1KX3D

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3D00
5GXQA 2YFWB 3WKJC 2HIOB 1KX4A 4Z2MH 4WU8B 3RELD 5GXQB 3MGPC 3AZID 3AZKD 5AV5C 4E44A 5B31C 1M19A 3AZMC 3X1VD 5B40D 3WAAC 1P3GD 4LD9A 3AZJC 5GT3A 2FJ7D 5FUGA 5BT1D 3AZGD 1KX3A 5AV8A 4G92B 1M19B 5CP6A 5JRGA 1M18C 3X1VC 3C1BA 4J8VA 4LD9B 3VH5T 4YS3A 1KX5D 5AV8C 5GT3B 5JRGC 5FUGB 4EO5C 1KX3B 5AV8B 5DNMD 5JRGB 5CP6B 3C1CA 4KGCD 5AV6D 3AFAD 3UTAC 5C3IC 1JFIA 3W96A 3C1BB 4J8VB 3AN2A 5C3IB 5B0ZC 4YS3B 4Z66C 4NE6A 3C1CC 1HQ3C 4NE3A 3B6FC 2F8NH 3AYWA 4WNNA 3W96C 3C1CB 1P34A 3AFAC 3MGQA 3UT9A 1JFIB 3W96B 3B6GA 3AN2B 4JJNA 3REJD 3AZLD 3W99D 5BS7C 4G91C 3REIA 5F99A 4J8UC 3WA9D 3AYWB 4WNNB 3NQJA 1EQZA 3B0DB 1P34B 3MGQB 4JJNC 5GSUA 3UT9B 3B6GB 5B33D 4JJNB 5CPKA 1P3KC 1P3BD 5AVBA 2HUEB 3AV1C 4KUDD 3REIB 4WV4B 5F99B 3WTPE 3NQJB 5GSUC 1EQZB 5CPID 1ULYA 5GT0A 5GSUB 5CPKC 5AVBC 5CPKB 4H9QA 2AROD 5AVBB 3X1SD 2NQBA 1F1EA 3REHA 3KWQA 3MGRC 3A6NC 5GT0B 2IO5C 1H3OA 3W97D 2IO5B 5E5AA 4H9QB 1P3ID 1ZLAA 2NQBB 4H9RA 4WZSB 4J8XA 5B0YA 3REHB 3KWQB 1S32D 5CPJA 1H3OB 5E5AB 2CV5D 3REKD 1ZLAB 1P3IC 4H9RB 1P3LD 1F66A 4J8XB 5B0YB 3O62C 3VH6A 5DNNA 1N1JA 5B24A 1TAFA 4X23D 1ID3A 5B32D 3LJAC 3MNNC 2NZDD 3MVDA 1P3FA 3TU4A 3KUYA 1U35A 5DNNB 1P3MC 1N1JB 5B24B 1TAFB 4XUJD 1ID3B 4Z2MG 5B32C 1P3AD 3X1UD 5B2IA 1BH8A 3MVDB 1P3FB 3TU4B 3LZ1D 5AY8C 4H9SC 4H9PA 4CSRA 3KUYB 1U35B 4Z5TA 5JA4A 2BYKA 5AV9A 4YM6C 5B2IB 1BH8B 4H9PB 4CSRB 2HIOC 3MGPD 4Z5TB 5AV5D 5JA4B 2BYKB 5B31D 5AV9B 1BFMA 5B1MA 4WU8C 3AZMD 5GXQC 3WAAD 4J8WA 3AZNA 3AV2A 4NE5A 3AZJD 3AZEA 1KX4C 4WU9A 5B1MB 1P3PA 1M18D 1KX4B 5AVCA 4J8WB 3AZNB 3AV2B 3MGSA 3AZEB 1M1AA 5AV8D 4G92C 1M19C 5JRGD 1P3OA 4WU9B 4ZBJB 1P3PB 3AZFA 4ZUXA 3MGSC 2RVQC 2F8ND 3UTAD 2PYOA 5AVCB 4LD9C 3MGSB 5GT3C 2F8NK 1M1AB 5B0ZD 4Z66D 1KX3C 5CP6C 3C1CD 3AZFC 1P3OB 1HQ3D 3B6FD 5G49A 2PYOC 3LZ0A 3W96D 3AZFB 4ZUXB 3AZIA 3AZKA 2PYOB 3C1BC 4J8VC 4YS3C 3LZ0C 2BYMA 5G49B 4J8UD 4DRBA 3LZ0B 1AOIA 3B6GD 3AZIB 3AZKB 2FJ7A 4JJND 3AN2C 1WWIA 1P3KD 3AV1D 3AYWC 1AOIC 3B0DC 2BYMB 1P34C 5GSUD 3MGQC 3UT9C 1AOIB 1KX5A 3B6GC 2FJ7B 1TZYA 5CPKD 3VH6W 5AVBD 2HUEC 5DNMA 2JSSA 4KGCA 3REIC 5F99C 3AZHA 1EQZC 1TZYC 5B2JA 1KX5B 3MGRD 3A6ND 1TZYB 1B67A 3KXBA 5DNMB 4KGCB 5B2JC 3AZHB 4CAYA 5B2JB 5GT0C 3AZLA 3KXBC 3W99A 5B1LA 3KXBB 3WA9A 2NQBC 2L5AA 4QLCA 3REHC 3KWQC 4CAYB 5B33A 3AZLB 5B1LC 3W99B 3O62D 5B1LB 5E5AC 1ZLAC 4QLCC 3WA9B 4R8PA 3LJAD 4QLCB 4J8XC 5B0YC 3LZ1C 3MNND 5CPJC 5B33B 5CPJB 5BNXA 1P3MD 1B6WA 4DRAA 4R8PB 1F66C 1F66B 5AY8D 5DNNC 4M6BA 4UUZA 3X1TA 5B24C 5BNXB 4AWLB 1ID3C 3UTBA 4H9NA 1S32A 4YM6D 3MVDC 1P3FC 3TU4C 3NQUA 3X1TC 3KUYC 1U35C 3UTBC 2CV5A 4UUZB 3REKA 5BO0A 3X1TB 4Z5TD 1P3LA 3UTBB 2HIOD 4H9NB 2LY8A 1S32B 5B2IC 4WU8D 3NQUB 3B0BA 4XZQA 5B31G 5GXQD 2CV5B 3REKB 5BO0B 1P3LB 4Z5TC 1R4VA 3W98A 3V9RA 5AV9C 4HGAB 1KX4D 3VH5A 3WTPA 4J8WD 4XUJA 4XZQB 3W98C 1P3AA 3B0CW 3LELA 3W98B 3V9RB 1M19D 3LZ1A 1P3PD 5B1MC 3WTPB 3WKJA 4XUJB 4J8WC 3AZNC 3LELC 3MGSD 2RVQD 3AV2C 4LD9D 3VH6T 3AZEC 1P3AB 3LELB 5GT3D 2F8NG 1KX3D 4WU9C 4ZBJC 3LZ1B 5BNVA 5CP6D 1P3PC 3AZFD 4ZUXD 2PYOD 5AVCC 3MGPA 3WKJB 5AV5A 3C1BD 4J8VD 1M1AC 4YS3D 5B31A 3KSYA 3AZMA 1P3OC 5BNVB 3LZ0D 3WAAA 3RELA 4ZUXC 1WWSA 3AZJA 3MGPB 5AV5B 3AN2D 5B31B 3AZMB 1M18A 3RELC 2YFVA 3X1VA 5B40A 3AYWD 1AOID 3WAAB 3RELB 3AZIC 3AZKC 1P34D 3AZJB 1P3GA 3MGQD 3UT9D 1BH9A 3AZGA 5B40C 1M18B 3REID 2YFVB 5F99D 3X1VB 5B40B 3UTAA 1P3GC 2F8NA 1EQZD 1KU5A 1TZYD 1P3GB 2FJ7C 5B0ZA 4Z66A 5BT1C 3AZGC 1BH9B 4EO5B 1HQ3A 3AZGB 3B6FA 3AZHD 5B2JD 5AV6A 3AFAA 1HTAA 3UTAB 2F8NB 1KX5C 5GT0D 5B0ZB 4Z66B 3KXBD 4KHAA 5BS7A 5DNMC 1HQ3B 3B6FB 4KGCC 5AV6C 4J8UA 2NQBD 4NFTA 3AZHC 5AV6B 3AFAB 5KDMA 3REHD 1Q9CA 3KWQD 1P3KA 3REJA 5B1LD 2CWEA 4KHAB 3AV1A 4G91B 5E5AD 4J8UB 4QLCD 1ZLAD 4J8XD 5B0YD 5KDMB 3REJC 3AZLC 5CPJD 3W99C 1P3KB 3REJB 1P3BA 3AV1B 3WA9C 4R8PD 4KUDA 4H9OA 3MGRA 3A6NA 1F66D 5CPIA 5B33C 3VH5W 1P3BC 5B32G 4KUDC 5DNND 5B24D 1A7WA 2AROA 3B0CT 3X1SA 1P3BB 1ID3D 4KUDB 4R8PC 5CPIC 3R45A 4H9OB 3MGRB 3A6NB 3MVDD 5CPIB 1P3FD 3TU4D 3X1TD 3W97A 2AROC 3X1SC 3KUYD 1U35D 3UTBD 4AWLC 1P3IA 2AROB 3X1SB 3R45B 5B2ID 3W97C 3O62A 3W97B 4E45A 3LJAA 1P3IB 3MNNA 1S32C 5AV9D 4XZQD 3O62B 1P3MA 2CV5C 3REKC 1P3LC 4X23A 3LJAB 3W98D 5B32A 3MNNB 4HGAC 2NZDA 5AY8A 4H9SA 5B1MD 3WTPD 4XZQC 4X23C 1P3MB 3AZND 3AV2D 3LELD 4X23B 5B32B 3AZED 2NZDC 4YM6A 3X1UA 2NZDB 4WU9D 5AY8B 2YFWA 3WKJD 3WTPC 4XUJC 5CHLB 2HIOA 5AVCD 1P3AC 3X1UC 1M1AD 4YM6B 4WU8A 3X1UB 1P3OD
