2BYMA

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
65
structure length
65
Chain Sequence
TGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 20
structure length 65
sequence length 65
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bymA00
3MVDC 4KGCC 1ID3B 4Z66D 1M19D 5G49B 3AZND 2RVQC 1F66B 5GXQA 3MGPC 3AN2B 3KWQB 3WAAB 1WWIA 4KGCD 5B1MB 5CP6C 3AZGA 5C3IB 5DNNA 2RVQD 1P3AC 5B32C 3A6NB 5AY8A 3NQJA 1S32A 1P3KB 5B24B 1M18A 5CPKA 5KDMA 5CP6D 5AVCC 4G92C 5GT0A 5E5AA 3AV1D 3W96D 3REHC 3UTBC 4ZUXC 3VH5T 1P3PC 3AZMA 1P3AD 5B32D 3AZIC 1P3GB 3LJAC 3KUYD 1TAFA 2FJ7C 4J8VA 5JA4A 5AV9A 3MVDA 4H9NA 3X1UC 4YS3C 3AZHD 3REHD 1P3FA 4J8UD 3AFAB 4UUZB 5GSUC 3C1BD 1P3PD 1M1AB 4XZQC 5BO0A 3REIB 3AZID 1B67A 3WA9B 4Z5TA 2IO5C 3LZ1C 3MGPA 5BT1C 4KUDB 3UT9A 2FJ7D 4LD9B 3WTPB 1TZYC 4G91C 5AV8B 3X1UD 4YS3D 2NZDB 3REKC 5G49A 3VH6T 5GSUD 4WU8C 2AROB 1P3BC 2CV5B 1F66A 1KX4C 5B0YB 5CPIB 1P3LA 3AN2A 5B31C 3KWQA 3WTPE 1H3OA 4YM6B 3B6GD 3B0DC 4XUJC 3REKD 5B1LB 3W98C 3X1SD 4WU8D 5CHLB 4JJND 1KX4D 3W97D 3WKJB 3X1TD 1P3OC 3MGRC 1P3KA 5B24A 3MGQC 3X1VB 3B6FC 5AV6D 5GT3B 3MNNA 4XUJD 1ZLAD 2NQBC 1HQ3C 3W98D 3LZ0B 5CPJD 4XZQA 3LELB 1N1JB 1F1EA 4J8WD 1P3GA 1P3MD 1P3OD 3REJD 1TZYA 3MGQD 3TU4B 5GXQC 2PYOA 4H9SC 2NQBD 1HQ3D 3AZKB 3B0CT 4UUZA 4AWLB 1P3BA 5B2JB 2L5AA 1A7WA 3AZGC 1M1AA 2BYMA 2HUEC 4QLCA 4KUDA 3MGSB 4LD9A 3WTPA 5GXQD 5AY8C 4R8PB 4CAYA 5AVBC 1S32C 1M18C 5CPKC 2NZDA 4KHAB 2HIOB 4E45A 5F99B 3AZGD 5GT0C 5E5AC 2AROA 2YFWB 5DNND 3VH5A 5B0ZC 1KX3B 5AV5D 5B40D 3AZMC 5CPIA 5AY8D 2YFVB 1M19B 1S32D 4YM6A 1M18D 3C1CB 3AZJD 3B0BA 3AZNB 5FUGB 4J8VC 3AZFB 4EO5B 5B1LA 5AV9C 5B33B 5GT0D 5E5AD 2CWEA 1P3FC 3AZEB 3AYWD 4J8XC 3WKJA 3NQUA 1P3IA 3AZMD 3UTAD 4Z5TC 3W99B 3X1VA 4X23D 3UT9C 4H9SA 5GT3A 2F8ND 5B2ID 3AV2B 5DNMB 5AV9D 3MVDD 3LZ0A 1U35B 1P3FD 1EQZB 3VH6A 3LELA 1N1JA 4HGAB 4Z5TD 1BFMA 1Q9CA 1F66C 3MGPD 3AV1B 3W96B 3UT9D 3TU4A 5AVBA 1P3LC 3AN2C 3KWQC 5B32B 3AZKA 5B2JA 5C3IC 3KUYB 5B0ZA 5JRGA 4G92B 1F66D 3AZHB 4J8UB 5BNXB 1P3LD 4R8PA 1P3KC 5B24C 3C1BB 4H9RB 3MNNC 5AVCD 4KHAA 2HIOA 5F99A 4H9QB 3UTBD 4ZUXD 2YFWA 4J8XA 1KX3A 1KX5A 1BH8A 3X1UB 3LJAD 2YFVA 1P3GC 1M19A 1P3KD 5GSUB 5B24D 3C1CA 4WU9B 3MNND 2PYOC 3AZFA 5B33A 1ID3A 2F8NG 3AFAC 4Z2MG 3AZEA 4XZQD 5BS7A 4NE5A 1M1AC 3B6GB 3LZ1D 3WA9C 4QLCC 5BT1D 3W99A 1BH9B 1P3GD 4KUDC 1TZYD 3KXBB 3X1SB 3WTPC 4LD9C 3RELB 3WAAA 2PYOD 3AV2A 4H9OB 5DNMA 5B1MA 4JJNB 3W97B 3X1TB 1EQZA 1U35A 2NZDC 4E44A 1P3BD 2AROC 5AV6B 1AOIB 3A6NA 4QLCD 1ZLAB 3W96A 3AV1A 5B32G 5CPIC 5B31D 3W98B 4LD9D 5CPJB 1P34B 4NE3A 4YM6C 2NZDD 4J8WB 1P3MB 5B1LC 3KUYA 3REJB 3WKJC 2NQBB 1P3IC 1HQ3B 4ZBJB 3MGRD 4M6BA 5BNXA 4J8UA 3B6FD 3X1VC 4H9RA 3C1BA 5GT3C 4WV4B 3VH5W 4H9QA 3AFAA 5B1LD 3LZ0C 4Z2MH 3REIA 3LELC 1ULYA 1P3ID 3WA9A 3WKJD 3AZGB 3X1VD 5AV8A 1HTAA 4WU9A 5DNNB 5GT3D 3TU4C 2HUEB 5AV5B 4WNNB 5B40B 3LZ0D 3AZKC 3AZLB 4AWLC 5B2JC 3LELD 2CV5A 3AZJB 3R45B 5JRGC 3B6GA 5B0YA 3O62B 1BH9A 3KXBA 3X1SA 5GT0B 3TU4D 3RELA 5AVBD 4Z66B 4R8PC 4H9OA 3AYWB 5CPKD 2LY8A 3W97A 4JJNA 3AZMB 3KSYA 3VH6W 3X1TA 3UTAB 3AZKD 2HIOC 5F99C 5B2JD 4H9PB 5B0ZD 4X23B 5AV6A 1AOIA 5JRGD 1KX3C 2F8NB 5B2IB 1KX5C 5AV9B 3MVDB 4KGCB 4H9NB 4CSRB 1P3FB 4R8PD 5CPJA 1P34A 1M19C 4J8VD 3C1CC 2F8NK 4J8WA 3AZFC 4EO5C 1P3MA 2HIOD 5F99D 3REJA 5B33C 1ID3C 3MGPB 4J8XD 1KX3D 3AZEC 1KX5D 3V9RB 2BYKB 5BS7C 5CP6B 3W99C 3C1CD 3WAAC 3AZFD 3AV2C 5DNMC 1P3AB 5B33D 5B1MC 1ID3D 1EQZC 1U35C 1P3LB 3AZED 1H3OB 5AVCB 4HGAC 3MGSA 3A6NC 3W99D 3REHB 3UTBB 3W96C 4ZUXB 3AN2D 3AV1C 3KWQD 5AV5A 3WAAD 3B0CW 4WNNA 1P3PB 3AV2D 5DNMD 3AZIB 5B40A 5B1MD 1EQZD 1U35D 3AZLA 3LJAB 2FJ7B 3KUYC 3AZJA 3R45A 3MNNB 3O62A 3A6ND 4YS3B 3AZHC 4J8UC 4Z66A 3AYWA 3AZNA 5FUGA 4XZQB 3C1BC 3UTAA 2IO5B 3LZ1B 4H9PA 4X23A 1TZYB 4G91B 5BNVB 2F8NA 5B2IA 2PYOB 4NE6A 3REIC 4KGCA 4CSRA 3REKB 4WU8B 1P3BB 5AV8C 4DRAA 4WU9C 2BYMB 1KX4B 4QLCB 3AFAD 5B31B 3V9RA 1M1AD 4CAYB 2BYKA 3REID 3B0DB 4XUJB 5CP6A 2CV5C 3B6GC 3WA9D 4KUDD 5B0YC 3WTPD 3KXBC 3X1SC 5AV8D 4WU9D 1JFIB 3RELC 1P3AA 5B32A 4JJNC 3W97C 3X1TC 1P3OB 3MGRB 3MGQB 3B6FB 2AROD 5AV6C 5AVCA 2CV5D 1AOIC 5B0YD 3AZHA 3REHA 1ZLAC 5CPID 3UTBA 4ZUXA 3KXBD 3RELD 1P3PA 4YM6D 1KU5A 5CPJC 3AZIA 1P34C 3NQUB 1P3IB 3LJAA 2F8NH 4WZSB 4J8WC 2FJ7A 1P3MC 3REJC 5GXQB 1AOID 3X1UA 4YS3A 1B6WA 4ZBJC 5GSUA 1P34D 3LZ1A 5BNVA 5AY8B 3NQJB 5AVBB 1S32B 1R4VA 1M18B 5CPKB 3REKA 5KDMB 3MGSC 5E5AB 4WU8A 2JSSA 5B0ZB 5DNNC 5B31G 5JRGB 5AV5C 1KX4A 5B40C 5B31A 3AZLC 1TAFB 4XUJA 4J8VB 3AZJC 1ZLAA 5JA4B 3O62C 3MGSD 3W98A 1JFIA 4Z66C 4J8XB 3AYWC 1KX5B 3AZNC 1BH8B 5BO0B 3UTAC 3MGRA 1WWSA 4Z5TB 1P3OA 3MGQA 4NFTA 3AZLD 3B6FA 3UT9B 4X23C 2NQBA 5B2IC 1HQ3A 3O62D 4DRBA
