3O62D

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62D00
1H3OA 3VH6W 5B0ZD 3KSYA 5GT0C 1P34D 5B1LD 3UT9D 3AZGB 1ZLAA 5GXQC 1U35C 5GT0D 5JRGA 3REKA 3AV2B 1ULYA 3B6FC 3WAAA 2HUEC 3MGPA 3AZMC 1BH8A 3REJB 3X1UB 1U35D 3WA9A 1M18C 3W97D 3AZMD 3AZID 4UUZA 1F66B 1P3BB 5B24B 3C1CB 3TU4C 5AY8C 1M18D 4H9SC 4J8VB 2F8NG 4HGAB 3WTPC 3REHC 4YM6C 3TU4D 5AY8D 5AV5C 5CPKB 5BS7C 3AZJA 3VH5W 5CPIC 4KUDB 4J8UA 3R45B 3WTPD 1TZYA 3REHD 4YM6D 5DNMB 1P3AC 1KX4B 5AV5D 3X1TA 5CPID 2NZDC 5GSUA 3AZKA 1P3FA 1ID3C 3O62D 3KXBC 1P3AD 3UTBC 2NQBA 2F8NK 3AN2B 4CSRA 1P3BC 5B24C 1EQZD 1P3OB 2AROD 5DNNC 2NZDD 1ID3D 2F8NA 4M6BA 3KXBD 2F8NH 3UTBD 4HGAC 4JJNA 1WWIA 5B0ZA 3AFAC 5AV6B 5B40A 5B0YD 1P34A 5AV8D 5CPKC 3C1BB 5BNXA 3REID 3RELB 5B1LA 3UT9A 5GT0A 4WU8B 3AFAD 4J8XC 1P3GC 1KX4C 2FJ7C 3AZLB 1A7WA 3AZNC 5GXQA 3NQJA 1U35A 4WU9C 4J8XD 1P3GD 1ZLAD 3B6FA 2FJ7D 3AZMA 5JRGD 4R8PB 3REKD 4KGCC 3AZND 3MGPD 5B1MB 4WU9D 1KX3C 5FUGB 1M18A 4KHAB 1N1JB 1P3LB 4KGCD 3WKJB 4YS3C 5AV6C 1M1AC 1B67A 1P3IB 1KX3D 3TU4A 3B0DC 4WNNA 5AY8A 3KWQB 3C1BC 4H9SA 1M19C 4YS3D 4X23C 3WTPA 1M1AD 3REHA 4YM6A 1AOIB 2CWEA 3B0CW 5AV5A 5BS7A 5AV9C 1M19D 5B33C 5CPIA 4XUJC 4X23D 1P3AA 3X1VC 5AV9D 5B33D 3AV1B 4XUJD 1P3KB 2NZDA 2CV5C 1ID3A 3W99B 3KXBA 3LELB 3UTBA 3WKJC 3X1VD 4Z66B 3A6NB 1P3BA 5B24A 4EO5C 3V9RA 2NQBD 5DNNA 2CV5D 4WV4B 1S32B 3AFAA 5CPJB 3MGRC 3W96C 5CPKA 5B40D 4DRAA 3MVDB 3MNNC 3W98B 4J8XA 1P3GA 1KX4A 1JFIA 2HIOB 3MGRD 3MGSB 4XZQB 3LJAC 4H9OB 2FJ7A 3W96D 4H9RA 3AZNA 3LZ1C 1P3KC 3MNND 5AVBC 4QLCC 4WU9A 3LELC 1F1EA 2YFVB 5GXQD 1WWSA 3LJAD 4Z2MG 3AYWB 4H9PB 1KX5C 1BH9A 3B6FD 4KGCA 5B32C 3LZ1D 5CP6B 1HQ3B 1P3MB 5AVBD 4QLCD 3X1SB 1KX3A 2PYOC 1S32C 1KX5D 4YS3A 5B32D 5AV6A 1M1AA 5BO0B 5G49A 2PYOD 3C1BA 5F99B 3RELA 5BNVA 1M19A 4X23A 3AZGC 4E45A 4XZQC 3AV2C 5E5AB 5AV9A 5B33A 4XUJA 5B31B 3REJC 3AZGD 4Z2MH 3VH6A 3MGQB 3AZHB 5GT3B 3X1UC 3AV2D 3UTAB 3X1VA 3VH6T 1R4VA 4J8WB 1F66C 2YFWA 3REJD 2CV5A 4LD9B 3C1CC 3X1UD 5B2IB 3NQUA 3WKJA 1H3OB 4H9QA 4J8VC 2BYMA 2IO5B 4H9NA 1P3PB 1F66D 1P3BD 5B24D 5B32G 5F99C 5DNND 3C1CD 4J8VD 4CAYA 3WAAB 5JRGB 3REKB 4KUDC 5B2JB 3MGRA 3W96A 5DNMC 1TAFA 5CPKD 3MNNA 2JSSA 3WA9B 4ZUXB 4KUDD 3AZFB 3LJAA 4UUZB 1KX4D 5DNMD 4DRBA 3LZ1A 3AN2C 1P3KA 2BYKA 3VH5A 5AVBA 4LD9C 1P3OC 4QLCA 3LELA 4Z5TB 3VH5T 1KX5A 5B32A 3AN2D 1P3PC 2PYOA 1S32A 3AZJB 4ZBJB 4J8UB 1TZYB 5B2JC 5KDMA 3RELC 3B6GB 5AV6D 4WU8C 3X1TB 4G92B 3AZLC 3C1BD 5GSUB 4ZUXC 3RELD 3AZKB 1P3FB 3AZGA 3AZEB 4XZQA 4CSRB 3AV2A 3KUYB 1HTAA 3AZLD 4R8PC 2RVQC 3REJA 2F8NB 3LZ0B 5AVCB 4Z5TC 4NE5A 5B1MC 3X1UA 4AWLB 4JJNB 5B0ZB 4WZSB 1P3LC 4R8PD 4E44A 1P34B 2RVQD 1F66A 1P3IC 4NE3A 5BNXB 3C1CA 5B1MD 1B6WA 5B1LB 3UT9B 3KWQC 4J8VA 3B6GC 5GT0B 1P3LD 3WKJD 5F99A 1P3ID 1AOIC 3KWQD 3NQJB 1U35B 3AZEC 4KUDA 3R45A 3W97B 2HUEB 3AZMB 3KUYC 3AZIB 1AOID 5DNMA 1KU5A 5B31A 3LZ0C 3AV1C 5AVCC 1M18B 3W99C 3AN2A 4Z66C 3A6NC 4LD9A 3AV1D 3TU4B 1P3OA 4WNNB 5AY8B 3B0CT 1P3KD 3W99D 3WTPB 3LELD 1P3PA 4Z66D 3A6ND 3REHB 4YM6B 5CPJC 5AV5B 5JA4B 5CPIB 1S32D 5B2JA 3MVDC 5BT1C 3W97C 3O62B 3W98C 1P3AB 3AZIC 5CPJD 4WU8A 2HIOC 3MGSC 1EQZB 2AROB 3AZLA 2NZDB 4ZUXA 1ID3B 3MVDD 5BT1D 3KXBB 3AZFA 3W98D 3UTBB 2HIOD 3MGSD 3V9RB 4XZQD 5CHLB 3AYWC 5DNNB 4R8PA 5B0YB 5CP6C 5AV8B 1HQ3C 1P3MC 4Z5TA 5B1MA 3REIB 3X1SC 5FUGA 3AYWD 4KHAA 1N1JA 3AFAB 3WTPE 1P3LA 5CP6D 1P3IA 1HQ3D 1P3MD 3X1SD 3KWQA 3O62C 3B6GA 4J8XB 1P3GB 1ZLAB 1JFIB 2FJ7B 4H9RB 1EQZC 3AZNB 2AROC 1AOIA 3MGPB 5F99D 5E5AC 3AZEA 4WU9B 1BH8B 5B31C 3KUYA 3MGQC 1BH9B 4KGCB 3AZHC 5GT3C 5B0YC 3UTAC 5E5AD 5AV8C 1KX3B 3LZ0A 3AV1A 5AVCA 4J8WC 3REIC 5B31D 3W99A 3MGQD 4YS3B 3AZHD 5GT3D 5B2IC 1M1AB 3UTAD 4Z66A 3A6NA 2IO5C 5G49B 3B0DB 4J8WD 5BNVB 1M19B 4LD9D 1P3OD 4X23B 5B2ID 1ZLAC 3WAAC 5JRGC 3REKC 5CPJA 1P3PD 5B1LC 5AV9B 4G91B 5B33B 3MGPC 4XUJB 3MVDA 3W97A 3W98A 3WAAD 3WA9C 3AZIA 5B2JD 3X1VB 3AZFC 2HIOA 2L5AA 3MGSA 4H9OA 2NQBB 4WU8D 2YFWB 3B0BA 2CV5B 1Q9CA 3WA9D 4ZUXD 3NQUB 4H9QB 3AZFD 2YFVA 2BYMB 4H9NB 4EO5B 5B31G 3AYWA 4H9PA 5CP6A 1HQ3A 5B40B 1P3MA 3X1SA 5C3IB 4CAYB 2LY8A 3AZJC 4Z5TD 4ZBJC 4J8UC 4NE6A 4NFTA 3MGRB 1TZYC 3W96B 5JA4A 5BO0A 4G91C 1TAFB 3MNNB 3X1TC 3AZJD 3O62A 4J8UD 4G92C 1BFMA 5GSUC 3AZKC 1TZYD 5GXQB 3LJAB 1P3FC 3B6GD 1EQZA 3B6FB 2NQBC 2AROA 3LZ1B 3X1TD 2BYKB 5AVBB 5E5AA 4QLCB 5GSUD 3AZKD 1P3FD 3AZED 1KX5B 3MGQA 3AZHA 5GT3A 5B32B 4AWLC 5B0YA 4JJNC 3UTAA 3KUYD 5B0ZC 5AV8A 2PYOB 5B40C 4J8WA 3REIA 1P34C 2F8ND 5C3IC 3LZ0D 5AVCD 5B2IA 5KDMB 3UT9C 4JJND