chains in the Genus database with same CATH superfamily
5GXQA 2YFWB 3WKJC 2HIOB 1KX4A 4Z2MH 4WU8B 3KFUG 3RELD 5GXQB 3MGPC 3AZID 3AZKD 5AV5C 4E44A 5B31C 1M19A 3AZMC 3X1VD 5B40D 3WAAC 1P3GD 4LD9A 3AZJC 5GT3A 2FJ7D 5FUGA 5BT1D 3AZGD 1KX3A 5AV8A 4G92B 1M19B 4UPKA 5CP6A 5JRGA 1M18C 3X1VC 3C1BA 4J8VA 4LD9B 3VH5T 4YS3A 1KX5D 5AV8C 5GT3B 5JRGC 5FUGB 4EO5C 1KX3B 5AV8B 3H0MC 5DNMD 5JRGB 2F2AC 5CP6B 3C1CA 4KGCD 5AV6D 3AFAD 3UTAC 5C3IC 1JFIA 3W96A 3C1BB 4J8VB 3AN2A 5C3IB 5B0ZC 4YS3B 4Z66C 2G5IC 4NE6A 3C1CC 1HQ3C 4NE3A 2ZM5A 3B6FC 2F8NH 3AYWA 4WNNA 3W96C 3C1CB 1P34A 2DF4C 3AFAC 3MGQA 3UT9A 1JFIB 3W96B 3B6GA 3AN2B 4JJNA 3REJD 3H0RC 3AZLD 3W99D 5BS7C 4G91C 3REIA 5F99A 4J8UC 3WA9D 3AYWB 4WNNB 3NQJA 1EQZA 3B0DB 1P34B 3MGQB 4JJNC 5GSUA 3UT9B 3B6GB 5B33D 4JJNB 5CPKA 1P3KC 1P3BD 5AVBA 2HUEB 3AV1C 4KUDD 3REIB 4WV4B 5F99B 3WTPE 3NQJB 5GSUC 1EQZB 5CPID 1ULYA 5GT0A 5GSUB 5CPKC 5AVBC 5CPKB 4H9QA 2AROD 5AVBB 3X1SD 2NQBA 2ZY2A 1F1EA 2VQRA 3REHA 3KWQA 3MGRC 3A6NC 2DQNC 5GT0B 2IO5C 1H3OA 3W97D 1W2EA 2IO5B 5E5AA 4H9QB 1P3ID 1ZLAA 2NQBB 4H9RA 4WZSB 4J8XA 5B0YA 3REHB 3KWQB 1S32D 5CPJA 1H3OB 5E5AB 2CV5D 3REKD 1ZLAB 2XD5A 4H9RB 1P3IC 2Y2LA 1P3LD 1F66A 4J8XB 5B0YB 3O62C 3VH6A 5DNNA 1N1JA 5B24A 1TAFA 4X23D 1ID3A 5B32D 3LJAC 2Y2OA 3MNNC 2NZDD 3MVDA 1P3FA 3TU4A 3KUYA 1U35A 5DNNB 1P3MC 1N1JB 5B24B 1TAFB 4XUJD 1ID3B 4Z2MG 2ZY5A 5B32C 1P3AD 3X1UD 5B2IA 1BH8A 3MVDB 2Y2IA 1P3FB 3TU4B 3LZ1D 5AY8C 4H9SC 4H9PA 4CSRA 3KUYB 1U35B 4Z5TA 5JA4A 2BYKA 5AV9A 4YM6C 5B2IB 3EPLA 1BH8B 4H9PB 4CSRB 2HIOC 3MGPD 4Z5TB 5AV5D 5JA4B 2BYKB 5B31D 5AV9B 1BFMA 5B1MA 4WU8C 3AZMD 5GXQC 3WAAD 4J8WA 3AZNA 3AV2A 4NE5A 3AZJD 3AZEA 1KX4C 4WU9A 5B1MB 1P3PA 1M18D 1KX4B 5AVCA 4J8WB 3AZNB 3AV2B 3MGSA 3AZEB 1M1AA 5AV8D 2ZY3A 4G92C 1M19C 5JRGD 1P3OA 4WU9B 4ZBJB 1P3PB 3AZFA 4ZUXA 3MGSC 2RVQC 2F8ND 3UTAD 2PYOA 5AVCB 4LD9C 2W8SA 5GT3C 3MGSB 2F8NK 1M1AB 5B0ZD 4Z66D 1KX3C 5CP6C 3C1CD 3AZFC 1P3OB 1HQ3D 3B6FD 1T3UA 5G49A 2PYOC 3LZ0A 3W96D 3AZFB 4ZUXB 3AZIA 3AZKA 2PYOB 3C1BC 4J8VC 4YS3C 3LZ0C 2BYMA 5G49B 4J8UD 4DRBA 3LZ0B 1AOIA 3B6GD 3AZIB 3AZKB 2FJ7A 2Y2MA 4JJND 3AN2C 1WWIA 1P3KD 3AV1D 3AYWC 1AOIC 3B0DC 2BYMB 1P34C 5GSUD 3MGQC 3UT9C 1AOIB 1KX5A 3B6GC 2FJ7B 1TZYA 4WJ3C 5CPKD 3VH6W 5AVBD 2HUEC 5DNMA 2JSSA 4KGCA 3REIC 5F99C 3AZHA 1EQZC 1TZYC 5B2JA 1KX5B 3MGRD 3A6ND 2JCHA 1TZYB 1B67A 2G5HC 3KXBA 5DNMB 4KGCB 5B2JC 3AZHB 3EPHA 4CAYA 5B2JB 5GT0C 3AZLA 3KXBC 3W99A 3IP4C 5B1LA 3KXBB 3WA9A 2NQBC 3A1KA 3FDDA 2L5AA 4QLCA 3REHC 3KWQC 4CAYB 5B33A 2JE5A 5B1LC 3AZLB 3W99B 3O62D 5B1LB 5E5AC 1ZLAC 4QLCC 3WA9B 4R8PA 3LJAD 4QLCB 4J8XC 5B0YC 3LZ1C 3MNND 3EG5B 5CPJC 5B33B 5CPJB 5BNXA 1P3MD 1B6WA 4DRAA 4R8PB 1F66C 1F66B 5AY8D 5DNNC 4M6BA 4UUZA 3X1TA 5B24C 5BNXB 4AWLB 1ID3C 3UTBA 4H9NA 1S32A 4YM6D 3MVDC 1P3FC 3TU4C 3NQUA 3X1TC 3KUYC 1U35C 3UTBC 2CV5A 4UUZB 3REKA 5BO0A 3X1TB 4Z5TD 1P3LA 3UTBB 2Y2HA 2HIOD 4H9NB 2Y2GA 2LY8A 1S32B 5B2IC 2Y2QA 4WU8D 3NQUB 3B0BA 4XZQA 5B31G 5GXQD 2CV5B 3REKB 5BO0B 1P3LB 4Z5TC 1R4VA 3W98A 3V9RA 5AV9C 4HGAB 1KX4D 2Y2JA 3VH5A 3WTPA 4J8WD 4XUJA 4XZQB 3W98C 1P3AA 3B0CW 3LELA 3W98B 3V9RB 1M19D 3LZ1A 1P3PD 5B1MC 3WTPB 3WKJA 4XUJB 4J8WC 3AZNC 3LELC 3MGSD 2RVQD 3AV2C 2BG1A 4LD9D 3VH6T 3AZEC 1P3AB 3LELB 5GT3D 2F8NG 1KX3D 4WU9C 4ZBJC 3LZ1B 5BNVA 5CP6D 1P3PC 3AZFD 4ZUXD 2PYOD 5AVCC 3MGPA 3WKJB 5AV5A 3C1BD 4J8VD 1M1AC 4YS3D 5B31A 3KSYA 3AZMA 1P3OC 5BNVB 2J8PA 3LZ0D 3WAAA 3RELA 4ZUXC 1WWSA 2FFFB 3AZJA 3MGPB 5AV5B 3AN2D 5B31B 3AZMB 1M18A 3RELC 2YFVA 3X1VA 5B40A 3AYWD 1AOID 3WAAB 3RELB 3AZIC 3AZKC 1P34D 3AZJB 1P3GA 3MGQD 3UT9D 1BH9A 3AZGA 5B40C 2ZY4A 1M18B 3REID 2YFVB 5F99D 3X1VB 5B40B 3UTAA 1P3GC 2F8NA 1EQZD 1KU5A 1TZYD 1P3GB 2FJ7C 3H0LC 5B0ZA 4Z66A 5BT1C 3AZGC 1BH9B 4EO5B 1HQ3A 3AZGB 3B6FA 3AZHD 5B2JD 5AV6A 3AFAA 1HTAA 3UTAB 2F8NB 1KX5C 3EPJA 5GT0D 5B0ZB 4Z66B 3KXBD 4KHAA 5BS7A 5DNMC 1HQ3B 3B6FB 2XD1A 4KGCC 5AV6C 4J8UA 2NQBD 4NFTA 3AZHC 5AV6B 3AFAB 5KDMA 3REHD 1Q9CA 3KWQD 1P3KA 3REJA 5B1LD 2CWEA 4KHAB 3AV1A 4G91B 5E5AD 4J8UB 4QLCD 1ZLAD 4J8XD 5B0YD 5KDMB 3REJC 3AZLC 5CPJD 3W99C 1P3KB 3REJB 1P3BA 3AV1B 3WA9C 4R8PD 4KUDA 4DQYB 4H9OA 3MGRA 3A6NA 1F66D 5CPIA 5B33C 3VH5W 1P3BC 5B32G 4KUDC 5DNND 2Y2PA 5B24D 1A7WA 2AROA 3B0CT 3X1SA 1P3BB 1ID3D 4KUDB 2Y2NA 4R8PC 5CPIC 3R45A 4H9OB 3MGRB 3A6NB 3MVDD 5CPIB 1P3FD 3TU4D 3X1TD 3W97A 2AROC 3X1SC 3KUYD 3AL0C 1U35D 3UTBD 4AWLC 1P3IA 2AROB 3X1SB 3R45B 3A1IA 5B2ID 3W97C 3P5JB 3O62A 3W97B 4E45A 3LJAA 3EPKA 1P3IB 3MNNA 1S32C 5AV9D 4XZQD 3O62B 1P3MA 2CV5C 3REKC 1P3LC 4X23A 3LJAB 3W98D 1Z2CB 5B32A 3MNNB 4HGAC 2NZDA 5AY8A 4H9SA 5B1MD 3WTPD 4XZQC 4X23C 1P3MB 3AZND 3AV2D 3F6TA 3LELD 4X23B 2UWXA 2Y2KA 5B32B 1PZRA 3AZED 4YM6A 2NZDC 3X1UA 2NZDB 4WU9D 5AY8B 2YFWA 3WKJD 3WTPC 4XUJC 5CHLB 2HIOA 5AVCD 1P3AC 3X1UC 1M1AD 4YM6B 4WU8A 3X1UB 2RIQA 1P3OD