chains in the Genus database with same CATH superfamily
3MVDC 2DF4C 1ID3B 4KGCC 2Y2PA 2Y2QA 4Z66D 1M19D 5G49B 3AZND 2RVQC 1F66B 5GXQA 3MGPC 3AN2B 2UWXA 3KWQB 3WAAB 1WWIA 4KGCD 5B1MB 5CP6C 3AZGA 5C3IB 3FDDA 2VQRA 5DNNA 2RVQD 4WJ3C 1P3AC 5B32C 3A6NB 5AY8A 3NQJA 1S32A 2F2AC 1P3KB 5B24B 1M18A 5CPKA 2Y2KA 5KDMA 5CP6D 5AVCC 4G92C 5GT0A 5E5AA 3AV1D 3W96D 3REHC 3UTBC 4ZUXC 3VH5T 1P3PC 3AZMA 1P3AD 5B32D 3AZIC 1P3GB 3LJAC 3EPHA 3KUYD 1TAFA 2FJ7C 4J8VA 2ZM5A 5JA4A 5AV9A 3MVDA 4H9NA 3X1UC 4YS3C 3EPKA 3REHD 3AZHD 4J8UD 3AFAB 1P3FA 4UUZB 5GSUC 3C1BD 1P3PD 1M1AB 4XZQC 5BO0A 3REIB 3AZID 1B67A 3WA9B 4Z5TA 2IO5C 3LZ1C 3MGPA 5BT1C 4KUDB 3UT9A 2FJ7D 4LD9B 3WTPB 1TZYC 4G91C 5AV8B 3X1UD 4YS3D 2NZDB 3REKC 5G49A 3VH6T 5GSUD 4WU8C 2AROB 1P3BC 2CV5B 1F66A 1KX4C 5B0YB 5CPIB 1P3LA 2FFFB 3AN2A 5B31C 3KWQA 3WTPE 1H3OA 4YM6B 3B6GD 3B0DC 4XUJC 3REKD 5B1LB 3W98C 3X1SD 4WU8D 2Y2MA 5CHLB 4JJND 1KX4D 3W97D 3WKJB 3X1TD 1P3OC 2XD1A 3MGRC 1P3KA 5B24A 3MGQC 3X1VB 3B6FC 5AV6D 5GT3B 3MNNA 1PZRA 4XUJD 1ZLAD 2NQBC 1HQ3C 3W98D 3LZ0B 5CPJD 4XZQA 2DQNC 3LELB 1N1JB 1F1EA 4J8WD 1P3GA 1P3MD 1P3OD 3REJD 1TZYA 3MGQD 3TU4B 5GXQC 2PYOA 2Y2GA 4H9SC 2NQBD 1HQ3D 3AZKB 3B0CT 4UUZA 4AWLB 1P3BA 5B2JB 2L5AA 1A7WA 3AZGC 1M1AA 2BYMA 2HUEC 4QLCA 4KUDA 3MGSB 4LD9A 3WTPA 4UPKA 5GXQD 5AY8C 4R8PB 4CAYA 5AVBC 1S32C 1M18C 5CPKC 2NZDA 4KHAB 2HIOB 4E45A 5F99B 3AZGD 5GT0C 5E5AC 2AROA 2YFWB 5DNND 3VH5A 5B0ZC 1KX3B 5AV5D 5B40D 3AZMC 5CPIA 5AY8D 2YFVB 1M19B 1S32D 4YM6A 1M18D 3C1CB 3AZJD 3B0BA 3AZNB 5FUGB 4J8VC 3AZFB 4EO5B 5B1LA 5AV9C 5B33B 5GT0D 5E5AD 2CWEA 1P3FC 3AZEB 3AYWD 4J8XC 3WKJA 3NQUA 1P3IA 3AZMD 3UTAD 3A1KA 4Z5TC 3W99B 3X1VA 4X23D 3UT9C 4H9SA 5GT3A 2F8ND 5B2ID 3AV2B 5DNMB 5AV9D 3H0LC 3MVDD 3LZ0A 1U35B 1P3FD 1EQZB 3VH6A 3LELA 1N1JA 2Y2LA 4HGAB 4Z5TD 1BFMA 1Q9CA 1F66C 3MGPD 3AV1B 3W96B 3UT9D 3TU4A 5AVBA 1P3LC 3AN2C 3KWQC 3EPJA 5B32B 3AZKA 2JE5A 5B2JA 5C3IC 3KUYB 5B0ZA 5JRGA 2RIQA 4G92B 1F66D 3AZHB 4J8UB 5BNXB 1P3LD 4R8PA 2XD5A 1P3KC 5B24C 3C1BB 4H9RB 3P5JB 4DQYB 3MNNC 5AVCD 4KHAA 2HIOA 5F99A 4H9QB 3UTBD 4ZUXD 2YFWA 4J8XA 1KX3A 1KX5A 1BH8A 3X1UB 3LJAD 2YFVA 1P3GC 1M19A 1P3KD 5GSUB 5B24D 3C1CA 4WU9B 3MNND 2PYOC 3AZFA 2Y2JA 5B33A 1ID3A 2F8NG 3AFAC 1Z2CB 4Z2MG 3AZEA 3IP4C 4XZQD 5BS7A 4NE5A 1M1AC 3B6GB 3LZ1D 3WA9C 4QLCC 5BT1D 3F6TA 3W99A 1BH9B 1P3GD 4KUDC 1TZYD 3KXBB 3X1SB 3WTPC 4LD9C 3RELB 3WAAA 2PYOD 3AV2A 4H9OB 5DNMA 5B1MA 4JJNB 3W97B 3X1TB 1EQZA 1U35A 2NZDC 4E44A 1P3BD 2AROC 5AV6B 1AOIB 3A6NA 4QLCD 1ZLAB 3W96A 3AV1A 5B32G 5CPIC 5B31D 3W98B 4LD9D 5CPJB 1P34B 4NE3A 4YM6C 2NZDD 4J8WB 1P3MB 5B1LC 3KUYA 3REJB 2JCHA 3WKJC 2NQBB 1P3IC 1HQ3B 4ZBJB 3MGRD 4M6BA 5BNXA 4J8UA 3B6FD 3X1VC 4H9RA 3C1BA 5GT3C 4WV4B 3VH5W 4H9QA 3AFAA 5B1LD 3LZ0C 4Z2MH 3REIA 3LELC 1ULYA 1P3ID 3WA9A 3WKJD 3AZGB 3X1VD 5AV8A 1HTAA 4WU9A 5DNNB 5GT3D 3TU4C 2HUEB 2W8SA 5AV5B 4WNNB 1W2EA 5B40B 3LZ0D 3AZKC 3AZLB 4AWLC 5B2JC 3LELD 2CV5A 3AZJB 3R45B 5JRGC 3B6GA 5B0YA 3O62B 1BH9A 3KXBA 5GT0B 3X1SA 3TU4D 3RELA 5AVBD 4Z66B 4R8PC 2BG1A 4H9OA 3AYWB 5CPKD 2LY8A 3W97A 4JJNA 3AZMB 3KSYA 3VH6W 3X1TA 3UTAB 3AZKD 2HIOC 5F99C 5B2JD 4H9PB 2ZY5A 5B0ZD 5AV6A 4X23B 1AOIA 5JRGD 1KX3C 2F8NB 5B2IB 1KX5C 5AV9B 3MVDB 4KGCB 4H9NB 4CSRB 1P3FB 4R8PD 5CPJA 1P34A 1M19C 4J8VD 3C1CC 2F8NK 4J8WA 3H0RC 4EO5C 3AZFC 2HIOD 5F99D 3REJA 5B33C 1P3MA 3MGPB 1ID3C 4J8XD 1KX3D 3AZEC 1KX5D 3V9RB 2BYKB 5BS7C 5CP6B 3W99C 2G5IC 3C1CD 3WAAC 3AZFD 3AV2C 5DNMC 1P3AB 5B33D 5B1MC 1ID3D 1EQZC 1U35C 1P3LB 3AZED 1H3OB 5AVCB 4HGAC 3MGSA 3A6NC 3W99D 3REHB 3UTBB 3W96C 4ZUXB 3AN2D 3AV1C 3KWQD 5AV5A 3WAAD 3B0CW 4WNNA 1P3PB 3AV2D 5DNMD 3AZIB 5B40A 5B1MD 2Y2NA 1EQZD 1U35D 3AZLA 3LJAB 2FJ7B 3KUYC 3AZJA 3R45A 3MNNB 1T3UA 3O62A 3A6ND 4YS3B 3AZHC 4J8UC 4Z66A 3AYWA 3AZNA 5FUGA 4XZQB 3C1BC 3UTAA 2IO5B 3LZ1B 2J8PA 4H9PA 4X23A 1TZYB 4G91B 5BNVB 2F8NA 5B2IA 2PYOB 4NE6A 3REIC 4KGCA 4CSRA 3REKB 4WU8B 1P3BB 5AV8C 4DRAA 4WU9C 2BYMB 1KX4B 4QLCB 3AFAD 5B31B 3V9RA 1M1AD 4CAYB 2BYKA 3REID 3B0DB 4XUJB 5CP6A 2CV5C 3B6GC 3WA9D 4KUDD 5B0YC 3WTPD 2ZY3A 3KXBC 3X1SC 5AV8D 4WU9D 1JFIB 3RELC 2ZY2A 1P3AA 5B32A 4JJNC 3W97C 3X1TC 1P3OB 3MGRB 3MGQB 3B6FB 2AROD 5AV6C 5AVCA 2CV5D 1AOIC 5B0YD 3AZHA 3REHA 1ZLAC 5CPID 3UTBA 4ZUXA 3KXBD 2ZY4A 3RELD 1P3PA 3A1IA 1KU5A 4YM6D 3AZIA 5CPJC 1P34C 3NQUB 1P3IB 3LJAA 2F8NH 4WZSB 4J8WC 2FJ7A 1P3MC 3REJC 5GXQB 1AOID 3X1UA 2Y2HA 1B6WA 4YS3A 2Y2OA 4ZBJC 3KFUG 5GSUA 1P34D 3LZ1A 5BNVA 5AY8B 3NQJB 5AVBB 1S32B 1R4VA 1M18B 2G5HC 5CPKB 3REKA 5KDMB 3EG5B 3MGSC 5E5AB 4WU8A 2Y2IA 2JSSA 5B0ZB 5DNNC 5B31G 5JRGB 5AV5C 1KX4A 5B40C 5B31A 3AZLC 3AL0C 1TAFB 4XUJA 4J8VB 3AZJC 3H0MC 1ZLAA 5JA4B 3O62C 3MGSD 3W98A 1JFIA 4Z66C 4J8XB 3AYWC 1KX5B 3AZNC 1BH8B 5BO0B 3UTAC 3MGRA 1WWSA 4Z5TB 1P3OA 3MGQA 4NFTA 3EPLA 3AZLD 3B6FA 3UT9B 4X23C 2NQBA 5B2IC 1HQ3A 3O62D 4DRBA
