2BYMA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 65
sequence length 65
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bymA00
3AZED 5CPJB 5B2JA 3C1BD 3VH6T 3WKJB 1BH9A 1TZYD 2PYOA 2PYOC 4XUJD 5DNNA 5CPJC 5GXQB 3WKJC 1P3GB 3AZGB 1EQZC 4YS3A 5AV6D 3B6GA 4YS3C 1P3MA 1P3AD 5GXQC 3TU4B 4KUDB 3KUYA 5CPKA 3MGPA 4CSRA 3REIB 3KUYC 3MGPC 2AROD 4XZQB 3X1SD 4J8XA 3WTPE 4QLCA 4J8VB 1P3LA 1KX5A 1KX5C 5DNMA 1P3LC 2F8NB 3TU4C 5B31A 5DNMC 5GT0D 4E44A 3REJD 4XZQC 3MNNA 3B0DB 4EO5C 2CV5B 3MGRB 5F99D 5B0ZD 1F66D 5JRGD 4R8PD 3AZMB 2FJ7A 3B0DC 2FJ7C 3AZID 5B2JD 1AOID 5B0YD 5B2IC 1P3IA 3MGRC 3R45A 1P3IC 5CPIA 3W99B 3X1TA 5CPIC 3X1TC 2YFVA 2YFWB 1M19B 5AVBA 5AVBC 2NQBB 4Z5TA 1U35D 5B40D 1P3MD 2HUEB 4H9PB 5B1MD 2HIOB 4Z5TC 4WU9D 3WA9B 4J8XD 1KX3A 2HUEC 3V9RB 3C1CC 5B31D 3X1UA 3X1UC 3MNND 3W96B 1WWIA 1P3PA 1HQ3D 3AZJD 1P3FB 3AZLA 1P3PC 1ID3D 1H3OB 4LD9A 4LD9C 3AZLC 3MVDA 5AV5A 4J8UB 3AV2D 3NQUA 3KXBA 4J8UC 4HGAB 4J8WA 2NZDD 1M18D 4ZUXA 3REHA 5AVCA 1P3KA 3AV1D 4HGAC 3AZFB 3AZHD 3WTPB 1P34A 1KX3D 4WU8C 1JFIA 4X23B 1Q9CA 5FUGB 4YM6D 3WTPC 4Z66D 3LZ1D 5CP6A 3AZEB 3WAAD 3C1BB 4UUZB 5CP6C 3O62D 4G92B 5GT3D 3UT9B 1KX4A 1KX4C 3AZEC 3C1BC 1TZYA 3MVDD 5AV5D 4CAYA 1TZYC 1P3BD 1S32A 4XUJA 4AWLB 3AFAD 4XUJC 3X1VD 1ZLAB 5B32B 4WNNB 5KDMB 3KXBD 4J8WD 3NQJA 4H9NA 5AV6C 3VH6A 3REHD 1P3AC 1P3KD 2AROA 3X1SA 1M1AA 2LY8A 2AROC 3X1SC 1F1EA 3AZKD 3REKB 5GT0A 3UTBA 5BNVB 5JA4A 4H9OB 5GT0C 3REJA 4H9RA 5B2JB 3KWQD 3AYWD 5F99A 5B0ZA 1F66A 1BH9B 5B0ZC 5AY8D 5F99C 1F66C 5JRGA 4R8PA 1N1JA 2PYOB 5JRGC 3AZIA 5DNNB 5B0YA 1AOIA 3AZIC 5B2JC 1P3OA 5B0YC 1AOIC 1S32D 4DRBA 4JJND 3AN2D 1EQZB 2BYMA 4YS3B 3B6GB 5DNNC 3KUYB 5CPKB 5E5AD 3MGPB 4CSRB 1U35A 5B40A 4J8XB 1KX5B 1P3LB 5B1MA 4QLCB 4WU9A 5B40C 1P3MC 3B6GC 5DNMB 5B1MC 4WU9C 5CPKC 1M1AD 4J8XC 3MNNB 4EO5B 4QLCC 5B1LA 5B31C 3UTBD 2FJ7B 3MNNC 5B2IB 4KHAA 1P3IB 3R45B 5CPIB 3X1TB 1HQ3A 3AZJA 1ID3A 1HQ3C 1ID3C 1P3OD 3AZGA 2YFVB 5AVBB 3AV2A 3W97D 4Z5TB 3AV2C 4KUDA 5GSUA 2NZDA 1M18A 3C1CB 1M18C 3X1UB 3AV1A 3MGQD 3AZHA 3B6FD 1BFMA 3AZHC 1KX3C 2CV5A 5B1LD 1KU5A 4KGCA 5G49A 3MGSD 4YM6A 4Z66A 3LZ1A 4YM6C 1P3PB 4Z66C 3LZ1C 3WAAA 3AZLB 4LD9B 3WAAC 3O62A 5GT3A 3O62C 3MVDB 5AV5B 5GT3C 5GXQD 5AV9A 3UTAA 1P3GD 3NQUB 3AZGD 1P3BA 3MVDC 5AV5C 1P3BC 3AFAA 3LELA 3X1VA 5BNXA 3AFAC 4ZUXB 4KUDD 3X1VC 3REHB 3REID 3B0CT 3B0BA 5AVCB 5GSUD 3KXBC 2F8NH 1P3KB 3AZNA 4J8VD 4J8WC 1P34B 4WU8B 3A6NA 4ZUXC 1JFIB 2L5AA 3REHC 5AVCC 1P3KC 1P34C 3AZKA 2CV5D 5CP6B 3AZKC 4KGCD 3AZMD 3LZ0A 2BYKA 1KX4B 3KWQA 3AYWA 3KWQC 1TZYB 3W99D 5BT1D 5AY8A 3AYWC 2IO5B 1R4VA 4CAYB 5AY8C 1S32B 4XUJB 5AV9D 3UTAD 1M19D 1BH8A 3VH5T 2IO5C 4NE3A 4JJNA 3AN2A 2NQBD 1S32C 4JJNC 2JSSA 4WV4B 5AV6B 3NQJB 3LELD 2HIOD 4H9NB 1P3AB 3WA9D 5B32G 5E5AA 5E5AC 3AZND 2AROB 3X1SB 1M1AB 3A6ND 3LJAA 3B0CW 5FUGA 5GT0B 5B33A 5JA4B 3W96D 3REJB 1M1AC 5CHLB 4ZBJB 3W98A 5B0ZB 5F99B 1F66B 3UTBC 4H9QA 5JRGB 1B6WA 1N1JB 4R8PB 3LZ0D 3REJC 1P3FD 3AZIB 4ZBJC 5B0YB 1AOIB 1P3OB 4R8PC 5B24A 2BYMB 1P3OC 3RELA 4H9SA 3W97A 1P3MB 1U35B 5B40B 5B1MB 4WU9B 3W97C 3VH5W 2RVQD 1TAFA 3AZFD 5AV8A 4X23D 1U35C 3LJAD 3REKA 5B31B 5B33D 3B6FA 3MGQA 3B6FC 3MGQC 5BO0A 2F8NG 5B1LC 3W98D 4KHAB 3MGSA 3UT9D 1B67A 3MGSC 5CPJA 1HQ3B 3AZJB 1ID3B 3WKJA 1EQZA 1WWSA 5B24D 1ULYA 5GXQA 3AV2B 1ZLAD 3AZJC 1P3GA 5B32D 1P3GC 3RELD 3AZGC 4NE6A 5GSUB 2NZDB 1M18B 3TU4A 4KUDC 3REIA 3REIC 4XZQA 5AV8D 5BS7A 5GSUC 4J8VA 3AZHB 3AV1B 1KX3B 5BS7C 4J8VC 2F8NA 2NZDC 3REKD 4KGCB 3AV1C 5G49B 4YM6B 4Z66B 3LZ1B 4Z2MG 5B2IA 3MGRA 2CV5C 3WAAB 3O62B 2PYOD 5GT3B 3AZMA 4KGCC 5CPJD 3AZMC 5DNND 3WKJD 3VH6W 5AV9B 3UTAB 3W99A 1EQZD 1P3BB 3W99C 5BT1C 4YS3D 3B6GD 3AFAB 5AV9C 3LELB 3UTAC 5BNXB 3X1VB 2YFWA 1M19A 3KUYD 5CPKD 3MGPD 2F8NK 1M19C 3KXBB 2NQBA 4J8WB 1KX5D 4H9PA 3C1CA 4QLCD 2HIOA 3TU4D 3AZNB 1P3LD 3WA9A 5DNMD 3LELC 2HIOC 3A6NB 3WA9C 4E45A 4XZQD 3V9RA 3AZNC 2F8ND 3A6NC 3AZKB 3VH5A 1A7WA 3W96A 2FJ7D 4G91B 3W96C 3LZ0B 2BYKB 5B2ID 3KSYA 3MGRD 3KWQB 1P3ID 3AYWB 5CPID 3X1TD 5AY8B 2CWEA 1P3FA 4G91C 1H3OA 3LZ0C 1P3FC 4J8UA 5AVBD 1BH8B 1HTAA 4JJNB 3AN2B 5C3IB 4Z5TD 5E5AB 3AN2C 5C3IC 3C1CD 4WU8A 4NE5A 3LJAB 3X1UD 3AZFA 2RVQC 5B33B 3WTPA 4Z2MH 4DRAA 3AZFC 4X23A 4X23C 3LJAC 4M6BA 3UTBB 3W98B 5B33C 4H9QB 1P3PD 3AZEA 4LD9D 3AZLD 4H9RB 4UUZA 3C1BA 3W98C 4G92C 3UT9A 3UT9C 5B24B 4J8UD 2NQBC 3RELB 4NFTA 5AV6A 1ZLAA 4AWLC 5B24C 4ZUXD 5B32A 1P3AA 4WNNA 4WZSB 1ZLAC 5KDMA 3W97B 5B32C 5AVCD 3RELC 1TAFB 4H9SC 1P34D 4WU8D 5AV8B 3WTPD 3B6FB 3MGQB 5AV8C 5BO0B 5CP6D 5B31G 5B1LB 5BNVA 3REKC 4H9OA 3MGSB 1KX4D
