3UTBC 1R4VA 4J8UA 4KGCB 1M18A 3AZLA 3NQUA 5B33D 3W99C 5AV6B 1P3KB 1F66B 3KUYB 4H9QB 4XZQD 5B2IA 3REJD 3REKD 5AVBB 1P3IC 2PYOD 4WU9A 4J8UC 3AZLC 3MGSA 3AYWB 3AZJB 1ZLAD 1U35A 5AY8B 4J8VA 5B2IC 3TU4D 5CPIB 4Z66D 3WA9A 4WU9C 5GT3C 4J8WA 2NZDA 1KX5D 3MGSC 3AZHA 1M1AA 1U35C 2BYKA 1HQ3D 5B31D 5GT0B 3MGQB 5KDMB 1P3FD 5BNVB 5CP6B 4Z5TD 4J8WC 1P3KC 1F66C 2NZDC 4ZUXB 3X1UA 2CWEA 3A6NC 2FJ7B 3W96D 3AZHC 5JA4B 3AFAD 4UUZB 3B6FB 3REIA 5B2JA 5B0ZA 5CPKD 5AV9D 3KSYA 4J8UD 3AYWC 1M18D 1KX4A 4R8PB 3X1SB 3VH6W 1P3BA 4H9OA 2AROD 5F99B 3B0CW 3KWQA 5B2ID 3AN2A 3REIC 5B0ZC 3AZGB 5BS7A 3C1CA 3RELC 3MGSD 5BNXA 3MGRB 4YM6B 3WKJD 3AZMA 1U35D 1P34A 3R45A 3KWQC 3MGQC 3X1VB 4YS3A 4J8VD 3AN2C 1P3BC 4XZQB 1BH9B 3WA9D 4ZUXC 3REJB 1A7WA 1TAFA 5B0YA 3C1CC 3REKB 1AOIA 1P3MA 1M19A 2PYOB 2NZDD 1P3PD 1BH8B 2HUEB 3AZHD 1M1AD 5BO0B 1P34C 3LELA 4YS3C 4X23A 2BYMA 5GSUB 3AZFD 3TU4B 5B33A 4Z66B 4R8PC 5B0YC 1AOIC 1P3MC 1M19C 2IO5C 2YFWB 4H9SA 3X1UD 4XUJB 3WTPB
chains in the Genus database with same CATH superfamily
1WWIA 5AV8B 3LZ1B 3VH5A 3AZIA 1Q9CA 3B6GB 3REID 5B2JD 5B31B 5DNNA 4ZBJB 3UTAB 1P3FB 1ID3A 4QLCA 2YFVB 3W98A 4H9SC 5GXQA 4DRAA 5B33C 1KX4D 3C1BA 5E5AA 1ZLAA 4CSRB 4H9NB 4XZQC 3W99B 4UPKA 3KWQD 5CPJA 5FUGB 3AZIC 4EO5C 3WTPE 4WNNA 1PZRA 2F2AC 2UWXA 4E44A 5DNNC 3REKC 1P3AA 5CPKB 3C1CD 4JJNA 1KX5A 4J8UB 1M18B 3AZLB 1ZLAC 3NQUB 5AV5A 3AZMD 3AZEA 1P34D 3TU4C 1HQ3A 4KHAA 5B2IB 5AVCA 2F8NG 4Z5TA 5B32G 3AZKA 4WU9B 1M19D 1KX5C 3W96A 4LD9A 3MGSB 3LELD 4X23D 1HQ3C 3B0DC 5B31C 1U35B 3EPHA 4ZBJC 1P3FC 4NE5A 4Z5TC 3WA9B 5B32D 2Y2IA 3W96C 4J8WB 4Z2MG 3LJAA 1TZYD 2NZDB 3AFAC 3A6NB 3LZ0A 1P3GA 3AZHB 3VH6T 2AROA 3AZID 5JRGA 2BYKB 5G49B 5CPKC 5AV9C 5DNND 3W98D 1M18C 4QLCD 1ID3D 5GXQD 3MVDA 3C1BD 5E5AD 3WKJA 1F1EA 2AROC 5B24A 1N1JA 5CPJD 2DQNC 3REIB 1P3AD 5B2JB 5B0ZB 3KFUG 4JJND 1P3PA 3WKJC 3RELB 2W8SA 5AV5D 1KX4B 2Y2OA 3AZED 3MNND 4J8VC 3AZFA 1P3BB 4H9OB 3KWQB 3WA9C 3AN2B 5AVCD 5DNMA 3AZKD 3C1CB 1P3PC 1M1AC 4LD9D 5BNXB 3AZMB 3AZFC 1BFMA 1KX3D 4WZSB 3R45B 1P34B 4YS3B 1JFIA 3REHD 3MGPA 1WWSA 5AV6A 3VH6A 4WJ3C 4CAYA 3X1UC 1TAFB 1AOIB 5B0YB 3VH5T 1P3MB 3LJAD 1M19B 2IO5B 2BG1A 1KU5A 3NQJA 2Y2PA 3LZ0D 1EQZD 1P3GD 5B1MD 1B67A 5JRGD 2BYMB 2JCHA 5B2JC 3MGPC 3AZND 4NE6A 3W97A 3V9RA 1KX4C 4KUDD 3MVDD 5B33B 1S32A 2ZY2A 5B24D 2F8NH 4H9PA 5BS7C 3AZIB 4EO5B 3UT9D 5DNNB 2L5AA 3W98B 4QLCB 5GXQB 3AZMC 3WAAD 5KDMA 3C1BB 5E5AB 4WU8D 1P3OD 1ZLAB 5CPJB 2F8NA 4WNNB 4J8XD 4Z2MH 5B32A 5DNMD 2VQRA 1TZYA 1KX5B 3LELC 4X23C 5AV5B 1H3OA 3AZEB 2Y2GA 4KGCD 1ULYA 1HQ3B 3B0DB 3MGPD 4KHAB 3AV2A 5AV6D 5AVCB 5B32C 5B40A 4Z5TB 1TZYC 3W96B 5BT1C 5AVBD 3AFAB 3AV2C 3AZJD 3W98C 1ID3C 4QLCC 5AV9B 3W97D 5AY8D 5GXQC 5B40C 3C1BC 5E5AC 4G91C 5CPID 2JE5A 1S32D 3MNNA 2RVQD 5CPJC 1P3GB 4E45A 2AROB 5JRGB 1P3AC 4JJNC 4H9RA 4G92C 1P3LA 5AV5C 5GT0D 3AZEC 3MNNC 3MVDB 3WKJB 1KX3A 3X1TA 5B24B 1N1JB 2YFWA 4J8VB 3REHA 5AVCC 2FJ7D 2F8ND 2HIOA 3AZKC 4LD9C 1EQZA 1P3PB 5BT1D 5B1MA 1M1AB 1KX3C 3X1TC 3B0CT 3O62A 3REHC 3UTBA 3AZFB 3AZNA 3AV2D 2HIOC 4HGAC 2XD1A 4KUDA 5B40D 5F99D 3LJAC 1EQZC 3X1UB 3LZ0C 1P3GC 5B1MC 3AZGD 2CV5A 3O62C 5JRGC 1P3IA 5B1LA 3AZNC 3MGRD 1JFIB 4YM6D 4M6BA 3UT9A 2F8NK 3MGPB 3KXBA 4KUDC 3A1IA 2G5IC 3X1VD 3MVDC 4CAYB 3EG5B 3WAAA 5C3IC 4WU8A 1P3OA 5B24C 3NQJB 2CV5C 3AV1A 5B1LC 2Y2QA 4WV4B 5GT3A 4DRBA 3UT9C 4J8XA 3KXBC 2NQBA 1P3LD 3V9RB 4AWLC 2G5HC 5GSUD 3W97B 3A1KA 3WAAC 3AL0C 2LY8A 5B31G 4WU8C 1P3OC 1S32B 3AV1C 3X1TD 4KGCA 4XUJD 1P3KA 4H9PB 1F66A 3WTPD 2HIOD 3KUYA 3A6NA 4H9QA 5DNMC 4J8XC 2NQBC 5AV8D 3LZ1D 3B6GD 5G49A 5AVBA 3UTAD 4KGCC 3LELB 3O62D 4X23B 2FFFB 3UTBD 2DF4C 5AV6C 3AYWA 3AZJA 3KUYC 1B6WA 5AY8A 2Y2JA 3W99D 2F8NB 5B32B 5CPIA 1TZYB 5AVBC 2CV5D 1P3ID 5B1LD 1H3OB 3AZJC 2ZY3A 3RELA 3AZLD 3W97C 3KXBD 5AY8C 3AV2B 3FDDA 1ID3B 5GT0A 5CPIC 5B40B 3MGQA 1S32C 2RVQC 3P5JB 5BNVA 4G91B 5CP6A 3AV1D 2ZM5A 4ZUXA 4WU9D 5GT3D 2FJ7A 2NQBD 5JA4A 1P3AB 1W2EA 5GT0C 4UUZA 4JJNB 3B6FA 2J8PA 4NE3A 