1KX3D

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3D00
4Z66D 1KX5B 5AV9C 4H9RA 1P3AA 1TZYC 4LD9D 4QLCD 1HQ3C 5AV5C 5FUGB 3WTPA 3LZ0D 4J8WB 1P3FD 3NQUA 5JRGA 3REHB 2CV5D 2BYKA 3MNND 5AV6C 1P3BC 3AZFA 1ID3D 1P3ID 3MGSA 3AZHB 1P3KC 3TU4B 2IO5C 5AVBA 3AZNB 2YFVB 4WU8A 3KXBA 4WNNA 3AZMA 1N1JB 5E5AB 1HQ3D 3B0BA 5AV5D 5B0ZA 5AY8A 4H9QA 5B0YA 3AN2B 4YS3B 1U35B 3WA9B 5AV6D 1P3BD 4X23A 4KUDC 4ZBJC 1P3KD 1P3MB 4AWLB 2RVQC 2NZDA 4KGCB 5B24C 3X1UA 4JJNA 4J8UA 3REKC 3W99B 5JA4B 4G91C 1AOIC 5AV8C 5DNMB 4KUDD 5DNNB 4R8PC 4NFTA 2RVQD 3W98B 1ULYA 5B24D 3C1BA 3REKD 5C3IC 5GSUC 3LJAB 5B33A 3UTBA 4J8VA 5CPJC 5GXQB 5BNVB 1AOID 5AV8D 3AV1C 1B6WA 5BT1C 4Z5TA 1ZLAA 3AFAB 3REID 1P3GB 1P3AC 4EO5B 5GSUD 3WTPC 3MGRB 2PYOA 4NE6A 5JRGC 2BYMA 3O62B 5AV9B 3LZ0A 3AZFC 3AV1D 1P3FA 1TZYB 5BT1D 3MGSC 2JSSA 2YFWB 2F8NB 5AVBC 3MNNA 4WU8C 1P3OB 1P3AD 3KXBC 3AZMC 1TAFA 3WTPD 3C1CA 2IO5B 5JRGD 5BO0A 5B0ZC 3V9RB 3AZIB 5AY8C 5B0YC 5AVCA 3AZFD 4H9OB 3MGSD 3AZJB 2NZDC 1F66B 1P3LB 5AV6A 2F8NK 4WU8D 3X1UC 4JJNC 4J8UC 3KXBD 3AZMD 3W97A 3VH5W 4ZBJB 3AZKB 5B0ZD 1KX3A 1M19B 5AY8D 4XZQB 5F99A 3AZLB 1M1AB 5GT0B 5B32D 5G49B 5B2JB 3X1UD 4JJND 1S32A 5CPIA 5B33C 3UTBC 4J8VC 5BS7A 4R8PB 3A6NA 1KX4B 2AROB 3KSYA 5KDMA 5B40D 4Z5TC 1ZLAC 1BH9B 4CAYA 1JFIB 5CPJB 3KWQB 3WAAA 3B0CT 4Z2MH 5B33D 3UTBD 4J8VD 1P3PB 4WZSB 3REIA 2PYOC 4WU9A 4J8XC 3R45B 3LZ0C 3MVDB 1P3FC 1M18A 1H3OA 4UUZA 4Z5TD 1ZLAD 3MNNC 4Z2MG 3LELA 3MGPA 3REJD 3AV2B 3B0CW 3AZFB 5BNXB 3X1SD 3C1CC 2PYOD 5AVBB 2LY8A 5GT3D 3VH6T 3VH5A 4J8XD 5AVCC 4YM6A 3B6FB 4H9NB 3X1TA 3NQJB 5B0YB 1HTAA 4X23B 3LZ1A 3MGQA 3C1CD 3W97C 5B1LA 1KX3C 2NZDB 5F99C 4DRAA 3AYWA 5AVCD 4J8UB 3X1VC 4HGAC 3UTAB 5B32A 1EQZB 4XUJB 1S32C 5CPIC 3AZEB 3UT9A 3KUYB 3W97D 5BS7C 3A6NC 2NQBA 1KX3D 4ZUXB 3B6GA 5B2IB 1Q9CA 5F99D 3C1BB 4DRBA 5CP6D 1KX5A 3B0DC 5B40A 3X1VD 5FUGA 5B1MB 4J8WA 3REHA 1A7WA 3W96B 3WAAC 1S32D 5CPID 3REIC 4WU9C 3A6ND 3TU4A 5B32G 1M18C 3RELA 4Z66B 1N1JA 5E5AA 3WKJC 4LD9B 3LELC 4QLCB 3MGPC 4G92B 3AN2A 3LZ0B 4YS3A 1P3FB 2FJ7A 3WA9A 3WAAD 2CV5B 1F1EA 4WU9D 3REJA 3WTPE 3MNNB 1P3MA 1ID3B 1P3IB 2HIOA 3X1SA 1M18D 1TAFB 4YM6C 3W99A 5GT3A 3C1CB 3X1TC 4J8XA 5BO0B 3WKJD 1WWIA 3LELD 5AV5B 1HQ3B 3MGPD 3LZ1C 3MGQC 5DNMA 5B1LC 5AV6B 1P3BB 2HUEC 3W98A 3AYWC 1P3KB 4YM6D 3LJAA 3X1TD 5B32C 5B31C 5GXQA 5BNVA 3LZ1D 3MGQD 3UT9C 4M6BA 5B1LD 2NQBC 3B6GC 4KUDB 3AYWD 1KX5C 1P3GA 3AZGD 5B40C 5B24B 4J8WC 5CP6A 1WWSA 3REKB 3O62A 3REHC 5B31D 3X1VA 4G91B 3UT9D 1P34D 3B0DB 1AOIB 4CAYB 2YFWA 2NQBD 2F8NA 3TU4C 3B6GD 5AV8B 1KU5A 3RELC 1KX5D 1P3OA 5E5AC 3REIB 4J8WD 5C3IB 5GSUB 3REHD 3AZIA 4YS3C 3AN2C 2FJ7C 3WA9C 1H3OB 1BH8A 5CPKA 4CSRB 3REJC 3AZHD 4H9PA 3TU4D 3AZJA 1P3MC 3AV1B 3AZND 1F66A 1P3LA 4KGCC 2HIOC 3X1SC 3RELD 3W99C 5E5AD 5GT3C 4H9RB 1P3AB 3AZKA 3WTPB 1M19A 4YS3D 4XZQA 3AN2D 1U35D 3NQUB 1M1AA 2FJ7D 3WA9D 5JRGB 5GT0A 5DNMC 3WKJA 2BYKB 5G49A 1P3MD 5B2JA 3W98C 4KGCD 2HIOD 3MGSB 5CHLB 3W99D 3MGQB 3LJAC 4WU8B 3KXBB 4WNNB 3AZMB 1KX4A 5GXQC 2AROA 2HUEB 5B0ZB 5DNMD 5AY8B 4H9QB 4E45A 1BH9A 5B32B 3W98D 1P3GC 3KWQA 4EO5C 3VH6W 3LJAD 1P3PA 3X1UB 5CP6C 4JJNB 2NQBB 4KHAA 3O62C 3AZGA 5GXQD 3R45A 3MVDA 5B40B 5B31A 3AFAD 1P34A 1P3GD 1P3OC 3AV2A 5BNXA 3MGRD 3O62D 2L5AA 3AZIC 5B33B 3UTBB 4J8VB 3RELB 4H9SA 5AV9D 5CPKC 1TZYD 2F8ND 3AZJC 3B6FA 4H9NA 1F66C 1P3LC 3NQJA 2CWEA 4Z5TB 1ZLAB 1P3OD 3AZHA 2FJ7B 3AZNA 5B31G 3REJB 3AZKC 2YFVA 4NE3A 1M19C 3AZID 2HIOB 4XZQC 3X1SB 3AZLC 1M1AC 2PYOB 2BYMB 5GT0C 5CPKD 5GT3B 4J8XB 3AZJD 1U35A 1F66D 5B2JC 1P3LD 3UTAA 1EQZA 4XUJA 3AZEA 4KGCA 3KUYA 3AZKD 1KX4C 2AROC 3VH6A 5B2IA 4ZUXA 1M19D 4XZQD 3AZLD 1M1AD 5GT0D 5JA4A 5AVCB 5B1MA 5B2JD 3KWQC 5DNNA 3W96A 1P3PC 4R8PD 3AZGC 1KX4D 2AROD 3W97B 4E44A 3MVDC 1KX3B 4Z66A 5F99B 5CP6B 5CPJD 1P34C 4LD9A 3KWQD 4QLCA 3AV2C 3X1VB 4HGAB 3AFAA 1P3PD 2CV5A 1S32B 5CPIB 1ID3A 4H9SC 3MGRA 1P3IA 3MVDD 3A6NB 5KDMB 3B6FC 3VH5T 5AV9A 1TZYA 3AZHC 5AV5A 1HQ3A 3AV2D 1BH8B 3AZNC 4X23C 5CPKB 4H9PB 3WAAB 5AVBD 1P3BA 4WU9B 1P3KA 3V9RA 3B6FD 1U35C 1M18B 2F8NH 3UTAC 4UUZB 4H9OA 5B0YD 1EQZC 4XUJC 4AWLC 3AZEC 4X23D 3WKJB 3LELB 4NE5A 3MGPB 3KUYC 4ZUXC 2NZDD 5B2IC 4KUDA 3C1BC 2F8NG 4J8UD 1BFMA 5B1MC 5B24A 1B67A 3AZLA 3UTAD 4YM6B 3REKA 1EQZD 5DNNC 4XUJD 3W96C 3X1TB 3AZED 3KUYD 1AOIA 4ZUXD 3LZ1B 5B2ID 5AV8A 5B1LB 3C1BD 4R8PA 4Z66C 3AYWB 5B1MD 4KHAB 3AZGB 5GSUA 4LD9C 4QLCC 4G92C 5DNND 3W96D 1JFIA 5CPJA 4WV4B 3AFAC 4CSRA 5B31B 2CV5C 1R4VA 3UT9B 3AV1A 1P34B 1ID3C 3MGRC 1P3IC 3B6GB