chains in the Genus database with same CATH superfamily
3AZED 5CPJB 5B2JA 3C1BD 3VH6T 3WKJB 1BH9A 1TZYD 2PYOA 2PYOC 4XUJD 5DNNA 5CPJC 5GXQB 3IP4C 3WKJC 1P3GB 2ZY5A 3AZGB 1EQZC 4YS3A 5AV6D 3B6GA 4YS3C 1P3MA 1P3AD 5GXQC 3TU4B 4KUDB 3KUYA 5CPKA 3MGPA 4CSRA 3REIB 3KUYC 3MGPC 2AROD 4XZQB 3X1SD 4J8XA 4QLCA 3WTPE 4J8VB 1P3LA 1KX5A 1KX5C 5DNMA 1P3LC 2F8NB 3TU4C 5B31A 5DNMC 5GT0D 4E44A 3REJD 2Y2NA 4XZQC 3MNNA 3B0DB 4EO5C 2CV5B 3MGRB 5F99D 5B0ZD 1F66D 5JRGD 4R8PD 3AZMB 2FJ7A 3B0DC 2FJ7C 3AZID 5B2JD 2Y2QA 1AOID 5B0YD 5B2IC 1P3IA 3MGRC 3R45A 1P3IC 5CPIA 3W99B 3X1TA 2XD1A 5CPIC 3X1TC 4WJ3C 2YFVA 2YFWB 1M19B 5AVBA 5AVBC 2NQBB 4Z5TA 1U35D 5B40D 1P3MD 2HUEB 4H9PB 5B1MD 2HIOB 4Z5TC 4WU9D 3WA9B 4J8XD 1KX3A 2HUEC 3V9RB 3C1CC 5B31D 3X1UA 3X1UC 3MNND 3W96B 1WWIA 3KFUG 1P3PA 1HQ3D 3AZJD 1P3FB 3AZLA 1P3PC 1ID3D 1H3OB 4LD9A 4LD9C 3AZLC 3MVDA 4UPKA 5AV5A 4J8UB 3AV2D 3NQUA 2VQRA 3KXBA 4J8UC 4HGAB 4J8WA 2NZDD 1M18D 4ZUXA 3REHA 5AVCA 1P3KA 3AV1D 4HGAC 3AZFB 3AZHD 3WTPB 1P34A 1KX3D 4WU8C 1JFIA 4X23B 1Q9CA 5FUGB 4YM6D 3WTPC 4Z66D 3LZ1D 2G5HC 5CP6A 3AZEB 3WAAD 3C1BB 4UUZB 5CP6C 3O62D 4G92B 5GT3D 3UT9B 1KX4A 1KX4C 3H0LC 3AZEC 3C1BC 1TZYA 3MVDD 5AV5D 4CAYA 1TZYC 1P3BD 1S32A 2BG1A 4XUJA 1PZRA 4AWLB 3AFAD 4XUJC 2DF4C 3X1VD 1ZLAB 5B32B 4WNNB 5KDMB 3KXBD 4J8WD 3NQJA 2Y2OA 3H0RC 4H9NA 5AV6C 3VH6A 3REHD 1P3AC 2F2AC 1P3KD 2AROA 3X1SA 1M1AA 2LY8A 2AROC 3X1SC 1F1EA 3AZKD 3REKB 5GT0A 3UTBA 5BNVB 5JA4A 4H9OB 5GT0C 2RIQA 3REJA 4H9RA 5B2JB 3KWQD 3AYWD 5F99A 5B0ZA 1F66A 1BH9B 5B0ZC 5AY8D 5F99C 1F66C 5JRGA 4R8PA 1N1JA 2PYOB 5JRGC 3AZIA 1W2EA 5DNNB 5B0YA 1AOIA 3AZIC 5B2JC 1P3OA 5B0YC 1AOIC 1S32D 4DRBA 4JJND 3AN2D 1EQZB 2BYMA 4YS3B 3B6GB 5DNNC 3KUYB 5CPKB 5E5AD 3MGPB 4CSRB 1U35A 5B40A 4J8XB 1KX5B 1P3LB 5B1MA 4QLCB 4WU9A 5B40C 1P3MC 3B6GC 2FFFB 5B1MC 5DNMB 4WU9C 3AL0C 5CPKC 2Y2PA 2ZY2A 1M1AD 4J8XC 3MNNB 4EO5B 4QLCC 3EPLA 5B1LA 5B31C 3UTBD 2FJ7B 3MNNC 5B2IB 4KHAA 1P3IB 3R45B 5CPIB 3X1TB 1HQ3A 3AZJA 1ID3A 1HQ3C 1ID3C 1P3OD 3AZGA 2YFVB 5AVBB 3AV2A 3W97D 4Z5TB 3AV2C 4KUDA 5GSUA 2NZDA 1M18A 2DQNC 3C1CB 1M18C 3X1UB 3AV1A 3MGQD 3AZHA 3B6FD 1BFMA 3AZHC 1KX3C 2CV5A 5B1LD 1KU5A 2Y2LA 4KGCA 5G49A 3MGSD 4YM6A 4Z66A 3LZ1A 4YM6C 1P3PB 4Z66C 3LZ1C 3WAAA 3AZLB 4LD9B 3WAAC 3O62A 5GT3A 3O62C 3MVDB 5AV5B 5GT3C 5GXQD 5AV9A 3UTAA 1P3GD 3NQUB 2Y2KA 3AZGD 1P3BA 3FDDA 3MVDC 5AV5C 1P3BC 3AFAA 3LELA 3X1VA 5BNXA 3AFAC 4ZUXB 4KUDD 3X1VC 3REHB 3REID 3B0CT 3B0BA 5AVCB 5GSUD 3KXBC 2F8NH 1P3KB 3AZNA 4J8VD 4J8WC 1P34B 4WU8B 3A6NA 4ZUXC 1JFIB 2L5AA 3REHC 3H0MC 5AVCC 1P3KC 1P34C 3A1KA 3AZKA 2CV5D 3EG5B 5CP6B 3AZKC 2ZY4A 4KGCD 3AZMD 3LZ0A 2BYKA 2Y2HA 1KX4B 3KWQA 3AYWA 3KWQC 1TZYB 3W99D 5BT1D 5AY8A 3AYWC 2IO5B 1R4VA 4CAYB 5AY8C 1S32B 4XUJB 5AV9D 3UTAD 1M19D 1BH8A 3VH5T 2IO5C 4NE3A 4JJNA 3AN2A 2NQBD 1S32C 4JJNC 2JSSA 4WV4B 5AV6B 3NQJB 3LELD 2HIOD 4H9NB 1P3AB 3WA9D 5B32G 5E5AA 5E5AC 3AZND 2AROB 3X1SB 1M1AB 3A6ND 3LJAA 3B0CW 5FUGA 5GT0B 5B33A 2Y2IA 5JA4B 3W96D 3REJB 1M1AC 5CHLB 3P5JB 4ZBJB 3W98A 5B0ZB 5F99B 1F66B 3UTBC 4H9QA 3EPJA 5JRGB 1B6WA 1N1JB 4R8PB 3LZ0D 3REJC 1P3FD 3EPKA 3AZIB 4ZBJC 5B0YB 1AOIB 1P3OB 4R8PC 5B24A 2BYMB 1P3OC 3RELA 4H9SA 3W97A 1P3MB 1U35B 5B40B 5B1MB 4WU9B 3W97C 3VH5W 2RVQD 1TAFA 3F6TA 3AZFD 1T3UA 5AV8A 4X23D 1U35C 3LJAD 3REKA 5B31B 2Y2MA 5B33D 3B6FA 3MGQA 2ZM5A 3B6FC 3MGQC 5BO0A 2F8NG 2Y2JA 5B1LC 3W98D 4KHAB 3MGSA 3UT9D 1B67A 3MGSC 5CPJA 1HQ3B 3AZJB 1ID3B 3WKJA 1EQZA 1WWSA 5B24D 1ULYA 5GXQA 3AV2B 1ZLAD 3AZJC 1P3GA 2JE5A 5B32D 1P3GC 3RELD 3AZGC 2XD5A 4NE6A 5GSUB 2NZDB 1M18B 2G5IC 3TU4A 4KUDC 3REIA 3REIC 4XZQA 5AV8D 5BS7A 5GSUC 4J8VA 3AZHB 3AV1B 1KX3B 5BS7C 4J8VC 2F8NA 2NZDC 3A1IA 3REKD 4KGCB 3AV1C 5G49B 4YM6B 4Z66B 3LZ1B 4Z2MG 5B2IA 3MGRA 2CV5C 3WAAB 3O62B 2PYOD 5GT3B 3AZMA 4KGCC 5CPJD 3AZMC 5DNND 3WKJD 3VH6W 5AV9B 3UTAB 3W99A 1EQZD 1P3BB 3W99C 5BT1C 4YS3D 2JCHA 3B6GD 3AFAB 5AV9C 3LELB 3UTAC 5BNXB 3X1VB 2YFWA 1M19A 3KUYD 5CPKD 3MGPD 2F8NK 1M19C 3KXBB 2UWXA 2NQBA 4J8WB 1KX5D 4H9PA 3C1CA 4QLCD 2HIOA 3TU4D 3AZNB 1P3LD 3WA9A 5DNMD 3LELC 2HIOC 3A6NB 3WA9C 4E45A 4XZQD 3V9RA 3AZNC 2F8ND 3A6NC 3AZKB 3VH5A 3EPHA 1A7WA 3W96A 2FJ7D 4G91B 3W96C 3LZ0B 2BYKB 5B2ID 3KSYA 3MGRD 3KWQB 1P3ID 3AYWB 4DQYB 5CPID 3X1TD 5AY8B 1Z2CB 2CWEA 1P3FA 4G91C 1H3OA 3LZ0C 1P3FC 4J8UA 5AVBD 1BH8B 1HTAA 4JJNB 3AN2B 5C3IB 4Z5TD 5E5AB 3AN2C 5C3IC 3C1CD 4WU8A 2Y2GA 4NE5A 3LJAB 3X1UD 3AZFA 2RVQC 5B33B 3WTPA 4Z2MH 4DRAA 3AZFC 2J8PA 4X23A 2W8SA 4X23C 3LJAC 4M6BA 3UTBB 3W98B 5B33C 4H9QB 1P3PD 3AZEA 4LD9D 3AZLD 4H9RB 4UUZA 3C1BA 3W98C 4G92C 3UT9A 3UT9C 5B24B 4J8UD 2NQBC 3RELB 4NFTA 5AV6A 1ZLAA 4AWLC 5B24C 4ZUXD 5B32A 1P3AA 4WNNA 4WZSB 1ZLAC 5KDMA 3W97B 5B32C 5AVCD 3RELC 1TAFB 4H9SC 1P34D 4WU8D 5AV8B 2ZY3A 3WTPD 3B6FB 3MGQB 5AV8C 5BO0B 5CP6D 5B31G 5B1LB 5BNVA 3REKC 4H9OA 3MGSB 1KX4D