chains in the Genus database with same CATH superfamily
1H3OA 3VH6W 5B0ZD 3KSYA 5GT0C 3A1IA 1P34D 5B1LD 3UT9D 3AZGB 1ZLAA 5GXQC 3IP4C 1U35C 5GT0D 5JRGA 3REKA 3AV2B 1ULYA 3B6FC 3WAAA 2HUEC 3MGPA 3AZMC 1BH8A 3REJB 3X1UB 1U35D 3WA9A 1M18C 3W97D 3AZMD 3AZID 4UUZA 1F66B 1P3BB 5B24B 3C1CB 3TU4C 5AY8C 1M18D 4H9SC 4J8VB 2F8NG 4HGAB 3WTPC 2Y2PA 3REHC 4YM6C 3EPKA 3TU4D 5AY8D 5AV5C 5CPKB 5BS7C 3AZJA 3VH5W 5CPIC 4KUDB 4J8UA 3R45B 3WTPD 1TZYA 3REHD 4YM6D 5DNMB 1P3AC 1KX4B 5AV5D 3X1TA 5CPID 2NZDC 5GSUA 3AZKA 1P3FA 1ID3C 3O62D 3KXBC 1P3AD 3UTBC 2NQBA 2F8NK 3AN2B 4CSRA 1P3BC 5B24C 1EQZD 1P3OB 2AROD 5DNNC 2NZDD 1ID3D 2F8NA 4M6BA 3KXBD 2F8NH 3UTBD 4HGAC 4JJNA 1WWIA 5B0ZA 3AFAC 5AV6B 2ZY4A 5B0YD 5B40A 1P34A 5AV8D 5CPKC 3C1BB 5BNXA 3REID 3RELB 5B1LA 3UT9A 1T3UA 5GT0A 4WU8B 3AFAD 2W8SA 4J8XC 1P3GC 1KX4C 2FJ7C 3AZLB 1A7WA 3AZNC 1W2EA 5GXQA 3NQJA 1U35A 4WU9C 4J8XD 1P3GD 1ZLAD 3B6FA 2FJ7D 3AZMA 5JRGD 4R8PB 3REKD 4KGCC 3AZND 3MGPD 5B1MB 4WU9D 1KX3C 5FUGB 1M18A 4KHAB 1N1JB 1P3LB 4KGCD 3WKJB 4YS3C 2F2AC 5AV6C 1M1AC 1B67A 1P3IB 1KX3D 3TU4A 3B0DC 4WNNA 5AY8A 3KWQB 3C1BC 4H9SA 1M19C 4YS3D 4X23C 3WTPA 1M1AD 3REHA 4YM6A 1AOIB 3B0CW 2CWEA 5AV5A 5BS7A 5AV9C 1M19D 5B33C 5CPIA 4XUJC 4X23D 2XD1A 1P3AA 4DQYB 3X1VC 5AV9D 5B33D 3AV1B 4XUJD 1P3KB 2NZDA 2CV5C 1ID3A 3W99B 3KXBA 3LELB 3UTBA 3WKJC 3X1VD 4Z66B 3A6NB 1P3BA 5B24A 4EO5C 3V9RA 2NQBD 5DNNA 2Y2KA 2CV5D 4WV4B 1S32B 3H0MC 2RIQA 3AFAA 5CPJB 3MGRC 3W96C 5CPKA 5B40D 4DRAA 3MVDB 2DF4C 3MNNC 3W98B 4J8XA 1P3GA 1KX4A 1JFIA 2HIOB 3MGRD 3MGSB 4XZQB 3LJAC 4H9OB 2FJ7A 3W96D 4H9RA 3AZNA 3LZ1C 1P3KC 3MNND 5AVBC 4QLCC 4WU9A 3LELC 1F1EA 2YFVB 5GXQD 1WWSA 3LJAD 4Z2MG 3AYWB 3FDDA 4H9PB 1KX5C 1BH9A 3B6FD 4KGCA 5B32C 3LZ1D 5CP6B 1HQ3B 1P3MB 5AVBD 4QLCD 3X1SB 1KX3A 2PYOC 1S32C 1KX5D 4YS3A 5B32D 5AV6A 1M1AA 5BO0B 5G49A 2PYOD 3C1BA 5F99B 3RELA 5BNVA 1M19A 4X23A 4WJ3C 3AZGC 4E45A 4XZQC 3AV2C 5E5AB 5AV9A 5B33A 4XUJA 5B31B 3REJC 3AZGD 4Z2MH 3VH6A 3MGQB 2XD5A 5GT3B 3X1UC 3AZHB 3AV2D 3UTAB 3X1VA 3AL0C 3VH6T 1R4VA 4J8WB 1F66C 2YFWA 3REJD 2CV5A 4LD9B 3C1CC 3X1UD 5B2IB 3NQUA 3WKJA 3EPHA 1H3OB 4H9QA 4J8VC 2BYMA 2IO5B 4H9NA 1P3PB 1F66D 1P3BD 5B24D 5B32G 5F99C 5DNND 3C1CD 1Z2CB 3H0LC 4J8VD 4CAYA 3WAAB 5JRGB 3REKB 4KUDC 5B2JB 3MGRA 3W96A 5DNMC 1TAFA 5CPKD 3MNNA 2JSSA 3WA9B 4ZUXB 4KUDD 3AZFB 3LJAA 4UUZB 1KX4D 5DNMD 4DRBA 3LZ1A 3AN2C 1P3KA 2BYKA 3VH5A 5AVBA 4LD9C 1P3OC 4QLCA 3LELA 4Z5TB 3VH5T 1KX5A 5B32A 3AN2D 3KFUG 1P3PC 3P5JB 2PYOA 2Y2OA 3H0RC 1S32A 3AZJB 4ZBJB 4J8UB 1TZYB 5B2JC 5KDMA 3RELC 3B6GB 5AV6D 4WU8C 3X1TB 2G5IC 4G92B 3AZLC 3C1BD 5GSUB 4ZUXC 3RELD 3AZKB 2Y2QA 1P3FB 3AZGA 3AZEB 2Y2JA 4XZQA 4CSRB 3AV2A 3KUYB 1HTAA 3AZLD 4R8PC 2RVQC 3REJA 2F8NB 2ZY3A 3F6TA 3LZ0B 5AVCB 4Z5TC 4NE5A 5B1MC 3X1UA 4AWLB 4JJNB 2Y2GA 5B0ZB 4WZSB 1P3LC 4R8PD 4E44A 1P34B 2RVQD 1F66A 1P3IC 4NE3A 5BNXB 3C1CA 5B1MD 1B6WA 5B1LB 3UT9B 3KWQC 4J8VA 3B6GC 5GT0B 1P3LD 3WKJD 5F99A 2BG1A 3EG5B 1P3ID 1AOIC 3KWQD 3NQJB 1U35B 3AZEC 4KUDA 3R45A 3W97B 2HUEB 3AZMB 3KUYC 3AZIB 1AOID 5DNMA 2ZY5A 1KU5A 2G5HC 2ZY2A 5B31A 3LZ0C 3AV1C 5AVCC 1M18B 3W99C 3AN2A 4Z66C 3A6NC 4LD9A 3AV1D 3TU4B 1P3OA 4WNNB 5AY8B 3B0CT 1P3KD 3W99D 3WTPB 3LELD 2VQRA 1P3PA 4Z66D 3A6ND 3REHB 4YM6B 2DQNC 5AV5B 5JA4B 5CPJC 5CPIB 1S32D 5B2JA 3MVDC 5BT1C 3W97C 3O62B 3W98C 1P3AB 3AZIC 5CPJD 4WU8A 2HIOC 3MGSC 3A1KA 1EQZB 2AROB 3AZLA 2NZDB 4ZUXA 1ID3B 3MVDD 5BT1D 3KXBB 2JCHA 3AZFA 3W98D 3UTBB 2Y2MA 2HIOD 3MGSD 3V9RB 4XZQD 5CHLB 3AYWC 5DNNB 4R8PA 5B0YB 5CP6C 5AV8B 1HQ3C 1P3MC 4Z5TA 5B1MA 3REIB 3X1SC 2FFFB 5FUGA 3AYWD 4KHAA 1N1JA 3AFAB 3WTPE 1P3LA 5CP6D 1P3IA 1HQ3D 1P3MD 3X1SD 3KWQA 3O62C 3B6GA 4J8XB 1P3GB 1ZLAB 1JFIB 2FJ7B 4H9RB 1EQZC 3AZNB 2AROC 1AOIA 3MGPB 2J8PA 5F99D 1PZRA 5E5AC 3AZEA 4WU9B 1BH8B 5B31C 3KUYA 3MGQC 1BH9B 4KGCB 3AZHC 5GT3C 5B0YC 3UTAC 5E5AD 5AV8C 1KX3B 3LZ0A 3AV1A 5AVCA 4J8WC 3REIC 5B31D 3W99A 3MGQD 4YS3B 3AZHD 5GT3D 5B2IC 1M1AB 3UTAD 2JE5A 4Z66A 3A6NA 3EPJA 2IO5C 5G49B 3B0DB 4J8WD 5BNVB 1M19B 4LD9D 1P3OD 4X23B 5B2ID 1ZLAC 3WAAC 5JRGC 3REKC 5CPJA 1P3PD 5B1LC 5AV9B 4G91B 5B33B 3MGPC 4XUJB 3MVDA 3W97A 3W98A 3WAAD 3WA9C 3AZIA 5B2JD 3X1VB 3AZFC 2HIOA 2L5AA 3MGSA 4H9OA 2NQBB 4WU8D 2Y2LA 2YFWB 3B0BA 2CV5B 1Q9CA 3WA9D 4ZUXD 3NQUB 4H9QB 3AZFD 2YFVA 2BYMB 2Y2NA 4H9NB 4EO5B 5B31G 3EPLA 3AYWA 4H9PA 5CP6A 4UPKA 1HQ3A 5B40B 1P3MA 3X1SA 5C3IB 4CAYB 2LY8A 2Y2HA 3AZJC 4Z5TD 4ZBJC 4J8UC 4NE6A 4NFTA 3MGRB 1TZYC 3W96B 5JA4A 5BO0A 4G91C 2ZM5A 1TAFB 3MNNB 3X1TC 3AZJD 3O62A 4J8UD 4G92C 1BFMA 5GSUC 3AZKC 1TZYD 5GXQB 3LJAB 1P3FC 3B6GD 1EQZA 3B6FB 2NQBC 2AROA 3LZ1B 3X1TD 2BYKB 5AVBB 5E5AA 4QLCB 5GSUD 3AZKD 1P3FD 2Y2IA 3AZED 1KX5B 3MGQA 3AZHA 5GT3A 5B32B 2UWXA 4AWLC 5B0YA 4JJNC 3UTAA 3KUYD 5B0ZC 5AV8A 2PYOB 5B40C 4J8WA 3REIA 1P34C 2F8ND 5C3IC 3LZ0D 5AVCD 5B2IA 5KDMB 3UT9C 4JJND