chains in the Genus database with same CATH topology
5GXQA 2YFWB 3WKJC 2HIOB 1KX4A 4Z2MH 4WU8B 3KFUG 3RELD 5GXQB 3MGPC 3AZID 3AZKD 5AV5C 4E44A 5B31C 1M19A 3AZMC 3X1VD 5B40D 3WAAC 1P3GD 4LD9A 3AZJC 5GT3A 2FJ7D 5FUGA 5BT1D 3AZGD 1KX3A 5AV8A 4G92B 1M19B 4UPKA 5CP6A 5JRGA 1M18C 3X1VC 3C1BA 4J8VA 4LD9B 3VH5T 4YS3A 1KX5D 5AV8C 5GT3B 5JRGC 5FUGB 4EO5C 1KX3B 5AV8B 3H0MC 5DNMD 5JRGB 2F2AC 5CP6B 3C1CA 4KGCD 5AV6D 3AFAD 3UTAC 5C3IC 1JFIA 3W96A 3C1BB 4J8VB 3AN2A 5C3IB 5B0ZC 4YS3B 4Z66C 2G5IC 4NE6A 3C1CC 1HQ3C 4NE3A 2ZM5A 3B6FC 2F8NH 3AYWA 4WNNA 3W96C 3C1CB 1P34A 2DF4C 3AFAC 3MGQA 3UT9A 1JFIB 3W96B 3B6GA 3AN2B 4JJNA 3REJD 3H0RC 3AZLD 3W99D 5BS7C 4G91C 3REIA 5F99A 4J8UC 3WA9D 3AYWB 4WNNB 3NQJA 1EQZA 3B0DB 1P34B 3MGQB 4JJNC 5GSUA 3UT9B 3B6GB 5B33D 4JJNB 5CPKA 1P3KC 1P3BD 5AVBA 2HUEB 3AV1C 4KUDD 3REIB 4WV4B 5F99B 3WTPE 3NQJB 5GSUC 1EQZB 5CPID 1ULYA 5GT0A 5GSUB 5CPKC 5AVBC 5CPKB 4H9QA 2AROD 5AVBB 3X1SD 2NQBA 2ZY2A 1F1EA 2VQRA 3REHA 3KWQA 3MGRC 3A6NC 2DQNC 5GT0B 2IO5C 1H3OA 3W97D 1W2EA 2IO5B 5E5AA 4H9QB 1P3ID 1ZLAA 2NQBB 4H9RA 4WZSB 4J8XA 5B0YA 3REHB 3KWQB 1S32D 5CPJA 1H3OB 5E5AB 2CV5D 3REKD 1ZLAB 2XD5A 4H9RB 1P3IC 2Y2LA 1P3LD 1F66A 4J8XB 5B0YB 3O62C 3VH6A 5DNNA 1N1JA 5B24A 1TAFA 4X23D 1ID3A 5B32D 3LJAC 2Y2OA 3MNNC 2NZDD 3MVDA 1P3FA 3TU4A 3KUYA 1U35A 5DNNB 1P3MC 1N1JB 5B24B 1TAFB 4XUJD 1ID3B 4Z2MG 2ZY5A 5B32C 1P3AD 3X1UD 5B2IA 1BH8A 3MVDB 2Y2IA 1P3FB 3TU4B 3LZ1D 5AY8C 4H9SC 4H9PA 4CSRA 3KUYB 1U35B 4Z5TA 5JA4A 2BYKA 5AV9A 4YM6C 5B2IB 3EPLA 1BH8B 4H9PB 4CSRB 2HIOC 3MGPD 4Z5TB 5AV5D 5JA4B 2BYKB 5B31D 5AV9B 1BFMA 5B1MA 4WU8C 3AZMD 5GXQC 3WAAD 4J8WA 3AZNA 3AV2A 4NE5A 3AZJD 3AZEA 1KX4C 4WU9A 5B1MB 1P3PA 1M18D 1KX4B 5AVCA 4J8WB 3AZNB 3AV2B 3MGSA 3AZEB 1M1AA 5AV8D 2ZY3A 4G92C 1M19C 5JRGD 1P3OA 4WU9B 4ZBJB 1P3PB 3AZFA 4ZUXA 3MGSC 2RVQC 2F8ND 3UTAD 2PYOA 5AVCB 4LD9C 2W8SA 5GT3C 3MGSB 2F8NK 1M1AB 5B0ZD 4Z66D 1KX3C 5CP6C 3C1CD 3AZFC 1P3OB 1HQ3D 3B6FD 1T3UA 5G49A 2PYOC 3LZ0A 3W96D 3AZFB 4ZUXB 3AZIA 3AZKA 2PYOB 3C1BC 4J8VC 4YS3C 3LZ0C 2BYMA 5G49B 4J8UD 4DRBA 3LZ0B 1AOIA 3B6GD 3AZIB 3AZKB 2FJ7A 2Y2MA 4JJND 3AN2C 1WWIA 1P3KD 3AV1D 3AYWC 1AOIC 3B0DC 2BYMB 1P34C 5GSUD 3MGQC 3UT9C 1AOIB 1KX5A 3B6GC 2FJ7B 1TZYA 4WJ3C 5CPKD 3VH6W 5AVBD 2HUEC 5DNMA 2JSSA 4KGCA 3REIC 5F99C 3AZHA 1EQZC 1TZYC 5B2JA 1KX5B 3MGRD 3A6ND 2JCHA 1TZYB 1B67A 2G5HC 3KXBA 5DNMB 4KGCB 5B2JC 3AZHB 3EPHA 4CAYA 5B2JB 5GT0C 3AZLA 3KXBC 3W99A 3IP4C 5B1LA 3KXBB 3WA9A 2NQBC 3A1KA 3FDDA 2L5AA 4QLCA 3REHC 3KWQC 4CAYB 5B33A 2JE5A 5B1LC 3AZLB 3W99B 3O62D 5B1LB 5E5AC 1ZLAC 4QLCC 3WA9B 4R8PA 3LJAD 4QLCB 4J8XC 5B0YC 3LZ1C 3MNND 3EG5B 5CPJC 5B33B 5CPJB 5BNXA 1P3MD 1B6WA 4DRAA 4R8PB 1F66C 1F66B 5AY8D 5DNNC 4M6BA 4UUZA 3X1TA 5B24C 5BNXB 4AWLB 1ID3C 3UTBA 4H9NA 1S32A 4YM6D 3MVDC 1P3FC 3TU4C 3NQUA 3X1TC 3KUYC 1U35C 3UTBC 2CV5A 4UUZB 3REKA 5BO0A 3X1TB 4Z5TD 1P3LA 3UTBB 2Y2HA 2HIOD 4H9NB 2Y2GA 2LY8A 1S32B 5B2IC 2Y2QA 4WU8D 3NQUB 3B0BA 4XZQA 5B31G 5GXQD 2CV5B 3REKB 5BO0B 1P3LB 4Z5TC 1R4VA 3W98A 3V9RA 5AV9C 4HGAB 1KX4D 2Y2JA 3VH5A 3WTPA 4J8WD 4XUJA 4XZQB 3W98C 1P3AA 3B0CW 3LELA 3W98B 3V9RB 1M19D 3LZ1A 1P3PD 5B1MC 3WTPB 3WKJA 4XUJB 4J8WC 3AZNC 3LELC 3MGSD 2RVQD 3AV2C 2BG1A 4LD9D 3VH6T 3AZEC 1P3AB 3LELB 5GT3D 2F8NG 1KX3D 4WU9C 4ZBJC 3LZ1B 5BNVA 5CP6D 1P3PC 3AZFD 4ZUXD 2PYOD 5AVCC 3MGPA 3WKJB 5AV5A 3C1BD 4J8VD 1M1AC 4YS3D 5B31A 3KSYA 3AZMA 1P3OC 5BNVB 2J8PA 3LZ0D 3WAAA 3RELA 4ZUXC 1WWSA 2FFFB 3AZJA 3MGPB 5AV5B 3AN2D 5B31B 3AZMB 1M18A 3RELC 2YFVA 3X1VA 5B40A 3AYWD 1AOID 3WAAB 3RELB 3AZIC 3AZKC 1P34D 3AZJB 1P3GA 3MGQD 3UT9D 1BH9A 3AZGA 5B40C 2ZY4A 1M18B 3REID 2YFVB 5F99D 3X1VB 5B40B 3UTAA 1P3GC 2F8NA 1EQZD 1KU5A 1TZYD 1P3GB 2FJ7C 3H0LC 5B0ZA 4Z66A 5BT1C 3AZGC 1BH9B 4EO5B 1HQ3A 3AZGB 3B6FA 3AZHD 5B2JD 5AV6A 3AFAA 1HTAA 3UTAB 2F8NB 1KX5C 3EPJA 5GT0D 5B0ZB 4Z66B 3KXBD 4KHAA 5BS7A 5DNMC 1HQ3B 3B6FB 2XD1A 4KGCC 5AV6C 4J8UA 2NQBD 4NFTA 