chains in the Genus database with same CATH topology
3AZED 5CPJB 5B2JA 3C1BD 3VH6T 3WKJB 1BH9A 1TZYD 2PYOA 2PYOC 4XUJD 5DNNA 5CPJC 5GXQB 3IP4C 3WKJC 1P3GB 2ZY5A 3AZGB 1EQZC 4YS3A 5AV6D 3B6GA 4YS3C 1P3MA 1P3AD 5GXQC 3TU4B 4KUDB 3KUYA 5CPKA 3MGPA 4CSRA 3REIB 3KUYC 3MGPC 2AROD 4XZQB 3X1SD 4J8XA 4QLCA 3WTPE 4J8VB 1P3LA 1KX5A 1KX5C 5DNMA 1P3LC 2F8NB 3TU4C 5B31A 5DNMC 5GT0D 4E44A 3REJD 2Y2NA 4XZQC 3MNNA 3B0DB 4EO5C 2CV5B 3MGRB 5F99D 5B0ZD 1F66D 5JRGD 4R8PD 3AZMB 2FJ7A 3B0DC 2FJ7C 3AZID 5B2JD 2Y2QA 1AOID 5B0YD 5B2IC 1P3IA 3MGRC 3R45A 1P3IC 5CPIA 3W99B 3X1TA 2XD1A 5CPIC 3X1TC 4WJ3C 2YFVA 2YFWB 1M19B 5AVBA 5AVBC 2NQBB 4Z5TA 1U35D 5B40D 1P3MD 2HUEB 4H9PB 5B1MD 2HIOB 4Z5TC 4WU9D 3WA9B 4J8XD 1KX3A 2HUEC 3V9RB 3C1CC 5B31D 3X1UA 3X1UC 3MNND 3W96B 1WWIA 3KFUG 1P3PA 1HQ3D 3AZJD 1P3FB 3AZLA 1P3PC 1ID3D 1H3OB 4LD9A 4LD9C 3AZLC 3MVDA 4UPKA 5AV5A 4J8UB 3AV2D 3NQUA 2VQRA 3KXBA 4J8UC 4HGAB 4J8WA 2NZDD 1M18D 4ZUXA 3REHA 5AVCA 1P3KA 3AV1D 4HGAC 3AZFB 3AZHD 3WTPB 1P34A 1KX3D 4WU8C 1JFIA 4X23B 1Q9CA 5FUGB 4YM6D 3WTPC 4Z66D 3LZ1D 2G5HC 5CP6A 3AZEB 3WAAD 3C1BB 4UUZB 5CP6C 3O62D 4G92B 5GT3D 3UT9B 1KX4A 1KX4C 3H0LC 3AZEC 3C1BC 1TZYA 3MVDD 5AV5D 4CAYA 1TZYC 1P3BD 1S32A 2BG1A 4XUJA 1PZRA 4AWLB 3AFAD 4XUJC 2DF4C 3X1VD 1ZLAB 5B32B 4WNNB 5KDMB 3KXBD 4J8WD 3NQJA 2Y2OA 3H0RC 4H9NA 5AV6C 3VH6A 3REHD 1P3AC 2F2AC 1P3KD 2AROA 3X1SA 1M1AA 2LY8A 2AROC 3X1SC 1F1EA 3AZKD 3REKB 5GT0A 3UTBA 5BNVB 5JA4A 4H9OB 5GT0C 2RIQA 3REJA 4H9RA 5B2JB 3KWQD 3AYWD 5F99A 5B0ZA 1F66A 1BH9B 5B0ZC 5AY8D 5F99C 1F66C 5JRGA 4R8PA 1N1JA 2PYOB 5JRGC 3AZIA 1W2EA 5DNNB 5B0YA 1AOIA 3AZIC 5B2JC 1P3OA 5B0YC 1AOIC 1S32D 4DRBA 4JJND 3AN2D 1EQZB 2BYMA 4YS3B 3B6GB 5DNNC 3KUYB 5CPKB 5E5AD 3MGPB 4CSRB 1U35A 5B40A 4J8XB 1KX5B 1P3LB 5B1MA 4QLCB 4WU9A 5B40C 1P3MC 3B6GC 2FFFB 5B1MC 5DNMB 4WU9C 3AL0C 5CPKC 2Y2PA 2ZY2A 1M1AD 4J8XC 3MNNB 4EO5B 4QLCC 3EPLA 5B1LA 5B31C 3UTBD 2FJ7B 3MNNC 5B2IB 4KHAA 1P3IB 3R45B 5CPIB 3X1TB 1HQ3A 3AZJA 1ID3A 1HQ3C 1ID3C 1P3OD 3AZGA 2YFVB 5AVBB 3AV2A 3W97D 4Z5TB 3AV2C 4KUDA 5GSUA 2NZDA 1M18A 2DQNC 3C1CB 1M18C 3X1UB 3AV1A 3MGQD 3AZHA 3B6FD 1BFMA 3AZHC 1KX3C 2CV5A 5B1LD 1KU5A 2Y2LA 4KGCA 5G49A 3MGSD 4YM6A 4Z66A 3LZ1A 4YM6C 1P3PB 4Z66C 3LZ1C 3WAAA 3AZLB 4LD9B 3WAAC 3O62A 5GT3A 3O62C 3MVDB 5AV5B 5GT3C 5GXQD 5AV9A 3UTAA 1P3GD 3NQUB 2Y2KA 3AZGD 1P3BA 3FDDA 3MVDC 5AV5C 1P3BC 3AFAA 3LELA 3X1VA 5BNXA 3AFAC 4ZUXB 4KUDD 3X1VC 3REHB 3REID 3B0CT 3B0BA 5AVCB 5GSUD 3KXBC 2F8NH 1P3KB 3AZNA 4J8VD 4J8WC 1P34B 4WU8B 3A6NA 4ZUXC 1JFIB 2L5AA 3REHC 3H0MC 5AVCC 1P3KC 1P34C 3A1KA 3AZKA 2CV5D 3EG5B 5CP6B 3AZKC 2ZY4A 4KGCD 3AZMD 3LZ0A 2BYKA 2Y2HA 1KX4B 3KWQA 3AYWA 3KWQC 1TZYB 3W99D 5BT1D 5AY8A 3AYWC 2IO5B 1R4VA 4CAYB 5AY8C 1S32B 4XUJB 5AV9D 3UTAD 1M19D 1BH8A 3VH5T 2IO5C 4NE3A 4JJNA 3AN2A 2NQBD 1S32C 4JJNC 2JSSA 4WV4B 5AV6B 3NQJB 3LELD 2HIOD 4H9NB 1P3AB 3WA9D 5B32G 5E5AA 5E5AC 3AZND 2AROB 3X1SB 1M1AB 3A6ND 3LJAA 3B0CW 5FUGA 5GT0B 5B33A 2Y2IA 5JA4B 3W96D 3REJB 1M1AC 5CHLB 3P5JB 4ZBJB 3W98A 5B0ZB 5F99B 1F66B 3UTBC 4H9QA 3EPJA 5JRGB 1B6WA 1N1JB 4R8PB 3LZ0D 3REJC 1P3FD 3EPKA 3AZIB 4ZBJC 5B0YB 1AOIB 1P3OB 4R8PC 5B24A 2BYMB 1P3OC 3RELA 4H9SA 3W97A 1P3MB 1U35B 5B40B 5B1MB 4WU9B 3W97C 3VH5W 2RVQD 1TAFA 3F6TA 3AZFD 1T3UA 5AV8A 4X23D 1U35C 3LJAD 3REKA 5B31B 2Y2MA 5B33D 3B6FA 3MGQA 2ZM5A 3B6FC 3MGQC 5BO0A 2F8NG 2Y2JA 5B1LC 3W98D 4KHAB 3MGSA 3UT9D 1B67A 3MGSC 5CPJA 1HQ3B 3AZJB 1ID3B 3WKJA 1EQZA 1WWSA 5B24D 1ULYA 5GXQA 3AV2B 1ZLAD 3AZJC 1P3GA 2JE5A 5B32D 1P3GC 3RELD 3AZGC 2XD5A 4NE6A 5GSUB 2NZDB 1M18B 2G5IC 3TU4A 4KUDC 3REIA 3REIC 4XZQA 5AV8D 5BS7A 5GSUC 4J8VA 3AZHB 3AV1B 1KX3B 5BS7C 4J8VC 2F8NA 2NZDC 3A1IA 3REKD 4KGCB 3AV1C 5G49B 4YM6B 4Z66B 3LZ1B 4Z2MG 5B2IA 3MGRA 2CV5C 3WAAB 3O62B 2PYOD 5GT3B 3AZMA 4KGCC 5CPJD 3AZMC 5DNND 3WKJD 3VH6W 5AV9B 3UTAB 3W99A 1EQZD 1P3BB 3W99C 5BT1C 4YS3D 