chains in the Genus database with same CATH topology
1H3OA 3VH6W 5B0ZD 3KSYA 5GT0C 3A1IA 1P34D 5B1LD 3UT9D 3AZGB 1ZLAA 5GXQC 3IP4C 1U35C 5GT0D 5JRGA 3REKA 3AV2B 1ULYA 3B6FC 3WAAA 2HUEC 3MGPA 3AZMC 1BH8A 3REJB 3X1UB 1U35D 3WA9A 1M18C 3W97D 3AZMD 3AZID 4UUZA 1F66B 1P3BB 5B24B 3C1CB 3TU4C 5AY8C 1M18D 4H9SC 4J8VB 2F8NG 4HGAB 3WTPC 2Y2PA 3REHC 4YM6C 3EPKA 3TU4D 5AY8D 5AV5C 5CPKB 5BS7C 3AZJA 3VH5W 5CPIC 4KUDB 4J8UA 3R45B 3WTPD 1TZYA 3REHD 4YM6D 5DNMB 1P3AC 1KX4B 5AV5D 3X1TA 5CPID 2NZDC 5GSUA 3AZKA 1P3FA 1ID3C 3O62D 3KXBC 1P3AD 3UTBC 2NQBA 2F8NK 3AN2B 4CSRA 1P3BC 5B24C 1EQZD 1P3OB 2AROD 5DNNC 2NZDD 1ID3D 2F8NA 4M6BA 3KXBD 2F8NH 3UTBD 4HGAC 4JJNA 1WWIA 5B0ZA 3AFAC 5AV6B 2ZY4A 5B0YD 5B40A 1P34A 5AV8D 5CPKC 3C1BB 5BNXA 3REID 3RELB 5B1LA 3UT9A 1T3UA 5GT0A 4WU8B 3AFAD 2W8SA 4J8XC 1P3GC 1KX4C 2FJ7C 3AZLB 1A7WA 3AZNC 1W2EA 5GXQA 3NQJA 1U35A 4WU9C 4J8XD 1P3GD 1ZLAD 3B6FA 2FJ7D 3AZMA 5JRGD 4R8PB 3REKD 4KGCC 3AZND 3MGPD 5B1MB 4WU9D 1KX3C 5FUGB 1M18A 4KHAB 1N1JB 1P3LB 4KGCD 3WKJB 4YS3C 2F2AC 5AV6C 1M1AC 1B67A 1P3IB 1KX3D 3TU4A 3B0DC 4WNNA 5AY8A 3KWQB 3C1BC 4H9SA 1M19C 4YS3D 4X23C 3WTPA 1M1AD 3REHA 4YM6A 1AOIB 3B0CW 2CWEA 5AV5A 5BS7A 5AV9C 1M19D 5B33C 5CPIA 4XUJC 4X23D 2XD1A 1P3AA 4DQYB 3X1VC 5AV9D 5B33D 3AV1B 4XUJD 1P3KB 2NZDA 2CV5C 1ID3A 3W99B 3KXBA 3LELB 3UTBA 3WKJC 3X1VD 4Z66B 3A6NB 1P3BA 5B24A 4EO5C 3V9RA 2NQBD 5DNNA 2Y2KA 2CV5D 4WV4B 1S32B 3H0MC 2RIQA 3AFAA 5CPJB 3MGRC 3W96C 5CPKA 5B40D 4DRAA 3MVDB 2DF4C 3MNNC 3W98B 4J8XA 1P3GA 1KX4A 1JFIA 2HIOB 3MGRD 3MGSB 4XZQB 3LJAC 4H9OB 2FJ7A 3W96D 4H9RA 3AZNA 3LZ1C 1P3KC 3MNND 5AVBC 4QLCC 4WU9A 3LELC 1F1EA 2YFVB 5GXQD 1WWSA 3LJAD 4Z2MG 3AYWB 3FDDA 4H9PB 1KX5C 1BH9A 3B6FD 4KGCA 5B32C 3LZ1D 5CP6B 1HQ3B 1P3MB 5AVBD 4QLCD 3X1SB 1KX3A 2PYOC 1S32C 1KX5D 4YS3A 5B32D 5AV6A 1M1AA 5BO0B 5G49A 2PYOD 3C1BA 5F99B 3RELA 5BNVA 1M19A 4X23A 4WJ3C 3AZGC 4E45A 4XZQC 3AV2C 5E5AB 5AV9A 5B33A 4XUJA 5B31B 3REJC 3AZGD 4Z2MH 3VH6A 3MGQB 2XD5A 5GT3B 3X1UC 3AZHB 3AV2D 3UTAB 3X1VA 3AL0C 3VH6T 1R4VA 4J8WB 1F66C 2YFWA 3REJD 2CV5A 4LD9B 3C1CC 3X1UD 5B2IB 3NQUA 3WKJA 3EPHA 1H3OB 4H9QA 4J8VC 2BYMA 2IO5B 4H9NA 1P3PB 1F66D 1P3BD 5B24D 5B32G 5F99C 5DNND 3C1CD 1Z2CB 3H0LC 4J8VD 4CAYA 3WAAB 5JRGB 3REKB 4KUDC 5B2JB 3MGRA 3W96A 5DNMC 1TAFA 5CPKD 3MNNA 2JSSA 3WA9B 4ZUXB 4KUDD 3AZFB 3LJAA 4UUZB 1KX4D 5DNMD 4DRBA 3LZ1A 3AN2C 1P3KA 2BYKA 3VH5A 5AVBA 4LD9C 1P3OC 4QLCA 3LELA 4Z5TB 3VH5T 1KX5A 5B32A 3AN2D 3KFUG 1P3PC 3P5JB 2PYOA 2Y2OA 3H0RC 1S32A 3AZJB 4ZBJB 4J8UB 1TZYB 5B2JC 5KDMA 3RELC 3B6GB 5AV6D 4WU8C 3X1TB 2G5IC 4G92B 3AZLC 3C1BD 5GSUB 4ZUXC 3RELD 3AZKB 2Y2QA 1P3FB 3AZGA 3AZEB 2Y2JA 4XZQA 4CSRB 3AV2A 3KUYB 1HTAA 3AZLD 4R8PC 2RVQC 3REJA 2F8NB 2ZY3A 3F6TA 3LZ0B 5AVCB 4Z5TC 4NE5A 5B1MC 3X1UA 4AWLB 4JJNB 2Y2GA 5B0ZB 4WZSB 1P3LC 4R8PD 4E44A 1P34B 2RVQD 1F66A 1P3IC 4NE3A 5BNXB 3C1CA 5B1MD 1B6WA 5B1LB 3UT9B 3KWQC 4J8VA 3B6GC 5GT0B 1P3LD 3WKJD 5F99A 2BG1A 3EG5B 1P3ID 1AOIC 3KWQD 3NQJB 1U35B 3AZEC 4KUDA 3R45A 3W97B 2HUEB 3AZMB 3KUYC 3AZIB 1AOID 5DNMA 2ZY5A 1KU5A 2G5HC 2ZY2A 5B31A 3LZ0C 3AV1C 5AVCC 1M18B 3W99C 3AN2A 4Z66C 3A6NC 4LD9A 3AV1D 3TU4B 1P3OA 4WNNB 5AY8B 3B0CT 1P3KD 3W99D 3WTPB 3LELD 2VQRA 1P3PA 4Z66D 3A6ND 3REHB 4YM6B 2DQNC 5AV5B 5JA4B 5CPJC 5CPIB 1S32D 5B2JA 3MVDC 5BT1C 3W97C 3O62B 3W98C 1P3AB 3AZIC 5CPJD 4WU8A 2HIOC 3MGSC 3A1KA 1EQZB 2AROB 3AZLA 2NZDB 4ZUXA 1ID3B 3MVDD 5BT1D 3KXBB 2JCHA 3AZFA 3W98D 3UTBB 2Y2MA 2HIOD 3MGSD 3V9RB 4XZQD 5CHLB 3AYWC 5DNNB 4R8PA 5B0YB 5CP6C 5AV8B 1HQ3C 1P3MC 4Z5TA 5B1MA 3REIB 3X1SC 2FFFB 5FUGA 3AYWD 4KHAA 1N1JA 3AFAB 3WTPE 1P3LA 5CP6D 1P3IA 1HQ3D 1P3MD 3X1SD 3KWQA 3O62C 3B6GA 4J8XB 1P3GB 1ZLAB 1JFIB 2FJ7B 4H9RB 1EQZC 3AZNB 2AROC 1AOIA 3MGPB 2J8PA 5F99D 1PZRA 5E5AC 3AZEA 4WU9B 1BH8B 5B31C 3KUYA 3MGQC 1BH9B 4KGCB 3AZHC 5GT3C 5B0YC 3UTAC 5E5AD 5AV8C 1KX3B 3LZ0A 3AV1A 5AVCA 4J8WC 3REIC 5B31D 3W99A 3MGQD 4YS3B 3AZHD 5GT3D 