chains in the Genus database with same CATH topology
3MVDC 2DF4C 1ID3B 4KGCC 2Y2PA 2Y2QA 4Z66D 1M19D 5G49B 3AZND 2RVQC 1F66B 5GXQA 3MGPC 3AN2B 2UWXA 3KWQB 3WAAB 1WWIA 4KGCD 5B1MB 5CP6C 3AZGA 5C3IB 3FDDA 2VQRA 5DNNA 2RVQD 4WJ3C 1P3AC 5B32C 3A6NB 5AY8A 3NQJA 1S32A 2F2AC 1P3KB 5B24B 1M18A 5CPKA 2Y2KA 5KDMA 5CP6D 5AVCC 4G92C 5GT0A 5E5AA 3AV1D 3W96D 3REHC 3UTBC 4ZUXC 3VH5T 1P3PC 3AZMA 1P3AD 5B32D 3AZIC 1P3GB 3LJAC 3EPHA 3KUYD 1TAFA 2FJ7C 4J8VA 2ZM5A 5JA4A 5AV9A 3MVDA 4H9NA 3X1UC 4YS3C 3EPKA 3REHD 3AZHD 4J8UD 3AFAB 1P3FA 4UUZB 5GSUC 3C1BD 1P3PD 1M1AB 4XZQC 5BO0A 3REIB 3AZID 1B67A 3WA9B 4Z5TA 2IO5C 3LZ1C 3MGPA 5BT1C 4KUDB 3UT9A 2FJ7D 4LD9B 3WTPB 1TZYC 4G91C 5AV8B 3X1UD 4YS3D 2NZDB 3REKC 5G49A 3VH6T 5GSUD 4WU8C 2AROB 1P3BC 2CV5B 1F66A 1KX4C 5B0YB 5CPIB 1P3LA 2FFFB 3AN2A 5B31C 3KWQA 3WTPE 1H3OA 4YM6B 3B6GD 3B0DC 4XUJC 3REKD 5B1LB 3W98C 3X1SD 4WU8D 2Y2MA 5CHLB 4JJND 1KX4D 3W97D 3WKJB 3X1TD 1P3OC 2XD1A 3MGRC 1P3KA 5B24A 3MGQC 3X1VB 3B6FC 5AV6D 5GT3B 3MNNA 1PZRA 4XUJD 1ZLAD 2NQBC 1HQ3C 3W98D 3LZ0B 5CPJD 4XZQA 2DQNC 3LELB 1N1JB 1F1EA 4J8WD 1P3GA 1P3MD 1P3OD 3REJD 1TZYA 3MGQD 3TU4B 5GXQC 2PYOA 2Y2GA 4H9SC 2NQBD 1HQ3D 3AZKB 3B0CT 4UUZA 4AWLB 1P3BA 5B2JB 2L5AA 1A7WA 3AZGC 1M1AA 2BYMA 2HUEC 4QLCA 4KUDA 3MGSB 4LD9A 3WTPA 4UPKA 5GXQD 5AY8C 4R8PB 4CAYA 5AVBC 1S32C 1M18C 5CPKC 2NZDA 4KHAB 2HIOB 4E45A 5F99B 3AZGD 5GT0C 5E5AC 2AROA 2YFWB 5DNND 3VH5A 5B0ZC 1KX3B 5AV5D 5B40D 3AZMC 5CPIA 5AY8D 2YFVB 1M19B 1S32D 4YM6A 1M18D 3C1CB 3AZJD 3B0BA 3AZNB 5FUGB 4J8VC 3AZFB 4EO5B 5B1LA 5AV9C 5B33B 5GT0D 5E5AD 2CWEA 1P3FC 3AZEB 3AYWD 4J8XC 3WKJA 3NQUA 1P3IA 3AZMD 3UTAD 3A1KA 4Z5TC 3W99B 3X1VA 4X23D 3UT9C 4H9SA 5GT3A 2F8ND 5B2ID 3AV2B 5DNMB 5AV9D 3H0LC 3MVDD 3LZ0A 1U35B 1P3FD 1EQZB 3VH6A 3LELA 1N1JA 2Y2LA 4HGAB 4Z5TD 1BFMA 1Q9CA 1F66C 3MGPD 3AV1B 3W96B 3UT9D 3TU4A 5AVBA 1P3LC 3AN2C 3KWQC 3EPJA 5B32B 3AZKA 2JE5A 5B2JA 5C3IC 3KUYB 5B0ZA 5JRGA 2RIQA 4G92B 1F66D 3AZHB 4J8UB 5BNXB 1P3LD 4R8PA 2XD5A 1P3KC 5B24C 3C1BB 4H9RB 3P5JB 4DQYB 3MNNC 5AVCD 4KHAA 2HIOA 5F99A 4H9QB 3UTBD 4ZUXD 2YFWA 4J8XA 1KX3A 1KX5A 1BH8A 3X1UB 3LJAD 2YFVA 1P3GC 1M19A 1P3KD 5GSUB 5B24D 3C1CA 4WU9B 3MNND 2PYOC 3AZFA 2Y2JA 5B33A 1ID3A 2F8NG 3AFAC 1Z2CB 4Z2MG 3AZEA 3IP4C 4XZQD 5BS7A 4NE5A 1M1AC 3B6GB 3LZ1D 3WA9C 4QLCC 5BT1D 3F6TA 3W99A 1BH9B 1P3GD 4KUDC 1TZYD 3KXBB 3X1SB 3WTPC 4LD9C 3RELB 3WAAA 2PYOD 3AV2A 4H9OB 5DNMA 5B1MA 4JJNB 3W97B 3X1TB 1EQZA 1U35A 2NZDC 4E44A 1P3BD 2AROC 5AV6B 1AOIB 3A6NA 4QLCD 1ZLAB 3W96A 3AV1A 5B32G 5CPIC 5B31D 3W98B 4LD9D 5CPJB 1P34B 4NE3A 4YM6C 2NZDD 4J8WB 1P3MB 5B1LC 3KUYA 3REJB 2JCHA 3WKJC 2NQBB 1P3IC 1HQ3B 4ZBJB 3MGRD 4M6BA 5BNXA 4J8UA 3B6FD 3X1VC 4H9RA 3C1BA 5GT3C 4WV4B 3VH5W 4H9QA 3AFAA 5B1LD 3LZ0C 4Z2MH 3REIA 3LELC 1ULYA 1P3ID 3WA9A 3WKJD 3AZGB 3X1VD 5AV8A 1HTAA 4WU9A 5DNNB 5GT3D 3TU4C 2HUEB 2W8SA 5AV5B 4WNNB 1W2EA 5B40B 3LZ0D 3AZKC 3AZLB 4AWLC 5B2JC 3LELD 2CV5A 3AZJB 3R45B 5JRGC 3B6GA 5B0YA 3O62B 1BH9A 3KXBA 5GT0B 3X1SA 3TU4D 3RELA 5AVBD 4Z66B 4R8PC 2BG1A 4H9OA 3AYWB 5CPKD 2LY8A 3W97A 4JJNA 3AZMB 3KSYA 3VH6W 3X1TA 3UTAB 3AZKD 2HIOC 5F99C 5B2JD 4H9PB 2ZY5A 5B0ZD 5AV6A 4X23B 1AOIA 5JRGD 1KX3C 2F8NB 5B2IB 1KX5C 5AV9B 3MVDB 4KGCB 4H9NB 4CSRB 1P3FB 4R8PD 5CPJA 1P34A 1M19C 4J8VD 3C1CC 2F8NK 4J8WA 3H0RC 4EO5C 3AZFC 2HIOD 5F99D 3REJA 5B33C 1P3MA 3MGPB 1ID3C 4J8XD 1KX3D 3AZEC 1KX5D 3V9RB 2BYKB 5BS7C 5CP6B 3W99C 2G5IC 3C1CD 3WAAC 3AZFD 3AV2C 5DNMC 1P3AB 5B33D 5B1MC 1ID3D 1EQZC 1U35C 1P3LB 3AZED 1H3OB 5AVCB 4HGAC 3MGSA 3A6NC 3W99D 3REHB 3UTBB 3W96C 4ZUXB 3AN2D 3AV1C 3KWQD 5AV5A 3WAAD 3B0CW 4WNNA 1P3PB 3AV2D 5DNMD 3AZIB 5B40A 5B1MD 2Y2NA 1EQZD 1U35D 3AZLA 3LJAB 2FJ7B 3KUYC 3AZJA 3R45A 3MNNB 1T3UA 3O62A 3A6ND 4YS3B 3AZHC 4J8UC 4Z66A 3AYWA 3AZNA 5FUGA 4XZQB 3C1BC 