2JCHA 3B6GD 3AFAB 5AV9C 3LELB 3UTAC 5BNXB 3X1VB 2YFWA 1M19A 3KUYD 5CPKD 3MGPD 2F8NK 1M19C 3KXBB 2UWXA 2NQBA 4J8WB 1KX5D 4H9PA 3C1CA 4QLCD 2HIOA 3TU4D 3AZNB 1P3LD 3WA9A 5DNMD 3LELC 2HIOC 3A6NB 3WA9C 4E45A 4XZQD 3V9RA 3AZNC 2F8ND 3A6NC 3AZKB 3VH5A 3EPHA 1A7WA 3W96A 2FJ7D 4G91B 3W96C 3LZ0B 2BYKB 5B2ID 3KSYA 3MGRD 3KWQB 1P3ID 3AYWB 4DQYB 5CPID 3X1TD 5AY8B 1Z2CB 2CWEA 1P3FA 4G91C 1H3OA 3LZ0C 1P3FC 4J8UA 5AVBD 1BH8B 1HTAA 4JJNB 3AN2B 5C3IB 4Z5TD 5E5AB 3AN2C 5C3IC 3C1CD 4WU8A 2Y2GA 4NE5A 3LJAB 3X1UD 3AZFA 2RVQC 5B33B 3WTPA 4Z2MH 4DRAA 3AZFC 2J8PA 4X23A 2W8SA 4X23C 3LJAC 4M6BA 3UTBB 3W98B 5B33C 4H9QB 1P3PD 3AZEA 4LD9D 3AZLD 4H9RB 4UUZA 3C1BA 3W98C 4G92C 3UT9A 3UT9C 5B24B 4J8UD 2NQBC 3RELB 4NFTA 5AV6A 1ZLAA 4AWLC 5B24C 4ZUXD 5B32A 1P3AA 4WNNA 4WZSB 1ZLAC 5KDMA 3W97B 5B32C 5AVCD 3RELC 1TAFB 4H9SC 1P34D 4WU8D 5AV8B 2ZY3A 3WTPD 3B6FB 3MGQB 5AV8C 5BO0B 5CP6D 5B31G 5B1LB 5BNVA 3REKC 4H9OA 3MGSB 1KX4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE D;  5CPJ B;  5B2J A;  3C1B D;  3VH6 T;  3WKJ B;  1BH9 A;  1TZY D;  2PYO A;  2PYO C;  4XUJ D;  5DNN A;  5CPJ C;  5GXQ B;  3WKJ C;  1P3G B;  3AZG B;  1EQZ C;  4YS3 A;  5AV6 D;  3B6G A;  4YS3 C;  1P3M A;  1P3A D;  5GXQ C;  3TU4 B;  4KUD B;  3KUY A;  5CPK A;  3MGP A;  4CSR A;  3REI B;  3KUY C;  3MGP C;  2ARO D;  4XZQ B;  3X1S D;  4J8X A;  3WTP E;  4QLC A;  4J8V B;  1P3L A;  1KX5 A;  1KX5 C;  5DNM A;  1P3L C;  2F8N B;  3TU4 C;  5B31 A;  5DNM C;  5GT0 D;  4E44 A;  3REJ D;  4XZQ C;  3MNN A;  3B0D B;  4EO5 C;  2CV5 B;  3MGR B;  5F99 D;  5B0Z D;  1F66 D;  5JRG D;  4R8P D;  3AZM B;  2FJ7 A;  3B0D C;  2FJ7 C;  3AZI D;  5B2J D;  1AOI D;  5B0Y D;  5B2I C;  1P3I A;  3MGR C;  3R45 A;  1P3I C;  5CPI A;  3W99 B;  3X1T A;  5CPI C;  3X1T C;  2YFV A;  2YFW B;  1M19 B;  5AVB A;  5AVB C;  2NQB B;  4Z5T A;  1U35 D;  5B40 D;  1P3M D;  2HUE B;  4H9P B;  5B1M D;  2HIO B;  4Z5T C;  4WU9 D;  3WA9 B;  4J8X D;  1KX3 A;  2HUE C;  3V9R B;  3C1C C;  5B31 D;  3X1U A;  3X1U C;  3MNN D;  3W96 B;  1WWI A;  1P3P A;  1HQ3 D;  3AZJ D;  1P3F B;  3AZL A;  1P3P C;  1ID3 D;  1H3O B;  4LD9 A;  4LD9 C;  3AZL C;  3MVD A;  5AV5 A;  4J8U B;  3AV2 D;  3NQU A;  3KXB A;  4J8U C;  4HGA B;  4J8W A;  2NZD D;  1M18 D;  4ZUX A;  3REH A;  5AVC A;  1P3K A;  3AV1 D;  4HGA C;  3AZF B;  3AZH D;  3WTP B;  1P34 A;  1KX3 D;  4WU8 C;  1JFI A;  4X23 B;  1Q9C A;  5FUG B;  4YM6 D;  3WTP C;  4Z66 D;  3LZ1 D;  5CP6 A;  3AZE B;  3WAA D;  3C1B B;  4UUZ B;  5CP6 C;  3O62 D;  4G92 B;  5GT3 D;  3UT9 B;  1KX4 A;  1KX4 C;  3AZE C;  3C1B C;  1TZY A;  3MVD D;  5AV5 D;  4CAY A;  1TZY C;  1P3B D;  1S32 A;  4XUJ A;  4AWL B;  3AFA D;  4XUJ C;  3X1V D;  1ZLA B;  5B32 B;  4WNN B;  5KDM B;  3KXB D;  4J8W D;  3NQJ A;  4H9N A;  5AV6 C;  3VH6 A;  3REH D;  1P3A C;  1P3K D;  2ARO A;  3X1S A;  1M1A A;  2LY8 A;  2ARO C;  3X1S C;  1F1E A;  3AZK D;  3REK B;  5GT0 A;  3UTB A;  5BNV B;  5JA4 A;  4H9O B;  5GT0 C;  3REJ A;  4H9R A;  5B2J B;  3KWQ D;  3AYW D;  5F99 A;  5B0Z A;  1F66 A;  1BH9 B;  5B0Z C;  5AY8 D;  5F99 C;  1F66 C;  5JRG A;  4R8P A;  1N1J A;  2PYO B;  5JRG C;  3AZI A;  5DNN B;  5B0Y A;  1AOI A;  3AZI C;  5B2J C;  1P3O A;  5B0Y C;  1AOI C;  1S32 D;  4DRB A;  4JJN D;  3AN2 D;  1EQZ B;  2BYM A;  4YS3 B;  3B6G B;  5DNN C;  3KUY B;  5CPK B;  5E5A D;  3MGP B;  4CSR B;  1U35 A;  5B40 A;  4J8X B;  1KX5 B;  1P3L B;  5B1M A;  4QLC B;  4WU9 A;  5B40 C;  1P3M C;  3B6G C;  5DNM B;  5B1M C;  4WU9 C;  5CPK C;  1M1A D;  4J8X C;  3MNN B;  4EO5 B;  4QLC C;  5B1L A;  5B31 C;  3UTB D;  2FJ7 B;  3MNN C;  5B2I B;  4KHA A;  1P3I B;  3R45 B;  5CPI B;  3X1T B;  1HQ3 A;  3AZJ A;  1ID3 A;  1HQ3 C;  1ID3 C;  1P3O D;  3AZG A;  2YFV B;  5AVB B;  3AV2 A;  3W97 D;  4Z5T B;  3AV2 C;  4KUD A;  5GSU A;  2NZD A;  1M18 A;  3C1C B;  1M18 C;  3X1U B;  3AV1 A;  3MGQ D;  3AZH A;  3B6F D;  1BFM A;  3AZH C;  1KX3 C;  2CV5 A;  5B1L D;  1KU5 A;  4KGC A;  5G49 A;  3MGS D;  4YM6 A;  4Z66 A;  3LZ1 A;  4YM6 C;  1P3P B;  4Z66 C;  3LZ1 C;  3WAA A;  3AZL B;  4LD9 B;  3WAA C;  3O62 A;  5GT3 A;  3O62 C;  3MVD B;  5AV5 B;  5GT3 C;  5GXQ D;  5AV9 A;  3UTA A;  1P3G D;  3NQU B;  3AZG D;  1P3B A;  3MVD C;  5AV5 C;  1P3B C;  3AFA A;  3LEL A;  3X1V A;  5BNX A;  3AFA C;  4ZUX B;  4KUD D;  3X1V C;  3REH B;  3REI D;  3B0C T;  3B0B A;  5AVC B;  5GSU D;  3KXB C;  2F8N H;  1P3K B;  3AZN A;  4J8V D;  4J8W C;  