4G92B 5CP6C 2ZY4A 3MNNB 3H0MC 2FJ7C 4R8PA 4J8WD 4NFTA 1P3KD 1F66D 2ZY5A 3X1SA 3A6ND 3KUYD 5F99A 3AZKB 3B6FC 4H9RB 1P3LB 2RIQA 3EPLA 3AZGA 4LD9B 2JSSA 1KX3B 3X1TB 3MGRA 3AYWD 4YM6A 3B0BA 3EPKA 3REHB 3X1SC 2Y2KA 2HIOB 4HGAB 5F99C 3X1VA 4XZQA 1BH9A 3LJAB 3AZGC 1EQZB 3LZ0B 3REJA 3REKA 5B0ZD 2PYOA 5B1MB 3MGRC 3O62B 4YM6C 3UTBB 1BH8A 3RELD 3AZNB 3VH5W 5BO0A 2Y2NA 3X1VC 5GSUA 4KUDB 1P3BD 3MGQD 3TU4A 3AN2D 3F6TA 5CP6D 3REJC 4Z66A 2PYOC 5C3IB 2CV5B 4ZUXD 4XUJA 1P3IB 5B1LB 2HUEC 3WTPA 5AV8A 3UT9B 1P3LC 5GSUC 3KXBB 3LZ1A 3B6GA 3B6FD 4YS3D 4AWLB 5B31A 3WAAB 4Z66C 3UTAA 4WU8B 1P3FA 1P3OB 2YFVA 5CHLB 4XUJC 5B0YD 4R8PD 3AV1B 3WTPC 1P3MD 1AOID 5GT3B 3X1SD 4CSRA 4H9NA 5AV8C 4J8XB 3LZ1C 3W99A 3AFAA 1HTAA 5FUGA 5DNMB 3B6GC 2NQBB 3UTAC 5CPKA 5AV9A 3UTBC 1R4VA 4J8UA 4KGCB 1M18A 3AZLA 3NQUA 1T3UA 5B33D 3W99C 5AV6B 3H0RC 1P3KB 1F66B 3KUYB 4H9QB 4XZQD 5B2IA 3REJD 3REKD 5AVBB 1P3IC 2PYOD 4WU9A 4J8UC 3AZLC 1Z2CB 3IP4C 3MGSA 3AYWB 3AZJB 1ZLAD 1U35A 5AY8B 4J8VA 5B2IC 3TU4D 5CPIB 4Z66D 3WA9A 4WU9C 5GT3C 4J8WA 2NZDA 1KX5D 2Y2HA 3MGSC 3AZHA 1M1AA 1U35C 2BYKA 1HQ3D 5B31D 5GT0B 3MGQB 5KDMB 1P3FD 5BNVB 5CP6B 4Z5TD 4J8WC 1P3KC 1F66C 2NZDC 4ZUXB 3X1UA 2CWEA 3A6NC 2FJ7B 3W96D 3AZHC 5JA4B 3AFAD 4UUZB 3B6FB 2XD5A 3REIA 5B2JA 5B0ZA 5CPKD 5AV9D 3KSYA 4J8UD 3AYWC 1M18D 1KX4A 4R8PB 3X1SB 3VH6W 1P3BA 4H9OA 2AROD 5F99B 3B0CW 3KWQA 5B2ID 3AN2A 3REIC 5B0ZC 3AZGB 5BS7A 4DQYB 3C1CA 3RELC 3MGSD 5BNXA 3MGRB 4YM6B 3WKJD 3AZMA 1U35D 1P34A 2Y2LA 3R45A 3KWQC 3MGQC 3X1VB 4J8VD 3AN2C 4YS3A 1P3BC 4XZQB 2Y2MA 1BH9B 3WA9D 4ZUXC 3REJB 1A7WA 1TAFA 5B0YA 3C1CC 3REKB 1AOIA 1P3MA 1M19A 2PYOB 2NZDD 1P3PD 1BH8B 2HUEB 3AZHD 1M1AD 5BO0B 3H0LC 3LELA 1P34C 4YS3C 4X23A 2BYMA 5GSUB 3AZFD 3TU4B 5B33A 3EPJA 4Z66B 5B0YC 4R8PC 1AOIC 1P3MC 1M19C 2IO5C 2YFWB 4H9SA 3X1UD 4XUJB 3WTPB
chains in the Genus database with same CATH topology
1WWIA 5AV8B 3LZ1B 3VH5A 3AZIA 1Q9CA 3B6GB 3REID 5B2JD 5B31B 5DNNA 4ZBJB 3UTAB 1P3FB 1ID3A 4QLCA 2YFVB 3W98A 4H9SC 5GXQA 4DRAA 5B33C 1KX4D 3C1BA 5E5AA 1ZLAA 4CSRB 4H9NB 4XZQC 3W99B 4UPKA 3KWQD 5CPJA 5FUGB 3AZIC 4EO5C 3WTPE 4WNNA 1PZRA 2F2AC 2UWXA 4E44A 5DNNC 3REKC 1P3AA 5CPKB 3C1CD 4JJNA 1KX5A 4J8UB 1M18B 3AZLB 1ZLAC 3NQUB 5AV5A 3AZMD 3AZEA 1P34D 3TU4C 1HQ3A 4KHAA 5B2IB 5AVCA 2F8NG 4Z5TA 5B32G 3AZKA 4WU9B 1M19D 1KX5C 3W96A 4LD9A 3MGSB 3LELD 4X23D 1HQ3C 3B0DC 5B31C 1U35B 3EPHA 4ZBJC 1P3FC 4NE5A 4Z5TC 3WA9B 5B32D 2Y2IA 3W96C 4J8WB 4Z2MG 3LJAA 1TZYD 2NZDB 3AFAC 3A6NB 3LZ0A 1P3GA 3AZHB 3VH6T 2AROA 3AZID 5JRGA 2BYKB 5G49B 5CPKC 5AV9C 5DNND 3W98D 1M18C 4QLCD 1ID3D 5GXQD 3MVDA 3C1BD 5E5AD 3WKJA 1F1EA 2AROC 5B24A 1N1JA 5CPJD 2DQNC 3REIB 1P3AD 5B2JB 5B0ZB 3KFUG 4JJND 1P3PA 3WKJC 3RELB 2W8SA 5AV5D 1KX4B 2Y2OA 3AZED 3MNND 4J8VC 3AZFA 1P3BB 4H9OB 3KWQB 3WA9C 3AN2B 5AVCD 5DNMA 3AZKD 3C1CB 1P3PC 1M1AC 4LD9D 5BNXB 3AZMB 3AZFC 1BFMA 1KX3D 4WZSB 3R45B 1P34B 4YS3B 1JFIA 3REHD 3MGPA 1WWSA 5AV6A 3VH6A 4WJ3C 4CAYA 3X1UC 1TAFB 1AOIB 5B0YB 3VH5T 1P3MB 3LJAD 1M19B 2IO5B 2BG1A 1KU5A 3NQJA 2Y2PA 3LZ0D 1EQZD 1P3GD 5B1MD 1B67A 5JRGD 2BYMB 2JCHA 5B2JC 3MGPC 3AZND 4NE6A 3W97A 3V9RA 1KX4C 4KUDD 3MVDD 5B33B 1S32A 2ZY2A 5B24D 2F8NH 4H9PA 5BS7C 3AZIB 4EO5B 3UT9D 5DNNB 2L5AA 3W98B 4QLCB 5GXQB 3AZMC 3WAAD 5KDMA 3C1BB 5E5AB 4WU8D 1P3OD 1ZLAB 5CPJB 2F8NA 4WNNB 4J8XD 4Z2MH 5B32A 5DNMD 2VQRA 1TZYA 1KX5B 3LELC 4X23C 5AV5B 1H3OA 3AZEB 2Y2GA 4KGCD 1ULYA 1HQ3B 3B0DB 3MGPD 4KHAB 3AV2A 5AV6D 5AVCB 5B32C 5B40A 4Z5TB 1TZYC 3W96B 5BT1C 5AVBD 3AFAB 3AV2C 3AZJD 3W98C 1ID3C 4QLCC 5AV9B 3W97D 5AY8D 5GXQC 5B40C 3C1BC 5E5AC 4G91C 5CPID 2JE5A 1S32D 3MNNA 2RVQD 5CPJC 1P3GB 4E45A 2AROB 5JRGB 1P3AC 4JJNC 4H9RA 4G92C 1P3LA 5AV5C 5GT0D 3AZEC 3MNNC 3MVDB 3WKJB 1KX3A 3X1TA 5B24B 1N1JB 2YFWA 4J8VB 3REHA 5AVCC 2FJ7D 2F8ND 2HIOA 3AZKC 4LD9C 1EQZA 1P3PB 5BT1D 5B1MA 1M1AB 1KX3C 3X1TC 3B0CT 3O62A 3REHC 3UTBA 3AZFB 3AZNA 3AV2D 2HIOC 4HGAC 2XD1A 4KUDA 5B40D 5F99D 3LJAC 1EQZC 3X1UB 3LZ0C 1P3GC 5B1MC 