chains in the Genus database with same CATH superfamily
4Z66D 1KX5B 5AV9C 2G5IC 4H9RA 1P3AA 1TZYC 4LD9D 4QLCD 1HQ3C 5AV5C 5FUGB 3WTPA 3LZ0D 4J8WB 1P3FD 3NQUA 5JRGA 3REHB 2CV5D 2BYKA 3MNND 5AV6C 1P3BC 3AZFA 2VQRA 1ID3D 1P3ID 3MGSA 3AZHB 1P3KC 3TU4B 2IO5C 5AVBA 3AZNB 2YFVB 4WU8A 3KXBA 4WNNA 3AZMA 1N1JB 5E5AB 1HQ3D 3B0BA 5AV5D 5B0ZA 5AY8A 4H9QA 5B0YA 3AN2B 4YS3B 1U35B 3WA9B 5AV6D 1P3BD 3KFUG 4X23A 4KUDC 3P5JB 4ZBJC 1P3KD 1P3MB 4AWLB 2RVQC 2NZDA 4KGCB 3AL0C 5B24C 3X1UA 4JJNA 4J8UA 3REKC 3W99B 5JA4B 4G91C 1AOIC 5AV8C 5DNMB 4KUDD 5DNNB 4R8PC 4NFTA 2RVQD 3W98B 1ULYA 5B24D 3C1BA 3EPKA 5C3IC 5GSUC 3REKD 3LJAB 5B33A 3UTBA 4J8VA 5CPJC 5GXQB 5BNVB 1AOID 2Y2LA 5AV8D 3AV1C 1B6WA 5BT1C 4Z5TA 1ZLAA 2ZY3A 3AFAB 3REID 1P3GB 1P3AC 4EO5B 5GSUD 3WTPC 3MGRB 2PYOA 1W2EA 4NE6A 5JRGC 2BYMA 3O62B 5AV9B 3LZ0A 3FDDA 3AZFC 3AV1D 1TZYB 5BT1D 3MGSC 1P3FA 3EPHA 2JSSA 2YFWB 2F8NB 5AVBC 3MNNA 2ZM5A 4WU8C 1P3OB 1P3AD 3KXBC 3AZMC 1TAFA 3WTPD 3C1CA 3EPJA 2IO5B 3A1IA 5BO0A 5JRGD 3V9RB 5B0ZC 3AZIB 5AY8C 5B0YC 5AVCA 3AZFD 4H9OB 3MGSD 3AZJB 2NZDC 1F66B 2J8PA 1P3LB 5AV6A 2F8NK 4WU8D 3X1UC 4JJNC 4J8UC 3KXBD 2Y2JA 3AZMD 3W97A 3VH5W 4ZBJB 3AZKB 5B0ZD 1KX3A 1M19B 5AY8D 4XZQB 5F99A 3AZLB 1M1AB 5GT0B 5B32D 4UPKA 5G49B 5B2JB 2W8SA 3A1KA 3X1UD 4JJND 1S32A 5CPIA 5B33C 3UTBC 4J8VC 5BS7A 4R8PB 3A6NA 1KX4B 2AROB 3F6TA 3KSYA 5KDMA 5B40D 4Z5TC 1ZLAC 1BH9B 4CAYA 4DQYB 5CPJB 1JFIB 3KWQB 2DF4C 3WAAA 3B0CT 4Z2MH 5B33D 3UTBD 4J8VD 1P3PB 4WZSB 3REIA 2PYOC 4WU9A 2Y2KA 4J8XC 3R45B 3LZ0C 3MVDB 1P3FC 1M18A 1H3OA 4UUZA 4Z5TD 1ZLAD 2FFFB 3MNNC 4Z2MG 3LELA 3MGPA 3REJD 3AV2B 3B0CW 3AZFB 5BNXB 3X1SD 3C1CC 2PYOD 5AVBB 2LY8A 5GT3D 3VH6T 3VH5A 4J8XD 5AVCC 4YM6A 3B6FB 4H9NB 3X1TA 3NQJB 5B0YB 1HTAA 4X23B 3LZ1A 3MGQA 3C1CD 3W97C 5B1LA 1KX3C 2NZDB 5F99C 4DRAA 2F2AC 3AYWA 5AVCD 4J8UB 3X1VC 2DQNC 4HGAC 3UTAB 5B32A 1EQZB 4XUJB 1S32C 5CPIC 2ZY4A 3AZEB 3UT9A 3KUYB 3W97D 5BS7C 3A6NC 2NQBA 1KX3D 4ZUXB 3B6GA 5B2IB 1Q9CA 5F99D 3C1BB 4DRBA 5CP6D 1KX5A 3H0RC 3B0DC 5B40A 3X1VD 5FUGA 5B1MB 4J8WA 3REHA 1A7WA 3W96B 3WAAC 1S32D 5CPID 3REIC 4WU9C 3A6ND 3TU4A 5B32G 1M18C 3RELA 4Z66B 1N1JA 5E5AA 3WKJC 4LD9B 3LELC 4QLCB 3MGPC 4G92B 1T3UA 3AN2A 3LZ0B 4YS3A 2JCHA 1P3FB 2FJ7A 3WA9A 3WAAD 2CV5B 1F1EA 4WU9D 3REJA 3WTPE 3MNNB 1P3MA 1ID3B 3H0MC 1P3IB 2HIOA 3X1SA 1M18D 2ZY5A 1TAFB 4YM6C 3W99A 5GT3A 3C1CB 3X1TC 4J8XA 5BO0B 3WKJD 1WWIA 3LELD 5AV5B 1HQ3B 3MGPD 3LZ1C 3MGQC 5DNMA 5B1LC 5AV6B 1P3BB 2HUEC 3W98A 3AYWC 2Y2OA 1P3KB 4YM6D 3LJAA 3X1TD 5B32C 5B31C 5GXQA 5BNVA 1PZRA 2Y2GA 3LZ1D 3MGQD 3UT9C 4M6BA 5B1LD 2NQBC 3B6GC 4KUDB 3AYWD 1KX5C 1P3GA 3AZGD 5B40C 5B24B 4J8WC 5CP6A 1WWSA 3REKB 3O62A 3REHC 5B31D 3X1VA 4G91B 3UT9D 1P34D 2ZY2A 3B0DB 1AOIB 4CAYB 2YFWA 2NQBD 2F8NA 3TU4C 3B6GD 5AV8B 1KU5A 3RELC 1KX5D 1P3OA 5E5AC 2Y2MA 3REIB 4J8WD 5C3IB 5GSUB 3REHD 3AZIA 4YS3C 3AN2C 2FJ7C 3WA9C 1H3OB 1BH8A 5CPKA 4CSRB 3REJC 3AZHD 4H9PA 3TU4D 3AZJA 1P3MC 3AV1B 3AZND 1F66A 1P3LA 4KGCC 2HIOC 3X1SC 3RELD 3W99C 5E5AD 5GT3C 4H9RB 1P3AB 3AZKA 3WTPB 1M19A 4YS3D 4XZQA 3AN2D 1U35D 3NQUB 1M1AA 2FJ7D 3WA9D 5JRGB 5GT0A 5DNMC 3WKJA 2BYKB 5G49A 1P3MD 5B2JA 3W98C 4KGCD 2HIOD 3MGSB 5CHLB 2Y2HA 3W99D 3MGQB 3H0LC 3LJAC 4WU8B 3KXBB 4WNNB 3AZMB 1KX4A 5GXQC 2AROA 2HUEB 5B0ZB 5DNMD 2XD5A 5AY8B 4H9QB 4E45A 1BH9A 5B32B 3W98D 1P3GC 3KWQA 4EO5C 3VH6W 3LJAD 1P3PA 3X1UB 5CP6C 4JJNB 2NQBB 4KHAA 3O62C 3AZGA 5GXQD 3R45A 3MVDA 5B40B 5B31A 3AFAD 2Y2IA 1P34A 1P3GD 1P3OC 3AV2A 5BNXA 3MGRD 3O62D 2L5AA 3AZIC 5B33B 3UTBB 4J8VB 3RELB 4H9SA 5AV9D 5CPKC 3EPLA 1TZYD 2F8ND 3AZJC 3B6FA 4H9NA 1F66C 1P3LC 3NQJA 2CWEA 4Z5TB 1ZLAB 1P3OD 3AZHA 2FJ7B 3AZNA 5B31G 3REJB 3AZKC 2YFVA 4NE3A 1M19C 3AZID 2HIOB 4XZQC 2RIQA 3X1SB 3AZLC 1M1AC 2PYOB 2BYMB 5GT0C 5CPKD 4WJ3C 5GT3B 4J8XB 3AZJD 1U35A 1F66D 5B2JC 1P3LD 3UTAA 1EQZA 4XUJA 3AZEA 4KGCA 3KUYA 3AZKD 1KX4C 2AROC 3VH6A 5B2IA 4ZUXA 1M19D 4XZQD 3AZLD 1M1AD 5GT0D 5JA4A 5AVCB 5B1MA 2BG1A 5B2JD 3KWQC 5DNNA 3W96A 1P3PC 4R8PD 3AZGC 1KX4D 2AROD 3W97B 4E44A 3MVDC 1KX3B 2Y2PA 4Z66A 5F99B 5CP6B 5CPJD 1P34C 4LD9A 3KWQD 4QLCA 1Z2CB 3AV2C 3X1VB 4HGAB 3AFAA 1P3PD 2CV5A 1S32B 5CPIB 2Y2NA 1ID3A 4H9SC 3MGRA 1P3IA 3MVDD 3A6NB 5KDMB 3B6FC 2UWXA 3VH5T 5AV9A 1TZYA 3AZHC 5AV5A 1HQ3A 3AV2D 1BH8B 3AZNC 4X23C 5CPKB 4H9PB 3WAAB 5AVBD 1P3BA 4WU9B 1P3KA 3V9RA 3B6FD 1U35C 1M18B 2F8NH 3UTAC 4UUZB 4H9OA 5B0YD 1EQZC 4XUJC 4AWLC 3AZEC 4X23D 3WKJB 3LELB 4NE5A 3MGPB 3KUYC 4ZUXC 2NZDD 5B2IC 3EG5B 4KUDA 3C1BC 2F8NG 4J8UD 2Y2QA 1BFMA 5B1MC 5B24A 1B67A 3AZLA 3UTAD 4YM6B 3REKA 1EQZD 5DNNC 4XUJD 3W96C 3X1TB 3AZED 3KUYD 1AOIA 4ZUXD 3LZ1B 5B2ID 5AV8A 5B1LB 3C1BD 4R8PA 4Z66C 2JE5A 3AYWB 5B1MD 4KHAB 3AZGB 5GSUA 4LD9C 4QLCC 4G92C 5DNND 3W96D 1JFIA 5CPJA 4WV4B 3AFAC 4CSRA 5B31B 2CV5C 1R4VA 3IP4C 2G5HC 3UT9B 3AV1A 1P34B 1ID3C 3MGRC 1P3IC 2XD1A 3B6GB