1P34 B;  4WU8 B;  3A6N A;  4ZUX C;  1JFI B;  2L5A A;  3REH C;  5AVC C;  1P3K C;  1P34 C;  3AZK A;  2CV5 D;  5CP6 B;  3AZK C;  4KGC D;  3AZM D;  3LZ0 A;  2BYK A;  1KX4 B;  3KWQ A;  3AYW A;  3KWQ C;  1TZY B;  3W99 D;  5BT1 D;  5AY8 A;  3AYW C;  2IO5 B;  1R4V A;  4CAY B;  5AY8 C;  1S32 B;  4XUJ B;  5AV9 D;  3UTA D;  1M19 D;  1BH8 A;  3VH5 T;  2IO5 C;  4NE3 A;  4JJN A;  3AN2 A;  2NQB D;  1S32 C;  4JJN C;  2JSS A;  4WV4 B;  5AV6 B;  3NQJ B;  3LEL D;  2HIO D;  4H9N B;  1P3A B;  3WA9 D;  5B32 G;  5E5A A;  5E5A C;  3AZN D;  2ARO B;  3X1S B;  1M1A B;  3A6N D;  3LJA A;  3B0C W;  5FUG A;  5GT0 B;  5B33 A;  5JA4 B;  3W96 D;  3REJ B;  1M1A C;  5CHL B;  4ZBJ B;  3W98 A;  5B0Z B;  5F99 B;  1F66 B;  3UTB C;  4H9Q A;  5JRG B;  1B6W A;  1N1J B;  4R8P B;  3LZ0 D;  3REJ C;  1P3F D;  3AZI B;  4ZBJ C;  5B0Y B;  1AOI B;  1P3O B;  4R8P C;  5B24 A;  2BYM B;  1P3O C;  3REL A;  4H9S A;  3W97 A;  1P3M B;  1U35 B;  5B40 B;  5B1M B;  4WU9 B;  3W97 C;  3VH5 W;  2RVQ D;  1TAF A;  3AZF D;  5AV8 A;  4X23 D;  1U35 C;  3LJA D;  3REK A;  5B31 B;  5B33 D;  3B6F A;  3MGQ A;  3B6F C;  3MGQ C;  5BO0 A;  2F8N G;  5B1L C;  3W98 D;  4KHA B;  3MGS A;  3UT9 D;  1B67 A;  3MGS C;  5CPJ A;  1HQ3 B;  3AZJ B;  1ID3 B;  3WKJ A;  1EQZ A;  1WWS A;  5B24 D;  1ULY A;  5GXQ A;  3AV2 B;  1ZLA D;  3AZJ C;  1P3G A;  5B32 D;  1P3G C;  3REL D;  3AZG C;  4NE6 A;  5GSU B;  2NZD B;  1M18 B;  3TU4 A;  4KUD C;  3REI A;  3REI C;  4XZQ A;  5AV8 D;  5BS7 A;  5GSU C;  4J8V A;  3AZH B;  3AV1 B;  1KX3 B;  5BS7 C;  4J8V C;  2F8N A;  2NZD C;  3REK D;  4KGC B;  3AV1 C;  5G49 B;  4YM6 B;  4Z66 B;  3LZ1 B;  4Z2M G;  5B2I A;  3MGR A;  2CV5 C;  3WAA B;  3O62 B;  2PYO D;  5GT3 B;  3AZM A;  4KGC C;  5CPJ D;  3AZM C;  5DNN D;  3WKJ D;  3VH6 W;  5AV9 B;  3UTA B;  3W99 A;  1EQZ D;  1P3B B;  3W99 C;  5BT1 C;  4YS3 D;  3B6G D;  3AFA B;  5AV9 C;  3LEL B;  3UTA C;  5BNX B;  3X1V B;  2YFW A;  1M19 A;  3KUY D;  5CPK D;  3MGP D;  2F8N K;  1M19 C;  3KXB B;  2NQB A;  4J8W B;  1KX5 D;  4H9P A;  3C1C A;  4QLC D;  2HIO A;  3TU4 D;  3AZN B;  1P3L D;  3WA9 A;  5DNM D;  3LEL C;  2HIO C;  3A6N B;  3WA9 C;  4E45 A;  4XZQ D;  3V9R A;  3AZN C;  2F8N D;  3A6N C;  3AZK B;  3VH5 A;  1A7W A;  3W96 A;  2FJ7 D;  4G91 B;  3W96 C;  3LZ0 B;  2BYK B;  5B2I D;  3KSY A;  3MGR D;  3KWQ B;  1P3I D;  3AYW B;  5CPI D;  3X1T D;  5AY8 B;  2CWE A;  1P3F A;  4G91 C;  1H3O A;  3LZ0 C;  1P3F C;  4J8U A;  5AVB D;  1BH8 B;  1HTA A;  4JJN B;  3AN2 B;  5C3I B;  4Z5T D;  5E5A B;  3AN2 C;  5C3I C;  3C1C D;  4WU8 A;  4NE5 A;  3LJA B;  3X1U D;  3AZF A;  2RVQ C;  5B33 B;  3WTP A;  4Z2M H;  4DRA A;  3AZF C;  4X23 A;  4X23 C;  3LJA C;  4M6B A;  3UTB B;  3W98 B;  5B33 C;  4H9Q B;  1P3P D;  3AZE A;  4LD9 D;  3AZL D;  4H9R B;  4UUZ A;  3C1B A;  3W98 C;  4G92 C;  3UT9 A;  3UT9 C;  5B24 B;  4J8U D;  2NQB C;  3REL B;  4NFT A;  5AV6 A;  1ZLA A;  4AWL C;  5B24 C;  4ZUX D;  5B32 A;  1P3A A;  4WNN A;  4WZS B;  1ZLA C;  5KDM A;  3W97 B;  5B32 C;  5AVC D;  3REL C;  1TAF B;  4H9S C;  1P34 D;  4WU8 D;  5AV8 B;  3WTP D;  3B6F B;  3MGQ B;  5AV8 C;  5BO0 B;  5CP6 D;  5B31 G;  5B1L B;  5BNV A;  3REK C;  4H9O A;  3MGS B;  1KX4 D; 
#chains in the Genus database with same CATH topology
 3AZE D;  5CPJ B;  5B2J A;  3C1B D;  3VH6 T;  3WKJ B;  1BH9 A;  1TZY D;  2PYO A;  2PYO C;  4XUJ D;  5DNN A;  5CPJ C;  5GXQ B;  3IP4 C;  3WKJ C;  1P3G B;  2ZY5 A;  3AZG B;  1EQZ C;  4YS3 A;  5AV6 D;  3B6G A;  4YS3 C;  1P3M A;  1P3A D;  5GXQ C;  3TU4 B;  4KUD B;  3KUY A;  5CPK A;  3MGP A;  4CSR A;  3REI B;  3KUY C;  3MGP C;  2ARO D;  4XZQ B;  3X1S D;  4J8X A;  4QLC A;  3WTP E;  4J8V B;  1P3L A;  1KX5 A;  1KX5 C;  5DNM A;  1P3L C;  2F8N B;  3TU4 C;  5B31 A;  5DNM C;  5GT0 D;  4E44 A;  3REJ D;  2Y2N A;  4XZQ C;  3MNN A;  3B0D B;  4EO5 C;  2CV5 B;  3MGR B;  5F99 D;  5B0Z D;  1F66 D;  5JRG D;  4R8P D;  3AZM B;  2FJ7 A;  3B0D C;  2FJ7 C;  3AZI D;  5B2J D;  2Y2Q A;  1AOI D;  5B0Y D;  5B2I C;  1P3I A;  3MGR C;  3R45 A;  1P3I C;  5CPI A;  3W99 B;  3X1T A;  2XD1 A;  5CPI C;  3X1T C;  4WJ3 C;  2YFV A;  2YFW B;  1M19 B;  5AVB A;  5AVB C;  2NQB B;  4Z5T A;  1U35 D;  5B40 D;  1P3M D;  2HUE B;  4H9P B;  5B1M D;  2HIO B;  4Z5T C;  4WU9 D;  3WA9 B;  4J8X D;  1KX3 A;  2HUE C;  3V9R B;  3C1C C;  5B31 D;  3X1U A;  3X1U C;  3MNN D;  3W96 B;  1WWI A;  3KFU G;  1P3P A;  1HQ3 D;  3AZJ D;  1P3F