3UTAA 2IO5B 3LZ1B 2J8PA 4H9PA 4X23A 1TZYB 4G91B 5BNVB 2F8NA 5B2IA 2PYOB 4NE6A 3REIC 4KGCA 4CSRA 3REKB 4WU8B 1P3BB 5AV8C 4DRAA 4WU9C 2BYMB 1KX4B 4QLCB 3AFAD 5B31B 3V9RA 1M1AD 4CAYB 2BYKA 3REID 3B0DB 4XUJB 5CP6A 2CV5C 3B6GC 3WA9D 4KUDD 5B0YC 3WTPD 2ZY3A 3KXBC 3X1SC 5AV8D 4WU9D 1JFIB 3RELC 2ZY2A 1P3AA 5B32A 4JJNC 3W97C 3X1TC 1P3OB 3MGRB 3MGQB 3B6FB 2AROD 5AV6C 5AVCA 2CV5D 1AOIC 5B0YD 3AZHA 3REHA 1ZLAC 5CPID 3UTBA 4ZUXA 3KXBD 2ZY4A 3RELD 1P3PA 3A1IA 1KU5A 4YM6D 3AZIA 5CPJC 1P34C 3NQUB 1P3IB 3LJAA 2F8NH 4WZSB 4J8WC 2FJ7A 1P3MC 3REJC 5GXQB 1AOID 3X1UA 2Y2HA 1B6WA 4YS3A 2Y2OA 4ZBJC 3KFUG 5GSUA 1P34D 3LZ1A 5BNVA 5AY8B 3NQJB 5AVBB 1S32B 1R4VA 1M18B 2G5HC 5CPKB 3REKA 5KDMB 3EG5B 3MGSC 5E5AB 4WU8A 2Y2IA 2JSSA 5B0ZB 5DNNC 5B31G 5JRGB 5AV5C 1KX4A 5B40C 5B31A 3AZLC 3AL0C 1TAFB 4XUJA 4J8VB 3AZJC 3H0MC 1ZLAA 5JA4B 3O62C 3MGSD 3W98A 1JFIA 4Z66C 4J8XB 3AYWC 1KX5B 3AZNC 1BH8B 5BO0B 3UTAC 3MGRA 1WWSA 4Z5TB 1P3OA 3MGQA 4NFTA 3EPLA 3AZLD 3B6FA 3UT9B 4X23C 2NQBA 5B2IC 1HQ3A 3O62D 4DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD C;  4KGC C;  1ID3 B;  4Z66 D;  1M19 D;  5G49 B;  3AZN D;  2RVQ C;  1F66 B;  5GXQ A;  3MGP C;  3AN2 B;  3KWQ B;  3WAA B;  1WWI A;  4KGC D;  5B1M B;  5CP6 C;  3AZG A;  5C3I B;  5DNN A;  2RVQ D;  1P3A C;  5B32 C;  3A6N B;  5AY8 A;  3NQJ A;  1S32 A;  1P3K B;  5B24 B;  1M18 A;  5CPK A;  5KDM A;  5CP6 D;  5AVC C;  4G92 C;  5GT0 A;  5E5A A;  3AV1 D;  3W96 D;  3REH C;  3UTB C;  4ZUX C;  3VH5 T;  1P3P C;  3AZM A;  1P3A D;  5B32 D;  3AZI C;  1P3G B;  3LJA C;  3KUY D;  1TAF A;  2FJ7 C;  4J8V A;  5JA4 A;  5AV9 A;  3MVD A;  4H9N A;  3X1U C;  4YS3 C;  3AZH D;  3REH D;  1P3F A;  4J8U D;  3AFA B;  4UUZ B;  5GSU C;  3C1B D;  1P3P D;  1M1A B;  4XZQ C;  5BO0 A;  3REI B;  3AZI D;  1B67 A;  3WA9 B;  4Z5T A;  2IO5 C;  3LZ1 C;  3MGP A;  5BT1 C;  4KUD B;  3UT9 A;  2FJ7 D;  4LD9 B;  3WTP B;  1TZY C;  4G91 C;  5AV8 B;  3X1U D;  4YS3 D;  2NZD B;  3REK C;  5G49 A;  3VH6 T;  5GSU D;  4WU8 C;  2ARO B;  1P3B C;  2CV5 B;  1F66 A;  1KX4 C;  5B0Y B;  5CPI B;  1P3L A;  3AN2 A;  5B31 C;  3KWQ A;  3WTP E;  1H3O A;  4YM6 B;  3B6G D;  3B0D C;  4XUJ C;  3REK D;  5B1L B;  3W98 C;  3X1S D;  4WU8 D;  5CHL B;  4JJN D;  1KX4 D;  3W97 D;  3WKJ B;  3X1T D;  1P3O C;  3MGR C;  1P3K A;  5B24 A;  3MGQ C;  3X1V B;  3B6F C;  5AV6 D;  5GT3 B;  3MNN A;  4XUJ D;  1ZLA D;  2NQB C;  1HQ3 C;  3W98 D;  3LZ0 B;  5CPJ D;  4XZQ A;  3LEL B;  1N1J B;  1F1E A;  4J8W D;  1P3G A;  1P3M D;  1P3O D;  3REJ D;  1TZY A;  3MGQ D;  3TU4 B;  5GXQ C;  2PYO A;  4H9S C;  2NQB D;  1HQ3 D;  3AZK B;  3B0C T;  4UUZ A;  4AWL B;  1P3B A;  5B2J B;  2L5A A;  1A7W A;  3AZG C;  1M1A A;  2BYM A;  2HUE C;  4QLC A;  4KUD A;  3MGS B;  4LD9 A;  3WTP A;  5GXQ D;  5AY8 C;  4R8P B;  4CAY A;  5AVB C;  1S32 C;  1M18 C;  5CPK C;  2NZD A;  4KHA B;  2HIO B;  4E45 A;  5F99 B;  3AZG D;  5GT0 C;  5E5A C;  2ARO A;  2YFW B;  5DNN D;  3VH5 A;  5B0Z C;  1KX3 B;  5AV5 D;  5B40 D;  3AZM C;  5CPI A;  5AY8 D;  2YFV B;  1M19 B;  1S32 D;  4YM6 A;  1M18 D;  3C1C B;  3AZJ D;  3B0B A;  3AZN B;  5FUG B;  4J8V C;  3AZF B;  4EO5 B;  5B1L A;  5AV9 C;  5B33 B;  5GT0 D;  5E5A D;  2CWE A;  1P3F C;  3AZE B;  3AYW D;  4J8X C;  3WKJ A;  3NQU A;  1P3I A;  3AZM D;  3UTA D;  4Z5T C;  3W99 B;  3X1V A;  4X23 D;  3UT9 C;  4H9S A;  5GT3 A;  2F8N D;  5B2I D;  3AV2 B;  5DNM B;  5AV9 D;  3MVD D;  3LZ0 A;  1U35 B;  1P3F D;  1EQZ B;  3VH6 A;  3LEL A;  1N1J A;  4HGA B;  4Z5T D;  1BFM A;  1Q9C A;  1F66 C;  3MGP D;  3AV1 B;  3W96 B;  3UT9 D;  3TU4 A;  5AVB A;  1P3L C;  3AN2 C;  3KWQ C;  5B32 B;  3AZK A;  5B2J A;  5C3I C;  3KUY B;  5B0Z A;  5JRG A;  4G92 B;  1F66 D;  3AZH B;  4J8U B;  5BNX B;  1P3L D;  4R8P A;  1P3K C;  5B24 C;  3C1B B;  4H9R B;  3MNN C;  5AVC D;  4KHA A;  2HIO A;  5F99 A;  4H9Q B;  3UTB D;  4ZUX D;  2YFW A;  4J8X A;  1KX3 A;  1KX5 A;  1BH8 A;  3X1U B;  3LJA D;  2YFV A;  1P3G C;  1M19 A;  1P3K D;  5GSU B;  5B24 D;  3C1C A;  4WU9 B;  3MNN D;  2PYO C;  3AZF A;  5B33 A;  1ID3 A;  2F8N G;  3AFA C;  4Z2M G;  3AZE A;  4XZQ D;  5BS7 A;  4NE5 A;  1M1A C;  3B6G B;  3LZ1 D;  3WA9 C;  4QLC C;  5BT1 D;  3W99 A;  1BH9 B;  1P3G D;  4KUD C;  1TZY D;  3KXB B;  3X1S B;  3WTP C;  4LD9 C;  3REL B;  3WAA A;  2PYO D;  3AV2 A;  4H9O B;  5DNM A;  5B1M A;  4JJN B;  3W97 B;  3X1T B;  1EQZ A;  1U35 A;  2NZD C;  4E44 A;  1P3B D;  2ARO C;  5AV6 B;  1AOI