chains in the Genus database with same CATH topology
4Z66D 1KX5B 5AV9C 2G5IC 4H9RA 1P3AA 1TZYC 4LD9D 4QLCD 1HQ3C 5AV5C 5FUGB 3WTPA 3LZ0D 4J8WB 1P3FD 3NQUA 5JRGA 3REHB 2CV5D 2BYKA 3MNND 5AV6C 1P3BC 3AZFA 2VQRA 1ID3D 1P3ID 3MGSA 3AZHB 1P3KC 3TU4B 2IO5C 5AVBA 3AZNB 2YFVB 4WU8A 3KXBA 4WNNA 3AZMA 1N1JB 5E5AB 1HQ3D 3B0BA 5AV5D 5B0ZA 5AY8A 4H9QA 5B0YA 3AN2B 4YS3B 1U35B 3WA9B 5AV6D 1P3BD 3KFUG 4X23A 4KUDC 3P5JB 4ZBJC 1P3KD 1P3MB 4AWLB 2RVQC 2NZDA 4KGCB 3AL0C 5B24C 3X1UA 4JJNA 4J8UA 3REKC 3W99B 5JA4B 4G91C 1AOIC 5AV8C 5DNMB 4KUDD 5DNNB 4R8PC 4NFTA 2RVQD 3W98B 1ULYA 5B24D 3C1BA 3EPKA 5C3IC 5GSUC 3REKD 3LJAB 5B33A 3UTBA 4J8VA 5CPJC 5GXQB 5BNVB 1AOID 2Y2LA 5AV8D 3AV1C 1B6WA 5BT1C 4Z5TA 1ZLAA 2ZY3A 3AFAB 3REID 1P3GB 1P3AC 4EO5B 5GSUD 3WTPC 3MGRB 2PYOA 1W2EA 4NE6A 5JRGC 2BYMA 3O62B 5AV9B 3LZ0A 3FDDA 3AZFC 3AV1D 1TZYB 5BT1D 3MGSC 1P3FA 3EPHA 2JSSA 2YFWB 2F8NB 5AVBC 3MNNA 2ZM5A 4WU8C 1P3OB 1P3AD 3KXBC 3AZMC 1TAFA 3WTPD 3C1CA 3EPJA 2IO5B 3A1IA 5BO0A 5JRGD 3V9RB 5B0ZC 3AZIB 5AY8C 5B0YC 5AVCA 3AZFD 4H9OB 3MGSD 3AZJB 2NZDC 1F66B 2J8PA 1P3LB 5AV6A 2F8NK 4WU8D 3X1UC 4JJNC 4J8UC 3KXBD 2Y2JA 3AZMD 3W97A 3VH5W 4ZBJB 3AZKB 5B0ZD 1KX3A 1M19B 5AY8D 4XZQB 5F99A 3AZLB 1M1AB 5GT0B 5B32D 4UPKA 5G49B 5B2JB 2W8SA 3A1KA 3X1UD 4JJND 1S32A 5CPIA 5B33C 3UTBC 4J8VC 5BS7A 4R8PB 3A6NA 1KX4B 2AROB 3F6TA 3KSYA 5KDMA 5B40D 4Z5TC 1ZLAC 1BH9B 4CAYA 4DQYB 5CPJB 1JFIB 3KWQB 2DF4C 3WAAA 3B0CT 4Z2MH 5B33D 3UTBD 4J8VD 1P3PB 4WZSB 3REIA 2PYOC 4WU9A 2Y2KA 4J8XC 3R45B 3LZ0C 3MVDB 1P3FC 1M18A 1H3OA 4UUZA 4Z5TD 1ZLAD 2FFFB 3MNNC 4Z2MG 3LELA 3MGPA 3REJD 3AV2B 3B0CW 3AZFB 5BNXB 3X1SD 3C1CC 2PYOD 5AVBB 2LY8A 5GT3D 3VH6T 3VH5A 4J8XD 5AVCC 4YM6A 3B6FB 4H9NB 3X1TA 3NQJB 5B0YB 1HTAA 4X23B 3LZ1A 3MGQA 3C1CD 3W97C 5B1LA 1KX3C 2NZDB 5F99C 4DRAA 2F2AC 3AYWA 5AVCD 4J8UB 3X1VC 2DQNC 4HGAC 3UTAB 5B32A 1EQZB 4XUJB 1S32C 5CPIC 2ZY4A 3AZEB 3UT9A 3KUYB 3W97D 5BS7C 3A6NC 2NQBA 1KX3D 4ZUXB 3B6GA 5B2IB 1Q9CA 5F99D 3C1BB 4DRBA 5CP6D 1KX5A 3H0RC 3B0DC 5B40A 3X1VD 5FUGA 5B1MB 4J8WA 3REHA 1A7WA 3W96B 3WAAC 1S32D 5CPID 3REIC 4WU9C 3A6ND 3TU4A 5B32G 1M18C 3RELA 4Z66B 1N1JA 5E5AA 3WKJC 4LD9B 3LELC 4QLCB 3MGPC 4G92B 1T3UA 3AN2A 3LZ0B 4YS3A 2JCHA 1P3FB 2FJ7A 3WA9A 3WAAD 2CV5B 1F1EA 4WU9D 3REJA 3WTPE 3MNNB 1P3MA 1ID3B 3H0MC 1P3IB 2HIOA 3X1SA 1M18D 2ZY5A 1TAFB 4YM6C 3W99A 5GT3A 3C1CB 3X1TC 4J8XA 5BO0B 3WKJD 1WWIA 3LELD 5AV5B 1HQ3B 3MGPD 3LZ1C 3MGQC 5DNMA 5B1LC 5AV6B 1P3BB 2HUEC 3W98A 3AYWC 2Y2OA 1P3KB 4YM6D 3LJAA 3X1TD 5B32C 5B31C 5GXQA 5BNVA 1PZRA 2Y2GA 3LZ1D 3MGQD 3UT9C 4M6BA 5B1LD 2NQBC 3B6GC 4KUDB 3AYWD 1KX5C 1P3GA 3AZGD 5B40C 5B24B 4J8WC 5CP6A 1WWSA 3REKB 3O62A 3REHC 5B31D 3X1VA 4G91B 3UT9D 1P34D 2ZY2A 3B0DB 1AOIB 4CAYB 2YFWA 2NQBD 2F8NA 3TU4C 3B6GD 5AV8B 1KU5A 3RELC 1KX5D 1P3OA 5E5AC 2Y2MA 3REIB 4J8WD 5C3IB 5GSUB 3REHD 3AZIA 4YS3C 3AN2C 2FJ7C 3WA9C 1H3OB 1BH8A 5CPKA 4CSRB 3REJC 3AZHD 4H9PA 3TU4D 3AZJA 1P3MC 3AV1B 3AZND 1F66A 1P3LA 4KGCC 2HIOC 3X1SC 3RELD 3W99C 5E5AD 5GT3C 4H9RB 1P3AB 3AZKA 3WTPB 1M19A 4YS3D 4XZQA 3AN2D 1U35D 3NQUB 1M1AA 2FJ7D 3WA9D 5JRGB 5GT0A 5DNMC 3WKJA 2BYKB 5G49A 1P3MD 5B2JA 3W98C 4KGCD 2HIOD 3MGSB 5CHLB 2Y2HA 3W99D 3MGQB 3H0LC 3LJAC 4WU8B 3KXBB 4WNNB 3AZMB 1KX4A 5GXQC 2AROA 2HUEB 5B0ZB 5DNMD 2XD5A 5AY8B 4H9QB 4E45A 1BH9A 5B32B 3W98D 1P3GC 3KWQA 4EO5C 3VH6W 3LJAD 1P3PA 3X1UB 5CP6C 4JJNB 2NQBB 4KHAA 3O62C 3AZGA 5GXQD 3R45A 3MVDA 5B40B 5B31A 3AFAD 2Y2IA 1P34A 1P3GD 1P3OC 3AV2A 5BNXA 3MGRD 3O62D 2L5AA 3AZIC 5B33B 3UTBB 4J8VB 3RELB 4H9SA 5AV9D 5CPKC 3EPLA 1TZYD 2F8ND 3AZJC 3B6FA 4H9NA 1F66C 1P3LC 3NQJA 2CWEA 4Z5TB 1ZLAB 1P3OD 3AZHA 2FJ7B 3AZNA 5B31G 3REJB 3AZKC 2YFVA 4NE3A 1M19C 3AZID 2HIOB 4XZQC 2RIQA 3X1SB 3AZLC 1M1AC 2PYOB 2BYMB 5GT0C 5CPKD 4WJ3C 5GT3B 4J8XB 3AZJD 1U35A 1F66D 5B2JC 1P3LD 3UTAA 1EQZA 4XUJA 3AZEA 4KGCA 3KUYA 3AZKD 1KX4C 2AROC 3VH6A 5B2IA 4ZUXA 1M19D 4XZQD 3AZLD 1M1AD 5GT0D 5JA4A 