B;  3AZL A;  1P3P C;  1ID3 D;  1H3O B;  4LD9 A;  4LD9 C;  3AZL C;  3MVD A;  4UPK A;  5AV5 A;  4J8U B;  3AV2 D;  3NQU A;  2VQR A;  3KXB A;  4J8U C;  4HGA B;  4J8W A;  2NZD D;  1M18 D;  4ZUX A;  3REH A;  5AVC A;  1P3K A;  3AV1 D;  4HGA C;  3AZF B;  3AZH D;  3WTP B;  1P34 A;  1KX3 D;  4WU8 C;  1JFI A;  4X23 B;  1Q9C A;  5FUG B;  4YM6 D;  3WTP C;  4Z66 D;  3LZ1 D;  2G5H C;  5CP6 A;  3AZE B;  3WAA D;  3C1B B;  4UUZ B;  5CP6 C;  3O62 D;  4G92 B;  5GT3 D;  3UT9 B;  1KX4 A;  1KX4 C;  3H0L C;  3AZE C;  3C1B C;  1TZY A;  3MVD D;  5AV5 D;  4CAY A;  1TZY C;  1P3B D;  1S32 A;  2BG1 A;  4XUJ A;  1PZR A;  4AWL B;  3AFA D;  4XUJ C;  2DF4 C;  3X1V D;  1ZLA B;  5B32 B;  4WNN B;  5KDM B;  3KXB D;  4J8W D;  3NQJ A;  2Y2O A;  3H0R C;  4H9N A;  5AV6 C;  3VH6 A;  3REH D;  1P3A C;  2F2A C;  1P3K D;  2ARO A;  3X1S A;  1M1A A;  2LY8 A;  2ARO C;  3X1S C;  1F1E A;  3AZK D;  3REK B;  5GT0 A;  3UTB A;  5BNV B;  5JA4 A;  4H9O B;  5GT0 C;  2RIQ A;  3REJ A;  4H9R A;  5B2J B;  3KWQ D;  3AYW D;  5F99 A;  5B0Z A;  1F66 A;  1BH9 B;  5B0Z C;  5AY8 D;  5F99 C;  1F66 C;  5JRG A;  4R8P A;  1N1J A;  2PYO B;  5JRG C;  3AZI A;  1W2E A;  5DNN B;  5B0Y A;  1AOI A;  3AZI C;  5B2J C;  1P3O A;  5B0Y C;  1AOI C;  1S32 D;  4DRB A;  4JJN D;  3AN2 D;  1EQZ B;  2BYM A;  4YS3 B;  3B6G B;  5DNN C;  3KUY B;  5CPK B;  5E5A D;  3MGP B;  4CSR B;  1U35 A;  5B40 A;  4J8X B;  1KX5 B;  1P3L B;  5B1M A;  4QLC B;  4WU9 A;  5B40 C;  1P3M C;  3B6G C;  2FFF B;  5B1M C;  5DNM B;  4WU9 C;  3AL0 C;  5CPK C;  2Y2P A;  2ZY2 A;  1M1A D;  4J8X C;  3MNN B;  4EO5 B;  4QLC C;  3EPL A;  5B1L A;  5B31 C;  3UTB D;  2FJ7 B;  3MNN C;  5B2I B;  4KHA A;  1P3I B;  3R45 B;  5CPI B;  3X1T B;  1HQ3 A;  3AZJ A;  1ID3 A;  1HQ3 C;  1ID3 C;  1P3O D;  3AZG A;  2YFV B;  5AVB B;  3AV2 A;  3W97 D;  4Z5T B;  3AV2 C;  4KUD A;  5GSU A;  2NZD A;  1M18 A;  2DQN C;  3C1C B;  1M18 C;  3X1U B;  3AV1 A;  3MGQ D;  3AZH A;  3B6F D;  1BFM A;  3AZH C;  1KX3 C;  2CV5 A;  5B1L D;  1KU5 A;  2Y2L A;  4KGC A;  5G49 A;  3MGS D;  4YM6 A;  4Z66 A;  3LZ1 A;  4YM6 C;  1P3P B;  4Z66 C;  3LZ1 C;  3WAA A;  3AZL B;  4LD9 B;  3WAA C;  3O62 A;  5GT3 A;  3O62 C;  3MVD B;  5AV5 B;  5GT3 C;  5GXQ D;  5AV9 A;  3UTA A;  1P3G D;  3NQU B;  2Y2K A;  3AZG D;  1P3B A;  3FDD A;  3MVD C;  5AV5 C;  1P3B C;  3AFA A;  3LEL A;  3X1V A;  5BNX A;  3AFA C;  4ZUX B;  4KUD D;  3X1V C;  3REH B;  3REI D;  3B0C T;  3B0B A;  5AVC B;  5GSU D;  3KXB C;  2F8N H;  1P3K B;  3AZN A;  4J8V D;  4J8W C;  1P34 B;  4WU8 B;  3A6N A;  4ZUX C;  1JFI B;  2L5A A;  3REH C;  3H0M C;  5AVC C;  1P3K C;  1P34 C;  3A1K A;  3AZK A;  2CV5 D;  3EG5 B;  5CP6 B;  3AZK C;  2ZY4 A;  4KGC D;  3AZM D;  3LZ0 A;  2BYK A;  2Y2H A;  1KX4 B;  3KWQ A;  3AYW A;  3KWQ C;  1TZY B;  3W99 D;  5BT1 D;  5AY8 A;  3AYW C;  2IO5 B;  1R4V A;  4CAY B;  5AY8 C;  1S32 B;  4XUJ B;  5AV9 D;  3UTA D;  1M19 D;  1BH8 A;  3VH5 T;  2IO5 C;  4NE3 A;  4JJN A;  3AN2 A;  2NQB D;  1S32 C;  4JJN C;  2JSS A;  4WV4 B;  5AV6 B;  3NQJ B;  3LEL D;  2HIO D;  4H9N B;  1P3A B;  3WA9 D;  5B32 G;  5E5A A;  5E5A C;  3AZN D;  2ARO B;  3X1S B;  1M1A B;  3A6N D;  3LJA A;  3B0C W;  5FUG A;  5GT0 B;  5B33 A;  2Y2I A;  5JA4 B;  3W96 D;  3REJ B;  1M1A C;  5CHL B;  3P5J B;  4ZBJ B;  3W98 A;  5B0Z B;  5F99 B;  1F66 B;  3UTB C;  4H9Q A;  3EPJ A;  5JRG B;  1B6W A;  1N1J B;  4R8P B;  3LZ0 D;  3REJ C;  1P3F D;  3EPK A;  3AZI B;  4ZBJ C;  5B0Y B;  1AOI B;  1P3O B;  4R8P C;  5B24 A;  2BYM B;  1P3O C;  3REL A;  4H9S A;  3W97 A;  1P3M B;  1U35 B;  5B40 B;  5B1M B;  4WU9 B;  3W97 C;  3VH5 W;  2RVQ D;  1TAF A;  3F6T A;  3AZF D;  1T3U A;  5AV8 A;  4X23 D;  1U35 C;  3LJA D;  3REK A;  5B31 B;  2Y2M A;  5B33 D;  3B6F A;  3MGQ A;  2ZM5 A;  3B6F C;  3MGQ C;  5BO0 A;  2F8N G;  2Y2J A;  5B1L C;  3W98 D;  4KHA B;  3MGS A;  3UT9 D;  1B67 A;  3MGS C;  5CPJ A;  1HQ3 B;  3AZJ B;  1ID3 B;  3WKJ A;  1EQZ A;  1WWS A;  5B24 D;  1ULY A;  5GXQ A;  3AV2 B;  1ZLA D;  3AZJ C;  1P3G A;  2JE5 A;  5B32 D;  1P3G C;  3REL D;  3AZG C;  2XD5 A;  4NE6 A;  5GSU B;  2NZD B;  1M18 B;  2G5I C;  3TU4 A;  4KUD C;  3REI A;  3REI C;  4XZQ A;  5AV8 D;  5BS7 A;  5GSU C;  4J8V A;  3AZH B;  3AV1 B;  1KX3 B;  5BS7 C;  4J8V C;  2F8N A;  2NZD C;  3A1I A;  3REK D;  4KGC B;  3AV1 C;  5G49 B;  4YM6 B;  4Z66 B;  3LZ1 B;  4Z2M G;  5B2I A;  3MGR A;  2CV5 C;  3WAA B;  3O62 B;  2PYO D;  5GT3 