B;  3A6N A;  4QLC D;  1ZLA B;  3W96 A;  3AV1 A;  5B32 G;  5CPI C;  5B31 D;  3W98 B;  4LD9 D;  5CPJ B;  1P34 B;  4NE3 A;  4YM6 C;  2NZD D;  4J8W B;  1P3M B;  5B1L C;  3KUY A;  3REJ B;  3WKJ C;  2NQB B;  1P3I C;  1HQ3 B;  4ZBJ B;  3MGR D;  4M6B A;  5BNX A;  4J8U A;  3B6F D;  3X1V C;  4H9R A;  3C1B A;  5GT3 C;  4WV4 B;  3VH5 W;  4H9Q A;  3AFA A;  5B1L D;  3LZ0 C;  4Z2M H;  3REI A;  3LEL C;  1ULY A;  1P3I D;  3WA9 A;  3WKJ D;  3AZG B;  3X1V D;  5AV8 A;  1HTA A;  4WU9 A;  5DNN B;  5GT3 D;  3TU4 C;  2HUE B;  5AV5 B;  4WNN B;  5B40 B;  3LZ0 D;  3AZK C;  3AZL B;  4AWL C;  5B2J C;  3LEL D;  2CV5 A;  3AZJ B;  3R45 B;  5JRG C;  3B6G A;  5B0Y A;  3O62 B;  1BH9 A;  3KXB A;  3X1S A;  5GT0 B;  3TU4 D;  3REL A;  5AVB D;  4Z66 B;  4R8P C;  4H9O A;  3AYW B;  5CPK D;  2LY8 A;  3W97 A;  4JJN A;  3AZM B;  3KSY A;  3VH6 W;  3X1T A;  3UTA B;  3AZK D;  2HIO C;  5F99 C;  5B2J D;  4H9P B;  5B0Z D;  4X23 B;  5AV6 A;  1AOI A;  5JRG D;  1KX3 C;  2F8N B;  5B2I B;  1KX5 C;  5AV9 B;  3MVD B;  4KGC B;  4H9N B;  4CSR B;  1P3F B;  4R8P D;  5CPJ A;  1P34 A;  1M19 C;  4J8V D;  3C1C C;  2F8N K;  4J8W A;  3AZF C;  4EO5 C;  1P3M A;  2HIO D;  5F99 D;  3REJ A;  5B33 C;  1ID3 C;  3MGP B;  4J8X D;  1KX3 D;  3AZE C;  1KX5 D;  3V9R B;  2BYK B;  5BS7 C;  5CP6 B;  3W99 C;  3C1C D;  3WAA C;  3AZF D;  3AV2 C;  5DNM C;  1P3A B;  5B33 D;  5B1M C;  1ID3 D;  1EQZ C;  1U35 C;  1P3L B;  3AZE D;  1H3O B;  5AVC B;  4HGA C;  3MGS A;  3A6N C;  3W99 D;  3REH B;  3UTB B;  3W96 C;  4ZUX B;  3AN2 D;  3AV1 C;  3KWQ D;  5AV5 A;  3WAA D;  3B0C W;  4WNN A;  1P3P B;  3AV2 D;  5DNM D;  3AZI B;  5B40 A;  5B1M D;  1EQZ D;  1U35 D;  3AZL A;  3LJA B;  2FJ7 B;  3KUY C;  3AZJ A;  3R45 A;  3MNN B;  3O62 A;  3A6N D;  4YS3 B;  3AZH C;  4J8U C;  4Z66 A;  3AYW A;  3AZN A;  5FUG A;  4XZQ B;  3C1B C;  3UTA A;  2IO5 B;  3LZ1 B;  4H9P A;  4X23 A;  1TZY B;  4G91 B;  5BNV B;  2F8N A;  5B2I A;  2PYO B;  4NE6 A;  3REI C;  4KGC A;  4CSR A;  3REK B;  4WU8 B;  1P3B B;  5AV8 C;  4DRA A;  4WU9 C;  2BYM B;  1KX4 B;  4QLC B;  3AFA D;  5B31 B;  3V9R A;  1M1A D;  4CAY B;  2BYK A;  3REI D;  3B0D B;  4XUJ B;  5CP6 A;  2CV5 C;  3B6G C;  3WA9 D;  4KUD D;  5B0Y C;  3WTP D;  3KXB C;  3X1S C;  5AV8 D;  4WU9 D;  1JFI B;  3REL C;  1P3A A;  5B32 A;  4JJN C;  3W97 C;  3X1T C;  1P3O B;  3MGR B;  3MGQ B;  3B6F B;  2ARO D;  5AV6 C;  5AVC A;  2CV5 D;  1AOI C;  5B0Y D;  3AZH A;  3REH A;  1ZLA C;  5CPI D;  3UTB A;  4ZUX A;  3KXB D;  3REL D;  1P3P A;  4YM6 D;  1KU5 A;  5CPJ C;  3AZI A;  1P34 C;  3NQU B;  1P3I B;  3LJA A;  2F8N H;  4WZS B;  4J8W C;  2FJ7 A;  1P3M C;  3REJ C;  5GXQ B;  1AOI D;  3X1U A;  4YS3 A;  1B6W A;  4ZBJ C;  5GSU A;  1P34 D;  3LZ1 A;  5BNV A;  5AY8 B;  3NQJ B;  5AVB B;  1S32 B;  1R4V A;  1M18 B;  5CPK B;  3REK A;  5KDM B;  3MGS C;  5E5A B;  4WU8 A;  2JSS A;  5B0Z B;  5DNN C;  5B31 G;  5JRG B;  5AV5 C;  1KX4 A;  5B40 C;  5B31 A;  3AZL C;  1TAF B;  4XUJ A;  4J8V B;  3AZJ C;  1ZLA A;  5JA4 B;  3O62 C;  3MGS D;  3W98 A;  1JFI A;  4Z66 C;  4J8X B;  3AYW C;  1KX5 B;  3AZN C;  1BH8 B;  5BO0 B;  3UTA C;  3MGR A;  1WWS A;  4Z5T B;  1P3O A;  3MGQ A;  4NFT A;  3AZL D;  3B6F A;  3UT9 B;  4X23 C;  2NQB A;  5B2I C;  1HQ3 A;  3O62 D;  4DRB A; 
#chains in the Genus database with same CATH topology
 3MVD C;  2DF4 C;  1ID3 B;  4KGC C;  2Y2P A;  2Y2Q A;  4Z66 D;  1M19 D;  5G49 B;  3AZN D;  2RVQ C;  1F66 B;  5GXQ A;  3MGP C;  3AN2 B;  2UWX A;  3KWQ B;  3WAA B;  1WWI A;  4KGC D;  5B1M B;  5CP6 C;  3AZG A;  5C3I B;  3FDD A;  2VQR A;  5DNN A;  2RVQ D;  4WJ3 C;  1P3A C;  5B32 C;  3A6N B;  5AY8 A;  3NQJ A;  1S32 A;  2F2A C;  1P3K B;  5B24 B;  1M18 A;  5CPK A;  2Y2K A;  5KDM A;  5CP6 D;  5AVC C;  4G92 C;  5GT0 A;  5E5A A;  3AV1 D;  3W96 D;  3REH C;  3UTB C;  4ZUX C;  3VH5 T;  1P3P C;  3AZM A;  1P3A D;  5B32 D;  3AZI C;  1P3G B;  3LJA C;  3EPH A;  3KUY D;  1TAF A;  2FJ7 C;  4J8V A;  2ZM5 A;  5JA4 A;  5AV9 A;  3MVD A;  4H9N A;  3X1U C;  4YS3 C;  3EPK A;  3REH D;  3AZH D;  4J8U D;  3AFA B;  1P3F A;  4UUZ B;  5GSU C;  3C1B D;  1P3P D;  1M1A B;  4XZQ C;  5BO0 A;  3REI B;  3AZI D;  1B67 A;  3WA9 B;  4Z5T A;  2IO5 C;  3LZ1 C;  3MGP A;  5BT1 C;  4KUD B;  3UT9 A;  2FJ7 D;  4LD9 B;  3WTP B;  1TZY C;  4G91 C;  5AV8 B;  3X1U D;  4YS3 D;  2NZD B;  3REK C;  5G49 A;  3VH6 T;  5GSU D;  4WU8 C;  2ARO B;  1P3B C;  2CV5 B;  1F66 A;  1KX4 C;  5B0Y B;  