5B2IC 1M1AB 3UTAD 2JE5A 4Z66A 3A6NA 3EPJA 2IO5C 5G49B 3B0DB 4J8WD 5BNVB 1M19B 4LD9D 1P3OD 4X23B 5B2ID 1ZLAC 3WAAC 5JRGC 3REKC 5CPJA 1P3PD 5B1LC 5AV9B 4G91B 5B33B 3MGPC 4XUJB 3MVDA 3W97A 3W98A 3WAAD 3WA9C 3AZIA 5B2JD 3X1VB 3AZFC 2HIOA 2L5AA 3MGSA 4H9OA 2NQBB 4WU8D 2Y2LA 2YFWB 3B0BA 2CV5B 1Q9CA 3WA9D 4ZUXD 3NQUB 4H9QB 3AZFD 2YFVA 2BYMB 2Y2NA 4H9NB 4EO5B 5B31G 3EPLA 3AYWA 4H9PA 5CP6A 4UPKA 1HQ3A 5B40B 1P3MA 3X1SA 5C3IB 4CAYB 2LY8A 2Y2HA 3AZJC 4Z5TD 4ZBJC 4J8UC 4NE6A 4NFTA 3MGRB 1TZYC 3W96B 5JA4A 5BO0A 4G91C 2ZM5A 1TAFB 3MNNB 3X1TC 3AZJD 3O62A 4J8UD 4G92C 1BFMA 5GSUC 3AZKC 1TZYD 5GXQB 3LJAB 1P3FC 3B6GD 1EQZA 3B6FB 2NQBC 2AROA 3LZ1B 3X1TD 2BYKB 5AVBB 5E5AA 4QLCB 5GSUD 3AZKD 1P3FD 2Y2IA 3AZED 1KX5B 3MGQA 3AZHA 5GT3A 5B32B 2UWXA 4AWLC 5B0YA 4JJNC 3UTAA 3KUYD 5B0ZC 5AV8A 2PYOB 5B40C 4J8WA 3REIA 1P34C 2F8ND 5C3IC 3LZ0D 5AVCD 5B2IA 5KDMB 3UT9C 4JJND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3O A;  3VH6 W;  5B0Z D;  3KSY A;  5GT0 C;  1P34 D;  5B1L D;  3UT9 D;  3AZG B;  1ZLA A;  5GXQ C;  1U35 C;  5GT0 D;  5JRG A;  3REK A;  3AV2 B;  1ULY A;  3B6F C;  3WAA A;  2HUE C;  3MGP A;  3AZM C;  1BH8 A;  3REJ B;  3X1U B;  1U35 D;  3WA9 A;  1M18 C;  3W97 D;  3AZM D;  3AZI D;  4UUZ A;  1F66 B;  1P3B B;  5B24 B;  3C1C B;  3TU4 C;  5AY8 C;  1M18 D;  4H9S C;  4J8V B;  2F8N G;  4HGA B;  3WTP C;  3REH C;  4YM6 C;  3TU4 D;  5AY8 D;  5AV5 C;  5CPK B;  5BS7 C;  3AZJ A;  3VH5 W;  5CPI C;  4KUD B;  4J8U A;  3R45 B;  3WTP D;  1TZY A;  3REH D;  4YM6 D;  5DNM B;  1P3A C;  1KX4 B;  5AV5 D;  3X1T A;  5CPI D;  2NZD C;  5GSU A;  3AZK A;  1P3F A;  1ID3 C;  3O62 D;  3KXB C;  1P3A D;  3UTB C;  2NQB A;  2F8N K;  3AN2 B;  4CSR A;  1P3B C;  5B24 C;  1EQZ D;  1P3O B;  2ARO D;  5DNN C;  2NZD D;  1ID3 D;  2F8N A;  4M6B A;  3KXB D;  2F8N H;  3UTB D;  4HGA C;  4JJN A;  1WWI A;  5B0Z A;  3AFA C;  5AV6 B;  5B40 A;  5B0Y D;  1P34 A;  5AV8 D;  5CPK C;  3C1B B;  5BNX A;  3REI D;  3REL B;  5B1L A;  3UT9 A;  5GT0 A;  4WU8 B;  3AFA D;  4J8X C;  1P3G C;  1KX4 C;  2FJ7 C;  3AZL B;  1A7W A;  3AZN C;  5GXQ A;  3NQJ A;  1U35 A;  4WU9 C;  4J8X D;  1P3G D;  1ZLA D;  3B6F A;  2FJ7 D;  3AZM A;  5JRG D;  4R8P B;  3REK D;  4KGC C;  3AZN D;  3MGP D;  5B1M B;  4WU9 D;  1KX3 C;  5FUG B;  1M18 A;  4KHA B;  1N1J B;  1P3L B;  4KGC D;  3WKJ B;  4YS3 C;  5AV6 C;  1M1A C;  1B67 A;  1P3I B;  1KX3 D;  3TU4 A;  3B0D C;  4WNN A;  5AY8 A;  3KWQ B;  3C1B C;  4H9S A;  1M19 C;  4YS3 D;  4X23 C;  3WTP A;  1M1A D;  3REH A;  4YM6 A;  1AOI B;  2CWE A;  3B0C W;  5AV5 A;  5BS7 A;  5AV9 C;  1M19 D;  5B33 C;  5CPI A;  4XUJ C;  4X23 D;  1P3A A;  3X1V C;  5AV9 D;  5B33 D;  3AV1 B;  4XUJ D;  1P3K B;  2NZD A;  2CV5 C;  1ID3 A;  3W99 B;  3KXB A;  3LEL B;  3UTB A;  3WKJ C;  3X1V D;  4Z66 B;  3A6N B;  1P3B A;  5B24 A;  4EO5 C;  3V9R A;  2NQB D;  5DNN A;  2CV5 D;  4WV4 B;  1S32 B;  3AFA A;  5CPJ B;  3MGR C;  3W96 C;  5CPK A;  5B40 D;  4DRA A;  3MVD B;  3MNN C;  3W98 B;  4J8X A;  1P3G A;  1KX4 A;  1JFI A;  2HIO B;  3MGR D;  3MGS B;  4XZQ B;  3LJA C;  4H9O B;  2FJ7 A;  3W96 D;  4H9R A;  3AZN A;  3LZ1 C;  1P3K C;  3MNN D;  5AVB C;  4QLC C;  4WU9 A;  3LEL C;  1F1E A;  2YFV B;  5GXQ D;  1WWS A;  3LJA D;  4Z2M G;  3AYW B;  4H9P B;  1KX5 C;  1BH9 A;  3B6F D;  4KGC A;  5B32 C;  3LZ1 D;  5CP6 B;  1HQ3 B;  1P3M B;  5AVB D;  4QLC D;  3X1S B;  1KX3 A;  2PYO C;  1S32 C;  1KX5 D;  4YS3 A;  5B32 D;  5AV6 A;  1M1A A;  5BO0 B;  5G49 A;  2PYO D;  3C1B A;  5F99 B;  3REL A;  5BNV A;  1M19 A;  4X23 A;  3AZG C;  4E45 A;  4XZQ C;  3AV2 C;  5E5A B;  5AV9 A;  5B33 A;  4XUJ A;  5B31 B;  3REJ C;  3AZG D;  4Z2M H;  3VH6 A;  3MGQ B;  3AZH B;  5GT3 B;  3X1U C;  3AV2 D;  3UTA B;  3X1V A;  3VH6 T;  1R4V A;  4J8W B;  1F66 C;  2YFW A;  3REJ D;  2CV5 A;  4LD9 B;  3C1C C;  3X1U D;  5B2I B;  3NQU A;  3WKJ A;  1H3O B;  4H9Q A;  4J8V C;  2BYM A;  2IO5 B;  4H9N A;  1P3P B;  1F66 D;  1P3B D;  5B24 D;  5B32 G;  5F99 C;  5DNN D;  3C1C D;  4J8V D;  4CAY A;  3WAA B;  5JRG B;  3REK B;  4KUD C;  5B2J B;  3MGR A;  3W96 A;  5DNM C;  1TAF A;  5CPK D;  3MNN A;  2JSS A;  3WA9 B;  4ZUX B;  4KUD D;  3AZF B;  3LJA A;  4UUZ B;  1KX4 D;  5DNM D;  4DRB A;  3LZ1 A;  3AN2 C;  1P3K A;  2BYK A;  3VH5 A;  5AVB A;  4LD9 C;  1P3O C;  4QLC A;  3LEL A;  4Z5T B;  3VH5 T;  1KX5 A;  5B32 A;  3AN2 D;  1P3P C;  2PYO A;  1S32 A;  3AZJ B;  4ZBJ B;  