B;  3AZM A;  4KGC C;  5CPJ D;  3AZM C;  5DNN D;  3WKJ D;  3VH6 W;  5AV9 B;  3UTA B;  3W99 A;  1EQZ D;  1P3B B;  3W99 C;  5BT1 C;  4YS3 D;  2JCH A;  3B6G D;  3AFA B;  5AV9 C;  3LEL B;  3UTA C;  5BNX B;  3X1V B;  2YFW A;  1M19 A;  3KUY D;  5CPK D;  3MGP D;  2F8N K;  1M19 C;  3KXB B;  2UWX A;  2NQB A;  4J8W B;  1KX5 D;  4H9P A;  3C1C A;  4QLC D;  2HIO A;  3TU4 D;  3AZN B;  1P3L D;  3WA9 A;  5DNM D;  3LEL C;  2HIO C;  3A6N B;  3WA9 C;  4E45 A;  4XZQ D;  3V9R A;  3AZN C;  2F8N D;  3A6N C;  3AZK B;  3VH5 A;  3EPH A;  1A7W A;  3W96 A;  2FJ7 D;  4G91 B;  3W96 C;  3LZ0 B;  2BYK B;  5B2I D;  3KSY A;  3MGR D;  3KWQ B;  1P3I D;  3AYW B;  4DQY B;  5CPI D;  3X1T D;  5AY8 B;  1Z2C B;  2CWE A;  1P3F A;  4G91 C;  1H3O A;  3LZ0 C;  1P3F C;  4J8U A;  5AVB D;  1BH8 B;  1HTA A;  4JJN B;  3AN2 B;  5C3I B;  4Z5T D;  5E5A B;  3AN2 C;  5C3I C;  3C1C D;  4WU8 A;  2Y2G A;  4NE5 A;  3LJA B;  3X1U D;  3AZF A;  2RVQ C;  5B33 B;  3WTP A;  4Z2M H;  4DRA A;  3AZF C;  2J8P A;  4X23 A;  2W8S A;  4X23 C;  3LJA C;  4M6B A;  3UTB B;  3W98 B;  5B33 C;  4H9Q B;  1P3P D;  3AZE A;  4LD9 D;  3AZL D;  4H9R B;  4UUZ A;  3C1B A;  3W98 C;  4G92 C;  3UT9 A;  3UT9 C;  5B24 B;  4J8U D;  2NQB C;  3REL B;  4NFT A;  5AV6 A;  1ZLA A;  4AWL C;  5B24 C;  4ZUX D;  5B32 A;  1P3A A;  4WNN A;  4WZS B;  1ZLA C;  5KDM A;  3W97 B;  5B32 C;  5AVC D;  3REL C;  1TAF B;  4H9S C;  1P34 D;  4WU8 D;  5AV8 B;  2ZY3 A;  3WTP D;  3B6F B;  3MGQ B;  5AV8 C;  5BO0 B;  5CP6 D;  5B31 G;  5B1L B;  5BNV A;  3REK C;  4H9O A;  3MGS B;  1KX4 D; 
#chains in the Genus database with same CATH homology
 3AZE D;  5CPJ B;  5B2J A;  3C1B D;  3VH6 T;  3WKJ B;  1BH9 A;  1TZY D;  2PYO A;  2PYO C;  4XUJ D;  5DNN A;  5CPJ C;  5GXQ B;  3IP4 C;  3WKJ C;  1P3G B;  2ZY5 A;  3AZG B;  1EQZ C;  4YS3 A;  5AV6 D;  3B6G A;  4YS3 C;  1P3M A;  1P3A D;  5GXQ C;  3TU4 B;  4KUD B;  3KUY A;  5CPK A;  3MGP A;  4CSR A;  3REI B;  3KUY C;  3MGP C;  2ARO D;  4XZQ B;  3X1S D;  4J8X A;  4QLC A;  3WTP E;  4J8V B;  1P3L A;  1KX5 A;  1KX5 C;  5DNM A;  1P3L C;  2F8N B;  3TU4 C;  5B31 A;  5DNM C;  5GT0 D;  4E44 A;  3REJ D;  2Y2N A;  4XZQ C;  3MNN A;  3B0D B;  4EO5 C;  2CV5 B;  3MGR B;  5F99 D;  5B0Z D;  1F66 D;  5JRG D;  4R8P D;  3AZM B;  2FJ7 A;  3B0D C;  2FJ7 C;  3AZI D;  5B2J D;  2Y2Q A;  1AOI D;  5B0Y D;  5B2I C;  1P3I A;  3MGR C;  3R45 A;  1P3I C;  5CPI A;  3W99 B;  3X1T A;  2XD1 A;  5CPI C;  3X1T C;  4WJ3 C;  2YFV A;  2YFW B;  1M19 B;  5AVB A;  5AVB C;  2NQB B;  4Z5T A;  1U35 D;  5B40 D;  1P3M D;  2HUE B;  4H9P B;  5B1M D;  2HIO B;  4Z5T C;  4WU9 D;  3WA9 B;  4J8X D;  1KX3 A;  2HUE C;  3V9R B;  3C1C C;  5B31 D;  3X1U A;  3X1U C;  3MNN D;  3W96 B;  1WWI A;  3KFU G;  1P3P A;  1HQ3 D;  3AZJ D;  1P3F B;  3AZL A;  1P3P C;  1ID3 D;  1H3O B;  4LD9 A;  4LD9 C;  3AZL C;  3MVD A;  4UPK A;  5AV5 A;  4J8U B;  3AV2 D;  3NQU A;  2VQR A;  3KXB A;  4J8U C;  4HGA B;  4J8W A;  2NZD D;  1M18 D;  4ZUX A;  3REH A;  5AVC A;  1P3K A;  3AV1 D;  4HGA C;  3AZF B;  3AZH D;  3WTP B;  1P34 A;  1KX3 D;  4WU8 C;  1JFI A;  4X23 B;  1Q9C A;  5FUG B;  4YM6 D;  3WTP C;  4Z66 D;  3LZ1 D;  2G5H C;  5CP6 A;  3AZE B;  3WAA D;  3C1B B;  4UUZ B;  5CP6 C;  3O62 D;  4G92 B;  5GT3 D;  3UT9 B;  1KX4 A;  1KX4 C;  3H0L C;  3AZE C;  3C1B C;  1TZY A;  3MVD D;  5AV5 D;  4CAY A;  1TZY C;  1P3B D;  1S32 A;  2BG1 A;  4XUJ A;  1PZR A;  4AWL B;  3AFA D;  4XUJ C;  2DF4 C;  3X1V D;  1ZLA B;  5B32 B;  4WNN B;  5KDM B;  3KXB D;  4J8W D;  3NQJ A;  2Y2O A;  3H0R C;  4H9N A;  5AV6 C;  3VH6 A;  3REH D;  1P3A C;  2F2A C;  1P3K D;  2ARO A;  3X1S A;  1M1A A;  2LY8 A;  2ARO C;  3X1S C;  1F1E A;  3AZK D;  3REK B;  5GT0 A;  3UTB A;  5BNV B;  5JA4 A;  4H9O B;  5GT0 C;  2RIQ A;  3REJ A;  4H9R A;  5B2J B;  3KWQ D;  3AYW D;  5F99 A;  5B0Z A;  1F66 A;  1BH9 B;  5B0Z C;  5AY8 D;  5F99 C;  1F66 C;  5JRG A;  4R8P A;  1N1J A;  2PYO B;  5JRG C;  3AZI A;  1W2E A;  5DNN B;  5B0Y A;  1AOI A;  3AZI C;  5B2J C;  1P3O A;  5B0Y C;  1AOI C;  1S32 D;  4DRB A;  4JJN D;  3AN2 D;  1EQZ B;  2BYM A;  4YS3 B;  3B6G B;  5DNN C;  3KUY B;  5CPK B;  5E5A D;  3MGP B;  4CSR B;  1U35 A;  5B40 A;  4J8X B;  1KX5 B;  1P3L B;  5B1M A;  4QLC B;  4WU9 A;  5B40 C;  1P3M C;  3B6G C;  2FFF B;  5B1M C;  5DNM B;  4WU9 C;  3AL0 C;  5CPK C;  2Y2P A;  2ZY2 A;  1M1A D;  4J8X C;  3MNN B;  4EO5 B;  4QLC C;  3EPL A;  5B1L A;  