3AZHC 5AV6B 3AFAB 5KDMA 3REHD 1Q9CA 3KWQD 1P3KA 3REJA 5B1LD 2CWEA 4KHAB 3AV1A 4G91B 5E5AD 4J8UB 4QLCD 1ZLAD 4J8XD 5B0YD 5KDMB 3REJC 3AZLC 5CPJD 3W99C 1P3KB 3REJB 1P3BA 3AV1B 3WA9C 4R8PD 4KUDA 4DQYB 4H9OA 3MGRA 3A6NA 1F66D 5CPIA 5B33C 3VH5W 1P3BC 5B32G 4KUDC 5DNND 2Y2PA 5B24D 1A7WA 2AROA 3B0CT 3X1SA 1P3BB 1ID3D 4KUDB 2Y2NA 4R8PC 5CPIC 3R45A 4H9OB 3MGRB 3A6NB 3MVDD 5CPIB 1P3FD 3TU4D 3X1TD 3W97A 2AROC 3X1SC 3KUYD 3AL0C 1U35D 3UTBD 4AWLC 1P3IA 2AROB 3X1SB 3R45B 3A1IA 5B2ID 3W97C 3P5JB 3O62A 3W97B 4E45A 3LJAA 3EPKA 1P3IB 3MNNA 1S32C 5AV9D 4XZQD 3O62B 1P3MA 2CV5C 3REKC 1P3LC 4X23A 3LJAB 3W98D 1Z2CB 5B32A 3MNNB 4HGAC 2NZDA 5AY8A 4H9SA 5B1MD 3WTPD 4XZQC 4X23C 1P3MB 3AZND 3AV2D 3F6TA 3LELD 4X23B 2UWXA 2Y2KA 5B32B 1PZRA 3AZED 4YM6A 2NZDC 3X1UA 2NZDB 4WU9D 5AY8B 2YFWA 3WKJD 3WTPC 4XUJC 5CHLB 2HIOA 5AVCD 1P3AC 3X1UC 1M1AD 4YM6B 4WU8A 3X1UB 2RIQA 1P3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ A;  2YFW B;  3WKJ C;  2HIO B;  1KX4 A;  4Z2M H;  4WU8 B;  3REL D;  5GXQ B;  3MGP C;  3AZI D;  3AZK D;  5AV5 C;  4E44 A;  5B31 C;  1M19 A;  3AZM C;  3X1V D;  5B40 D;  3WAA C;  1P3G D;  4LD9 A;  3AZJ C;  5GT3 A;  2FJ7 D;  5FUG A;  5BT1 D;  3AZG D;  1KX3 A;  5AV8 A;  4G92 B;  1M19 B;  5CP6 A;  5JRG A;  1M18 C;  3X1V C;  3C1B A;  4J8V A;  4LD9 B;  3VH5 T;  4YS3 A;  1KX5 D;  5AV8 C;  5GT3 B;  5JRG C;  5FUG B;  4EO5 C;  1KX3 B;  5AV8 B;  5DNM D;  5JRG B;  5CP6 B;  3C1C A;  4KGC D;  5AV6 D;  3AFA D;  3UTA C;  5C3I C;  1JFI A;  3W96 A;  3C1B B;  4J8V B;  3AN2 A;  5C3I B;  5B0Z C;  4YS3 B;  4Z66 C;  4NE6 A;  3C1C C;  1HQ3 C;  4NE3 A;  3B6F C;  2F8N H;  3AYW A;  4WNN A;  3W96 C;  3C1C B;  1P34 A;  3AFA C;  3MGQ A;  3UT9 A;  1JFI B;  3W96 B;  3B6G A;  3AN2 B;  4JJN A;  3REJ D;  3AZL D;  3W99 D;  5BS7 C;  4G91 C;  3REI A;  5F99 A;  4J8U C;  3WA9 D;  3AYW B;  4WNN B;  3NQJ A;  1EQZ A;  3B0D B;  1P34 B;  3MGQ B;  4JJN C;  5GSU A;  3UT9 B;  3B6G B;  5B33 D;  4JJN B;  5CPK A;  1P3K C;  1P3B D;  5AVB A;  2HUE B;  3AV1 C;  4KUD D;  3REI B;  4WV4 B;  5F99 B;  3WTP E;  3NQJ B;  5GSU C;  1EQZ B;  5CPI D;  1ULY A;  5GT0 A;  5GSU B;  5CPK C;  5AVB C;  5CPK B;  4H9Q A;  2ARO D;  5AVB B;  3X1S D;  2NQB A;  1F1E A;  3REH A;  3KWQ A;  3MGR C;  3A6N C;  5GT0 B;  2IO5 C;  1H3O A;  3W97 D;  2IO5 B;  5E5A A;  4H9Q B;  1P3I D;  1ZLA A;  2NQB B;  4H9R A;  4WZS B;  4J8X A;  5B0Y A;  3REH B;  3KWQ B;  1S32 D;  5CPJ A;  1H3O B;  5E5A B;  2CV5 D;  3REK D;  1ZLA B;  1P3I C;  4H9R B;  1P3L D;  1F66 A;  4J8X B;  5B0Y B;  3O62 C;  3VH6 A;  5DNN A;  1N1J A;  5B24 A;  1TAF A;  4X23 D;  1ID3 A;  5B32 D;  3LJA C;  3MNN C;  2NZD D;  3MVD A;  1P3F A;  3TU4 A;  3KUY A;  1U35 A;  5DNN B;  1P3M C;  1N1J B;  5B24 B;  1TAF B;  4XUJ D;  1ID3 B;  4Z2M G;  5B32 C;  1P3A D;  3X1U D;  5B2I A;  1BH8 A;  3MVD B;  1P3F B;  3TU4 B;  3LZ1 D;  5AY8 C;  4H9S C;  4H9P A;  4CSR A;  3KUY B;  1U35 B;  4Z5T A;  5JA4 A;  2BYK A;  5AV9 A;  4YM6 C;  5B2I B;  1BH8 B;  4H9P B;  4CSR B;  2HIO C;  3MGP D;  4Z5T B;  5AV5 D;  5JA4 B;  2BYK B;  5B31 D;  5AV9 B;  1BFM A;  5B1M A;  4WU8 C;  3AZM D;  5GXQ C;  3WAA D;  4J8W A;  3AZN A;  3AV2 A;  4NE5 A;  3AZJ D;  3AZE A;  1KX4 C;  4WU9 A;  5B1M B;  1P3P A;  1M18 D;  1KX4 B;  5AVC A;  4J8W B;  3AZN B;  3AV2 B;  3MGS A;  3AZE B;  1M1A A;  5AV8 D;  4G92 C;  1M19 C;  5JRG D;  1P3O A;  4WU9 B;  4ZBJ B;  1P3P B;  3AZF A;  4ZUX A;  3MGS C;  2RVQ C;  2F8N D;  3UTA D;  2PYO A;  5AVC B;  4LD9 C;  3MGS B;  5GT3 C;  2F8N K;  1M1A B;  5B0Z D;  4Z66 D;  1KX3 C;  5CP6 C;  3C1C D;  3AZF C;  1P3O B;  1HQ3 D;  3B6F D;  5G49 A;  2PYO C;  3LZ0 A;  3W96 D;  3AZF B;  4ZUX B;  3AZI A;  3AZK A;  2PYO B;  3C1B C;  4J8V C;  4YS3 C;  3LZ0 C;  2BYM A;  5G49 B;  4J8U D;  4DRB A;  3LZ0 B;  1AOI A;  3B6G D;  3AZI B;  3AZK B;  2FJ7 A;  4JJN D;  3AN2 C;  1WWI A;  1P3K D;  3AV1 D;  3AYW C;  1AOI C;  3B0D C;  2BYM B;  1P34 C;  5GSU D;  3MGQ C;  3UT9 C;  1AOI B;  1KX5 A;  3B6G C;  2FJ7 B;  1TZY A;  5CPK D;  3VH6 W;  5AVB D;  2HUE C;  5DNM A;  2JSS A;  4KGC A;  3REI C;  5F99 C;  3AZH A;  1EQZ C;  1TZY C;  5B2J A;  1KX5 B;  3MGR D;  3A6N D;  1TZY B;  1B67 A;  3KXB A;  5DNM B;  4KGC B;  5B2J C;  3AZH B;  4CAY A;  5B2J B;  5GT0 C;  3AZL A;  3KXB C;  3W99 A;  5B1L A;  3KXB B;  3WA9 A;  2NQB C;  2L5A A;  4QLC A;  3REH C;  3KWQ C;  4CAY B;  5B33 A;  3AZL B;  5B1L C;  3W99 