4J8U B;  1TZY B;  5B2J C;  5KDM A;  3REL C;  3B6G B;  5AV6 D;  4WU8 C;  3X1T B;  4G92 B;  3AZL C;  3C1B D;  5GSU B;  4ZUX C;  3REL D;  3AZK B;  1P3F B;  3AZG A;  3AZE B;  4XZQ A;  4CSR B;  3AV2 A;  3KUY B;  1HTA A;  3AZL D;  4R8P C;  2RVQ C;  3REJ A;  2F8N B;  3LZ0 B;  5AVC B;  4Z5T C;  4NE5 A;  5B1M C;  3X1U A;  4AWL B;  4JJN B;  5B0Z B;  4WZS B;  1P3L C;  4R8P D;  4E44 A;  1P34 B;  2RVQ D;  1F66 A;  1P3I C;  4NE3 A;  5BNX B;  3C1C A;  5B1M D;  1B6W A;  5B1L B;  3UT9 B;  3KWQ C;  4J8V A;  3B6G C;  5GT0 B;  1P3L D;  3WKJ D;  5F99 A;  1P3I D;  1AOI C;  3KWQ D;  3NQJ B;  1U35 B;  3AZE C;  4KUD A;  3R45 A;  3W97 B;  2HUE B;  3AZM B;  3KUY C;  3AZI B;  1AOI D;  5DNM A;  1KU5 A;  5B31 A;  3LZ0 C;  3AV1 C;  5AVC C;  1M18 B;  3W99 C;  3AN2 A;  4Z66 C;  3A6N C;  4LD9 A;  3AV1 D;  3TU4 B;  1P3O A;  4WNN B;  5AY8 B;  3B0C T;  1P3K D;  3W99 D;  3WTP B;  3LEL D;  1P3P A;  4Z66 D;  3A6N D;  3REH B;  4YM6 B;  5CPJ C;  5AV5 B;  5JA4 B;  5CPI B;  1S32 D;  5B2J A;  3MVD C;  5BT1 C;  3W97 C;  3O62 B;  3W98 C;  1P3A B;  3AZI C;  5CPJ D;  4WU8 A;  2HIO C;  3MGS C;  1EQZ B;  2ARO B;  3AZL A;  2NZD B;  4ZUX A;  1ID3 B;  3MVD D;  5BT1 D;  3KXB B;  3AZF A;  3W98 D;  3UTB B;  2HIO D;  3MGS D;  3V9R B;  4XZQ D;  5CHL B;  3AYW C;  5DNN B;  4R8P A;  5B0Y B;  5CP6 C;  5AV8 B;  1HQ3 C;  1P3M C;  4Z5T A;  5B1M A;  3REI B;  3X1S C;  5FUG A;  3AYW D;  4KHA A;  1N1J A;  3AFA B;  3WTP E;  1P3L A;  5CP6 D;  1P3I A;  1HQ3 D;  1P3M D;  3X1S D;  3KWQ A;  3O62 C;  3B6G A;  4J8X B;  1P3G B;  1ZLA B;  1JFI B;  2FJ7 B;  4H9R B;  1EQZ C;  3AZN B;  2ARO C;  1AOI A;  3MGP B;  5F99 D;  5E5A C;  3AZE A;  4WU9 B;  1BH8 B;  5B31 C;  3KUY A;  3MGQ C;  1BH9 B;  4KGC B;  3AZH C;  5GT3 C;  5B0Y C;  3UTA C;  5E5A D;  5AV8 C;  1KX3 B;  3LZ0 A;  3AV1 A;  5AVC A;  4J8W C;  3REI C;  5B31 D;  3W99 A;  3MGQ D;  4YS3 B;  3AZH D;  5GT3 D;  5B2I C;  1M1A B;  3UTA D;  4Z66 A;  3A6N A;  2IO5 C;  5G49 B;  3B0D B;  4J8W D;  5BNV B;  1M19 B;  4LD9 D;  1P3O D;  4X23 B;  5B2I D;  1ZLA C;  3WAA C;  5JRG C;  3REK C;  5CPJ A;  1P3P D;  5B1L C;  5AV9 B;  4G91 B;  5B33 B;  3MGP C;  4XUJ B;  3MVD A;  3W97 A;  3W98 A;  3WAA D;  3WA9 C;  3AZI A;  5B2J D;  3X1V B;  3AZF C;  2HIO A;  2L5A A;  3MGS A;  4H9O A;  2NQB B;  4WU8 D;  2YFW B;  3B0B A;  2CV5 B;  1Q9C A;  3WA9 D;  4ZUX D;  3NQU B;  4H9Q B;  3AZF D;  2YFV A;  2BYM B;  4H9N B;  4EO5 B;  5B31 G;  3AYW A;  4H9P A;  5CP6 A;  1HQ3 A;  5B40 B;  1P3M A;  3X1S A;  5C3I B;  4CAY B;  2LY8 A;  3AZJ C;  4Z5T D;  4ZBJ C;  4J8U C;  4NE6 A;  4NFT A;  3MGR B;  1TZY C;  3W96 B;  5JA4 A;  5BO0 A;  4G91 C;  1TAF B;  3MNN B;  3X1T C;  3AZJ D;  3O62 A;  4J8U D;  4G92 C;  1BFM A;  5GSU C;  3AZK C;  1TZY D;  5GXQ B;  3LJA B;  1P3F C;  3B6G D;  1EQZ A;  3B6F B;  2NQB C;  2ARO A;  3LZ1 B;  3X1T D;  2BYK B;  5AVB B;  5E5A A;  4QLC B;  5GSU D;  3AZK D;  1P3F D;  3AZE D;  1KX5 B;  3MGQ A;  3AZH A;  5GT3 A;  5B32 B;  4AWL C;  5B0Y A;  4JJN C;  3UTA A;  3KUY D;  5B0Z C;  5AV8 A;  2PYO B;  5B40 C;  4J8W A;  3REI A;  1P34 C;  2F8N D;  5C3I C;  3LZ0 D;  5AVC D;  5B2I A;  5KDM B;  3UT9 C;  4JJN D; 
#chains in the Genus database with same CATH topology
 1H3O A;  3VH6 W;  5B0Z D;  3KSY A;  5GT0 C;  3A1I A;  1P34 D;  5B1L D;  3UT9 D;  3AZG B;  1ZLA A;  5GXQ C;  3IP4 C;  1U35 C;  5GT0 D;  5JRG A;  3REK A;  3AV2 B;  1ULY A;  3B6F C;  3WAA A;  2HUE C;  3MGP A;  3AZM C;  1BH8 A;  3REJ B;  3X1U B;  1U35 D;  3WA9 A;  1M18 C;  3W97 D;  3AZM D;  3AZI D;  4UUZ A;  1F66 B;  1P3B B;  5B24 B;  3C1C B;  3TU4 C;  5AY8 C;  1M18 D;  4H9S C;  4J8V B;  2F8N G;  4HGA B;  3WTP C;  2Y2P A;  3REH C;  4YM6 C;  3EPK A;  3TU4 D;  5AY8 D;  5AV5 C;  5CPK B;  5BS7 C;  3AZJ A;  3VH5 W;  5CPI C;  4KUD B;  4J8U A;  3R45 B;  3WTP D;  1TZY A;  3REH D;  4YM6 D;  5DNM B;  1P3A C;  1KX4 B;  5AV5 D;  3X1T A;  5CPI D;  2NZD C;  5GSU A;  3AZK A;  1P3F A;  1ID3 C;  3O62 D;  3KXB C;  1P3A D;  3UTB C;  2NQB A;  2F8N K;  3AN2 B;  4CSR A;  1P3B C;  5B24 C;  1EQZ D;  1P3O B;  2ARO D;  5DNN C;  2NZD D;  1ID3 D;  2F8N A;  4M6B A;  3KXB D;  2F8N H;  3UTB D;  4HGA C;  4JJN A;  1WWI A;  5B0Z A;  3AFA C;  5AV6 B;  2ZY4 A;  5B0Y D;  5B40 A;  1P34 A;  5AV8 D;  5CPK C;  3C1B B;  5BNX A;  3REI D;  3REL B;  5B1L A;  3UT9 A;  1T3U A;  5GT0 A;  4WU8 B;  3AFA D;  2W8S A;  4J8X C;  1P3G C;  1KX4 C;  2FJ7 C;  