3O62D

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62D00
3AV1A 2AROC 1F1EA 3B0BA 4J8VB 1AOID 3C1CC 3W97D 4QLCC 1BH9B 5BNVA 3V9RA 5B40C 2HIOB 2NZDA 5B31B 3MGQB 1P3PB 3UTAC 3MGSC 3AFAA 3WTPA 1EQZA 1P3GA 4WU9C 3WTPE 2JSSA 5AV6C 3UTBC 3B6GD 5B1MA 1B6WA 5E5AA 2LY8A 3REKC 3REIC 5FUGA 3X1SD 5AVCA 3KUYC 3AYWC 1S32D 3AZLC 4H9QB 5GXQD 3A6ND 1KX3C 2F8NA 5B0YC 4Z66A 4KUDD 5B2JD 1ID3D 1S32C 5GT3A 5JRGB 4Z2MH 2BYKA 3NQUB 1HTAA 4CAYA 1P3ID 5CPJC 5B33B 5DNMD 3MVDA 1WWSA 3AZFD 1A7WA 3AZJD 5CPIA 3LZ1C 3AZEC 1HQ3C 2HUEC 5AV8C 5B24B 4DRBA 5B1LD 4Z5TD 4XUJC 3KWQB 3TU4C 1P3FA 4HGAC 4XZQA 3O62B 4R8PA 5CPJB 2NQBA 5AV5B 3AZHB 3MGRB 3REJC 3REHB 4J8XB 3AV1C 1KX5A 4G91B 3W96A 4KHAA 3KXBB 4AWLC 5GT0B 4J8VA 3LELD 4JJNB 2FJ7D 2PYOD 2HIOA 1P34D 4J8UB 5F99D 1P3OB 3WTPC 1EQZC 3MGPB 5B31A 4J8WB 3RELC 5B2IB 3LJAD 5B1MC 5E5AC 3X1TD 3AZNC 5BS7C 1ZLAD 5BNVB 5AVCC 2NZDB 5DNNB 1F66B 4Z66C 4ZUXD 5GSUA 3AFAB 5B0ZA 5GT3C 3X1UB 1M19D 1P3GB 1P3AB 1P3BB 3AN2B 2L5AA 3B0CW 3X1VB 5G49B 3MVDC 5JRGA 2CV5D 3NQUA 4WU8D 5CPIC 5CP6D 5B32A 1P3LD 1KX4D 5GT3B 4XZQC 3LZ0D 2BYKB 3AZGA 5B24A 1R4VA 4R8PC 2NQBC 3UT9D 3KWQA 2CWEA 3WA9A 3O62A 1P3KB 1KX5C 5AV5A 3AZHA 3MGRA 3REHA 4J8XA 1U35D 5AVBD 4J8VC 1P3FB 1P3MB 3WKJD 4NE3A 5CPKD 1M1AB 5GT0A 2HIOC 3VH5W 4X23D 4EO5B 4KGCD 2AROD 4JJNA 4DRAA 5B31C 1KX5B 3MGQC 1P3PC 3C1CD 4J8UA 3X1SA 4QLCD 1P3OA 5B40D 4CSRB 4KHAB 3MGPA 4J8WA 3A6NA 3W96B 3AZIB 3WAAB 5B2IA 4YS3A 3UTAD 3MGSD 5B0ZC 5DNNA 4WU9D 3UTBD 4LD9B 5AV6D 3B0CT 1F66A 3MNNB 4WV4B 5AY8B 3AV2B 5JRGC 3X1UA 3REKD 3W98B 3REID 2YFWA 3KUYD 3AYWD 3AN2A 1P3AA 4H9SA 1P3BA 3AZLD 3B6FB 3X1VA 5B33C 1M18B 5G49A 1KX3D 5B0YD 5GSUB 4NFTA 5B0ZB 2F8NG 5CPJD 5B24C 5AV9B 3KWQC 3WA9C 3W99B 3O62C 1TZYB 3LZ1D 5B32B 5AV5C 1HQ3D 3AZED 3AZHC 5AV8D 3MGRC 3REHC 4XUJD 4YM6B 4J8XC 1P3KA 3AZKB 4H9PB 3TU4D 3C1BA 4G91C 4E45A 3AZGB 3KXBC 3VH5T 5GT0C 3REJD 3WA9B 3AV1D 1P3MA 4JJNC 1AOIB 1BFMA 3W97B 1M1AA 4J8UC 3AZMA 4NE6A 1P3OC 3MGPC 4J8WC 5B2IC 4ZUXA 3B0DB 4CSRA 3AZIA 3WAAA 3WTPD 2NZDC 1EQZD 3B6GB 5DNNC 3RELD 1F66C 5B1MD 3AFAC 5E5AD 5B31G 3X1SB 3AZND 1JFIB 3X1UC 4LD9A 1P3GC 1P3AC 3A6NB 5GXQB 5AVCD 3AN2C 1P3BC 1KX4A 3X1VC 3MNNA 4KUDB 