5AVCB 5B1MA 2BG1A 5B2JD 3KWQC 5DNNA 3W96A 1P3PC 4R8PD 3AZGC 1KX4D 2AROD 3W97B 4E44A 3MVDC 1KX3B 2Y2PA 4Z66A 5F99B 5CP6B 5CPJD 1P34C 4LD9A 3KWQD 4QLCA 1Z2CB 3AV2C 3X1VB 4HGAB 3AFAA 1P3PD 2CV5A 1S32B 5CPIB 2Y2NA 1ID3A 4H9SC 3MGRA 1P3IA 3MVDD 3A6NB 5KDMB 3B6FC 2UWXA 3VH5T 5AV9A 1TZYA 3AZHC 5AV5A 1HQ3A 3AV2D 1BH8B 3AZNC 4X23C 5CPKB 4H9PB 3WAAB 5AVBD 1P3BA 4WU9B 1P3KA 3V9RA 3B6FD 1U35C 1M18B 2F8NH 3UTAC 4UUZB 4H9OA 5B0YD 1EQZC 4XUJC 4AWLC 3AZEC 4X23D 3WKJB 3LELB 4NE5A 3MGPB 3KUYC 4ZUXC 2NZDD 5B2IC 3EG5B 4KUDA 3C1BC 2F8NG 4J8UD 2Y2QA 1BFMA 5B1MC 5B24A 1B67A 3AZLA 3UTAD 4YM6B 3REKA 1EQZD 5DNNC 4XUJD 3W96C 3X1TB 3AZED 3KUYD 1AOIA 4ZUXD 3LZ1B 5B2ID 5AV8A 5B1LB 3C1BD 4R8PA 4Z66C 2JE5A 3AYWB 5B1MD 4KHAB 3AZGB 5GSUA 4LD9C 4QLCC 4G92C 5DNND 3W96D 1JFIA 5CPJA 4WV4B 3AFAC 4CSRA 5B31B 2CV5C 1R4VA 3IP4C 2G5HC 3UT9B 3AV1A 1P34B 1ID3C 3MGRC 1P3IC 2XD1A 3B6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 D;  1KX5 B;  5AV9 C;  4H9R A;  1P3A A;  1TZY C;  4LD9 D;  4QLC D;  1HQ3 C;  5AV5 C;  5FUG B;  3WTP A;  3LZ0 D;  4J8W B;  1P3F D;  3NQU A;  5JRG A;  3REH B;  2CV5 D;  2BYK A;  3MNN D;  5AV6 C;  1P3B C;  3AZF A;  1ID3 D;  1P3I D;  3MGS A;  3AZH B;  1P3K C;  3TU4 B;  2IO5 C;  5AVB A;  3AZN B;  2YFV B;  4WU8 A;  3KXB A;  4WNN A;  3AZM A;  1N1J B;  5E5A B;  1HQ3 D;  3B0B A;  5AV5 D;  5B0Z A;  5AY8 A;  4H9Q A;  5B0Y A;  3AN2 B;  4YS3 B;  1U35 B;  3WA9 B;  5AV6 D;  1P3B D;  4X23 A;  4KUD C;  4ZBJ C;  1P3K D;  1P3M B;  4AWL B;  2RVQ C;  2NZD A;  4KGC B;  5B24 C;  3X1U A;  4JJN A;  4J8U A;  3REK C;  3W99 B;  5JA4 B;  4G91 C;  1AOI C;  5AV8 C;  5DNM B;  4KUD D;  5DNN B;  4R8P C;  4NFT A;  2RVQ D;  3W98 B;  1ULY A;  5B24 D;  3C1B A;  3REK D;  5C3I C;  5GSU C;  3LJA B;  5B33 A;  3UTB A;  4J8V A;  5CPJ C;  5GXQ B;  5BNV B;  1AOI D;  5AV8 D;  3AV1 C;  1B6W A;  5BT1 C;  4Z5T A;  1ZLA A;  3AFA B;  3REI D;  1P3G B;  1P3A C;  4EO5 B;  5GSU D;  3WTP C;  3MGR B;  2PYO A;  4NE6 A;  5JRG C;  2BYM A;  3O62 B;  5AV9 B;  3LZ0 A;  3AZF C;  3AV1 D;  1P3F A;  1TZY B;  5BT1 D;  3MGS C;  2JSS A;  2YFW B;  2F8N B;  5AVB C;  3MNN A;  4WU8 C;  1P3O B;  1P3A D;  3KXB C;  3AZM C;  1TAF A;  3WTP D;  3C1C A;  2IO5 B;  5JRG D;  5BO0 A;  5B0Z C;  3V9R B;  3AZI B;  5AY8 C;  5B0Y C;  5AVC A;  3AZF D;  4H9O B;  3MGS D;  3AZJ B;  2NZD C;  1F66 B;  1P3L B;  5AV6 A;  2F8N K;  4WU8 D;  3X1U C;  4JJN C;  4J8U C;  3KXB D;  3AZM D;  3W97 A;  3VH5 W;  4ZBJ B;  3AZK B;  5B0Z D;  1KX3 A;  1M19 B;  5AY8 D;  4XZQ B;  5F99 A;  3AZL B;  1M1A B;  5GT0 B;  5B32 D;  5G49 B;  5B2J B;  3X1U D;  4JJN D;  1S32 A;  5CPI A;  5B33 C;  3UTB C;  4J8V C;  5BS7 A;  4R8P B;  3A6N A;  1KX4 B;  2ARO B;  3KSY A;  5KDM A;  5B40 D;  4Z5T C;  1ZLA C;  1BH9 B;  4CAY A;  1JFI B;  5CPJ B;  3KWQ B;  3WAA A;  3B0C T;  4Z2M H;  5B33 D;  3UTB D;  4J8V D;  1P3P B;  4WZS B;  3REI A;  2PYO C;  4WU9 A;  4J8X C;  3R45 B;  3LZ0 C;  3MVD B;  1P3F C;  1M18 A;  1H3O A;  4UUZ A;  4Z5T D;  1ZLA D;  3MNN C;  4Z2M G;  3LEL A;  3MGP A;  3REJ D;  3AV2 B;  3B0C W;  3AZF B;  5BNX B;  3X1S D;  3C1C C;  2PYO D;  5AVB B;  2LY8 A;  5GT3 D;  3VH6 T;  3VH5 A;  4J8X D;  5AVC C;  4YM6 A;  3B6F B;  4H9N B;  3X1T A;  3NQJ B;  5B0Y B;  1HTA A;  4X23 B;  3LZ1 A;  3MGQ A;  3C1C D;  3W97 C;  5B1L A;  1KX3 C;  2NZD B;  5F99 C;  4DRA A;  3AYW A;  5AVC D;  4J8U B;  3X1V C;  4HGA C;  3UTA B;  5B32 A;  1EQZ B;  4XUJ B;  1S32 C;  5CPI C;  3AZE B;  3UT9 A;  3KUY B;  3W97 D;  5BS7 C;  3A6N C;  2NQB A;  1KX3 D;  4ZUX B;  3B6G A;  5B2I B;  1Q9C A;  5F99 D;  3C1B B;  4DRB A;  5CP6 D;  1KX5 A;  3B0D C;  5B40 A;  3X1V D;  5FUG A;  5B1M B;  4J8W A;  3REH A;  1A7W A;  3W96 B;  3WAA C;  1S32 D;  5CPI D;  3REI C;  4WU9 C;  3A6N D;  3TU4 A;  5B32 G;  1M18 C;  3REL A;  4Z66 B;  1N1J A;  5E5A A;  3WKJ C;  4LD9 B;  3LEL C;  4QLC B;  3MGP C;  4G92 B;  3AN2 A;  3LZ0 B;  4YS3 A;  1P3F B;  2FJ7 A;  3WA9 A;  3WAA D;  2CV5 B;  1F1E A;  4WU9 D;  3REJ A;  3WTP E;  3MNN B;  1P3M A;  1ID3 B;  1P3I B;  2HIO A;  3X1S A;  1M18 D;  1TAF B;  4YM6 C;  3W99 A;  5GT3 A;  3C1C B;  3X1T C;  4J8X A;  5BO0 B;  3WKJ D;  1WWI A;  3LEL D;  5AV5 B;  1HQ3 B;  3MGP D;  3LZ1 C;  3MGQ C;  5DNM A;  5B1L C;  5AV6 B;  1P3B B;  2HUE C;  3W98 A;  3AYW C;  1P3K B;  4YM6 D;  3LJA A;  3X1T D;  5B32 C;  5B31 C;  5GXQ A;  5BNV A;  3LZ1 D;  3MGQ D;  3UT9 C;  4M6B A;  5B1L