3AZGD 2CV5A 3O62C 5JRGC 1P3IA 5B1LA 3AZNC 3MGRD 1JFIB 4YM6D 4M6BA 3UT9A 2F8NK 3MGPB 3KXBA 4KUDC 3A1IA 2G5IC 3X1VD 3MVDC 4CAYB 3EG5B 3WAAA 5C3IC 4WU8A 1P3OA 5B24C 3NQJB 2CV5C 3AV1A 5B1LC 2Y2QA 4WV4B 5GT3A 4DRBA 3UT9C 4J8XA 3KXBC 2NQBA 1P3LD 3V9RB 4AWLC 2G5HC 5GSUD 3W97B 3A1KA 3WAAC 3AL0C 2LY8A 5B31G 4WU8C 1P3OC 1S32B 3AV1C 3X1TD 4KGCA 4XUJD 1P3KA 4H9PB 1F66A 3WTPD 2HIOD 3KUYA 3A6NA 4H9QA 5DNMC 4J8XC 2NQBC 5AV8D 3LZ1D 3B6GD 5G49A 5AVBA 3UTAD 4KGCC 3LELB 3O62D 4X23B 2FFFB 3UTBD 2DF4C 5AV6C 3AYWA 3AZJA 3KUYC 1B6WA 5AY8A 2Y2JA 3W99D 2F8NB 5B32B 5CPIA 1TZYB 5AVBC 2CV5D 1P3ID 5B1LD 1H3OB 3AZJC 2ZY3A 3RELA 3AZLD 3W97C 3KXBD 5AY8C 3AV2B 3FDDA 1ID3B 5GT0A 5CPIC 5B40B 3MGQA 1S32C 2RVQC 3P5JB 5BNVA 4G91B 5CP6A 3AV1D 2ZM5A 4ZUXA 4WU9D 5GT3D 2FJ7A 2NQBD 5JA4A 1P3AB 1W2EA 5GT0C 4UUZA 4JJNB 3B6FA 2J8PA 4NE3A 4G92B 5CP6C 2ZY4A 3MNNB 3H0MC 2FJ7C 4R8PA 4J8WD 4NFTA 1P3KD 1F66D 2ZY5A 3X1SA 3A6ND 3KUYD 5F99A 3AZKB 3B6FC 4H9RB 1P3LB 2RIQA 3EPLA 3AZGA 4LD9B 2JSSA 1KX3B 3X1TB 3MGRA 3AYWD 4YM6A 3B0BA 3EPKA 3REHB 3X1SC 2Y2KA 2HIOB 4HGAB 5F99C 3X1VA 4XZQA 1BH9A 3LJAB 3AZGC 1EQZB 3LZ0B 3REJA 3REKA 5B0ZD 2PYOA 5B1MB 3MGRC 3O62B 4YM6C 3UTBB 1BH8A 3RELD 3AZNB 3VH5W 5BO0A 2Y2NA 3X1VC 5GSUA 4KUDB 1P3BD 3MGQD 3TU4A 3AN2D 3F6TA 5CP6D 3REJC 4Z66A 2PYOC 5C3IB 2CV5B 4ZUXD 4XUJA 1P3IB 5B1LB 2HUEC 3WTPA 5AV8A 3UT9B 1P3LC 5GSUC 3KXBB 3LZ1A 3B6GA 3B6FD 4YS3D 4AWLB 5B31A 3WAAB 4Z66C 3UTAA 4WU8B 1P3FA 1P3OB 2YFVA 5CHLB 4XUJC 5B0YD 4R8PD 3AV1B 3WTPC 1P3MD 1AOID 5GT3B 3X1SD 4CSRA 4H9NA 5AV8C 4J8XB 3LZ1C 3W99A 3AFAA 1HTAA 5FUGA 5DNMB 3B6GC 2NQBB 3UTAC 5CPKA 5AV9A 3UTBC 1R4VA 4J8UA 4KGCB 1M18A 3AZLA 3NQUA 1T3UA 5B33D 3W99C 5AV6B 3H0RC 1P3KB 1F66B 3KUYB 4H9QB 4XZQD 5B2IA 3REJD 3REKD 5AVBB 1P3IC 2PYOD 4WU9A 4J8UC 3AZLC 1Z2CB 3IP4C 3MGSA 3AYWB 3AZJB 1ZLAD 1U35A 5AY8B 4J8VA 5B2IC 3TU4D 5CPIB 4Z66D 3WA9A 4WU9C 5GT3C 4J8WA 2NZDA 1KX5D 2Y2HA 3MGSC 3AZHA 1M1AA 1U35C 2BYKA 1HQ3D 5B31D 5GT0B 3MGQB 5KDMB 1P3FD 5BNVB 5CP6B 4Z5TD 4J8WC 1P3KC 1F66C 2NZDC 4ZUXB 3X1UA 2CWEA 3A6NC 2FJ7B 3W96D 3AZHC 5JA4B 3AFAD 4UUZB 3B6FB 2XD5A 3REIA 5B2JA 5B0ZA 5CPKD 5AV9D 3KSYA 4J8UD 3AYWC 1M18D 1KX4A 4R8PB 3X1SB 3VH6W 1P3BA 4H9OA 2AROD 5F99B 3B0CW 3KWQA 5B2ID 3AN2A 3REIC 5B0ZC 3AZGB 5BS7A 4DQYB 3C1CA 3RELC 3MGSD 5BNXA 3MGRB 4YM6B 3WKJD 3AZMA 1U35D 1P34A 2Y2LA 3R45A 3KWQC 3MGQC 3X1VB 4J8VD 3AN2C 4YS3A 1P3BC 4XZQB 2Y2MA 1BH9B 3WA9D 4ZUXC 3REJB 1A7WA 1TAFA 5B0YA 3C1CC 3REKB 1AOIA 1P3MA 1M19A 2PYOB 2NZDD 1P3PD 1BH8B 2HUEB 3AZHD 1M1AD 5BO0B 3H0LC 3LELA 1P34C 4YS3C 4X23A 2BYMA 5GSUB 3AZFD 3TU4B 5B33A 3EPJA 4Z66B 5B0YC 4R8PC 1AOIC 1P3MC 1M19C 2IO5C 2YFWB 4H9SA 3X1UD 4XUJB 3WTPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWI A;  5AV8 B;  3LZ1 B;  3VH5 A;  3AZI A;  1Q9C A;  3B6G B;  3REI D;  5B2J D;  5B31 B;  5DNN A;  4ZBJ B;  3UTA B;  1P3F B;  1ID3 A;  4QLC A;  2YFV B;  3W98 A;  4H9S C;  5GXQ A;  4DRA A;  5B33 C;  1KX4 D;  3C1B A;  5E5A A;  1ZLA A;  4CSR B;  4H9N B;  4XZQ C;  3W99 B;  3KWQ D;  5CPJ A;  5FUG B;  3AZI C;  4EO5 C;  3WTP E;  4WNN A;  3REK C;  5DNN C;  4E44 A;  1P3A A;  5CPK B;  3C1C D;  4JJN A;  1KX5 A;  4J8U B;  1M18 B;  3AZL B;  1ZLA C;  3NQU B;  5AV5 A;  3AZM D;  3AZE A;  1P34 D;  3TU4 C;  1HQ3 A;  4KHA A;  5B2I B;  5AVC A;  2F8N G;  4Z5T A;  5B32 G;  3AZK A;  4WU9 B;  1M19 D;  1KX5 C;  3W96 A;  4LD9 A;  3MGS B;  3LEL D;  4X23 D;  1HQ3 C;  3B0D C;  5B31 C;  1U35 B;  4ZBJ C;  1P3F C;  4NE5 A;  4Z5T C;  3WA9 B;  5B32 D;  3W96 C;  4J8W B;  4Z2M G;  3LJA A;  1TZY D;  2NZD B;  3AFA C;  3A6N B;  3LZ0 A;  1P3G A;  3AZH B;  3VH6 T;  2ARO A;  3AZI D;  5JRG A;  2BYK B;  5G49 B;  5CPK C;  5AV9 C;  5DNN D;  3W98 D;  1M18 C;  4QLC D;  1ID3 D;  5GXQ D;  3MVD A;  3C1B D;  5E5A D;  3WKJ A;  1F1E A;  2ARO C;  5B24 A;  1N1J A;  5CPJ D;  3REI B;  1P3A D;  5B2J B;  5B0Z B;  4JJN D;  1P3P A;  3WKJ C;  3REL B;  1KX4 B;  5AV5 D;  3AZE D;  3MNN D;  4J8V C;  3AZF A;  