4KGCC 5B2JB 5AY8A 1ID3B 3AV2A 4YS3B 2F8ND 3W98A 4Z66D 3LZ0A 3B6FA 5GT3D 1P3IB 1M18A 5DNMB 3AZFB 4H9OB 3MVDD 2BYMA 3AZJB 2YFWB 5CPID 5B1LB 5AV9A 4Z5TB 5AVBA 3W99A 1TZYA 1B67A 1P3KC 4XZQD 4R8PD 2NQBD 4YM6A 3AZKA 4H9PA 1P3FC 1KX5D 1P3MC 4QLCA 4H9NB 5B40A 5BNXA 1M1AC 1TAFA 5JA4A 4EO5C 2YFVB 4WZSB 3AZMC 3LELB 1AOIA 4J8VD 3W97A 3UTAA 2FJ7B 3C1BB 2F8NH 1P34B 5F99B 3W96C 4WU9A 2HIOD 5C3IB 5AV6A 3AZIC 3WAAC 3LJAB 5B31D 3MGQD 1P3PD 3X1TB 3REIA 1ZLAB 3AZMB 3B6GA 4LD9C 4NE5A 3MNNC 4ZUXB 1S32A 2RVQC 1JFIA 5AY8C 3AV2C 3W98C 1M19B 5GXQA 5B0ZD 3B6FC 1M18C 4KUDA 5B2JA 1ID3A 5KDMB 2CV5B 5GSUC 4G92B 1P3IA 5JRGD 4WU8B 5DNMA 5CP6B 3R45A 1HQ3A 5BT1C 5B33D 3AZFA 4H9OA 1P3LB 1KX4B 5AV9C 3AZJA 3W99C 3LZ0B 1TZYC 5B1LA 4Z5TA 5B32C 3UT9B 5B24D 4YM6C 3KWQD 3AZKC 1Q9CA 3WA9D 2BYMB 3O62D 3AZGC 4ZBJB 5AV5D 2IO5B 3AZHD 1U35B 3MGRD 5AVBB 3REHD 4J8XD 1AOIC 1BH8A 4H9NA 3W97C 3WKJB 5CPKB 4WNNB 4X23B 2YFVA 3KXBD 3LELA 4KGCB 5GT0D 2AROB 3RELA 2FJ7A 2PYOA 4JJND 3C1CB 3B0DC 1P34A 5F99A 5BS7A 4QLCB 3AZNA 5B40B 5BNXB 4J8UD 1TAFB 1P3OD 5JA4B 3LJAA 3MGPD 3B6GC 4J8WD 5B2ID 3X1TA 3UTAB 3MGSB 1ZLAA 4UUZA 4YS3D 3X1SC 5BO0B 3VH5A 4WU9B 3UTBB 3A6NC 5GXQC 5AV6B 2NZDD 1ULYA 5DNND 4KUDC 5B2JC 1ID3C 1N1JB 4YS3C 1F66D 3VH6W 3REKB 1M19A 3AFAD 3KUYB 3REIB 3AYWB 1P3IC 3AZLB 3X1UD 1P3BD 5DNMC 1P3GD 3AN2D 1P3AD 1KX3B 5KDMA 5B0YB 3X1VD 2CV5A 3AZFC 3AZJC 1S32B 4WU8A 5CP6A 4H9SC 1P3LA 5B1LC 4Z5TC 4H9RA 3NQJB 3LZ1B 3UT9A 3AZEB 3R45B 1HQ3B 2HUEB 5AV8B 4XUJB 1WWIA 3TU4B 1KU5A 4HGAB 1P3KD 1H3OB 1BH9A 3C1BD 1U35A 3LELC 3REJB 3AV1B 3MGQA 1P3PA 5B32G 3WKJA 2FJ7C 1P3FD 2PYOC 5CPKA 1P3MD 4WNNA 4X23A 3C1BC 4Z2MG 1P34C 4KGCA 5F99C 4AWLB 1M1AD 2AROA 3V9RB 5C3IC 3AZMD 3LJAC 3C1CA 1BH8B 3X1TC 1ZLAC 3KSYA 3W96D 3WTPB 4H9QA 1EQZB 3AZID 3WAAD 3RELB 3MGSA 2PYOB 5B1MB 4ZUXC 5BO0A 5E5AB 3VH6T 4E44A 5CHLB 3AZNB 3UTBA 1M19C 5FUGB 5AVCB 5B33A 4LD9D 1N1JA 2F8NB 3REKA 4Z66B 3MNND 2CV5C 3KUYA 3AYWA 2RVQD 4UUZB 5AY8D 4G92C 3AZLA 3VH6A 3AV2D 4WU8C 3W98D 5CP6C 1KX3A 4CAYB 5B0YA 2F8NK 3B6FD 1M18D 1P3LC 1KX4C 3MVDB 5GSUD 3LZ0C 5CPJA 5CPIB 3UT9C 5BT1D 5AV9D 3NQJA 3LZ1A 3W99D 4XZQB 3AZEA 1TZYD 5AV8A 3KXBA 4R8PB 2NQBB 4XUJA 4ZBJC 5B32D 2IO5C 1U35C 5AVBC 3TU4A 4YM6D 4H9RB 1H3OA 3AZKD 4M6BA 3WKJC 5CPKC 4X23C 3AZGD 3REJA