B;  3O62 D;  5B1L B;  5E5A C;  1ZLA C;  4QLC C;  3WA9 B;  4R8P A;  3LJA D;  4QLC B;  4J8X C;  5B0Y C;  3LZ1 C;  3MNN D;  5CPJ C;  5B33 B;  5CPJ B;  5BNX A;  1P3M D;  1B6W A;  4DRA A;  4R8P B;  1F66 C;  1F66 B;  5AY8 D;  5DNN C;  4M6B A;  4UUZ A;  3X1T A;  5B24 C;  5BNX B;  4AWL B;  1ID3 C;  3UTB A;  4H9N A;  1S32 A;  4YM6 D;  3MVD C;  1P3F C;  3TU4 C;  3NQU A;  3X1T C;  3KUY C;  1U35 C;  3UTB C;  2CV5 A;  4UUZ B;  3REK A;  5BO0 A;  3X1T B;  4Z5T D;  1P3L A;  3UTB B;  2HIO D;  4H9N B;  2LY8 A;  1S32 B;  5B2I C;  4WU8 D;  3NQU B;  3B0B A;  4XZQ A;  5B31 G;  5GXQ D;  2CV5 B;  3REK B;  5BO0 B;  1P3L B;  4Z5T C;  1R4V A;  3W98 A;  3V9R A;  5AV9 C;  4HGA B;  1KX4 D;  3VH5 A;  3WTP A;  4J8W D;  4XUJ A;  4XZQ B;  3W98 C;  1P3A A;  3B0C W;  3LEL A;  3W98 B;  3V9R B;  1M19 D;  3LZ1 A;  1P3P D;  5B1M C;  3WTP B;  3WKJ A;  4XUJ B;  4J8W C;  3AZN C;  3LEL C;  3MGS D;  2RVQ D;  3AV2 C;  4LD9 D;  3VH6 T;  3AZE C;  1P3A B;  3LEL B;  5GT3 D;  2F8N G;  1KX3 D;  4WU9 C;  4ZBJ C;  3LZ1 B;  5BNV A;  5CP6 D;  1P3P C;  3AZF D;  4ZUX D;  2PYO D;  5AVC C;  3MGP A;  3WKJ B;  5AV5 A;  3C1B D;  4J8V D;  1M1A C;  4YS3 D;  5B31 A;  3KSY A;  3AZM A;  1P3O C;  5BNV B;  3LZ0 D;  3WAA A;  3REL A;  4ZUX C;  1WWS A;  3AZJ A;  3MGP B;  5AV5 B;  3AN2 D;  5B31 B;  3AZM B;  1M18 A;  3REL C;  2YFV A;  3X1V A;  5B40 A;  3AYW D;  1AOI D;  3WAA B;  3REL B;  3AZI C;  3AZK C;  1P34 D;  3AZJ B;  1P3G A;  3MGQ D;  3UT9 D;  1BH9 A;  3AZG A;  5B40 C;  1M18 B;  3REI D;  2YFV B;  5F99 D;  3X1V B;  5B40 B;  3UTA A;  1P3G C;  2F8N A;  1EQZ D;  1KU5 A;  1TZY D;  1P3G B;  2FJ7 C;  5B0Z A;  4Z66 A;  5BT1 C;  3AZG C;  1BH9 B;  4EO5 B;  1HQ3 A;  3AZG B;  3B6F A;  3AZH D;  5B2J D;  5AV6 A;  3AFA A;  1HTA A;  3UTA B;  2F8N B;  1KX5 C;  5GT0 D;  5B0Z B;  4Z66 B;  3KXB D;  4KHA A;  5BS7 A;  5DNM C;  1HQ3 B;  3B6F B;  4KGC C;  5AV6 C;  4J8U A;  2NQB D;  4NFT A;  3AZH C;  5AV6 B;  3AFA B;  5KDM A;  3REH D;  1Q9C A;  3KWQ D;  1P3K A;  3REJ A;  5B1L D;  2CWE A;  4KHA B;  3AV1 A;  4G91 B;  5E5A D;  4J8U B;  4QLC D;  1ZLA D;  4J8X D;  5B0Y D;  5KDM B;  3REJ C;  3AZL C;  5CPJ D;  3W99 C;  1P3K B;  3REJ B;  1P3B A;  3AV1 B;  3WA9 C;  4R8P D;  4KUD A;  4H9O A;  3MGR A;  3A6N A;  1F66 D;  5CPI A;  5B33 C;  3VH5 W;  1P3B C;  5B32 G;  4KUD C;  5DNN D;  5B24 D;  1A7W A;  2ARO A;  3B0C T;  3X1S A;  1P3B B;  1ID3 D;  4KUD B;  4R8P C;  5CPI C;  3R45 A;  4H9O B;  3MGR B;  3A6N B;  3MVD D;  5CPI B;  1P3F D;  3TU4 D;  3X1T D;  3W97 A;  2ARO C;  3X1S C;  3KUY D;  1U35 D;  3UTB D;  4AWL C;  1P3I A;  2ARO B;  3X1S B;  3R45 B;  5B2I D;  3W97 C;  3O62 A;  3W97 B;  4E45 A;  3LJA A;  1P3I B;  3MNN A;  1S32 C;  5AV9 D;  4XZQ D;  3O62 B;  1P3M A;  2CV5 C;  3REK C;  1P3L C;  4X23 A;  3LJA B;  3W98 D;  5B32 A;  3MNN B;  4HGA C;  2NZD A;  5AY8 A;  4H9S A;  5B1M D;  3WTP D;  4XZQ C;  4X23 C;  1P3M B;  3AZN D;  3AV2 D;  3LEL D;  4X23 B;  5B32 B;  3AZE D;  2NZD C;  4YM6 A;  3X1U A;  2NZD B;  4WU9 D;  5AY8 B;  2YFW A;  3WKJ D;  3WTP C;  4XUJ C;  5CHL B;  2HIO A;  5AVC D;  1P3A C;  3X1U C;  1M1A D;  4YM6 B;  4WU8 A;  3X1U B;  1P3O D; 
#chains in the Genus database with same CATH topology
 5GXQ A;  2YFW B;  3WKJ C;  2HIO B;  1KX4 A;  4Z2M H;  4WU8 B;  3KFU G;  3REL D;  5GXQ B;  3MGP C;  3AZI D;  3AZK D;  5AV5 C;  4E44 A;  5B31 C;  1M19 A;  3AZM C;  3X1V D;  5B40 D;  3WAA C;  1P3G D;  4LD9 A;  3AZJ C;  5GT3 A;  2FJ7 D;  5FUG A;  5BT1 D;  3AZG D;  1KX3 A;  5AV8 A;  4G92 B;  1M19 B;  4UPK A;  5CP6 A;  5JRG A;  1M18 C;  3X1V C;  3C1B A;  4J8V A;  4LD9 B;  3VH5 T;  4YS3 A;  1KX5 D;  5AV8 C;  5GT3 B;  5JRG C;  5FUG B;  4EO5 C;  1KX3 B;  5AV8 B;  3H0M C;  5DNM D;  5JRG B;  2F2A C;  5CP6 B;  3C1C A;  4KGC D;  5AV6 D;  3AFA D;  3UTA C;  5C3I C;  1JFI A;  3W96 A;  3C1B B;  4J8V B;  3AN2 A;  5C3I B;  5B0Z C;  4YS3 B;  4Z66 C;  2G5I C;  4NE6 A;  3C1C C;  1HQ3 C;  4NE3 A;  2ZM5 A;  3B6F C;  2F8N H;  3AYW A;  4WNN A;  3W96 C;  3C1C B;  1P34 A;  2DF4 C;  3AFA C;  3MGQ A;  3UT9 A;  1JFI B;  3W96 B;  3B6G A;  3AN2 B;  4JJN A;  3REJ D;  3H0R C;  3AZL D;  3W99 D;  5BS7 C;  4G91 C;  3REI A;  5F99 A;  4J8U C;  3WA9 D;  3AYW B;  4WNN B;  3NQJ A;  1EQZ A;  3B0D B;  1P34 B;  3MGQ B;  4JJN C;  5GSU A;  3UT9 B;  3B6G B;  5B33 D;  4JJN B;  5CPK A;  1P3K C;  1P3B D;  5AVB A;  2HUE B;  3AV1 C;  4KUD D;  3REI B;  