1P3B B;  4H9O B;  3KWQ B;  3WA9 C;  3AN2 B;  5AVC D;  5DNM A;  3AZK D;  3C1C B;  1P3P C;  1M1A C;  4LD9 D;  5BNX B;  3AZM B;  3AZF C;  1BFM A;  1KX3 D;  4WZS B;  3R45 B;  1P34 B;  4YS3 B;  1JFI A;  3REH D;  3MGP A;  1WWS A;  5AV6 A;  3VH6 A;  4CAY A;  3X1U C;  1TAF B;  1AOI B;  5B0Y B;  3VH5 T;  1P3M B;  3LJA D;  1M19 B;  2IO5 B;  1EQZ D;  1KU5 A;  3NQJ A;  3LZ0 D;  1P3G D;  5B1M D;  1B67 A;  5JRG D;  2BYM B;  5B2J C;  3MGP C;  3AZN D;  4NE6 A;  3W97 A;  3V9R A;  1KX4 C;  4KUD D;  3MVD D;  5B33 B;  1S32 A;  5B24 D;  2F8N H;  4H9P A;  5BS7 C;  3AZI B;  4EO5 B;  3UT9 D;  5DNN B;  2L5A A;  3W98 B;  4QLC B;  5GXQ B;  3AZM C;  3WAA D;  5KDM A;  3C1B B;  5E5A B;  4WU8 D;  1P3O D;  1ZLA B;  5CPJ B;  2F8N A;  4WNN B;  4J8X D;  4Z2M H;  5B32 A;  5DNM D;  1TZY A;  1KX5 B;  3LEL C;  4X23 C;  5AV5 B;  1H3O A;  3AZE B;  4KGC D;  1ULY A;  1HQ3 B;  3B0D B;  3MGP D;  4KHA B;  3AV2 A;  5AV6 D;  5AVC B;  5B32 C;  5B40 A;  4Z5T B;  1TZY C;  3W96 B;  5BT1 C;  5AVB D;  3AFA B;  3AV2 C;  3AZJ D;  3W98 C;  1ID3 C;  4QLC C;  5AV9 B;  3W97 D;  5AY8 D;  5GXQ C;  5B40 C;  3C1B C;  5E5A C;  4G91 C;  5CPI D;  1S32 D;  3MNN A;  2RVQ D;  5CPJ C;  1P3G B;  4E45 A;  2ARO B;  5JRG B;  1P3A C;  4JJN C;  4H9R A;  4G92 C;  1P3L A;  5AV5 C;  5GT0 D;  3AZE C;  3MNN C;  3MVD B;  3WKJ B;  1KX3 A;  3X1T A;  5B24 B;  1N1J B;  2YFW A;  4J8V B;  3REH A;  5AVC C;  2FJ7 D;  2F8N D;  2HIO A;  3AZK C;  4LD9 C;  1EQZ A;  1P3P B;  5BT1 D;  5B1M A;  1M1A B;  1KX3 C;  3X1T C;  3B0C T;  3O62 A;  3REH C;  3UTB A;  3AZF B;  3AZN A;  3AV2 D;  2HIO C;  4HGA C;  4KUD A;  5B40 D;  5F99 D;  3LJA C;  1EQZ C;  3X1U B;  3LZ0 C;  1P3G C;  5B1M C;  3AZG D;  2CV5 A;  3O62 C;  5JRG C;  1P3I A;  5B1L A;  3AZN C;  3MGR D;  1JFI B;  4YM6 D;  4M6B A;  3UT9 A;  2F8N K;  3MGP B;  3KXB A;  4KUD C;  3X1V D;  3MVD C;  4CAY B;  3WAA A;  5C3I C;  4WU8 A;  1P3O A;  5B24 C;  3NQJ B;  2CV5 C;  3AV1 A;  5B1L C;  4WV4 B;  5GT3 A;  4DRB A;  3UT9 C;  4J8X A;  3KXB C;  2NQB A;  1P3L D;  3V9R B;  4AWL C;  5GSU D;  3W97 B;  3WAA C;  2LY8 A;  5B31 G;  4WU8 C;  1P3O C;  1S32 B;  3AV1 C;  3X1T D;  4KGC A;  4XUJ D;  1P3K A;  4H9P B;  1F66 A;  3WTP D;  2HIO D;  3KUY A;  3A6N A;  4H9Q A;  5DNM C;  4J8X C;  2NQB C;  5AV8 D;  3LZ1 D;  3B6G D;  5G49 A;  5AVB A;  3UTA D;  4KGC C;  3LEL B;  3O62 D;  4X23 B;  3UTB D;  5AV6 C;  3AYW A;  3AZJ A;  3KUY C;  1B6W A;  5AY8 A;  3W99 D;  2F8N B;  5B32 B;  5CPI A;  1TZY B;  5AVB C;  2CV5 D;  1P3I D;  5B1L D;  1H3O B;  3AZJ C;  3AZL D;  3REL A;  3W97 C;  3KXB D;  5AY8 C;  3AV2 B;  1ID3 B;  5GT0 A;  5CPI C;  5B40 B;  3MGQ A;  1S32 C;  2RVQ C;  5BNV A;  4G91 B;  5CP6 A;  3AV1 D;  4ZUX A;  4WU9 D;  5GT3 D;  2FJ7 A;  2NQB D;  5JA4 A;  1P3A B;  5GT0 C;  4UUZ A;  4JJN B;  3B6F A;  4NE3 A;  4G92 B;  5CP6 C;  3MNN B;  2FJ7 C;  4R8P A;  4J8W D;  4NFT A;  1P3K D;  1F66 D;  3X1S A;  3A6N D;  3KUY D;  5F99 A;  3AZK B;  3B6F C;  4H9R B;  1P3L B;  3AZG A;  4LD9 B;  2JSS A;  1KX3 B;  3X1T B;  3MGR A;  3AYW D;  4YM6 A;  3B0B A;  3REH B;  3X1S C;  2HIO B;  4HGA B;  5F99 C;  3X1V A;  4XZQ A;  1BH9 A;  3LJA B;  3AZG C;  1EQZ B;  3LZ0 B;  3REJ A;  3REK A;  5B0Z D;  2PYO A;  5B1M B;  3MGR C;  3O62 B;  4YM6 C;  3UTB B;  1BH8 A;  3REL D;  3AZN B;  3VH5 W;  5BO0 A;  3X1V C;  5GSU A;  4KUD B;  1P3B D;  3MGQ D;  3TU4 A;  3AN2 D;  5CP6 D;  3REJ C;  4Z66 A;  2PYO C;  5C3I B;  2CV5 B;  4ZUX D;  4XUJ A;  1P3I B;  5B1L B;  2HUE C;  3WTP A;  5AV8 A;  3UT9 B;  1P3L C;  5GSU C;  3KXB B;  3LZ1 A;  3B6G A;  3B6F D;  4YS3 D;  4AWL B;  5B31 A;  3WAA B;  4Z66 C;  3UTA A;  4WU8 B;  1P3F A;  1P3O B;  2YFV A;  5CHL B;  4XUJ C;  5B0Y D;  4R8P D;  3AV1 B;  3WTP C;  1P3M D;  1AOI D;  5GT3 B;  3X1S D;  4CSR A;  4H9N A;  5AV8 C;  4J8X B;  3LZ1 C;  3W99 A;  3AFA A;  1HTA A;  5FUG A;  5DNM B;  3B6G C;  2NQB B;  3UTA C;  5CPK A;  5AV9 A;  3UTB C;  1R4V A;  4J8U A;  4KGC B;  1M18 A;  3AZL A;  