D;  2NQB C;  3B6G C;  4KUD B;  3AYW D;  1KX5 C;  1P3G A;  3AZG D;  5B40 C;  5B24 B;  4J8W C;  5CP6 A;  1WWS A;  3REK B;  3O62 A;  3REH C;  5B31 D;  3X1V A;  4G91 B;  3UT9 D;  1P34 D;  3B0D B;  1AOI B;  4CAY B;  2YFW A;  2NQB D;  2F8N A;  3TU4 C;  3B6G D;  5AV8 B;  1KU5 A;  3REL C;  1KX5 D;  1P3O A;  5E5A C;  3REI B;  4J8W D;  5C3I B;  5GSU B;  3REH D;  3AZI A;  4YS3 C;  3AN2 C;  2FJ7 C;  3WA9 C;  1H3O B;  1BH8 A;  5CPK A;  4CSR B;  3REJ C;  3AZH D;  4H9P A;  3TU4 D;  3AZJ A;  1P3M C;  3AV1 B;  3AZN D;  1F66 A;  1P3L A;  4KGC C;  2HIO C;  3X1S C;  3REL D;  3W99 C;  5E5A D;  5GT3 C;  4H9R B;  1P3A B;  3AZK A;  3WTP B;  1M19 A;  4YS3 D;  4XZQ A;  3AN2 D;  1U35 D;  3NQU B;  1M1A A;  2FJ7 D;  3WA9 D;  5JRG B;  5GT0 A;  5DNM C;  3WKJ A;  2BYK B;  5G49 A;  1P3M D;  5B2J A;  3W98 C;  4KGC D;  2HIO D;  3MGS B;  5CHL B;  3W99 D;  3MGQ B;  3LJA C;  4WU8 B;  3KXB B;  4WNN B;  3AZM B;  1KX4 A;  5GXQ C;  2ARO A;  2HUE B;  5B0Z B;  5DNM D;  5AY8 B;  4H9Q B;  4E45 A;  1BH9 A;  5B32 B;  3W98 D;  1P3G C;  3KWQ A;  4EO5 C;  3VH6 W;  3LJA D;  1P3P A;  3X1U B;  5CP6 C;  4JJN B;  2NQB B;  4KHA A;  3O62 C;  3AZG A;  5GXQ D;  3R45 A;  3MVD A;  5B40 B;  5B31 A;  3AFA D;  1P34 A;  1P3G D;  1P3O C;  3AV2 A;  5BNX A;  3MGR D;  3O62 D;  2L5A A;  3AZI C;  5B33 B;  3UTB B;  4J8V B;  3REL B;  4H9S A;  5AV9 D;  5CPK C;  1TZY D;  2F8N D;  3AZJ C;  3B6F A;  4H9N A;  1F66 C;  1P3L C;  3NQJ A;  2CWE A;  4Z5T B;  1ZLA B;  1P3O D;  3AZH A;  2FJ7 B;  3AZN A;  5B31 G;  3REJ B;  3AZK C;  2YFV A;  4NE3 A;  1M19 C;  3AZI D;  2HIO B;  4XZQ C;  3X1S B;  3AZL C;  1M1A C;  2PYO B;  2BYM B;  5GT0 C;  5CPK D;  5GT3 B;  4J8X B;  3AZJ D;  1U35 A;  1F66 D;  5B2J C;  1P3L D;  3UTA A;  1EQZ A;  4XUJ A;  3AZE A;  4KGC A;  3KUY A;  3AZK D;  1KX4 C;  2ARO C;  3VH6 A;  5B2I A;  4ZUX A;  1M19 D;  4XZQ D;  3AZL D;  1M1A D;  5GT0 D;  5JA4 A;  5AVC B;  5B1M A;  5B2J D;  3KWQ C;  5DNN A;  3W96 A;  1P3P C;  4R8P D;  3AZG C;  1KX4 D;  2ARO D;  3W97 B;  4E44 A;  3MVD C;  1KX3 B;  4Z66 A;  5F99 B;  5CP6 B;  5CPJ D;  1P34 C;  4LD9 A;  3KWQ D;  4QLC A;  3AV2 C;  3X1V B;  4HGA B;  3AFA A;  1P3P D;  2CV5 A;  1S32 B;  5CPI B;  1ID3 A;  4H9S C;  3MGR A;  1P3I A;  3MVD D;  3A6N B;  5KDM B;  3B6F C;  3VH5 T;  5AV9 A;  1TZY A;  3AZH C;  5AV5 A;  1HQ3 A;  3AV2 D;  1BH8 B;  3AZN C;  4X23 C;  5CPK B;  4H9P B;  3WAA B;  5AVB D;  1P3B A;  4WU9 B;  1P3K A;  3V9R A;  3B6F D;  1U35 C;  1M18 B;  2F8N H;  3UTA C;  4UUZ B;  4H9O A;  5B0Y D;  1EQZ C;  4XUJ C;  4AWL C;  3AZE C;  4X23 D;  3WKJ B;  3LEL B;  4NE5 A;  3MGP B;  3KUY C;  4ZUX C;  2NZD D;  5B2I C;  4KUD A;  3C1B C;  2F8N G;  4J8U D;  1BFM A;  5B1M C;  5B24 A;  1B67 A;  3AZL A;  3UTA D;  4YM6 B;  3REK A;  1EQZ D;  5DNN C;  4XUJ D;  3W96 C;  3X1T B;  3AZE D;  3KUY D;  1AOI A;  4ZUX D;  3LZ1 B;  5B2I D;  5AV8 A;  5B1L B;  3C1B D;  4R8P A;  4Z66 C;  3AYW B;  5B1M D;  4KHA B;  3AZG B;  5GSU A;  4LD9 C;  4QLC C;  4G92 C;  5DNN D;  3W96 D;  1JFI A;  5CPJ A;  4WV4 B;  3AFA C;  4CSR A;  5B31 B;  2CV5 C;  1R4V A;  3UT9 B;  3AV1 A;  1P34 B;  1ID3 C;  3MGR C;  1P3I C;  3B6G B; 
#chains in the Genus database with same CATH topology
 4Z66 D;  1KX5 B;  5AV9 C;  2G5I C;  4H9R A;  1P3A A;  1TZY C;  4LD9 D;  4QLC D;  1HQ3 C;  5AV5 C;  5FUG B;  3WTP A;  3LZ0 D;  4J8W B;  1P3F D;  3NQU A;  5JRG A;  3REH B;  2CV5 D;  2BYK A;  3MNN D;  5AV6 C;  1P3B C;  3AZF A;  2VQR A;  1ID3 D;  1P3I D;  3MGS A;  3AZH B;  1P3K C;  3TU4 B;  2IO5 C;  5AVB A;  3AZN B;  2YFV B;  4WU8 A;  3KXB A;  4WNN A;  3AZM A;  1N1J B;  5E5A B;  1HQ3 D;  3B0B A;  5AV5 D;  5B0Z A;  5AY8 A;  4H9Q A;  5B0Y A;  3AN2 B;  4YS3 B;  1U35 B;  3WA9 B;  5AV6 D;  1P3B D;  3KFU G;  4X23 A;  4KUD C;  3P5J B;  4ZBJ C;  1P3K D;  1P3M B;  4AWL B;  2RVQ C;  2NZD A;  4KGC B;  3AL0 C;  5B24 C;  3X1U A;  4JJN A;  4J8U A;  3REK C;  3W99 B;  5JA4 B;  4G91 C;  1AOI C;  5AV8 C;  5DNM B;  4KUD D;  5DNN B;  4R8P C;  4NFT A;  2RVQ D;  3W98 B;  1ULY A;  5B24 D;  3C1B A;  3EPK A;  5C3I C;  5GSU C;  3REK D;  3LJA B;  5B33 A;  3UTB A;  4J8V A;  5CPJ C;  5GXQ B;  5BNV B;  1AOI D;  2Y2L A;  5AV8 D;  3AV1 C;  1B6W A;  5BT1 C;  4Z5T A;  1ZLA A;  2ZY3 A;  3AFA B;  3REI D;  1P3G B;  1P3A C;  4EO5 B;  5GSU D;  3WTP C;  3MGR B;  2PYO A;  1W2E A;  4NE6 A;  5JRG C;  2BYM A;  3O62 B;  5AV9 B;  3LZ0 A;  3FDD A;  