5CPI B;  1P3L A;  2FFF B;  3AN2 A;  5B31 C;  3KWQ A;  3WTP E;  1H3O A;  4YM6 B;  3B6G D;  3B0D C;  4XUJ C;  3REK D;  5B1L B;  3W98 C;  3X1S D;  4WU8 D;  2Y2M A;  5CHL B;  4JJN D;  1KX4 D;  3W97 D;  3WKJ B;  3X1T D;  1P3O C;  2XD1 A;  3MGR C;  1P3K A;  5B24 A;  3MGQ C;  3X1V B;  3B6F C;  5AV6 D;  5GT3 B;  3MNN A;  1PZR A;  4XUJ D;  1ZLA D;  2NQB C;  1HQ3 C;  3W98 D;  3LZ0 B;  5CPJ D;  4XZQ A;  2DQN C;  3LEL B;  1N1J B;  1F1E A;  4J8W D;  1P3G A;  1P3M D;  1P3O D;  3REJ D;  1TZY A;  3MGQ D;  3TU4 B;  5GXQ C;  2PYO A;  2Y2G A;  4H9S C;  2NQB D;  1HQ3 D;  3AZK B;  3B0C T;  4UUZ A;  4AWL B;  1P3B A;  5B2J B;  2L5A A;  1A7W A;  3AZG C;  1M1A A;  2BYM A;  2HUE C;  4QLC A;  4KUD A;  3MGS B;  4LD9 A;  3WTP A;  4UPK A;  5GXQ D;  5AY8 C;  4R8P B;  4CAY A;  5AVB C;  1S32 C;  1M18 C;  5CPK C;  2NZD A;  4KHA B;  2HIO B;  4E45 A;  5F99 B;  3AZG D;  5GT0 C;  5E5A C;  2ARO A;  2YFW B;  5DNN D;  3VH5 A;  5B0Z C;  1KX3 B;  5AV5 D;  5B40 D;  3AZM C;  5CPI A;  5AY8 D;  2YFV B;  1M19 B;  1S32 D;  4YM6 A;  1M18 D;  3C1C B;  3AZJ D;  3B0B A;  3AZN B;  5FUG B;  4J8V C;  3AZF B;  4EO5 B;  5B1L A;  5AV9 C;  5B33 B;  5GT0 D;  5E5A D;  2CWE A;  1P3F C;  3AZE B;  3AYW D;  4J8X C;  3WKJ A;  3NQU A;  1P3I A;  3AZM D;  3UTA D;  3A1K A;  4Z5T C;  3W99 B;  3X1V A;  4X23 D;  3UT9 C;  4H9S A;  5GT3 A;  2F8N D;  5B2I D;  3AV2 B;  5DNM B;  5AV9 D;  3H0L C;  3MVD D;  3LZ0 A;  1U35 B;  1P3F D;  1EQZ B;  3VH6 A;  3LEL A;  1N1J A;  2Y2L A;  4HGA B;  4Z5T D;  1BFM A;  1Q9C A;  1F66 C;  3MGP D;  3AV1 B;  3W96 B;  3UT9 D;  3TU4 A;  5AVB A;  1P3L C;  3AN2 C;  3KWQ C;  3EPJ A;  5B32 B;  3AZK A;  2JE5 A;  5B2J A;  5C3I C;  3KUY B;  5B0Z A;  5JRG A;  2RIQ A;  4G92 B;  1F66 D;  3AZH B;  4J8U B;  5BNX B;  1P3L D;  4R8P A;  2XD5 A;  1P3K C;  5B24 C;  3C1B B;  4H9R B;  3P5J B;  4DQY B;  3MNN C;  5AVC D;  4KHA A;  2HIO A;  5F99 A;  4H9Q B;  3UTB D;  4ZUX D;  2YFW A;  4J8X A;  1KX3 A;  1KX5 A;  1BH8 A;  3X1U B;  3LJA D;  2YFV A;  1P3G C;  1M19 A;  1P3K D;  5GSU B;  5B24 D;  3C1C A;  4WU9 B;  3MNN D;  2PYO C;  3AZF A;  2Y2J A;  5B33 A;  1ID3 A;  2F8N G;  3AFA C;  1Z2C B;  4Z2M G;  3AZE A;  3IP4 C;  4XZQ D;  5BS7 A;  4NE5 A;  1M1A C;  3B6G B;  3LZ1 D;  3WA9 C;  4QLC C;  5BT1 D;  3F6T A;  3W99 A;  1BH9 B;  1P3G D;  4KUD C;  1TZY D;  3KXB B;  3X1S B;  3WTP C;  4LD9 C;  3REL B;  3WAA A;  2PYO D;  3AV2 A;  4H9O B;  5DNM A;  5B1M A;  4JJN B;  3W97 B;  3X1T B;  1EQZ A;  1U35 A;  2NZD C;  4E44 A;  1P3B D;  2ARO C;  5AV6 B;  1AOI B;  3A6N A;  4QLC D;  1ZLA B;  3W96 A;  3AV1 A;  5B32 G;  5CPI C;  5B31 D;  3W98 B;  4LD9 D;  5CPJ B;  1P34 B;  4NE3 A;  4YM6 C;  2NZD D;  4J8W B;  1P3M B;  5B1L C;  3KUY A;  3REJ B;  2JCH A;  3WKJ C;  2NQB B;  1P3I C;  1HQ3 B;  4ZBJ B;  3MGR D;  4M6B A;  5BNX A;  4J8U A;  3B6F D;  3X1V C;  4H9R A;  3C1B A;  5GT3 C;  4WV4 B;  3VH5 W;  4H9Q A;  3AFA A;  5B1L D;  3LZ0 C;  4Z2M H;  3REI A;  3LEL C;  1ULY A;  1P3I D;  3WA9 A;  3WKJ D;  3AZG B;  3X1V D;  5AV8 A;  1HTA A;  4WU9 A;  5DNN B;  5GT3 D;  3TU4 C;  2HUE B;  2W8S A;  5AV5 B;  4WNN B;  1W2E A;  5B40 B;  3LZ0 D;  3AZK C;  3AZL B;  4AWL C;  5B2J C;  3LEL D;  2CV5 A;  3AZJ B;  3R45 B;  5JRG C;  3B6G A;  5B0Y A;  3O62 B;  1BH9 A;  3KXB A;  5GT0 B;  3X1S A;  3TU4 D;  3REL A;  5AVB D;  4Z66 B;  4R8P C;  2BG1 A;  4H9O A;  3AYW B;  5CPK D;  2LY8 A;  3W97 A;  4JJN A;  3AZM B;  3KSY A;  3VH6 W;  3X1T A;  3UTA B;  3AZK D;  2HIO C;  5F99 C;  5B2J D;  4H9P B;  2ZY5 A;  5B0Z D;  5AV6 A;  4X23 B;  1AOI A;  5JRG D;  1KX3 C;  2F8N B;  5B2I B;  1KX5 C;  5AV9 B;  3MVD B;  4KGC B;  4H9N B;  4CSR B;  1P3F B;  4R8P D;  5CPJ A;  1P34 A;  1M19 C;  4J8V D;  3C1C C;  2F8N K;  4J8W A;  3H0R C;  4EO5 C;  3AZF C;  2HIO D;  5F99 D;  3REJ A;  5B33 C;  1P3M A;  3MGP B;  1ID3 C;  4J8X D;  1KX3 D;  3AZE C;  1KX5 D;  3V9R B;  2BYK B;  5BS7 C;  5CP6 B;  3W99 C;  2G5I C;  3C1C D;  3WAA C;  3AZF D;  3AV2 C;  5DNM C;  1P3A B;  5B33 D;  5B1M C;  1ID3 D;  1EQZ C;  1U35 C;  1P3L B;  3AZE D;  1H3O B;  5AVC B;  4HGA C;  3MGS A;  3A6N C;  3W99 D;  3REH B;  3UTB B;  3W96 C;  4ZUX B;  3AN2 D;  3AV1 C;  3KWQ D;  5AV5 A;  3WAA D;  3B0C W;  4WNN A;  1P3P B;  3AV2 D;  5DNM D;  3AZI B;  5B40 A;  5B1M D;  2Y2N A;  1EQZ D;  1U35 D;  3AZL A;  3LJA B;  2FJ7 B;  3KUY C;  3AZJ A;  3R45 A;  3MNN B;  1T3U A;  3O62 A;  3A6N D;  4YS3 B;  3AZH C;  4J8U C;  4Z66 A;  3AYW A;  3AZN A;  5FUG A;  4XZQ B;  3C1B C;  3UTA A;  2IO5 B;  3LZ1 B;  2J8P A;  4H9P A;  4X23 A;  1TZY B;  4G91 B;  5BNV B;  2F8N A;  5B2I A;  2PYO B;  4NE6 A;  3REI C;  4KGC A;  4CSR A;  3REK B;  4WU8 B;  1P3B B;  5AV8 C;  4DRA A;  4WU9 C;  2BYM B;  1KX4 B;  4QLC B;  3AFA D;  5B31 B;  3V9R A;  1M1A D;  4CAY B;  2BYK A;  3REI D;  3B0D B;  4XUJ B;  5CP6 A;  2CV5 C;  3B6G C;  3WA9 D;  4KUD D;  5B0Y C;  3WTP D;  2ZY3 A;  3KXB C;  3X1S C;  5AV8 D;  4WU9 D;  1JFI B;  3REL C;  2ZY2 A;  1P3A A;  5B32 A;  4JJN C;  3W97 C;  3X1T C;  1P3O B;  3MGR B;  3MGQ B;  3B6F B;  2ARO D;  5AV6 C;  5AVC A;  2CV5 D;  1AOI C;  5B0Y D;  3AZH A;  3REH A;  1ZLA C;  5CPI D;  3UTB A;  4ZUX A;  3KXB D;  2ZY4 A;  3REL D;  1P3P A;  3A1I A;  1KU5 A;  4YM6 D;  3AZI A;  5CPJ C;  1P34 C;  3NQU B;  1P3I B;  3LJA A;  2F8N H;  4WZS B;  4J8W C;  2FJ7 A;  1P3M C;  3REJ C;  5GXQ B;  1AOI D;  3X1U A;  2Y2H A;  1B6W A;  4YS3 A;  2Y2O A;  4ZBJ C;  3KFU G;  5GSU A;  1P34 D;  3LZ1 A;  5BNV A;  5AY8 B;  3NQJ B;  5AVB B;  1S32 B;  1R4V A;  1M18 B;  2G5H C;  5CPK B;  3REK A;  5KDM B;  3EG5 B;  3MGS C;  5E5A B;  4WU8 A;  2Y2I A;  2JSS A;  5B0Z B;  5DNN C;  5B31 G;  5JRG B;  5AV5 C;  1KX4 A;  5B40 C;  5B31 A;  3AZL C;  3AL0 C;  1TAF B;  4XUJ A;  4J8V B;  3AZJ C;  3H0M C;  1ZLA A;  5JA4 B;  3O62 C;  3MGS D;  3W98 A;  1JFI A;  4Z66 C;  4J8X B;  3AYW C;  1KX5 B;  3AZN C;  1BH8 B;  5BO0 B;  3UTA C;  3MGR A;  1WWS A;  4Z5T B;  1P3O A;  3MGQ A;  4NFT A;  3EPL A;  3AZL D;  3B6F A;  3UT9 B;  4X23 C;  2NQB A;  5B2I C;  1HQ3 A;  3O62 D;  4DRB A; 
#chains in the Genus database with same CATH homology
 3MVD C;  2DF4 C;  1ID3 B;  4KGC C;  2Y2P A;  2Y2Q A;  4Z66 D;  1M19 D;  5G49 B;  3AZN D;  2RVQ C;  1F66 B;  5GXQ A;  3MGP C;  3AN2 B;  2UWX A;  3KWQ B;  3WAA B;  1WWI A;  4KGC D;  5B1M B;  5CP6 C;  3AZG A;  5C3I B;  3FDD A;  2VQR A;  5DNN A;  2RVQ D;  4WJ3 C;  1P3A C;  5B32 C;  3A6N B;  5AY8 A;  3NQJ A;  1S32 A;  2F2A C;  1P3K B;  5B24 B;  1M18 A;  5CPK A;  2Y2K A;  5KDM A;  5CP6 D;  5AVC C;  4G92 C;  5GT0 A;  5E5A A;  3AV1 D;  3W96 D;  3REH C;  3UTB C;  4ZUX C;  3VH5 T;  1P3P C;  3AZM A;  1P3A D;  5B32 D;  3AZI C;  1P3G B;  3LJA C;  3EPH A;  3KUY D;  1TAF A;  2FJ7 C;  4J8V A;  2ZM5 A;  5JA4 A;  5AV9 A;  3MVD A;  4H9N A;  3X1U C;  4YS3 C;  3EPK A;  3REH D;  3AZH D;  4J8U D;  3AFA B;  1P3F A;  4UUZ B;  5GSU C;  3C1B D;  1P3P D;  1M1A B;  4XZQ C;  5BO0 A;  3REI B;  3AZI D;  1B67 A;  3WA9 B;  4Z5T A;  2IO5 C;  3LZ1 C;  3MGP A;  5BT1 C;  4KUD B;  3UT9 A;  2FJ7 D;  4LD9 B;  3WTP B;  1TZY C;  4G91 C;  5AV8 B;  3X1U D;  4YS3 D;  2NZD B;  3REK C;  5G49 A;  3VH6 T;  5GSU D;  4WU8 C;  2ARO B;  1P3B C;  2CV5 B;  1F66 A;  1KX4 C;  5B0Y B;  5CPI B;  1P3L A;  2FFF B;  3AN2 A;  5B31 C;  3KWQ A;  3WTP E;  1H3O A;  4YM6 B;  3B6G D;  3B0D C;  4XUJ C;  3REK D;  5B1L B;  3W98 C;  3X1S D;  4WU8 D;  2Y2M A;  5CHL B;  4JJN D;  1KX4 D;  3W97 D;  3WKJ B;  3X1T D;  1P3O C;  2XD1 A;  3MGR C;  1P3K A;  5B24 A;  3MGQ C;  3X1V B;  3B6F C;  5AV6 D;  5GT3 B;  3MNN A;  1PZR A;  4XUJ D;  1ZLA D;  2NQB C;  1HQ3 C;  3W98 D;  3LZ0 B;  5CPJ D;  4XZQ A;  2DQN C;  3LEL B;  1N1J B;  1F1E A;  4J8W D;  1P3G A;  1P3M D;  1P3O D;  3REJ D;  1TZY A;  3MGQ D;  3TU4 B;  5GXQ C;  2PYO A;  2Y2G A;  4H9S C;  2NQB D;  1HQ3 D;  3AZK B;  3B0C T;  4UUZ A;  4AWL B;  1P3B A;  5B2J B;  2L5A A;  1A7W A;  3AZG C;  1M1A A;  2BYM A;  2HUE C;  4QLC A;  4KUD A;  3MGS B;  4LD9 A;  3WTP A;  4UPK A;  5GXQ D;  5AY8 C;  4R8P B;  4CAY A;  5AVB C;  1S32 C;  1M18 C;  5CPK C;  2NZD A;  4KHA B;  2HIO B;  4E45 A;  5F99 B;  3AZG D;  5GT0 C;  5E5A C;  2ARO A;  2YFW B;  5DNN D;  3VH5 A;  5B0Z C;  1KX3 B;  5AV5 D;  5B40 D;  3AZM C;  5CPI A;  5AY8 D;  2YFV B;  1M19 B;  1S32 D;  4YM6 A;  1M18 D;  3C1C B;  3AZJ D;  3B0B A;  3AZN B;  5FUG B;  4J8V C;  3AZF B;  4EO5 B;  5B1L A;  5AV9 C;  5B33 B;  5GT0 D;  5E5A D;  2CWE A;  1P3F C;  3AZE B;  3AYW D;  4J8X C;  3WKJ A;  3NQU A;  1P3I A;  3AZM D;  3UTA D;  3A1K A;  4Z5T C;  3W99 B;  3X1V A;  4X23 D;  3UT9 C;  4H9S A;  5GT3 A;  2F8N D;  5B2I D;  3AV2 B;  5DNM B;  5AV9 D;  3H0L C;  3MVD D;  3LZ0 A;  1U35 B;  1P3F D;  1EQZ B;  3VH6 A;  3LEL A;  1N1J A;  2Y2L A;  4HGA B;  4Z5T D;  1BFM A;  1Q9C A;  1F66 C;  3MGP D;  3AV1 B;  3W96 B;  3UT9 D;  3TU4 A;  5AVB A;  1P3L C;  3AN2 C;  3KWQ C;  3EPJ A;  5B32 B;  