3NQU A;  5B33 D;  3W99 C;  5AV6 B;  1P3K B;  1F66 B;  3KUY B;  4H9Q B;  4XZQ D;  5B2I A;  3REJ D;  3REK D;  5AVB B;  1P3I C;  2PYO D;  4WU9 A;  4J8U C;  3AZL C;  3MGS A;  3AYW B;  3AZJ B;  1ZLA D;  1U35 A;  5AY8 B;  4J8V A;  5B2I C;  3TU4 D;  5CPI B;  4Z66 D;  3WA9 A;  4WU9 C;  5GT3 C;  4J8W A;  2NZD A;  1KX5 D;  3MGS C;  3AZH A;  1M1A A;  1U35 C;  2BYK A;  1HQ3 D;  5B31 D;  5GT0 B;  3MGQ B;  5KDM B;  1P3F D;  5BNV B;  5CP6 B;  4Z5T D;  4J8W C;  1P3K C;  1F66 C;  2NZD C;  4ZUX B;  3X1U A;  2CWE A;  3A6N C;  2FJ7 B;  3W96 D;  3AZH C;  5JA4 B;  3AFA D;  4UUZ B;  3B6F B;  3REI A;  5B2J A;  5B0Z A;  5CPK D;  5AV9 D;  3KSY A;  4J8U D;  3AYW C;  1M18 D;  1KX4 A;  4R8P B;  3X1S B;  3VH6 W;  1P3B A;  4H9O A;  2ARO D;  5F99 B;  3B0C W;  3KWQ A;  5B2I D;  3AN2 A;  3REI C;  5B0Z C;  3AZG B;  5BS7 A;  3C1C A;  3REL C;  3MGS D;  5BNX A;  3MGR B;  4YM6 B;  3WKJ D;  3AZM A;  1U35 D;  1P34 A;  3R45 A;  3KWQ C;  3MGQ C;  3X1V B;  4YS3 A;  4J8V D;  3AN2 C;  1P3B C;  4XZQ B;  1BH9 B;  3WA9 D;  4ZUX C;  3REJ B;  1A7W A;  1TAF A;  5B0Y A;  3C1C C;  3REK B;  1AOI A;  1P3M A;  1M19 A;  2PYO B;  2NZD D;  1P3P D;  1BH8 B;  2HUE B;  3AZH D;  1M1A D;  5BO0 B;  1P34 C;  3LEL A;  4YS3 C;  4X23 A;  2BYM A;  5GSU B;  3AZF D;  3TU4 B;  5B33 A;  4Z66 B;  4R8P C;  5B0Y C;  1AOI C;  1P3M C;  1M19 C;  2IO5 C;  2YFW B;  4H9S A;  3X1U D;  4XUJ B;  3WTP B; 
#chains in the Genus database with same CATH topology
 1WWI A;  5AV8 B;  3LZ1 B;  3VH5 A;  3AZI A;  1Q9C A;  3B6G B;  3REI D;  5B2J D;  5B31 B;  5DNN A;  4ZBJ B;  3UTA B;  1P3F B;  1ID3 A;  4QLC A;  2YFV B;  3W98 A;  4H9S C;  5GXQ A;  4DRA A;  5B33 C;  1KX4 D;  3C1B A;  5E5A A;  1ZLA A;  4CSR B;  4H9N B;  4XZQ C;  3W99 B;  4UPK A;  3KWQ D;  5CPJ A;  5FUG B;  3AZI C;  4EO5 C;  3WTP E;  4WNN A;  1PZR A;  2F2A C;  2UWX A;  4E44 A;  5DNN C;  3REK C;  1P3A A;  5CPK B;  3C1C D;  4JJN A;  1KX5 A;  4J8U B;  1M18 B;  3AZL B;  1ZLA C;  3NQU B;  5AV5 A;  3AZM D;  3AZE A;  1P34 D;  3TU4 C;  1HQ3 A;  4KHA A;  5B2I B;  5AVC A;  2F8N G;  4Z5T A;  5B32 G;  3AZK A;  4WU9 B;  1M19 D;  1KX5 C;  3W96 A;  4LD9 A;  3MGS B;  3LEL D;  4X23 D;  1HQ3 C;  3B0D C;  5B31 C;  1U35 B;  3EPH A;  4ZBJ C;  1P3F C;  4NE5 A;  4Z5T C;  3WA9 B;  5B32 D;  2Y2I A;  3W96 C;  4J8W B;  4Z2M G;  3LJA A;  1TZY D;  2NZD B;  3AFA C;  3A6N B;  3LZ0 A;  1P3G A;  3AZH B;  3VH6 T;  2ARO A;  3AZI D;  5JRG A;  2BYK B;  5G49 B;  5CPK C;  5AV9 C;  5DNN D;  3W98 D;  1M18 C;  4QLC D;  1ID3 D;  5GXQ D;  3MVD A;  3C1B D;  5E5A D;  3WKJ A;  1F1E A;  2ARO C;  5B24 A;  1N1J A;  5CPJ D;  2DQN C;  3REI B;  1P3A D;  5B2J B;  5B0Z B;  3KFU G;  4JJN D;  1P3P A;  3WKJ C;  3REL B;  2W8S A;  5AV5 D;  1KX4 B;  2Y2O A;  3AZE D;  3MNN D;  4J8V C;  3AZF A;  1P3B B;  4H9O B;  3KWQ B;  3WA9 C;  3AN2 B;  5AVC D;  5DNM A;  3AZK D;  3C1C B;  1P3P C;  1M1A C;  4LD9 D;  5BNX B;  3AZM B;  3AZF C;  1BFM A;  1KX3 D;  4WZS B;  3R45 B;  1P34 B;  4YS3 B;  1JFI A;  3REH D;  3MGP A;  1WWS A;  5AV6 A;  3VH6 A;  4WJ3 C;  4CAY A;  3X1U C;  1TAF B;  1AOI B;  5B0Y B;  3VH5 T;  1P3M B;  3LJA D;  1M19 B;  2IO5 B;  2BG1 A;  1KU5 A;  3NQJ A;  2Y2P A;  3LZ0 D;  1EQZ D;  1P3G D;  5B1M D;  1B67 A;  5JRG D;  2BYM B;  2JCH A;  5B2J C;  3MGP C;  3AZN D;  4NE6 A;  3W97 A;  3V9R A;  1KX4 C;  4KUD D;  3MVD D;  5B33 B;  1S32 A;  2ZY2 A;  5B24 D;  2F8N H;  4H9P A;  5BS7 C;  3AZI B;  4EO5 B;  3UT9 D;  5DNN B;  2L5A A;  3W98 B;  4QLC B;  5GXQ B;  3AZM C;  3WAA D;  5KDM A;  3C1B B;  5E5A B;  4WU8 D;  1P3O D;  1ZLA B;  5CPJ B;  2F8N A;  4WNN B;  4J8X D;  4Z2M H;  5B32 A;  5DNM D;  2VQR A;  1TZY A;  1KX5 B;  3LEL C;  4X23 C;  5AV5 B;  1H3O A;  3AZE B;  2Y2G A;  4KGC D;  1ULY A;  1HQ3 B;  3B0D B;  3MGP D;  4KHA B;  3AV2 A;  5AV6 D;  5AVC B;  5B32 C;  5B40 A;  4Z5T B;  1TZY C;  3W96 B;  5BT1 C;  5AVB D;  3AFA B;  3AV2 C;  3AZJ D;  3W98 C;  1ID3 C;  4QLC C;  5AV9 B;  3W97 D;  5AY8 