3AZL B;  1A7W A;  3AZN C;  1W2E A;  5GXQ A;  3NQJ A;  1U35 A;  4WU9 C;  4J8X D;  1P3G D;  1ZLA D;  3B6F A;  2FJ7 D;  3AZM A;  5JRG D;  4R8P B;  3REK D;  4KGC C;  3AZN D;  3MGP D;  5B1M B;  4WU9 D;  1KX3 C;  5FUG B;  1M18 A;  4KHA B;  1N1J B;  1P3L B;  4KGC D;  3WKJ B;  4YS3 C;  2F2A C;  5AV6 C;  1M1A C;  1B67 A;  1P3I B;  1KX3 D;  3TU4 A;  3B0D C;  4WNN A;  5AY8 A;  3KWQ B;  3C1B C;  4H9S A;  1M19 C;  4YS3 D;  4X23 C;  3WTP A;  1M1A D;  3REH A;  4YM6 A;  1AOI B;  3B0C W;  2CWE A;  5AV5 A;  5BS7 A;  5AV9 C;  1M19 D;  5B33 C;  5CPI A;  4XUJ C;  4X23 D;  2XD1 A;  1P3A A;  4DQY B;  3X1V C;  5AV9 D;  5B33 D;  3AV1 B;  4XUJ D;  1P3K B;  2NZD A;  2CV5 C;  1ID3 A;  3W99 B;  3KXB A;  3LEL B;  3UTB A;  3WKJ C;  3X1V D;  4Z66 B;  3A6N B;  1P3B A;  5B24 A;  4EO5 C;  3V9R A;  2NQB D;  5DNN A;  2Y2K A;  2CV5 D;  4WV4 B;  1S32 B;  3H0M C;  2RIQ A;  3AFA A;  5CPJ B;  3MGR C;  3W96 C;  5CPK A;  5B40 D;  4DRA A;  3MVD B;  2DF4 C;  3MNN C;  3W98 B;  4J8X A;  1P3G A;  1KX4 A;  1JFI A;  2HIO B;  3MGR D;  3MGS B;  4XZQ B;  3LJA C;  4H9O B;  2FJ7 A;  3W96 D;  4H9R A;  3AZN A;  3LZ1 C;  1P3K C;  3MNN D;  5AVB C;  4QLC C;  4WU9 A;  3LEL C;  1F1E A;  2YFV B;  5GXQ D;  1WWS A;  3LJA D;  4Z2M G;  3AYW B;  3FDD A;  4H9P B;  1KX5 C;  1BH9 A;  3B6F D;  4KGC A;  5B32 C;  3LZ1 D;  5CP6 B;  1HQ3 B;  1P3M B;  5AVB D;  4QLC D;  3X1S B;  1KX3 A;  2PYO C;  1S32 C;  1KX5 D;  4YS3 A;  5B32 D;  5AV6 A;  1M1A A;  5BO0 B;  5G49 A;  2PYO D;  3C1B A;  5F99 B;  3REL A;  5BNV A;  1M19 A;  4X23 A;  4WJ3 C;  3AZG C;  4E45 A;  4XZQ C;  3AV2 C;  5E5A B;  5AV9 A;  5B33 A;  4XUJ A;  5B31 B;  3REJ C;  3AZG D;  4Z2M H;  3VH6 A;  3MGQ B;  2XD5 A;  5GT3 B;  3X1U C;  3AZH B;  3AV2 D;  3UTA B;  3X1V A;  3AL0 C;  3VH6 T;  1R4V A;  4J8W B;  1F66 C;  2YFW A;  3REJ D;  2CV5 A;  4LD9 B;  3C1C C;  3X1U D;  5B2I B;  3NQU A;  3WKJ A;  3EPH A;  1H3O B;  4H9Q A;  4J8V C;  2BYM A;  2IO5 B;  4H9N A;  1P3P B;  1F66 D;  1P3B D;  5B24 D;  5B32 G;  5F99 C;  5DNN D;  3C1C D;  1Z2C B;  3H0L C;  4J8V D;  4CAY A;  3WAA B;  5JRG B;  3REK B;  4KUD C;  5B2J B;  3MGR A;  3W96 A;  5DNM C;  1TAF A;  5CPK D;  3MNN A;  2JSS A;  3WA9 B;  4ZUX B;  4KUD D;  3AZF B;  3LJA A;  4UUZ B;  1KX4 D;  5DNM D;  4DRB A;  3LZ1 A;  3AN2 C;  1P3K A;  2BYK A;  3VH5 A;  5AVB A;  4LD9 C;  1P3O C;  4QLC A;  3LEL A;  4Z5T B;  3VH5 T;  1KX5 A;  5B32 A;  3AN2 D;  3KFU G;  1P3P C;  3P5J B;  2PYO A;  2Y2O A;  3H0R C;  1S32 A;  3AZJ B;  4ZBJ B;  4J8U B;  1TZY B;  5B2J C;  5KDM A;  3REL C;  3B6G B;  5AV6 D;  4WU8 C;  3X1T B;  2G5I C;  4G92 B;  3AZL C;  3C1B D;  5GSU B;  4ZUX C;  3REL D;  3AZK B;  2Y2Q A;  1P3F B;  3AZG A;  3AZE B;  2Y2J A;  4XZQ A;  4CSR B;  3AV2 A;  3KUY B;  1HTA A;  3AZL D;  4R8P C;  2RVQ C;  3REJ A;  2F8N B;  2ZY3 A;  3F6T A;  3LZ0 B;  5AVC B;  4Z5T C;  4NE5 A;  5B1M C;  3X1U A;  4AWL B;  4JJN B;  2Y2G A;  5B0Z B;  4WZS B;  1P3L C;  4R8P D;  4E44 A;  1P34 B;  2RVQ D;  1F66 A;  1P3I C;  4NE3 A;  5BNX B;  3C1C A;  5B1M D;  1B6W A;  5B1L B;  3UT9 B;  3KWQ C;  4J8V A;  3B6G C;  5GT0 B;  1P3L D;  3WKJ D;  5F99 A;  2BG1 A;  3EG5 B;  1P3I D;  1AOI C;  3KWQ D;  3NQJ B;  1U35 B;  3AZE C;  4KUD A;  3R45 A;  3W97 B;  2HUE B;  3AZM B;  3KUY C;  3AZI B;  1AOI D;  5DNM A;  2ZY5 A;  1KU5 A;  2G5H C;  2ZY2 A;  5B31 A;  3LZ0 C;  3AV1 C;  5AVC C;  1M18 B;  3W99 C;  3AN2 A;  4Z66 C;  3A6N C;  4LD9 A;  3AV1 D;  3TU4 B;  1P3O A;  4WNN B;  5AY8 B;  3B0C T;  1P3K D;  3W99 D;  3WTP B;  3LEL D;  2VQR A;  1P3P A;  4Z66 D;  3A6N D;  3REH B;  4YM6 B;  2DQN C;  5AV5 B;  5JA4 B;  5CPJ C;  5CPI B;  1S32 D;  5B2J A;  3MVD C;  5BT1 C;  3W97 C;  3O62 B;  3W98 C;  1P3A B;  3AZI C;  5CPJ D;  4WU8 A;  2HIO C;  3MGS C;  3A1K A;  1EQZ B;  2ARO B;  3AZL A;  2NZD B;  4ZUX A;  1ID3 B;  3MVD D;  5BT1 D;  3KXB B;  2JCH A;  3AZF A;  3W98 D;  3UTB B;  2Y2M A;  2HIO D;  3MGS D;  3V9R B;  4XZQ D;  5CHL B;  3AYW C;  5DNN B;  4R8P A;  5B0Y B;  5CP6 C;  5AV8 B;  1HQ3 C;  1P3M C;  4Z5T A;  5B1M A;  3REI B;  3X1S C;  2FFF B;  5FUG A;  3AYW D;  4KHA A;  1N1J A;  3AFA B;  3WTP E;  1P3L A;  5CP6 D;  1P3I A;  1HQ3 D;  1P3M D;  3X1S D;  3KWQ A;  3O62 C;  3B6G A;  4J8X B;  1P3G B;  1ZLA B;  1JFI B;  2FJ7 B;  4H9R B;  1EQZ C;  3AZN B;  2ARO C;  1AOI A;  3MGP B;  2J8P A;  5F99 D;  1PZR A;  5E5A C;  3AZE A;  4WU9 B;  1BH8 B;  5B31 C;  3KUY