3AZK A;  2JE5 A;  5B2J A;  5C3I C;  3KUY B;  5B0Z A;  5JRG A;  2RIQ A;  4G92 B;  1F66 D;  3AZH B;  4J8U B;  5BNX B;  1P3L D;  4R8P A;  2XD5 A;  1P3K C;  5B24 C;  3C1B B;  4H9R B;  3P5J B;  4DQY B;  3MNN C;  5AVC D;  4KHA A;  2HIO A;  5F99 A;  4H9Q B;  3UTB D;  4ZUX D;  2YFW A;  4J8X A;  1KX3 A;  1KX5 A;  1BH8 A;  3X1U B;  3LJA D;  2YFV A;  1P3G C;  1M19 A;  1P3K D;  5GSU B;  5B24 D;  3C1C A;  4WU9 B;  3MNN D;  2PYO C;  3AZF A;  2Y2J A;  5B33 A;  1ID3 A;  2F8N G;  3AFA C;  1Z2C B;  4Z2M G;  3AZE A;  3IP4 C;  4XZQ D;  5BS7 A;  4NE5 A;  1M1A C;  3B6G B;  3LZ1 D;  3WA9 C;  4QLC C;  5BT1 D;  3F6T A;  3W99 A;  1BH9 B;  1P3G D;  4KUD C;  1TZY D;  3KXB B;  3X1S B;  3WTP C;  4LD9 C;  3REL B;  3WAA A;  2PYO D;  3AV2 A;  4H9O B;  5DNM A;  5B1M A;  4JJN B;  3W97 B;  3X1T B;  1EQZ A;  1U35 A;  2NZD C;  4E44 A;  1P3B D;  2ARO C;  5AV6 B;  1AOI B;  3A6N A;  4QLC D;  1ZLA B;  3W96 A;  3AV1 A;  5B32 G;  5CPI C;  5B31 D;  3W98 B;  4LD9 D;  5CPJ B;  1P34 B;  4NE3 A;  4YM6 C;  2NZD D;  4J8W B;  1P3M B;  5B1L C;  3KUY A;  3REJ B;  2JCH A;  3WKJ C;  2NQB B;  1P3I C;  1HQ3 B;  4ZBJ B;  3MGR D;  4M6B A;  5BNX A;  4J8U A;  3B6F D;  3X1V C;  4H9R A;  3C1B A;  5GT3 C;  4WV4 B;  3VH5 W;  4H9Q A;  3AFA A;  5B1L D;  3LZ0 C;  4Z2M H;  3REI A;  3LEL C;  1ULY A;  1P3I D;  3WA9 A;  3WKJ D;  3AZG B;  3X1V D;  5AV8 A;  1HTA A;  4WU9 A;  5DNN B;  5GT3 D;  3TU4 C;  2HUE B;  2W8S A;  5AV5 B;  4WNN B;  1W2E A;  5B40 B;  3LZ0 D;  3AZK C;  3AZL B;  4AWL C;  5B2J C;  3LEL D;  2CV5 A;  3AZJ B;  3R45 B;  5JRG C;  3B6G A;  5B0Y A;  3O62 B;  1BH9 A;  3KXB A;  5GT0 B;  3X1S A;  3TU4 D;  3REL A;  5AVB D;  4Z66 B;  4R8P C;  2BG1 A;  4H9O A;  3AYW B;  5CPK D;  2LY8 A;  3W97 A;  4JJN A;  3AZM B;  3KSY A;  3VH6 W;  3X1T A;  3UTA B;  3AZK D;  2HIO C;  5F99 C;  5B2J D;  4H9P B;  2ZY5 A;  5B0Z D;  5AV6 A;  4X23 B;  1AOI A;  5JRG D;  1KX3 C;  2F8N B;  5B2I B;  1KX5 C;  5AV9 B;  3MVD B;  4KGC B;  4H9N B;  4CSR B;  1P3F B;  4R8P D;  5CPJ A;  1P34 A;  1M19 C;  4J8V D;  3C1C C;  2F8N K;  4J8W A;  3H0R C;  4EO5 C;  3AZF C;  2HIO D;  5F99 D;  3REJ A;  5B33 C;  1P3M A;  3MGP B;  1ID3 C;  4J8X D;  1KX3 D;  3AZE C;  1KX5 D;  3V9R B;  2BYK B;  5BS7 C;  5CP6 B;  3W99 C;  2G5I C;  3C1C D;  3WAA C;  3AZF D;  3AV2 C;  5DNM C;  1P3A B;  5B33 D;  5B1M C;  1ID3 D;  1EQZ C;  1U35 C;  1P3L B;  3AZE D;  1H3O B;  5AVC B;  4HGA C;  3MGS A;  3A6N C;  3W99 D;  3REH B;  3UTB B;  3W96 C;  4ZUX B;  3AN2 D;  3AV1 C;  3KWQ D;  5AV5 A;  3WAA D;  3B0C W;  4WNN A;  1P3P B;  3AV2 D;  5DNM D;  3AZI B;  5B40 A;  5B1M D;  2Y2N A;  1EQZ D;  1U35 D;  3AZL A;  3LJA B;  2FJ7 B;  3KUY C;  3AZJ A;  3R45 A;  3MNN B;  1T3U A;  3O62 A;  3A6N D;  4YS3 B;  3AZH C;  4J8U C;  4Z66 A;  3AYW A;  3AZN A;  5FUG A;  4XZQ B;  3C1B C;  3UTA A;  2IO5 B;  3LZ1 B;  2J8P A;  4H9P A;  4X23 A;  1TZY B;  4G91 B;  5BNV B;  2F8N A;  5B2I A;  2PYO B;  4NE6 A;  3REI C;  4KGC A;  4CSR A;  3REK B;  4WU8 B;  1P3B B;  5AV8 C;  4DRA A;  4WU9 C;  2BYM B;  1KX4 B;  4QLC B;  3AFA D;  5B31 B;  3V9R A;  1M1A D;  4CAY B;  2BYK A;  3REI D;  3B0D B;  4XUJ B;  5CP6 A;  2CV5 C;  3B6G C;  3WA9 D;  4KUD D;  5B0Y C;  3WTP D;  2ZY3 A;  3KXB C;  3X1S C;  5AV8 D;  4WU9 D;  1JFI B;  3REL C;  2ZY2 A;  1P3A A;  5B32 A;  4JJN C;  3W97 C;  3X1T C;  1P3O B;  3MGR B;  3MGQ B;  3B6F B;  2ARO D;  5AV6 C;  5AVC A;  2CV5 D;  1AOI C;  5B0Y D;  3AZH A;  3REH A;  1ZLA C;  5CPI D;  3UTB A;  4ZUX A;  3KXB D;  2ZY4 A;  3REL D;  1P3P A;  3A1I A;  1KU5 A;  4YM6 D;  3AZI A;  5CPJ C;  1P34 C;  3NQU B;  1P3I B;  3LJA A;  2F8N H;  4WZS B;  4J8W C;  2FJ7 A;  1P3M C;  3REJ C;  5GXQ B;  1AOI D;  3X1U A;  2Y2H A;  1B6W A;  4YS3 A;  2Y2O A;  4ZBJ C;  3KFU G;  5GSU A;  1P34 D;  3LZ1 A;  5BNV A;  5AY8 B;  3NQJ B;  5AVB B;  1S32 B;  1R4V A;  1M18 B;  2G5H C;  5CPK B;  3REK A;  5KDM B;  3EG5 B;  3MGS C;  5E5A B;  4WU8 A;  2Y2I A;  2JSS A;  5B0Z B;  5DNN C;  5B31 G;  5JRG B;  5AV5 C;  1KX4 A;  5B40 C;  5B31 A;  3AZL C;  3AL0 C;  1TAF B;  4XUJ A;  4J8V B;  3AZJ C;  3H0M C;  1ZLA A;  5JA4 B;  3O62 C;  3MGS D;  3W98 A;  1JFI A;  4Z66 C;  4J8X B;  3AYW C;  1KX5 B;  3AZN C;  1BH8 B;  5BO0 B;  3UTA C;  3MGR A;  1WWS A;  4Z5T B;  1P3O A;  3MGQ A;  4NFT A;  3EPL A;  3AZL D;  3B6F A;  3UT9 B;  4X23 C;  2NQB A;  5B2I C;  1HQ3 A;  3O62 D;  4DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...