4WV4 B;  5F99 B;  3WTP E;  3NQJ B;  5GSU C;  1EQZ B;  5CPI D;  1ULY A;  5GT0 A;  5GSU B;  5CPK C;  5AVB C;  5CPK B;  4H9Q A;  2ARO D;  5AVB B;  3X1S D;  2NQB A;  2ZY2 A;  1F1E A;  2VQR A;  3REH A;  3KWQ A;  3MGR C;  3A6N C;  2DQN C;  5GT0 B;  2IO5 C;  1H3O A;  3W97 D;  1W2E A;  2IO5 B;  5E5A A;  4H9Q B;  1P3I D;  1ZLA A;  2NQB B;  4H9R A;  4WZS B;  4J8X A;  5B0Y A;  3REH B;  3KWQ B;  1S32 D;  5CPJ A;  1H3O B;  5E5A B;  2CV5 D;  3REK D;  1ZLA B;  2XD5 A;  4H9R B;  1P3I C;  2Y2L A;  1P3L D;  1F66 A;  4J8X B;  5B0Y B;  3O62 C;  3VH6 A;  5DNN A;  1N1J A;  5B24 A;  1TAF A;  4X23 D;  1ID3 A;  5B32 D;  3LJA C;  2Y2O A;  3MNN C;  2NZD D;  3MVD A;  1P3F A;  3TU4 A;  3KUY A;  1U35 A;  5DNN B;  1P3M C;  1N1J B;  5B24 B;  1TAF B;  4XUJ D;  1ID3 B;  4Z2M G;  2ZY5 A;  5B32 C;  1P3A D;  3X1U D;  5B2I A;  1BH8 A;  3MVD B;  2Y2I A;  1P3F B;  3TU4 B;  3LZ1 D;  5AY8 C;  4H9S C;  4H9P A;  4CSR A;  3KUY B;  1U35 B;  4Z5T A;  5JA4 A;  2BYK A;  5AV9 A;  4YM6 C;  5B2I B;  3EPL A;  1BH8 B;  4H9P B;  4CSR B;  2HIO C;  3MGP D;  4Z5T B;  5AV5 D;  5JA4 B;  2BYK B;  5B31 D;  5AV9 B;  1BFM A;  5B1M A;  4WU8 C;  3AZM D;  5GXQ C;  3WAA D;  4J8W A;  3AZN A;  3AV2 A;  4NE5 A;  3AZJ D;  3AZE A;  1KX4 C;  4WU9 A;  5B1M B;  1P3P A;  1M18 D;  1KX4 B;  5AVC A;  4J8W B;  3AZN B;  3AV2 B;  3MGS A;  3AZE B;  1M1A A;  5AV8 D;  2ZY3 A;  4G92 C;  1M19 C;  5JRG D;  1P3O A;  4WU9 B;  4ZBJ B;  1P3P B;  3AZF A;  4ZUX A;  3MGS C;  2RVQ C;  2F8N D;  3UTA D;  2PYO A;  5AVC B;  4LD9 C;  2W8S A;  5GT3 C;  3MGS B;  2F8N K;  1M1A B;  5B0Z D;  4Z66 D;  1KX3 C;  5CP6 C;  3C1C D;  3AZF C;  1P3O B;  1HQ3 D;  3B6F D;  1T3U A;  5G49 A;  2PYO C;  3LZ0 A;  3W96 D;  3AZF B;  4ZUX B;  3AZI A;  3AZK A;  2PYO B;  3C1B C;  4J8V C;  4YS3 C;  3LZ0 C;  2BYM A;  5G49 B;  4J8U D;  4DRB A;  3LZ0 B;  1AOI A;  3B6G D;  3AZI B;  3AZK B;  2FJ7 A;  2Y2M A;  4JJN D;  3AN2 C;  1WWI A;  1P3K D;  3AV1 D;  3AYW C;  1AOI C;  3B0D C;  2BYM B;  1P34 C;  5GSU D;  3MGQ C;  3UT9 C;  1AOI B;  1KX5 A;  3B6G C;  2FJ7 B;  1TZY A;  4WJ3 C;  5CPK D;  3VH6 W;  5AVB D;  2HUE C;  5DNM A;  2JSS A;  4KGC A;  3REI C;  5F99 C;  3AZH A;  1EQZ C;  1TZY C;  5B2J A;  1KX5 B;  3MGR D;  3A6N D;  2JCH A;  1TZY B;  1B67 A;  2G5H C;  3KXB A;  5DNM B;  4KGC B;  5B2J C;  3AZH B;  3EPH A;  4CAY A;  5B2J B;  5GT0 C;  3AZL A;  3KXB C;  3W99 A;  3IP4 C;  5B1L A;  3KXB B;  3WA9 A;  2NQB C;  3A1K A;  3FDD A;  2L5A A;  4QLC A;  3REH C;  3KWQ C;  4CAY B;  5B33 A;  2JE5 A;  5B1L C;  3AZL B;  3W99 B;  3O62 D;  5B1L B;  5E5A C;  1ZLA C;  4QLC C;  3WA9 B;  4R8P A;  3LJA D;  4QLC B;  4J8X C;  5B0Y C;  3LZ1 C;  3MNN D;  3EG5 B;  5CPJ C;  5B33 B;  5CPJ B;  5BNX A;  1P3M D;  1B6W A;  4DRA A;  4R8P B;  1F66 C;  1F66 B;  5AY8 D;  5DNN C;  4M6B A;  4UUZ A;  3X1T A;  5B24 C;  5BNX B;  4AWL B;  1ID3 C;  3UTB A;  4H9N A;  1S32 A;  4YM6 D;  3MVD C;  1P3F C;  3TU4 C;  3NQU A;  3X1T C;  3KUY C;  1U35 C;  3UTB C;  2CV5 A;  4UUZ B;  3REK A;  5BO0 A;  3X1T B;  4Z5T D;  1P3L A;  3UTB B;  2Y2H A;  2HIO D;  4H9N B;  2Y2G A;  2LY8 A;  1S32 B;  5B2I C;  2Y2Q A;  4WU8 D;  3NQU B;  3B0B A;  4XZQ A;  5B31 G;  5GXQ D;  2CV5 B;  3REK B;  5BO0 B;  1P3L B;  4Z5T C;  1R4V A;  3W98 A;  3V9R A;  5AV9 C;  4HGA B;  1KX4 D;  2Y2J A;  3VH5 A;  3WTP A;  4J8W D;  4XUJ A;  4XZQ B;  3W98 C;  1P3A A;  3B0C W;  3LEL A;  3W98 B;  3V9R B;  1M19 D;  3LZ1 A;  1P3P D;  5B1M C;  3WTP B;  3WKJ A;  4XUJ B;  4J8W C;  3AZN C;  3LEL C;  3MGS D;  2RVQ D;  3AV2 C;  2BG1 A;  4LD9 D;  3VH6 T;  3AZE C;  1P3A B;  3LEL B;  5GT3 D;  2F8N G;  1KX3 D;  4WU9 C;  4ZBJ C;  3LZ1 B;  5BNV A;  5CP6 D;  1P3P C;  3AZF D;  4ZUX D;  2PYO D;  5AVC C;  3MGP A;  3WKJ B;  5AV5 A;  3C1B D;  4J8V D;  1M1A C;  4YS3 D;  5B31 A;  3KSY A;  3AZM A;  1P3O C;  5BNV B;  2J8P A;  3LZ0 D;  3WAA A;  3REL A;  4ZUX C;  1WWS A;  2FFF B;  3AZJ A;  3MGP B;  5AV5 B;  3AN2 D;  5B31 B;  3AZM B;  1M18 A;  3REL C;  2YFV A;  3X1V A;  5B40 A;  3AYW D;  1AOI D;  3WAA B;  3REL B;  3AZI C;  3AZK C;  1P34 D;  3AZJ B;  1P3G A;  3MGQ D;  3UT9 D;  1BH9 A;  3AZG A;  5B40 C;  2ZY4 A;  1M18 B;  3REI D;  2YFV B;  5F99 D;  3X1V B;  5B40 B;  3UTA A;  1P3G C;  2F8N A;  1EQZ D;  1KU5 A;  1TZY D;  1P3G B;  2FJ7 C;  3H0L C;  5B0Z A;  4Z66 A;  5BT1 C;  3AZG C;  1BH9 B;  4EO5 B;  1HQ3 A;  3AZG B;  3B6F A;  3AZH D;  5B2J D;  5AV6 