D;  5GXQ C;  5B40 C;  3C1B C;  5E5A C;  4G91 C;  5CPI D;  2JE5 A;  1S32 D;  3MNN A;  2RVQ D;  5CPJ C;  1P3G B;  4E45 A;  2ARO B;  5JRG B;  1P3A C;  4JJN C;  4H9R A;  4G92 C;  1P3L A;  5AV5 C;  5GT0 D;  3AZE C;  3MNN C;  3MVD B;  3WKJ B;  1KX3 A;  3X1T A;  5B24 B;  1N1J B;  2YFW A;  4J8V B;  3REH A;  5AVC C;  2FJ7 D;  2F8N D;  2HIO A;  3AZK C;  4LD9 C;  1EQZ A;  1P3P B;  5BT1 D;  5B1M A;  1M1A B;  1KX3 C;  3X1T C;  3B0C T;  3O62 A;  3REH C;  3UTB A;  3AZF B;  3AZN A;  3AV2 D;  2HIO C;  4HGA C;  2XD1 A;  4KUD A;  5B40 D;  5F99 D;  3LJA C;  1EQZ C;  3X1U B;  3LZ0 C;  1P3G C;  5B1M C;  3AZG D;  2CV5 A;  3O62 C;  5JRG C;  1P3I A;  5B1L A;  3AZN C;  3MGR D;  1JFI B;  4YM6 D;  4M6B A;  3UT9 A;  2F8N K;  3MGP B;  3KXB A;  4KUD C;  3A1I A;  2G5I C;  3X1V D;  3MVD C;  4CAY B;  3EG5 B;  3WAA A;  5C3I C;  4WU8 A;  1P3O A;  5B24 C;  3NQJ B;  2CV5 C;  3AV1 A;  5B1L C;  2Y2Q A;  4WV4 B;  5GT3 A;  4DRB A;  3UT9 C;  4J8X A;  3KXB C;  2NQB A;  1P3L D;  3V9R B;  4AWL C;  2G5H C;  5GSU D;  3W97 B;  3A1K A;  3WAA C;  3AL0 C;  2LY8 A;  5B31 G;  4WU8 C;  1P3O C;  1S32 B;  3AV1 C;  3X1T D;  4KGC A;  4XUJ D;  1P3K A;  4H9P B;  1F66 A;  3WTP D;  2HIO D;  3KUY A;  3A6N A;  4H9Q A;  5DNM C;  4J8X C;  2NQB C;  5AV8 D;  3LZ1 D;  3B6G D;  5G49 A;  5AVB A;  3UTA D;  4KGC C;  3LEL B;  3O62 D;  4X23 B;  2FFF B;  3UTB D;  2DF4 C;  5AV6 C;  3AYW A;  3AZJ A;  3KUY C;  1B6W A;  5AY8 A;  2Y2J A;  3W99 D;  2F8N B;  5B32 B;  5CPI A;  1TZY B;  5AVB C;  2CV5 D;  1P3I D;  5B1L D;  1H3O B;  3AZJ C;  2ZY3 A;  3REL A;  3AZL D;  3W97 C;  3KXB D;  5AY8 C;  3AV2 B;  3FDD A;  1ID3 B;  5GT0 A;  5CPI C;  5B40 B;  3MGQ A;  1S32 C;  2RVQ C;  3P5J B;  5BNV A;  4G91 B;  5CP6 A;  3AV1 D;  2ZM5 A;  4ZUX A;  4WU9 D;  5GT3 D;  2FJ7 A;  2NQB D;  5JA4 A;  1P3A B;  1W2E A;  5GT0 C;  4UUZ A;  4JJN B;  3B6F A;  2J8P A;  4NE3 A;  4G92 B;  5CP6 C;  2ZY4 A;  3MNN B;  3H0M C;  2FJ7 C;  4R8P A;  4J8W D;  4NFT A;  1P3K D;  1F66 D;  2ZY5 A;  3X1S A;  3A6N D;  3KUY D;  5F99 A;  3AZK B;  3B6F C;  4H9R B;  1P3L B;  2RIQ A;  3EPL A;  3AZG A;  4LD9 B;  2JSS A;  1KX3 B;  3X1T B;  3MGR A;  3AYW D;  4YM6 A;  3B0B A;  3EPK A;  3REH B;  3X1S C;  2Y2K A;  2HIO B;  4HGA B;  5F99 C;  3X1V A;  4XZQ A;  1BH9 A;  3LJA B;  3AZG C;  1EQZ B;  3LZ0 B;  3REJ A;  3REK A;  5B0Z D;  2PYO A;  5B1M B;  3MGR C;  3O62 B;  4YM6 C;  3UTB B;  1BH8 A;  3REL D;  3AZN B;  3VH5 W;  5BO0 A;  2Y2N A;  3X1V C;  5GSU A;  4KUD B;  1P3B D;  3MGQ D;  3TU4 A;  3AN2 D;  3F6T A;  5CP6 D;  3REJ C;  4Z66 A;  2PYO C;  5C3I B;  2CV5 B;  4ZUX D;  4XUJ A;  1P3I B;  5B1L B;  2HUE C;  3WTP A;  5AV8 A;  3UT9 B;  1P3L C;  5GSU C;  3KXB B;  3LZ1 A;  3B6G A;  3B6F D;  4YS3 D;  4AWL B;  5B31 A;  3WAA B;  4Z66 C;  3UTA A;  4WU8 B;  1P3F A;  1P3O B;  2YFV A;  5CHL B;  4XUJ C;  5B0Y D;  4R8P D;  3AV1 B;  3WTP C;  1P3M D;  1AOI D;  5GT3 B;  3X1S D;  4CSR A;  4H9N A;  5AV8 C;  4J8X B;  3LZ1 C;  3W99 A;  3AFA A;  1HTA A;  5FUG A;  5DNM B;  3B6G C;  2NQB B;  3UTA C;  5CPK A;  5AV9 A;  3UTB C;  1R4V A;  4J8U A;  4KGC B;  1M18 A;  3AZL A;  3NQU A;  1T3U A;  5B33 D;  3W99 C;  5AV6 B;  3H0R C;  1P3K B;  1F66 B;  3KUY B;  4H9Q B;  4XZQ D;  5B2I A;  3REJ D;  3REK D;  5AVB B;  1P3I C;  2PYO D;  4WU9 A;  4J8U C;  3AZL C;  1Z2C B;  3IP4 C;  3MGS A;  3AYW B;  3AZJ B;  1ZLA D;  1U35 A;  5AY8 B;  4J8V A;  5B2I C;  3TU4 D;  5CPI B;  4Z66 D;  3WA9 A;  4WU9 C;  5GT3 C;  4J8W A;  2NZD A;  1KX5 D;  2Y2H A;  3MGS C;  3AZH A;  1M1A A;  1U35 C;  2BYK A;  1HQ3 D;  5B31 D;  5GT0 B;  3MGQ B;  5KDM B;  1P3F D;  5BNV B;  5CP6 B;  4Z5T D;  4J8W C;  1P3K C;  1F66 C;  2NZD C;  4ZUX B;  3X1U A;  2CWE A;  3A6N C;  2FJ7 B;  3W96 D;  3AZH C;  5JA4 B;  3AFA D;  4UUZ B;  3B6F B;  2XD5 A;  3REI A;  5B2J A;  5B0Z A;  5CPK D;  5AV9 D;  3KSY A;  4J8U D;  3AYW C;  1M18 D;  1KX4 A;  4R8P B;  3X1S B;  3VH6 W;  1P3B A;  4H9O A;  2ARO D;  5F99 B;  3B0C W;  3KWQ A;  5B2I D;  3AN2 A;  3REI C;  5B0Z C;  3AZG B;  5BS7 A;  4DQY B;  3C1C A;  3REL C;  3MGS D;  5BNX A;  3MGR B;  4YM6 B;  3WKJ D;  3AZM A;  1U35 D;  1P34 A;  2Y2L A;  3R45 A;  3KWQ C;  3MGQ C;  3X1V B;  4J8V D;  3AN2 C;  4YS3 A;  1P3B C;  4XZQ B;  2Y2M A;  1BH9 B;  3WA9 D;  4ZUX C;  3REJ B;  1A7W A;  1TAF A;  5B0Y A;  3C1C C;  3REK B;  1AOI A;  1P3M A;  1M19 A;  2PYO B;  2NZD D;  1P3P D;  1BH8 B;  2HUE B;  3AZH D;  1M1A D;  5BO0 B;  3H0L C;  3LEL A;  1P34 C;  4YS3 C;  4X23 A;  2BYM A;  5GSU B;  3AZF D;  3TU4 B;  5B33 A;  3EPJ A;  4Z66 B;  5B0Y C;  4R8P C;  1AOI C;  1P3M C;  1M19 C;  2IO5 C;  2YFW B;  4H9S A;  3X1U D;  4XUJ B;  3WTP B; 
#chains in the Genus database with same CATH homology
 1WWI A;  5AV8 B;  3LZ1 B;  3VH5 A;  3AZI A;  1Q9C A;  3B6G B;  3REI D;  5B2J D;  5B31 B;  5DNN A;  4ZBJ B;  3UTA B;  1P3F B;  1ID3 A;  4QLC A;  2YFV B;  3W98 A;  4H9S C;  5GXQ A;  4DRA A;  5B33 C;  1KX4 D;  3C1B A;  5E5A A;  1ZLA A;  4CSR B;  4H9N B;  4XZQ C;  3W99 B;  4UPK A;  3KWQ D;  5CPJ A;  5FUG B;  3AZI C;  4EO5 C;  3WTP E;  4WNN A;  1PZR A;  2F2A C;  2UWX A;  4E44 A;  5DNN C;  3REK C;  1P3A A;  5CPK B;  3C1C D;  4JJN A;  1KX5 A;  4J8U B;  1M18 B;  3AZL B;  1ZLA C;  3NQU B;  5AV5 A;  3AZM D;  3AZE A;  1P34 D;  3TU4 C;  1HQ3 A;  4KHA A;  5B2I B;  5AVC A;  2F8N G;  4Z5T A;  5B32 G;  3AZK A;  4WU9 B;  1M19 D;  1KX5 C;  3W96 A;  4LD9 A;  3MGS B;  3LEL D;  4X23 D;  1HQ3 C;  3B0D C;  5B31 C;  1U35 B;  3EPH A;  4ZBJ C;  1P3F C;  4NE5 A;  4Z5T C;  3WA9 B;  5B32 D;  2Y2I A;  3W96 C;  4J8W B;  4Z2M G;  3LJA A;  1TZY D;  2NZD B;  3AFA C;  3A6N B;  3LZ0 A;  1P3G A;  3AZH B;  3VH6 T;  2ARO A;  3AZI D;  5JRG A;  2BYK B;  5G49 B;  5CPK C;  5AV9 C;  5DNN D;  3W98 D;  1M18 C;  4QLC D;  1ID3 D;  5GXQ D;  3MVD A;  3C1B D;  5E5A D;  3WKJ A;  1F1E A;  2ARO C;  5B24 A;  1N1J A;  5CPJ D;  2DQN C;  3REI B;  1P3A D;  5B2J B;  5B0Z B;  3KFU G;  4JJN D;  1P3P A;  3WKJ C;  3REL B;  2W8S A;  5AV5 D;  1KX4 B;  2Y2O A;  3AZE D;  3MNN D;  4J8V C;  3AZF A;  1P3B B;  4H9O B;  3KWQ B;  3WA9 C;  3AN2 B;  5AVC D;  5DNM A;  3AZK D;  3C1C B;  1P3P C;  1M1A C;  4LD9 D;  5BNX B;  3AZM B;  3AZF C;  1BFM A;  1KX3 D;  4WZS B;  3R45 B;  1P34 B;  4YS3 B;  1JFI A;  3REH D;  3MGP A;  1WWS A;  5AV6 A;  3VH6 A;  4WJ3 C;  4CAY A;  3X1U C;  1TAF B;  1AOI B;  5B0Y B;  3VH5 T;  1P3M B;  3LJA D;  1M19 B;  2IO5 B;  2BG1 A;  1KU5 A;  3NQJ A;  2Y2P A;  3LZ0 D;  1EQZ D;  1P3G D;  5B1M D;  1B67 A;  5JRG D;  2BYM B;  2JCH A;  5B2J C;  3MGP C;  3AZN D;  4NE6 A;  3W97 A;  3V9R A;  1KX4 C;  4KUD D;  3MVD D;  5B33 B;  1S32 A;  2ZY2 A;  5B24 D;  2F8N H;  4H9P A;  5BS7 C;  3AZI B;  4EO5 B;  3UT9 D;  5DNN B;  2L5A A;  3W98 B;  4QLC B;  5GXQ B;  3AZM C;  3WAA D;  5KDM A;  3C1B B;  5E5A B;  4WU8 D;  1P3O D;  1ZLA B;  5CPJ B;  2F8N A;  4WNN B;  4J8X D;  4Z2M H;  5B32 A;  5DNM D;  2VQR A;  1TZY A;  1KX5 B;  3LEL C;  4X23 C;  5AV5 B;  1H3O A;  3AZE B;  2Y2G A;  4KGC D;  1ULY A;  1HQ3 B;  3B0D B;  3MGP D;  4KHA B;  3AV2 A;  5AV6 D;  5AVC B;  5B32 C;  5B40 A;  4Z5T B;  1TZY C;  3W96 B;  5BT1 C;  5AVB D;  3AFA B;  3AV2 C;  3AZJ D;  3W98 C;  1ID3 C;  4QLC C;  5AV9 B;  3W97 D;  5AY8 D;  5GXQ C;  5B40 C;  3C1B C;  5E5A C;  4G91 C;  5CPI D;  2JE5 A;  1S32 D;  3MNN A;  2RVQ D;  5CPJ C;  1P3G B;  4E45 A;  2ARO B;  5JRG B;  1P3A C;  4JJN C;  4H9R A;  4G92 C;  1P3L A;  5AV5 C;  5GT0 D;  3AZE C;  3MNN C;  3MVD B;  3WKJ B;  1KX3 A;  3X1T A;  5B24 B;  1N1J B;  2YFW A;  4J8V B;  3REH A;  5AVC C;  2FJ7 D;  2F8N D;  2HIO A;  3AZK C;  4LD9 C;  1EQZ A;  1P3P B;  5BT1 D;  5B1M A;  1M1A B;  1KX3 C;  3X1T C;  3B0C T;  3O62 A;  3REH C;  3UTB A;  3AZF B;  3AZN A;  3AV2 D;  2HIO C;  4HGA C;  2XD1 A;  4KUD A;  5B40 D;  5F99 D;  3LJA C;  1EQZ C;  3X1U B;  3LZ0 C;  1P3G C;  5B1M C;  3AZG D;  2CV5 A;  3O62 C;  5JRG C;  1P3I A;  5B1L A;  3AZN C;  3MGR D;  1JFI B;  4YM6 D;  4M6B A;  3UT9 A;  