3AZF C;  3AV1 D;  1TZY B;  5BT1 D;  3MGS C;  1P3F A;  3EPH A;  2JSS A;  2YFW B;  2F8N B;  5AVB C;  3MNN A;  2ZM5 A;  4WU8 C;  1P3O B;  1P3A D;  3KXB C;  3AZM C;  1TAF A;  3WTP D;  3C1C A;  3EPJ A;  2IO5 B;  3A1I A;  5BO0 A;  5JRG D;  3V9R B;  5B0Z C;  3AZI B;  5AY8 C;  5B0Y C;  5AVC A;  3AZF D;  4H9O B;  3MGS D;  3AZJ B;  2NZD C;  1F66 B;  2J8P A;  1P3L B;  5AV6 A;  2F8N K;  4WU8 D;  3X1U C;  4JJN C;  4J8U C;  3KXB D;  2Y2J A;  3AZM D;  3W97 A;  3VH5 W;  4ZBJ B;  3AZK B;  5B0Z D;  1KX3 A;  1M19 B;  5AY8 D;  4XZQ B;  5F99 A;  3AZL B;  1M1A B;  5GT0 B;  5B32 D;  4UPK A;  5G49 B;  5B2J B;  2W8S A;  3A1K A;  3X1U D;  4JJN D;  1S32 A;  5CPI A;  5B33 C;  3UTB C;  4J8V C;  5BS7 A;  4R8P B;  3A6N A;  1KX4 B;  2ARO B;  3F6T A;  3KSY A;  5KDM A;  5B40 D;  4Z5T C;  1ZLA C;  1BH9 B;  4CAY A;  4DQY B;  5CPJ B;  1JFI B;  3KWQ B;  2DF4 C;  3WAA A;  3B0C T;  4Z2M H;  5B33 D;  3UTB D;  4J8V D;  1P3P B;  4WZS B;  3REI A;  2PYO C;  4WU9 A;  2Y2K A;  4J8X C;  3R45 B;  3LZ0 C;  3MVD B;  1P3F C;  1M18 A;  1H3O A;  4UUZ A;  4Z5T D;  1ZLA D;  2FFF B;  3MNN C;  4Z2M G;  3LEL A;  3MGP A;  3REJ D;  3AV2 B;  3B0C W;  3AZF B;  5BNX B;  3X1S D;  3C1C C;  2PYO D;  5AVB B;  2LY8 A;  5GT3 D;  3VH6 T;  3VH5 A;  4J8X D;  5AVC C;  4YM6 A;  3B6F B;  4H9N B;  3X1T A;  3NQJ B;  5B0Y B;  1HTA A;  4X23 B;  3LZ1 A;  3MGQ A;  3C1C D;  3W97 C;  5B1L A;  1KX3 C;  2NZD B;  5F99 C;  4DRA A;  2F2A C;  3AYW A;  5AVC D;  4J8U B;  3X1V C;  2DQN C;  4HGA C;  3UTA B;  5B32 A;  1EQZ B;  4XUJ B;  1S32 C;  5CPI C;  2ZY4 A;  3AZE B;  3UT9 A;  3KUY B;  3W97 D;  5BS7 C;  3A6N C;  2NQB A;  1KX3 D;  4ZUX B;  3B6G A;  5B2I B;  1Q9C A;  5F99 D;  3C1B B;  4DRB A;  5CP6 D;  1KX5 A;  3H0R C;  3B0D C;  5B40 A;  3X1V D;  5FUG A;  5B1M B;  4J8W A;  3REH A;  1A7W A;  3W96 B;  3WAA C;  1S32 D;  5CPI D;  3REI C;  4WU9 C;  3A6N D;  3TU4 A;  5B32 G;  1M18 C;  3REL A;  4Z66 B;  1N1J A;  5E5A A;  3WKJ C;  4LD9 B;  3LEL C;  4QLC B;  3MGP C;  4G92 B;  1T3U A;  3AN2 A;  3LZ0 B;  4YS3 A;  2JCH A;  1P3F B;  2FJ7 A;  3WA9 A;  3WAA D;  2CV5 B;  1F1E A;  4WU9 D;  3REJ A;  3WTP E;  3MNN B;  1P3M A;  1ID3 B;  3H0M C;  1P3I B;  2HIO A;  3X1S A;  1M18 D;  2ZY5 A;  1TAF B;  4YM6 C;  3W99 A;  5GT3 A;  3C1C B;  3X1T C;  4J8X A;  5BO0 B;  3WKJ D;  1WWI A;  3LEL D;  5AV5 B;  1HQ3 B;  3MGP D;  3LZ1 C;  3MGQ C;  5DNM A;  5B1L C;  5AV6 B;  1P3B B;  2HUE C;  3W98 A;  3AYW C;  2Y2O A;  1P3K B;  4YM6 D;  3LJA A;  3X1T D;  5B32 C;  5B31 C;  5GXQ A;  5BNV A;  1PZR A;  2Y2G A;  3LZ1 D;  3MGQ D;  3UT9 C;  4M6B A;  5B1L D;  2NQB C;  3B6G C;  4KUD B;  3AYW D;  1KX5 C;  1P3G A;  3AZG D;  5B40 C;  5B24 B;  4J8W C;  5CP6 A;  1WWS A;  3REK B;  3O62 A;  3REH C;  5B31 D;  3X1V A;  4G91 B;  3UT9 D;  1P34 D;  2ZY2 A;  3B0D B;  1AOI B;  4CAY B;  2YFW A;  2NQB D;  2F8N A;  3TU4 C;  3B6G D;  5AV8 B;  1KU5 A;  3REL C;  1KX5 D;  1P3O A;  5E5A C;  2Y2M A;  3REI B;  4J8W D;  5C3I B;  5GSU B;  3REH D;  3AZI A;  4YS3 C;  3AN2 C;  2FJ7 C;  3WA9 C;  1H3O B;  1BH8 A;  5CPK A;  4CSR B;  3REJ C;  3AZH D;  4H9P A;  3TU4 D;  3AZJ A;  1P3M C;  3AV1 B;  3AZN D;  1F66 A;  1P3L A;  4KGC C;  2HIO C;  3X1S C;  3REL D;  3W99 C;  5E5A D;  5GT3 C;  4H9R B;  1P3A B;  3AZK A;  3WTP B;  1M19 A;  4YS3 D;  4XZQ A;  3AN2 D;  1U35 D;  3NQU B;  1M1A A;  2FJ7 D;  3WA9 D;  5JRG B;  5GT0 A;  5DNM C;  3WKJ A;  2BYK B;  5G49 A;  1P3M D;  5B2J A;  3W98 C;  4KGC D;  2HIO D;  3MGS B;  5CHL B;  2Y2H A;  3W99 D;  3MGQ B;  3H0L C;  3LJA C;  4WU8 B;  3KXB B;  4WNN B;  3AZM B;  1KX4 A;  5GXQ C;  2ARO A;  2HUE B;  5B0Z B;  5DNM D;  2XD5 A;  5AY8 B;  4H9Q B;  4E45 A;  1BH9 A;  5B32 B;  3W98 D;  1P3G C;  3KWQ A;  4EO5 C;  3VH6 W;  3LJA D;  1P3P A;  3X1U B;  5CP6 C;  4JJN B;  2NQB B;  4KHA A;  3O62 C;  3AZG A;  5GXQ D;  3R45 A;  3MVD A;  5B40 B;  5B31 A;  3AFA D;  2Y2I A;  1P34 A;  1P3G D;  1P3O C;  3AV2 A;  5BNX A;  3MGR D;  3O62 D;  2L5A A;  3AZI C;  5B33 B;  3UTB B;  4J8V B;  3REL B;  4H9S A;  5AV9 D;  5CPK C;  3EPL A;  1TZY D;  2F8N D;  3AZJ C;  3B6F A;  4H9N A;  1F66 C;  1P3L C;  3NQJ A;  2CWE A;  4Z5T B;  1ZLA B;  1P3O D;  3AZH A;  2FJ7 B;  3AZN A;  5B31 G;  3REJ B;  3AZK C;  2YFV A;  4NE3 A;  1M19 C;  3AZI D;  2HIO B;  4XZQ C;  2RIQ A;  3X1S B;  3AZL C;  1M1A C;  2PYO B;  2BYM B;  5GT0 C;  5CPK D;  4WJ3 C;  5GT3 B;  4J8X B;  3AZJ D;  1U35 