A;  3MGQ C;  1BH9 B;  4KGC B;  3AZH C;  5GT3 C;  5B0Y C;  3UTA C;  5E5A D;  5AV8 C;  1KX3 B;  3LZ0 A;  3AV1 A;  5AVC A;  4J8W C;  3REI C;  5B31 D;  3W99 A;  3MGQ D;  4YS3 B;  3AZH D;  5GT3 D;  5B2I C;  1M1A B;  3UTA D;  2JE5 A;  4Z66 A;  3A6N A;  3EPJ A;  2IO5 C;  5G49 B;  3B0D B;  4J8W D;  5BNV B;  1M19 B;  4LD9 D;  1P3O D;  4X23 B;  5B2I D;  1ZLA C;  3WAA C;  5JRG C;  3REK C;  5CPJ A;  1P3P D;  5B1L C;  5AV9 B;  4G91 B;  5B33 B;  3MGP C;  4XUJ B;  3MVD A;  3W97 A;  3W98 A;  3WAA D;  3WA9 C;  3AZI A;  5B2J D;  3X1V B;  3AZF C;  2HIO A;  2L5A A;  3MGS A;  4H9O A;  2NQB B;  4WU8 D;  2Y2L A;  2YFW B;  3B0B A;  2CV5 B;  1Q9C A;  3WA9 D;  4ZUX D;  3NQU B;  4H9Q B;  3AZF D;  2YFV A;  2BYM B;  2Y2N A;  4H9N B;  4EO5 B;  5B31 G;  3EPL A;  3AYW A;  4H9P A;  5CP6 A;  4UPK A;  1HQ3 A;  5B40 B;  1P3M A;  3X1S A;  5C3I B;  4CAY B;  2LY8 A;  2Y2H A;  3AZJ C;  4Z5T D;  4ZBJ C;  4J8U C;  4NE6 A;  4NFT A;  3MGR B;  1TZY C;  3W96 B;  5JA4 A;  5BO0 A;  4G91 C;  2ZM5 A;  1TAF B;  3MNN B;  3X1T C;  3AZJ D;  3O62 A;  4J8U D;  4G92 C;  1BFM A;  5GSU C;  3AZK C;  1TZY D;  5GXQ B;  3LJA B;  1P3F C;  3B6G D;  1EQZ A;  3B6F B;  2NQB C;  2ARO A;  3LZ1 B;  3X1T D;  2BYK B;  5AVB B;  5E5A A;  4QLC B;  5GSU D;  3AZK D;  1P3F D;  2Y2I A;  3AZE D;  1KX5 B;  3MGQ A;  3AZH A;  5GT3 A;  5B32 B;  2UWX A;  4AWL C;  5B0Y A;  4JJN C;  3UTA A;  3KUY D;  5B0Z C;  5AV8 A;  2PYO B;  5B40 C;  4J8W A;  3REI A;  1P34 C;  2F8N D;  5C3I C;  3LZ0 D;  5AVC D;  5B2I A;  5KDM B;  3UT9 C;  4JJN D; 
#chains in the Genus database with same CATH homology
 1H3O A;  3VH6 W;  5B0Z D;  3KSY A;  5GT0 C;  3A1I A;  1P34 D;  5B1L D;  3UT9 D;  3AZG B;  1ZLA A;  5GXQ C;  3IP4 C;  1U35 C;  5GT0 D;  5JRG A;  3REK A;  3AV2 B;  1ULY A;  3B6F C;  3WAA A;  2HUE C;  3MGP A;  3AZM C;  1BH8 A;  3REJ B;  3X1U B;  1U35 D;  3WA9 A;  1M18 C;  3W97 D;  3AZM D;  3AZI D;  4UUZ A;  1F66 B;  1P3B B;  5B24 B;  3C1C B;  3TU4 C;  5AY8 C;  1M18 D;  4H9S C;  4J8V B;  2F8N G;  4HGA B;  3WTP C;  2Y2P A;  3REH C;  4YM6 C;  3EPK A;  3TU4 D;  5AY8 D;  5AV5 C;  5CPK B;  5BS7 C;  3AZJ A;  3VH5 W;  5CPI C;  4KUD B;  4J8U A;  3R45 B;  3WTP D;  1TZY A;  3REH D;  4YM6 D;  5DNM B;  1P3A C;  1KX4 B;  5AV5 D;  3X1T A;  5CPI D;  2NZD C;  5GSU A;  3AZK A;  1P3F A;  1ID3 C;  3O62 D;  3KXB C;  1P3A D;  3UTB C;  2NQB A;  2F8N K;  3AN2 B;  4CSR A;  1P3B C;  5B24 C;  1EQZ D;  1P3O B;  2ARO D;  5DNN C;  2NZD D;  1ID3 D;  2F8N A;  4M6B A;  3KXB D;  2F8N H;  3UTB D;  4HGA C;  4JJN A;  1WWI A;  5B0Z A;  3AFA C;  5AV6 B;  2ZY4 A;  5B0Y D;  5B40 A;  1P34 A;  5AV8 D;  5CPK C;  3C1B B;  5BNX A;  3REI D;  3REL B;  5B1L A;  3UT9 A;  1T3U A;  5GT0 A;  4WU8 B;  3AFA D;  2W8S A;  4J8X C;  1P3G C;  1KX4 C;  2FJ7 C;  3AZL B;  1A7W A;  3AZN C;  1W2E A;  5GXQ A;  3NQJ A;  1U35 A;  4WU9 C;  4J8X D;  1P3G D;  1ZLA D;  3B6F A;  2FJ7 D;  3AZM A;  5JRG D;  4R8P B;  3REK D;  4KGC C;  3AZN D;  3MGP D;  5B1M B;  4WU9 D;  1KX3 C;  5FUG B;  1M18 A;  4KHA B;  1N1J B;  1P3L B;  4KGC D;  3WKJ B;  4YS3 C;  2F2A C;  5AV6 C;  1M1A C;  1B67 A;  1P3I B;  1KX3 D;  3TU4 A;  3B0D C;  4WNN A;  5AY8 A;  3KWQ B;  3C1B C;  4H9S A;  1M19 C;  4YS3 D;  4X23 C;  3WTP A;  1M1A D;  3REH A;  4YM6 A;  1AOI B;  3B0C W;  2CWE A;  5AV5 A;  5BS7 A;  5AV9 C;  1M19 D;  5B33 C;  5CPI A;  4XUJ C;  4X23 D;  2XD1 A;  1P3A A;  4DQY B;  3X1V C;  5AV9 D;  5B33 D;  3AV1 B;  4XUJ D;  1P3K B;  2NZD A;  2CV5 C;  1ID3 A;  3W99 B;  3KXB A;  3LEL B;  3UTB A;  3WKJ C;  3X1V D;  4Z66 B;  3A6N B;  1P3B A;  5B24 A;  4EO5 C;  3V9R A;  2NQB D;  5DNN A;  2Y2K A;  2CV5 D;  4WV4 B;  1S32 B;  3H0M C;  2RIQ A;  3AFA A;  5CPJ B;  3MGR C;  3W96 C;  5CPK A;  5B40 D;  4DRA A;  3MVD B;  2DF4 C;  3MNN C;  3W98 B;  4J8X A;  1P3G A;  1KX4 A;  1JFI A;  2HIO B;  3MGR D;  3MGS B;  4XZQ B;  3LJA C;  4H9O B;  2FJ7 A;  3W96 D;  4H9R A;  3AZN A;  3LZ1 C;  1P3K C;  3MNN D;  5AVB C;  4QLC C;  4WU9 A;  3LEL C;  1F1E A;  2YFV B;  5GXQ D;  1WWS A;  3LJA D;  4Z2M G;  3AYW B;  3FDD A;  4H9P B;  1KX5 C;  1BH9 A;  3B6F D;  4KGC A;  5B32 C;  3LZ1 D;  5CP6 B;  1HQ3 B;  1P3M B;  5AVB D;  4QLC D;  3X1S B;  1KX3 A;  2PYO C;  1S32 C;  1KX5 D;  4YS3 A;  5B32 D;  5AV6 A;  1M1A A;  5BO0 B;  5G49 A;  2PYO D;  3C1B A;  5F99 B;  3REL A;  5BNV A;  1M19 A;  4X23 A;  4WJ3 C;  3AZG C;  4E45 A;  4XZQ C;  3AV2 C;  