5B31 C;  3UTB D;  2FJ7 B;  3MNN C;  5B2I B;  4KHA A;  1P3I B;  3R45 B;  5CPI B;  3X1T B;  1HQ3 A;  3AZJ A;  1ID3 A;  1HQ3 C;  1ID3 C;  1P3O D;  3AZG A;  2YFV B;  5AVB B;  3AV2 A;  3W97 D;  4Z5T B;  3AV2 C;  4KUD A;  5GSU A;  2NZD A;  1M18 A;  2DQN C;  3C1C B;  1M18 C;  3X1U B;  3AV1 A;  3MGQ D;  3AZH A;  3B6F D;  1BFM A;  3AZH C;  1KX3 C;  2CV5 A;  5B1L D;  1KU5 A;  2Y2L A;  4KGC A;  5G49 A;  3MGS D;  4YM6 A;  4Z66 A;  3LZ1 A;  4YM6 C;  1P3P B;  4Z66 C;  3LZ1 C;  3WAA A;  3AZL B;  4LD9 B;  3WAA C;  3O62 A;  5GT3 A;  3O62 C;  3MVD B;  5AV5 B;  5GT3 C;  5GXQ D;  5AV9 A;  3UTA A;  1P3G D;  3NQU B;  2Y2K A;  3AZG D;  1P3B A;  3FDD A;  3MVD C;  5AV5 C;  1P3B C;  3AFA A;  3LEL A;  3X1V A;  5BNX A;  3AFA C;  4ZUX B;  4KUD D;  3X1V C;  3REH B;  3REI D;  3B0C T;  3B0B A;  5AVC B;  5GSU D;  3KXB C;  2F8N H;  1P3K B;  3AZN A;  4J8V D;  4J8W C;  1P34 B;  4WU8 B;  3A6N A;  4ZUX C;  1JFI B;  2L5A A;  3REH C;  3H0M C;  5AVC C;  1P3K C;  1P34 C;  3A1K A;  3AZK A;  2CV5 D;  3EG5 B;  5CP6 B;  3AZK C;  2ZY4 A;  4KGC D;  3AZM D;  3LZ0 A;  2BYK A;  2Y2H A;  1KX4 B;  3KWQ A;  3AYW A;  3KWQ C;  1TZY B;  3W99 D;  5BT1 D;  5AY8 A;  3AYW C;  2IO5 B;  1R4V A;  4CAY B;  5AY8 C;  1S32 B;  4XUJ B;  5AV9 D;  3UTA D;  1M19 D;  1BH8 A;  3VH5 T;  2IO5 C;  4NE3 A;  4JJN A;  3AN2 A;  2NQB D;  1S32 C;  4JJN C;  2JSS A;  4WV4 B;  5AV6 B;  3NQJ B;  3LEL D;  2HIO D;  4H9N B;  1P3A B;  3WA9 D;  5B32 G;  5E5A A;  5E5A C;  3AZN D;  2ARO B;  3X1S B;  1M1A B;  3A6N D;  3LJA A;  3B0C W;  5FUG A;  5GT0 B;  5B33 A;  2Y2I A;  5JA4 B;  3W96 D;  3REJ B;  1M1A C;  5CHL B;  3P5J B;  4ZBJ B;  3W98 A;  5B0Z B;  5F99 B;  1F66 B;  3UTB C;  4H9Q A;  3EPJ A;  5JRG B;  1B6W A;  1N1J B;  4R8P B;  3LZ0 D;  3REJ C;  1P3F D;  3EPK A;  3AZI B;  4ZBJ C;  5B0Y B;  1AOI B;  1P3O B;  4R8P C;  5B24 A;  2BYM B;  1P3O C;  3REL A;  4H9S A;  3W97 A;  1P3M B;  1U35 B;  5B40 B;  5B1M B;  4WU9 B;  3W97 C;  3VH5 W;  2RVQ D;  1TAF A;  3F6T A;  3AZF D;  1T3U A;  5AV8 A;  4X23 D;  1U35 C;  3LJA D;  3REK A;  5B31 B;  2Y2M A;  5B33 D;  3B6F A;  3MGQ A;  2ZM5 A;  3B6F C;  3MGQ C;  5BO0 A;  2F8N G;  2Y2J A;  5B1L C;  3W98 D;  4KHA B;  3MGS A;  3UT9 D;  1B67 A;  3MGS C;  5CPJ A;  1HQ3 B;  3AZJ B;  1ID3 B;  3WKJ A;  1EQZ A;  1WWS A;  5B24 D;  1ULY A;  5GXQ A;  3AV2 B;  1ZLA D;  3AZJ C;  1P3G A;  2JE5 A;  5B32 D;  1P3G C;  3REL D;  3AZG C;  2XD5 A;  4NE6 A;  5GSU B;  2NZD B;  1M18 B;  2G5I C;  3TU4 A;  4KUD C;  3REI A;  3REI C;  4XZQ A;  5AV8 D;  5BS7 A;  5GSU C;  4J8V A;  3AZH B;  3AV1 B;  1KX3 B;  5BS7 C;  4J8V C;  2F8N A;  2NZD C;  3A1I A;  3REK D;  4KGC B;  3AV1 C;  5G49 B;  4YM6 B;  4Z66 B;  3LZ1 B;  4Z2M G;  5B2I A;  3MGR A;  2CV5 C;  3WAA B;  3O62 B;  2PYO D;  5GT3 B;  3AZM A;  4KGC C;  5CPJ D;  3AZM C;  5DNN D;  3WKJ D;  3VH6 W;  5AV9 B;  3UTA B;  3W99 A;  1EQZ D;  1P3B B;  3W99 C;  5BT1 C;  4YS3 D;  2JCH A;  3B6G D;  3AFA B;  5AV9 C;  3LEL B;  3UTA C;  5BNX B;  3X1V B;  2YFW A;  1M19 A;  3KUY D;  5CPK D;  3MGP D;  2F8N K;  1M19 C;  3KXB B;  2UWX A;  2NQB A;  4J8W B;  1KX5 D;  4H9P A;  3C1C A;  4QLC D;  2HIO A;  3TU4 D;  3AZN B;  1P3L D;  3WA9 A;  5DNM D;  3LEL C;  2HIO C;  3A6N B;  3WA9 C;  4E45 A;  4XZQ D;  3V9R A;  3AZN C;  2F8N D;  3A6N C;  3AZK B;  3VH5 A;  3EPH A;  1A7W A;  3W96 A;  2FJ7 D;  4G91 B;  3W96 C;  3LZ0 B;  2BYK B;  5B2I D;  3KSY A;  3MGR D;  3KWQ B;  1P3I D;  3AYW B;  4DQY B;  5CPI D;  3X1T D;  5AY8 B;  1Z2C B;  2CWE A;  1P3F A;  4G91 C;  1H3O A;  3LZ0 C;  1P3F C;  4J8U A;  5AVB D;  1BH8 B;  1HTA A;  4JJN B;  3AN2 B;  5C3I B;  4Z5T D;  5E5A B;  3AN2 C;  5C3I C;  3C1C D;  4WU8 A;  2Y2G A;  4NE5 A;  3LJA B;  3X1U D;  3AZF A;  2RVQ C;  5B33 B;  3WTP A;  4Z2M H;  4DRA A;  3AZF C;  2J8P A;  4X23 A;  2W8S A;  4X23 C;  3LJA C;  4M6B A;  3UTB B;  3W98 B;  5B33 C;  4H9Q B;  1P3P D;  3AZE A;  4LD9 D;  3AZL D;  4H9R B;  4UUZ A;  3C1B A;  3W98 C;  4G92 C;  3UT9 A;  3UT9 C;  5B24 B;  4J8U D;  2NQB C;  3REL B;  4NFT A;  5AV6 A;  1ZLA A;  4AWL C;  5B24 C;  4ZUX D;  5B32 A;  1P3A A;  4WNN A;  4WZS B;  1ZLA C;  5KDM A;  3W97 B;  5B32 C;  5AVC D;  3REL C;  1TAF B;  4H9S C;  1P34 D;  4WU8 D;  5AV8 B;  2ZY3 A;  3WTP D;  3B6F B;  3MGQ B;  5AV8 C;  5BO0 B;  5CP6 D;  5B31 G;  5B1L B;  5BNV A;  3REK C;  4H9O A;  3MGS B;  1KX4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...