A;  3AFA A;  1HTA A;  3UTA B;  2F8N B;  1KX5 C;  3EPJ A;  5GT0 D;  5B0Z B;  4Z66 B;  3KXB D;  4KHA A;  5BS7 A;  5DNM C;  1HQ3 B;  3B6F B;  2XD1 A;  4KGC C;  5AV6 C;  4J8U A;  2NQB D;  4NFT A;  3AZH C;  5AV6 B;  3AFA B;  5KDM A;  3REH D;  1Q9C A;  3KWQ D;  1P3K A;  3REJ A;  5B1L D;  2CWE A;  4KHA B;  3AV1 A;  4G91 B;  5E5A D;  4J8U B;  4QLC D;  1ZLA D;  4J8X D;  5B0Y D;  5KDM B;  3REJ C;  3AZL C;  5CPJ D;  3W99 C;  1P3K B;  3REJ B;  1P3B A;  3AV1 B;  3WA9 C;  4R8P D;  4KUD A;  4DQY B;  4H9O A;  3MGR A;  3A6N A;  1F66 D;  5CPI A;  5B33 C;  3VH5 W;  1P3B C;  5B32 G;  4KUD C;  5DNN D;  2Y2P A;  5B24 D;  1A7W A;  2ARO A;  3B0C T;  3X1S A;  1P3B B;  1ID3 D;  4KUD B;  2Y2N A;  4R8P C;  5CPI C;  3R45 A;  4H9O B;  3MGR B;  3A6N B;  3MVD D;  5CPI B;  1P3F D;  3TU4 D;  3X1T D;  3W97 A;  2ARO C;  3X1S C;  3KUY D;  3AL0 C;  1U35 D;  3UTB D;  4AWL C;  1P3I A;  2ARO B;  3X1S B;  3R45 B;  3A1I A;  5B2I D;  3W97 C;  3P5J B;  3O62 A;  3W97 B;  4E45 A;  3LJA A;  3EPK A;  1P3I B;  3MNN A;  1S32 C;  5AV9 D;  4XZQ D;  3O62 B;  1P3M A;  2CV5 C;  3REK C;  1P3L C;  4X23 A;  3LJA B;  3W98 D;  1Z2C B;  5B32 A;  3MNN B;  4HGA C;  2NZD A;  5AY8 A;  4H9S A;  5B1M D;  3WTP D;  4XZQ C;  4X23 C;  1P3M B;  3AZN D;  3AV2 D;  3F6T A;  3LEL D;  4X23 B;  2UWX A;  2Y2K A;  5B32 B;  1PZR A;  3AZE D;  4YM6 A;  2NZD C;  3X1U A;  2NZD B;  4WU9 D;  5AY8 B;  2YFW A;  3WKJ D;  3WTP C;  4XUJ C;  5CHL B;  2HIO A;  5AVC D;  1P3A C;  3X1U C;  1M1A D;  4YM6 B;  4WU8 A;  3X1U B;  2RIQ A;  1P3O D; 
#chains in the Genus database with same CATH homology
 5GXQ A;  2YFW B;  3WKJ C;  2HIO B;  1KX4 A;  4Z2M H;  4WU8 B;  3KFU G;  3REL D;  5GXQ B;  3MGP C;  3AZI D;  3AZK D;  5AV5 C;  4E44 A;  5B31 C;  1M19 A;  3AZM C;  3X1V D;  5B40 D;  3WAA C;  1P3G D;  4LD9 A;  3AZJ C;  5GT3 A;  2FJ7 D;  5FUG A;  5BT1 D;  3AZG D;  1KX3 A;  5AV8 A;  4G92 B;  1M19 B;  4UPK A;  5CP6 A;  5JRG A;  1M18 C;  3X1V C;  3C1B A;  4J8V A;  4LD9 B;  3VH5 T;  4YS3 A;  1KX5 D;  5AV8 C;  5GT3 B;  5JRG C;  5FUG B;  4EO5 C;  1KX3 B;  5AV8 B;  3H0M C;  5DNM D;  5JRG B;  2F2A C;  5CP6 B;  3C1C A;  4KGC D;  5AV6 D;  3AFA D;  3UTA C;  5C3I C;  1JFI A;  3W96 A;  3C1B B;  4J8V B;  3AN2 A;  5C3I B;  5B0Z C;  4YS3 B;  4Z66 C;  2G5I C;  4NE6 A;  3C1C C;  1HQ3 C;  4NE3 A;  2ZM5 A;  3B6F C;  2F8N H;  3AYW A;  4WNN A;  3W96 C;  3C1C B;  1P34 A;  2DF4 C;  3AFA C;  3MGQ A;  3UT9 A;  1JFI B;  3W96 B;  3B6G A;  3AN2 B;  4JJN A;  3REJ D;  3H0R C;  3AZL D;  3W99 D;  5BS7 C;  4G91 C;  3REI A;  5F99 A;  4J8U C;  3WA9 D;  3AYW B;  4WNN B;  3NQJ A;  1EQZ A;  3B0D B;  1P34 B;  3MGQ B;  4JJN C;  5GSU A;  3UT9 B;  3B6G B;  5B33 D;  4JJN B;  5CPK A;  1P3K C;  1P3B D;  5AVB A;  2HUE B;  3AV1 C;  4KUD D;  3REI B;  4WV4 B;  5F99 B;  3WTP E;  3NQJ B;  5GSU C;  1EQZ B;  5CPI D;  1ULY A;  5GT0 A;  5GSU B;  5CPK C;  5AVB C;  5CPK B;  4H9Q A;  2ARO D;  5AVB B;  3X1S D;  2NQB A;  2ZY2 A;  1F1E A;  2VQR A;  3REH A;  3KWQ A;  3MGR C;  3A6N C;  2DQN C;  5GT0 B;  2IO5 C;  1H3O A;  3W97 D;  1W2E A;  2IO5 B;  5E5A A;  4H9Q B;  1P3I D;  1ZLA A;  2NQB B;  4H9R A;  4WZS B;  4J8X A;  5B0Y A;  3REH B;  3KWQ B;  1S32 D;  5CPJ A;  1H3O B;  5E5A B;  2CV5 D;  3REK D;  1ZLA B;  2XD5 A;  4H9R B;  1P3I C;  2Y2L A;  1P3L D;  1F66 A;  4J8X B;  5B0Y B;  3O62 C;  3VH6 A;  5DNN A;  1N1J A;  5B24 A;  1TAF A;  4X23 D;  1ID3 A;  5B32 D;  3LJA C;  2Y2O A;  3MNN C;  2NZD D;  3MVD A;  1P3F A;  3TU4 A;  3KUY A;  1U35 A;  5DNN B;  1P3M C;  1N1J B;  5B24 B;  1TAF B;  4XUJ D;  1ID3 B;  4Z2M G;  2ZY5 A;  5B32 C;  1P3A D;  3X1U D;  5B2I A;  1BH8 A;  3MVD B;  2Y2I A;  1P3F B;  3TU4 B;  3LZ1 D;  5AY8 C;  4H9S C;  4H9P A;  4CSR A;  3KUY B;  1U35 B;  4Z5T A;  5JA4 A;  2BYK A;  5AV9 A;  4YM6 C;  5B2I B;  3EPL A;  1BH8 B;  4H9P B;  4CSR B;  2HIO C;  3MGP D;  4Z5T B;  5AV5 D;  5JA4 B;  2BYK B;  5B31 D;  5AV9 B;  1BFM A;  5B1M A;  4WU8 C;  3AZM D;  5GXQ C;  3WAA D;  4J8W A;  3AZN A;  3AV2 A;  4NE5 A;  3AZJ D;  3AZE A;  1KX4 C;  4WU9 A;  5B1M B;  1P3P A;  1M18 D;  1KX4 B;  5AVC A;  4J8W B;  3AZN B;  3AV2 B;  3MGS A;  3AZE B;  1M1A A;  5AV8 D;  2ZY3 A;  4G92 C;  1M19 C;  5JRG D;  1P3O A;  4WU9 B;  4ZBJ B;  1P3P B;  3AZF A;  4ZUX A;  3MGS C;  2RVQ C;  2F8N D;  3UTA D;  2PYO A;  5AVC B;  4LD9 C;  2W8S A;  5GT3 C;  3MGS B;  2F8N K;  1M1A B;  5B0Z D;  4Z66 D;  