A;  1F66 D;  5B2J C;  1P3L D;  3UTA A;  1EQZ A;  4XUJ A;  3AZE A;  4KGC A;  3KUY A;  3AZK D;  1KX4 C;  2ARO C;  3VH6 A;  5B2I A;  4ZUX A;  1M19 D;  4XZQ D;  3AZL D;  1M1A D;  5GT0 D;  5JA4 A;  5AVC B;  5B1M A;  2BG1 A;  5B2J D;  3KWQ C;  5DNN A;  3W96 A;  1P3P C;  4R8P D;  3AZG C;  1KX4 D;  2ARO D;  3W97 B;  4E44 A;  3MVD C;  1KX3 B;  2Y2P A;  4Z66 A;  5F99 B;  5CP6 B;  5CPJ D;  1P34 C;  4LD9 A;  3KWQ D;  4QLC A;  1Z2C B;  3AV2 C;  3X1V B;  4HGA B;  3AFA A;  1P3P D;  2CV5 A;  1S32 B;  5CPI B;  2Y2N A;  1ID3 A;  4H9S C;  3MGR A;  1P3I A;  3MVD D;  3A6N B;  5KDM B;  3B6F C;  2UWX A;  3VH5 T;  5AV9 A;  1TZY A;  3AZH C;  5AV5 A;  1HQ3 A;  3AV2 D;  1BH8 B;  3AZN C;  4X23 C;  5CPK B;  4H9P B;  3WAA B;  5AVB D;  1P3B A;  4WU9 B;  1P3K A;  3V9R A;  3B6F D;  1U35 C;  1M18 B;  2F8N H;  3UTA C;  4UUZ B;  4H9O A;  5B0Y D;  1EQZ C;  4XUJ C;  4AWL C;  3AZE C;  4X23 D;  3WKJ B;  3LEL B;  4NE5 A;  3MGP B;  3KUY C;  4ZUX C;  2NZD D;  5B2I C;  3EG5 B;  4KUD A;  3C1B C;  2F8N G;  4J8U D;  2Y2Q A;  1BFM A;  5B1M C;  5B24 A;  1B67 A;  3AZL A;  3UTA D;  4YM6 B;  3REK A;  1EQZ D;  5DNN C;  4XUJ D;  3W96 C;  3X1T B;  3AZE D;  3KUY D;  1AOI A;  4ZUX D;  3LZ1 B;  5B2I D;  5AV8 A;  5B1L B;  3C1B D;  4R8P A;  4Z66 C;  2JE5 A;  3AYW B;  5B1M D;  4KHA B;  3AZG B;  5GSU A;  4LD9 C;  4QLC C;  4G92 C;  5DNN D;  3W96 D;  1JFI A;  5CPJ A;  4WV4 B;  3AFA C;  4CSR A;  5B31 B;  2CV5 C;  1R4V A;  3IP4 C;  2G5H C;  3UT9 B;  3AV1 A;  1P34 B;  1ID3 C;  3MGR C;  1P3I C;  2XD1 A;  3B6G B; 
#chains in the Genus database with same CATH homology
 4Z66 D;  1KX5 B;  5AV9 C;  2G5I C;  4H9R A;  1P3A A;  1TZY C;  4LD9 D;  4QLC D;  1HQ3 C;  5AV5 C;  5FUG B;  3WTP A;  3LZ0 D;  4J8W B;  1P3F D;  3NQU A;  5JRG A;  3REH B;  2CV5 D;  2BYK A;  3MNN D;  5AV6 C;  1P3B C;  3AZF A;  2VQR A;  1ID3 D;  1P3I D;  3MGS A;  3AZH B;  1P3K C;  3TU4 B;  2IO5 C;  5AVB A;  3AZN B;  2YFV B;  4WU8 A;  3KXB A;  4WNN A;  3AZM A;  1N1J B;  5E5A B;  1HQ3 D;  3B0B A;  5AV5 D;  5B0Z A;  5AY8 A;  4H9Q A;  5B0Y A;  3AN2 B;  4YS3 B;  1U35 B;  3WA9 B;  5AV6 D;  1P3B D;  3KFU G;  4X23 A;  4KUD C;  3P5J B;  4ZBJ C;  1P3K D;  1P3M B;  4AWL B;  2RVQ C;  2NZD A;  4KGC B;  3AL0 C;  5B24 C;  3X1U A;  4JJN A;  4J8U A;  3REK C;  3W99 B;  5JA4 B;  4G91 C;  1AOI C;  5AV8 C;  5DNM B;  4KUD D;  5DNN B;  4R8P C;  4NFT A;  2RVQ D;  3W98 B;  1ULY A;  5B24 D;  3C1B A;  3EPK A;  5C3I C;  5GSU C;  3REK D;  3LJA B;  5B33 A;  3UTB A;  4J8V A;  5CPJ C;  5GXQ B;  5BNV B;  1AOI D;  2Y2L A;  5AV8 D;  3AV1 C;  1B6W A;  5BT1 C;  4Z5T A;  1ZLA A;  2ZY3 A;  3AFA B;  3REI D;  1P3G B;  1P3A C;  4EO5 B;  5GSU D;  3WTP C;  3MGR B;  2PYO A;  1W2E A;  4NE6 A;  5JRG C;  2BYM A;  3O62 B;  5AV9 B;  3LZ0 A;  3FDD A;  3AZF C;  3AV1 D;  1TZY B;  5BT1 D;  3MGS C;  1P3F A;  3EPH A;  2JSS A;  2YFW B;  2F8N B;  5AVB C;  3MNN A;  2ZM5 A;  4WU8 C;  1P3O B;  1P3A D;  3KXB C;  3AZM C;  1TAF A;  3WTP D;  3C1C A;  3EPJ A;  2IO5 B;  3A1I A;  5BO0 A;  5JRG D;  3V9R B;  5B0Z C;  3AZI B;  5AY8 C;  5B0Y C;  5AVC A;  3AZF D;  4H9O B;  3MGS D;  3AZJ B;  2NZD C;  1F66 B;  2J8P A;  1P3L B;  5AV6 A;  2F8N K;  4WU8 D;  3X1U C;  4JJN C;  4J8U C;  3KXB D;  2Y2J A;  3AZM D;  3W97 A;  3VH5 W;  4ZBJ B;  3AZK B;  5B0Z D;  1KX3 A;  1M19 B;  5AY8 D;  4XZQ B;  5F99 A;  3AZL B;  1M1A B;  5GT0 B;  5B32 D;  4UPK A;  5G49 B;  5B2J B;  2W8S A;  3A1K A;  3X1U D;  4JJN D;  1S32 A;  5CPI A;  5B33 C;  3UTB C;  4J8V C;  5BS7 A;  4R8P B;  3A6N A;  1KX4 B;  2ARO B;  3F6T A;  3KSY A;  5KDM A;  5B40 D;  4Z5T C;  1ZLA C;  1BH9 B;  4CAY A;  4DQY B;  5CPJ B;  1JFI B;  3KWQ B;  2DF4 C;  3WAA A;  3B0C T;  4Z2M H;  5B33 D;  3UTB D;  4J8V D;  1P3P B;  4WZS B;  3REI A;  2PYO C;  4WU9 A;  2Y2K A;  4J8X C;  3R45 B;  3LZ0 C;  3MVD B;  1P3F C;  1M18 A;  1H3O A;  4UUZ A;  4Z5T D;  1ZLA D;  2FFF B;  3MNN C;  4Z2M G;  3LEL A;  3MGP A;  3REJ D;  3AV2 B;  3B0C W;  3AZF B;  5BNX B;  3X1S D;  3C1C C;  2PYO D;  5AVB B;  2LY8 A;  5GT3 D;  3VH6 T;  3VH5 A;  4J8X D;  5AVC C;  4YM6 A;  3B6F B;  4H9N B;  3X1T A;  3NQJ B;  5B0Y B;  1HTA A;  4X23 B;  3LZ1 A;  3MGQ A;  3C1C D;  3W97 C;  5B1L A;  1KX3 C;  2NZD B;  5F99 C;  4DRA A;  2F2A C;  3AYW A;  5AVC D;  4J8U B;  3X1V C;  2DQN C;  4HGA C;  3UTA B;  5B32 A;  1EQZ B;  4XUJ B;  1S32 C;  5CPI C;  2ZY4 A;  3AZE B;  3UT9 A;  3KUY B;  