2F8N K;  3MGP B;  3KXB A;  4KUD C;  3A1I A;  2G5I C;  3X1V D;  3MVD C;  4CAY B;  3EG5 B;  3WAA A;  5C3I C;  4WU8 A;  1P3O A;  5B24 C;  3NQJ B;  2CV5 C;  3AV1 A;  5B1L C;  2Y2Q A;  4WV4 B;  5GT3 A;  4DRB A;  3UT9 C;  4J8X A;  3KXB C;  2NQB A;  1P3L D;  3V9R B;  4AWL C;  2G5H C;  5GSU D;  3W97 B;  3A1K A;  3WAA C;  3AL0 C;  2LY8 A;  5B31 G;  4WU8 C;  1P3O C;  1S32 B;  3AV1 C;  3X1T D;  4KGC A;  4XUJ D;  1P3K A;  4H9P B;  1F66 A;  3WTP D;  2HIO D;  3KUY A;  3A6N A;  4H9Q A;  5DNM C;  4J8X C;  2NQB C;  5AV8 D;  3LZ1 D;  3B6G D;  5G49 A;  5AVB A;  3UTA D;  4KGC C;  3LEL B;  3O62 D;  4X23 B;  2FFF B;  3UTB D;  2DF4 C;  5AV6 C;  3AYW A;  3AZJ A;  3KUY C;  1B6W A;  5AY8 A;  2Y2J A;  3W99 D;  2F8N B;  5B32 B;  5CPI A;  1TZY B;  5AVB C;  2CV5 D;  1P3I D;  5B1L D;  1H3O B;  3AZJ C;  2ZY3 A;  3REL A;  3AZL D;  3W97 C;  3KXB D;  5AY8 C;  3AV2 B;  3FDD A;  1ID3 B;  5GT0 A;  5CPI C;  5B40 B;  3MGQ A;  1S32 C;  2RVQ C;  3P5J B;  5BNV A;  4G91 B;  5CP6 A;  3AV1 D;  2ZM5 A;  4ZUX A;  4WU9 D;  5GT3 D;  2FJ7 A;  2NQB D;  5JA4 A;  1P3A B;  1W2E A;  5GT0 C;  4UUZ A;  4JJN B;  3B6F A;  2J8P A;  4NE3 A;  4G92 B;  5CP6 C;  2ZY4 A;  3MNN B;  3H0M C;  2FJ7 C;  4R8P A;  4J8W D;  4NFT A;  1P3K D;  1F66 D;  2ZY5 A;  3X1S A;  3A6N D;  3KUY D;  5F99 A;  3AZK B;  3B6F C;  4H9R B;  1P3L B;  2RIQ A;  3EPL A;  3AZG A;  4LD9 B;  2JSS A;  1KX3 B;  3X1T B;  3MGR A;  3AYW D;  4YM6 A;  3B0B A;  3EPK A;  3REH B;  3X1S C;  2Y2K A;  2HIO B;  4HGA B;  5F99 C;  3X1V A;  4XZQ A;  1BH9 A;  3LJA B;  3AZG C;  1EQZ B;  3LZ0 B;  3REJ A;  3REK A;  5B0Z D;  2PYO A;  5B1M B;  3MGR C;  3O62 B;  4YM6 C;  3UTB B;  1BH8 A;  3REL D;  3AZN B;  3VH5 W;  5BO0 A;  2Y2N A;  3X1V C;  5GSU A;  4KUD B;  1P3B D;  3MGQ D;  3TU4 A;  3AN2 D;  3F6T A;  5CP6 D;  3REJ C;  4Z66 A;  2PYO C;  5C3I B;  2CV5 B;  4ZUX D;  4XUJ A;  1P3I B;  5B1L B;  2HUE C;  3WTP A;  5AV8 A;  3UT9 B;  1P3L C;  5GSU C;  3KXB B;  3LZ1 A;  3B6G A;  3B6F D;  4YS3 D;  4AWL B;  5B31 A;  3WAA B;  4Z66 C;  3UTA A;  4WU8 B;  1P3F A;  1P3O B;  2YFV A;  5CHL B;  4XUJ C;  5B0Y D;  4R8P D;  3AV1 B;  3WTP C;  1P3M D;  1AOI D;  5GT3 B;  3X1S D;  4CSR A;  4H9N A;  5AV8 C;  4J8X B;  3LZ1 C;  3W99 A;  3AFA A;  1HTA A;  5FUG A;  5DNM B;  3B6G C;  2NQB B;  3UTA C;  5CPK A;  5AV9 A;  3UTB C;  1R4V A;  4J8U A;  4KGC B;  1M18 A;  3AZL A;  3NQU A;  1T3U A;  5B33 D;  3W99 C;  5AV6 B;  3H0R C;  1P3K B;  1F66 B;  3KUY B;  4H9Q B;  4XZQ D;  5B2I A;  3REJ D;  3REK D;  5AVB B;  1P3I C;  2PYO D;  4WU9 A;  4J8U C;  3AZL C;  1Z2C B;  3IP4 C;  3MGS A;  3AYW B;  3AZJ B;  1ZLA D;  1U35 A;  5AY8 B;  4J8V A;  5B2I C;  3TU4 D;  5CPI B;  4Z66 D;  3WA9 A;  4WU9 C;  5GT3 C;  4J8W A;  2NZD A;  1KX5 D;  2Y2H A;  3MGS C;  3AZH A;  1M1A A;  1U35 C;  2BYK A;  1HQ3 D;  5B31 D;  5GT0 B;  3MGQ B;  5KDM B;  1P3F D;  5BNV B;  5CP6 B;  4Z5T D;  4J8W C;  1P3K C;  1F66 C;  2NZD C;  4ZUX B;  3X1U A;  2CWE A;  3A6N C;  2FJ7 B;  3W96 D;  3AZH C;  5JA4 B;  3AFA D;  4UUZ B;  3B6F B;  2XD5 A;  3REI A;  5B2J A;  5B0Z A;  5CPK D;  5AV9 D;  3KSY A;  4J8U D;  3AYW C;  1M18 D;  1KX4 A;  4R8P B;  3X1S B;  3VH6 W;  1P3B A;  4H9O A;  2ARO D;  5F99 B;  3B0C W;  3KWQ A;  5B2I D;  3AN2 A;  3REI C;  5B0Z C;  3AZG B;  5BS7 A;  4DQY B;  3C1C A;  3REL C;  3MGS D;  5BNX A;  3MGR B;  4YM6 B;  3WKJ D;  3AZM A;  1U35 D;  1P34 A;  2Y2L A;  3R45 A;  3KWQ C;  3MGQ C;  3X1V B;  4J8V D;  3AN2 C;  4YS3 A;  1P3B C;  4XZQ B;  2Y2M A;  1BH9 B;  3WA9 D;  4ZUX C;  3REJ B;  1A7W A;  1TAF A;  5B0Y A;  3C1C C;  3REK B;  1AOI A;  1P3M A;  1M19 A;  2PYO B;  2NZD D;  1P3P D;  1BH8 B;  2HUE B;  3AZH D;  1M1A D;  5BO0 B;  3H0L C;  3LEL A;  1P34 C;  4YS3 C;  4X23 A;  2BYM A;  5GSU B;  3AZF D;  3TU4 B;  5B33 A;  3EPJ A;  4Z66 B;  5B0Y C;  4R8P C;  1AOI C;  1P3M C;  1M19 C;  2IO5 C;  2YFW B;  4H9S A;  3X1U D;  4XUJ B;  3WTP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...