1KX3 C;  5CP6 C;  3C1C D;  3AZF C;  1P3O B;  1HQ3 D;  3B6F D;  1T3U A;  5G49 A;  2PYO C;  3LZ0 A;  3W96 D;  3AZF B;  4ZUX B;  3AZI A;  3AZK A;  2PYO B;  3C1B C;  4J8V C;  4YS3 C;  3LZ0 C;  2BYM A;  5G49 B;  4J8U D;  4DRB A;  3LZ0 B;  1AOI A;  3B6G D;  3AZI B;  3AZK B;  2FJ7 A;  2Y2M A;  4JJN D;  3AN2 C;  1WWI A;  1P3K D;  3AV1 D;  3AYW C;  1AOI C;  3B0D C;  2BYM B;  1P34 C;  5GSU D;  3MGQ C;  3UT9 C;  1AOI B;  1KX5 A;  3B6G C;  2FJ7 B;  1TZY A;  4WJ3 C;  5CPK D;  3VH6 W;  5AVB D;  2HUE C;  5DNM A;  2JSS A;  4KGC A;  3REI C;  5F99 C;  3AZH A;  1EQZ C;  1TZY C;  5B2J A;  1KX5 B;  3MGR D;  3A6N D;  2JCH A;  1TZY B;  1B67 A;  2G5H C;  3KXB A;  5DNM B;  4KGC B;  5B2J C;  3AZH B;  3EPH A;  4CAY A;  5B2J B;  5GT0 C;  3AZL A;  3KXB C;  3W99 A;  3IP4 C;  5B1L A;  3KXB B;  3WA9 A;  2NQB C;  3A1K A;  3FDD A;  2L5A A;  4QLC A;  3REH C;  3KWQ C;  4CAY B;  5B33 A;  2JE5 A;  5B1L C;  3AZL B;  3W99 B;  3O62 D;  5B1L B;  5E5A C;  1ZLA C;  4QLC C;  3WA9 B;  4R8P A;  3LJA D;  4QLC B;  4J8X C;  5B0Y C;  3LZ1 C;  3MNN D;  3EG5 B;  5CPJ C;  5B33 B;  5CPJ B;  5BNX A;  1P3M D;  1B6W A;  4DRA A;  4R8P B;  1F66 C;  1F66 B;  5AY8 D;  5DNN C;  4M6B A;  4UUZ A;  3X1T A;  5B24 C;  5BNX B;  4AWL B;  1ID3 C;  3UTB A;  4H9N A;  1S32 A;  4YM6 D;  3MVD C;  1P3F C;  3TU4 C;  3NQU A;  3X1T C;  3KUY C;  1U35 C;  3UTB C;  2CV5 A;  4UUZ B;  3REK A;  5BO0 A;  3X1T B;  4Z5T D;  1P3L A;  3UTB B;  2Y2H A;  2HIO D;  4H9N B;  2Y2G A;  2LY8 A;  1S32 B;  5B2I C;  2Y2Q A;  4WU8 D;  3NQU B;  3B0B A;  4XZQ A;  5B31 G;  5GXQ D;  2CV5 B;  3REK B;  5BO0 B;  1P3L B;  4Z5T C;  1R4V A;  3W98 A;  3V9R A;  5AV9 C;  4HGA B;  1KX4 D;  2Y2J A;  3VH5 A;  3WTP A;  4J8W D;  4XUJ A;  4XZQ B;  3W98 C;  1P3A A;  3B0C W;  3LEL A;  3W98 B;  3V9R B;  1M19 D;  3LZ1 A;  1P3P D;  5B1M C;  3WTP B;  3WKJ A;  4XUJ B;  4J8W C;  3AZN C;  3LEL C;  3MGS D;  2RVQ D;  3AV2 C;  2BG1 A;  4LD9 D;  3VH6 T;  3AZE C;  1P3A B;  3LEL B;  5GT3 D;  2F8N G;  1KX3 D;  4WU9 C;  4ZBJ C;  3LZ1 B;  5BNV A;  5CP6 D;  1P3P C;  3AZF D;  4ZUX D;  2PYO D;  5AVC C;  3MGP A;  3WKJ B;  5AV5 A;  3C1B D;  4J8V D;  1M1A C;  4YS3 D;  5B31 A;  3KSY A;  3AZM A;  1P3O C;  5BNV B;  2J8P A;  3LZ0 D;  3WAA A;  3REL A;  4ZUX C;  1WWS A;  2FFF B;  3AZJ A;  3MGP B;  5AV5 B;  3AN2 D;  5B31 B;  3AZM B;  1M18 A;  3REL C;  2YFV A;  3X1V A;  5B40 A;  3AYW D;  1AOI D;  3WAA B;  3REL B;  3AZI C;  3AZK C;  1P34 D;  3AZJ B;  1P3G A;  3MGQ D;  3UT9 D;  1BH9 A;  3AZG A;  5B40 C;  2ZY4 A;  1M18 B;  3REI D;  2YFV B;  5F99 D;  3X1V B;  5B40 B;  3UTA A;  1P3G C;  2F8N A;  1EQZ D;  1KU5 A;  1TZY D;  1P3G B;  2FJ7 C;  3H0L C;  5B0Z A;  4Z66 A;  5BT1 C;  3AZG C;  1BH9 B;  4EO5 B;  1HQ3 A;  3AZG B;  3B6F A;  3AZH D;  5B2J D;  5AV6 A;  3AFA A;  1HTA A;  3UTA B;  2F8N B;  1KX5 C;  3EPJ A;  5GT0 D;  5B0Z B;  4Z66 B;  3KXB D;  4KHA A;  5BS7 A;  5DNM C;  1HQ3 B;  3B6F B;  2XD1 A;  4KGC C;  5AV6 C;  4J8U A;  2NQB D;  4NFT A;  3AZH C;  5AV6 B;  3AFA B;  5KDM A;  3REH D;  1Q9C A;  3KWQ D;  1P3K A;  3REJ A;  5B1L D;  2CWE A;  4KHA B;  3AV1 A;  4G91 B;  5E5A D;  4J8U B;  4QLC D;  1ZLA D;  4J8X D;  5B0Y D;  5KDM B;  3REJ C;  3AZL C;  5CPJ D;  3W99 C;  1P3K B;  3REJ B;  1P3B A;  3AV1 B;  3WA9 C;  4R8P D;  4KUD A;  4DQY B;  4H9O A;  3MGR A;  3A6N A;  1F66 D;  5CPI A;  5B33 C;  3VH5 W;  1P3B C;  5B32 G;  4KUD C;  5DNN D;  2Y2P A;  5B24 D;  1A7W A;  2ARO A;  3B0C T;  3X1S A;  1P3B B;  1ID3 D;  4KUD B;  2Y2N A;  4R8P C;  5CPI C;  3R45 A;  4H9O B;  3MGR B;  3A6N B;  3MVD D;  5CPI B;  1P3F D;  3TU4 D;  3X1T D;  3W97 A;  2ARO C;  3X1S C;  3KUY D;  3AL0 C;  1U35 D;  3UTB D;  4AWL C;  1P3I A;  2ARO B;  3X1S B;  3R45 B;  3A1I A;  5B2I D;  3W97 C;  3P5J B;  3O62 A;  3W97 B;  4E45 A;  3LJA A;  3EPK A;  1P3I B;  3MNN A;  1S32 C;  5AV9 D;  4XZQ D;  3O62 B;  1P3M A;  2CV5 C;  3REK C;  1P3L C;  4X23 A;  3LJA B;  3W98 D;  1Z2C B;  5B32 A;  3MNN B;  4HGA C;  2NZD A;  5AY8 A;  4H9S A;  5B1M D;  3WTP D;  4XZQ C;  4X23 C;  1P3M B;  3AZN D;  3AV2 D;  3F6T A;  3LEL D;  4X23 B;  2UWX A;  2Y2K A;  5B32 B;  1PZR A;  3AZE D;  4YM6 A;  2NZD C;  3X1U A;  2NZD B;  4WU9 D;  5AY8 B;  2YFW A;  3WKJ D;  3WTP C;  4XUJ C;  5CHL B;  2HIO A;  5AVC D;  1P3A C;  3X1U C;  1M1A D;  4YM6 B;  4WU8 A;  3X1U B;  2RIQ A;  1P3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...