3W97 D;  5BS7 C;  3A6N C;  2NQB A;  1KX3 D;  4ZUX B;  3B6G A;  5B2I B;  1Q9C A;  5F99 D;  3C1B B;  4DRB A;  5CP6 D;  1KX5 A;  3H0R C;  3B0D C;  5B40 A;  3X1V D;  5FUG A;  5B1M B;  4J8W A;  3REH A;  1A7W A;  3W96 B;  3WAA C;  1S32 D;  5CPI D;  3REI C;  4WU9 C;  3A6N D;  3TU4 A;  5B32 G;  1M18 C;  3REL A;  4Z66 B;  1N1J A;  5E5A A;  3WKJ C;  4LD9 B;  3LEL C;  4QLC B;  3MGP C;  4G92 B;  1T3U A;  3AN2 A;  3LZ0 B;  4YS3 A;  2JCH A;  1P3F B;  2FJ7 A;  3WA9 A;  3WAA D;  2CV5 B;  1F1E A;  4WU9 D;  3REJ A;  3WTP E;  3MNN B;  1P3M A;  1ID3 B;  3H0M C;  1P3I B;  2HIO A;  3X1S A;  1M18 D;  2ZY5 A;  1TAF B;  4YM6 C;  3W99 A;  5GT3 A;  3C1C B;  3X1T C;  4J8X A;  5BO0 B;  3WKJ D;  1WWI A;  3LEL D;  5AV5 B;  1HQ3 B;  3MGP D;  3LZ1 C;  3MGQ C;  5DNM A;  5B1L C;  5AV6 B;  1P3B B;  2HUE C;  3W98 A;  3AYW C;  2Y2O A;  1P3K B;  4YM6 D;  3LJA A;  3X1T D;  5B32 C;  5B31 C;  5GXQ A;  5BNV A;  1PZR A;  2Y2G A;  3LZ1 D;  3MGQ D;  3UT9 C;  4M6B A;  5B1L D;  2NQB C;  3B6G C;  4KUD B;  3AYW D;  1KX5 C;  1P3G A;  3AZG D;  5B40 C;  5B24 B;  4J8W C;  5CP6 A;  1WWS A;  3REK B;  3O62 A;  3REH C;  5B31 D;  3X1V A;  4G91 B;  3UT9 D;  1P34 D;  2ZY2 A;  3B0D B;  1AOI B;  4CAY B;  2YFW A;  2NQB D;  2F8N A;  3TU4 C;  3B6G D;  5AV8 B;  1KU5 A;  3REL C;  1KX5 D;  1P3O A;  5E5A C;  2Y2M A;  3REI B;  4J8W D;  5C3I B;  5GSU B;  3REH D;  3AZI A;  4YS3 C;  3AN2 C;  2FJ7 C;  3WA9 C;  1H3O B;  1BH8 A;  5CPK A;  4CSR B;  3REJ C;  3AZH D;  4H9P A;  3TU4 D;  3AZJ A;  1P3M C;  3AV1 B;  3AZN D;  1F66 A;  1P3L A;  4KGC C;  2HIO C;  3X1S C;  3REL D;  3W99 C;  5E5A D;  5GT3 C;  4H9R B;  1P3A B;  3AZK A;  3WTP B;  1M19 A;  4YS3 D;  4XZQ A;  3AN2 D;  1U35 D;  3NQU B;  1M1A A;  2FJ7 D;  3WA9 D;  5JRG B;  5GT0 A;  5DNM C;  3WKJ A;  2BYK B;  5G49 A;  1P3M D;  5B2J A;  3W98 C;  4KGC D;  2HIO D;  3MGS B;  5CHL B;  2Y2H A;  3W99 D;  3MGQ B;  3H0L C;  3LJA C;  4WU8 B;  3KXB B;  4WNN B;  3AZM B;  1KX4 A;  5GXQ C;  2ARO A;  2HUE B;  5B0Z B;  5DNM D;  2XD5 A;  5AY8 B;  4H9Q B;  4E45 A;  1BH9 A;  5B32 B;  3W98 D;  1P3G C;  3KWQ A;  4EO5 C;  3VH6 W;  3LJA D;  1P3P A;  3X1U B;  5CP6 C;  4JJN B;  2NQB B;  4KHA A;  3O62 C;  3AZG A;  5GXQ D;  3R45 A;  3MVD A;  5B40 B;  5B31 A;  3AFA D;  2Y2I A;  1P34 A;  1P3G D;  1P3O C;  3AV2 A;  5BNX A;  3MGR D;  3O62 D;  2L5A A;  3AZI C;  5B33 B;  3UTB B;  4J8V B;  3REL B;  4H9S A;  5AV9 D;  5CPK C;  3EPL A;  1TZY D;  2F8N D;  3AZJ C;  3B6F A;  4H9N A;  1F66 C;  1P3L C;  3NQJ A;  2CWE A;  4Z5T B;  1ZLA B;  1P3O D;  3AZH A;  2FJ7 B;  3AZN A;  5B31 G;  3REJ B;  3AZK C;  2YFV A;  4NE3 A;  1M19 C;  3AZI D;  2HIO B;  4XZQ C;  2RIQ A;  3X1S B;  3AZL C;  1M1A C;  2PYO B;  2BYM B;  5GT0 C;  5CPK D;  4WJ3 C;  5GT3 B;  4J8X B;  3AZJ D;  1U35 A;  1F66 D;  5B2J C;  1P3L D;  3UTA A;  1EQZ A;  4XUJ A;  3AZE A;  4KGC A;  3KUY A;  3AZK D;  1KX4 C;  2ARO C;  3VH6 A;  5B2I A;  4ZUX A;  1M19 D;  4XZQ D;  3AZL D;  1M1A D;  5GT0 D;  5JA4 A;  5AVC B;  5B1M A;  2BG1 A;  5B2J D;  3KWQ C;  5DNN A;  3W96 A;  1P3P C;  4R8P D;  3AZG C;  1KX4 D;  2ARO D;  3W97 B;  4E44 A;  3MVD C;  1KX3 B;  2Y2P A;  4Z66 A;  5F99 B;  5CP6 B;  5CPJ D;  1P34 C;  4LD9 A;  3KWQ D;  4QLC A;  1Z2C B;  3AV2 C;  3X1V B;  4HGA B;  3AFA A;  1P3P D;  2CV5 A;  1S32 B;  5CPI B;  2Y2N A;  1ID3 A;  4H9S C;  3MGR A;  1P3I A;  3MVD D;  3A6N B;  5KDM B;  3B6F C;  2UWX A;  3VH5 T;  5AV9 A;  1TZY A;  3AZH C;  5AV5 A;  1HQ3 A;  3AV2 D;  1BH8 B;  3AZN C;  4X23 C;  5CPK B;  4H9P B;  3WAA B;  5AVB D;  1P3B A;  4WU9 B;  1P3K A;  3V9R A;  3B6F D;  1U35 C;  1M18 B;  2F8N H;  3UTA C;  4UUZ B;  4H9O A;  5B0Y D;  1EQZ C;  4XUJ C;  4AWL C;  3AZE C;  4X23 D;  3WKJ B;  3LEL B;  4NE5 A;  3MGP B;  3KUY C;  4ZUX C;  2NZD D;  5B2I C;  3EG5 B;  4KUD A;  3C1B C;  2F8N G;  4J8U D;  2Y2Q A;  1BFM A;  5B1M C;  5B24 A;  1B67 A;  3AZL A;  3UTA D;  4YM6 B;  3REK A;  1EQZ D;  5DNN C;  4XUJ D;  3W96 C;  3X1T B;  3AZE D;  3KUY D;  1AOI A;  4ZUX D;  3LZ1 B;  5B2I D;  5AV8 A;  5B1L B;  3C1B D;  4R8P A;  4Z66 C;  2JE5 A;  3AYW B;  5B1M D;  4KHA B;  3AZG B;  5GSU A;  4LD9 C;  4QLC C;  4G92 C;  5DNN D;  3W96 D;  1JFI A;  5CPJ A;  4WV4 B;  3AFA C;  4CSR A;  5B31 B;  2CV5 C;  1R4V A;  3IP4 C;  2G5H C;  3UT9 B;  3AV1 A;  1P34 B;  1ID3 C;  3MGR C;  1P3I C;  2XD1 A;  3B6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...