5E5A B;  5AV9 A;  5B33 A;  4XUJ A;  5B31 B;  3REJ C;  3AZG D;  4Z2M H;  3VH6 A;  3MGQ B;  2XD5 A;  5GT3 B;  3X1U C;  3AZH B;  3AV2 D;  3UTA B;  3X1V A;  3AL0 C;  3VH6 T;  1R4V A;  4J8W B;  1F66 C;  2YFW A;  3REJ D;  2CV5 A;  4LD9 B;  3C1C C;  3X1U D;  5B2I B;  3NQU A;  3WKJ A;  3EPH A;  1H3O B;  4H9Q A;  4J8V C;  2BYM A;  2IO5 B;  4H9N A;  1P3P B;  1F66 D;  1P3B D;  5B24 D;  5B32 G;  5F99 C;  5DNN D;  3C1C D;  1Z2C B;  3H0L C;  4J8V D;  4CAY A;  3WAA B;  5JRG B;  3REK B;  4KUD C;  5B2J B;  3MGR A;  3W96 A;  5DNM C;  1TAF A;  5CPK D;  3MNN A;  2JSS A;  3WA9 B;  4ZUX B;  4KUD D;  3AZF B;  3LJA A;  4UUZ B;  1KX4 D;  5DNM D;  4DRB A;  3LZ1 A;  3AN2 C;  1P3K A;  2BYK A;  3VH5 A;  5AVB A;  4LD9 C;  1P3O C;  4QLC A;  3LEL A;  4Z5T B;  3VH5 T;  1KX5 A;  5B32 A;  3AN2 D;  3KFU G;  1P3P C;  3P5J B;  2PYO A;  2Y2O A;  3H0R C;  1S32 A;  3AZJ B;  4ZBJ B;  4J8U B;  1TZY B;  5B2J C;  5KDM A;  3REL C;  3B6G B;  5AV6 D;  4WU8 C;  3X1T B;  2G5I C;  4G92 B;  3AZL C;  3C1B D;  5GSU B;  4ZUX C;  3REL D;  3AZK B;  2Y2Q A;  1P3F B;  3AZG A;  3AZE B;  2Y2J A;  4XZQ A;  4CSR B;  3AV2 A;  3KUY B;  1HTA A;  3AZL D;  4R8P C;  2RVQ C;  3REJ A;  2F8N B;  2ZY3 A;  3F6T A;  3LZ0 B;  5AVC B;  4Z5T C;  4NE5 A;  5B1M C;  3X1U A;  4AWL B;  4JJN B;  2Y2G A;  5B0Z B;  4WZS B;  1P3L C;  4R8P D;  4E44 A;  1P34 B;  2RVQ D;  1F66 A;  1P3I C;  4NE3 A;  5BNX B;  3C1C A;  5B1M D;  1B6W A;  5B1L B;  3UT9 B;  3KWQ C;  4J8V A;  3B6G C;  5GT0 B;  1P3L D;  3WKJ D;  5F99 A;  2BG1 A;  3EG5 B;  1P3I D;  1AOI C;  3KWQ D;  3NQJ B;  1U35 B;  3AZE C;  4KUD A;  3R45 A;  3W97 B;  2HUE B;  3AZM B;  3KUY C;  3AZI B;  1AOI D;  5DNM A;  2ZY5 A;  1KU5 A;  2G5H C;  2ZY2 A;  5B31 A;  3LZ0 C;  3AV1 C;  5AVC C;  1M18 B;  3W99 C;  3AN2 A;  4Z66 C;  3A6N C;  4LD9 A;  3AV1 D;  3TU4 B;  1P3O A;  4WNN B;  5AY8 B;  3B0C T;  1P3K D;  3W99 D;  3WTP B;  3LEL D;  2VQR A;  1P3P A;  4Z66 D;  3A6N D;  3REH B;  4YM6 B;  2DQN C;  5AV5 B;  5JA4 B;  5CPJ C;  5CPI B;  1S32 D;  5B2J A;  3MVD C;  5BT1 C;  3W97 C;  3O62 B;  3W98 C;  1P3A B;  3AZI C;  5CPJ D;  4WU8 A;  2HIO C;  3MGS C;  3A1K A;  1EQZ B;  2ARO B;  3AZL A;  2NZD B;  4ZUX A;  1ID3 B;  3MVD D;  5BT1 D;  3KXB B;  2JCH A;  3AZF A;  3W98 D;  3UTB B;  2Y2M A;  2HIO D;  3MGS D;  3V9R B;  4XZQ D;  5CHL B;  3AYW C;  5DNN B;  4R8P A;  5B0Y B;  5CP6 C;  5AV8 B;  1HQ3 C;  1P3M C;  4Z5T A;  5B1M A;  3REI B;  3X1S C;  2FFF B;  5FUG A;  3AYW D;  4KHA A;  1N1J A;  3AFA B;  3WTP E;  1P3L A;  5CP6 D;  1P3I A;  1HQ3 D;  1P3M D;  3X1S D;  3KWQ A;  3O62 C;  3B6G A;  4J8X B;  1P3G B;  1ZLA B;  1JFI B;  2FJ7 B;  4H9R B;  1EQZ C;  3AZN B;  2ARO C;  1AOI A;  3MGP B;  2J8P A;  5F99 D;  1PZR A;  5E5A C;  3AZE A;  4WU9 B;  1BH8 B;  5B31 C;  3KUY A;  3MGQ C;  1BH9 B;  4KGC B;  3AZH C;  5GT3 C;  5B0Y C;  3UTA C;  5E5A D;  5AV8 C;  1KX3 B;  3LZ0 A;  3AV1 A;  5AVC A;  4J8W C;  3REI C;  5B31 D;  3W99 A;  3MGQ D;  4YS3 B;  3AZH D;  5GT3 D;  5B2I C;  1M1A B;  3UTA D;  2JE5 A;  4Z66 A;  3A6N A;  3EPJ A;  2IO5 C;  5G49 B;  3B0D B;  4J8W D;  5BNV B;  1M19 B;  4LD9 D;  1P3O D;  4X23 B;  5B2I D;  1ZLA C;  3WAA C;  5JRG C;  3REK C;  5CPJ A;  1P3P D;  5B1L C;  5AV9 B;  4G91 B;  5B33 B;  3MGP C;  4XUJ B;  3MVD A;  3W97 A;  3W98 A;  3WAA D;  3WA9 C;  3AZI A;  5B2J D;  3X1V B;  3AZF C;  2HIO A;  2L5A A;  3MGS A;  4H9O A;  2NQB B;  4WU8 D;  2Y2L A;  2YFW B;  3B0B A;  2CV5 B;  1Q9C A;  3WA9 D;  4ZUX D;  3NQU B;  4H9Q B;  3AZF D;  2YFV A;  2BYM B;  2Y2N A;  4H9N B;  4EO5 B;  5B31 G;  3EPL A;  3AYW A;  4H9P A;  5CP6 A;  4UPK A;  1HQ3 A;  5B40 B;  1P3M A;  3X1S A;  5C3I B;  4CAY B;  2LY8 A;  2Y2H A;  3AZJ C;  4Z5T D;  4ZBJ C;  4J8U C;  4NE6 A;  4NFT A;  3MGR B;  1TZY C;  3W96 B;  5JA4 A;  5BO0 A;  4G91 C;  2ZM5 A;  1TAF B;  3MNN B;  3X1T C;  3AZJ D;  3O62 A;  4J8U D;  4G92 C;  1BFM A;  5GSU C;  3AZK C;  1TZY D;  5GXQ B;  3LJA B;  1P3F C;  3B6G D;  1EQZ A;  3B6F B;  2NQB C;  2ARO A;  3LZ1 B;  3X1T D;  2BYK B;  5AVB B;  5E5A A;  4QLC B;  5GSU D;  3AZK D;  1P3F D;  2Y2I A;  3AZE D;  1KX5 B;  3MGQ A;  3AZH A;  5GT3 A;  5B32 B;  2UWX A;  4AWL C;  5B0Y A;  4JJN C;  3UTA A;  3KUY D;  5B0Z C;  5AV8 A;  2PYO B;  5B40 C;  4J8W A;  3REI A;  1P34 C;  2F8N D;  5C3I C;  3LZ0 D;  5AVC D;  5B2I A;  5KDM B;  3UT9 C;  4JJN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...