chains in the Genus database with same CATH superfamily
3IP4C 3AV1A 2AROC 1F1EA 3B0BA 4J8VB 1AOID 2Y2PA 3C1CC 3W97D 4QLCC 1BH9B 5BNVA 3V9RA 5B40C 2HIOB 2NZDA 5B31B 3MGQB 1P3PB 3UTAC 3MGSC 3AFAA 3WTPA 1EQZA 2JCHA 1P3GA 4WU9C 2VQRA 3WTPE 2JSSA 5AV6C 3UTBC 3KFUG 3B6GD 5B1MA 1B6WA 5E5AA 2LY8A 3REKC 3REIC 5FUGA 3X1SD 5AVCA 3KUYC 3AYWC 1S32D 3AZLC 4H9QB 5GXQD 3A6ND 1KX3C 2Y2JA 2F8NA 5B0YC 4Z66A 4KUDD 5B2JD 1ID3D 1S32C 5GT3A 2BG1A 4Z2MH 5JRGB 2BYKA 3NQUB 1HTAA 4CAYA 1P3ID 5CPJC 5B33B 5DNMD 3MVDA 1WWSA 3AZFD 1A7WA 3AZJD 5CPIA 3LZ1C 3EPKA 2DF4C 3AZEC 1HQ3C 2HUEC 5AV8C 5B24B 4DRBA 5B1LD 4Z5TD 4XUJC 3KWQB 3TU4C 1P3FA 4HGAC 4XZQA 3O62B 4R8PA 5CPJB 2NQBA 5AV5B 3AZHB 3MGRB 3REJC 3REHB 4J8XB 3AV1C 1KX5A 2DQNC 2J8PA 4G91B 3W96A 4KHAA 2Y2OA 3KXBB 4AWLC 5GT0B 4J8VA 2UWXA 3LELD 4JJNB 2FJ7D 2PYOD 2HIOA 1P34D 4J8UB 5F99D 1P3OB 3WTPC 1EQZC 3MGPB 5B31A 4J8WB 3RELC 5B2IB 3LJAD 5B1MC 5E5AC 3X1TD 3AZNC 5BS7C 1ZLAD 1PZRA 5BNVB 3F6TA 5AVCC 2NZDB 4WJ3C 5DNNB 2Y2LA 1F66B 4Z66C 4ZUXD 5GSUA 2RIQA 3AFAB 5B0ZA 5GT3C 3X1UB 1M19D 3EPJA 1P3AB 1P3GB 3AN2B 1P3BB 2L5AA 3B0CW 3X1VB 5G49B 3MVDC 2F2AC 5JRGA 2CV5D 3NQUA 4WU8D 5CPIC 5CP6D 5B32A 1W2EA 2Y2KA 1P3LD 1KX4D 5GT3B 4XZQC 3LZ0D 2BYKB 3AZGA 5B24A 1R4VA 4R8PC 2NQBC 3UT9D 3KWQA 2CWEA 3WA9A 3O62A 1P3KB 1KX5C 5AV5A 3AZHA 3MGRA 3REHA 4J8XA 1U35D 5AVBD 4J8VC 1P3FB 1P3MB 3WKJD 4NE3A 5CPKD 1M1AB 5GT0A 2HIOC 3VH5W 4X23D 4EO5B 4KGCD 2FFFB 2AROD 4JJNA 4DRAA 5B31C 1KX5B 3MGQC 1P3PC 3C1CD 4J8UA 3X1SA 3EG5B 4QLCD 1P3OA 5B40D 4CSRB 4KHAB 3MGPA 4J8WA 3A6NA 3W96B 3AZIB 3WAAB 5B2IA 4YS3A 3UTAD 3MGSD 5B0ZC 5DNNA 4WU9D 3UTBD 4LD9B 5AV6D 3B0CT 1F66A 3MNNB 4WV4B 2Y2QA 5AY8B 3AV2B 5JRGC 3X1UA 3REKD 3W98B 3REID 2YFWA 2ZY5A 3KUYD 3AYWD 3AN2A 4H9SA 1P3AA 3AZLD 1P3BA 3B6FB 3X1VA 5B33C 1M18B 5G49A 1KX3D 5B0YD 5GSUB 4NFTA 5B0ZB 2F8NG 5CPJD 5B24C 5AV9B 3KWQC 3WA9C 3W99B 3O62C 1T3UA 1TZYB 3LZ1D 5B32B 5AV5C 1HQ3D 3AZED 3AZHC 5AV8D 3EPHA 3MGRC 3REHC 4XUJD 4YM6B 4J8XC 1P3KA 3AZKB 4H9PB 3TU4D 3C1BA 2G5IC 4G91C 4E45A 3AZGB 3KXBC 3VH5T 5GT0C 3REJD 3WA9B 3AV1D 1P3MA 4JJNC 1AOIB 1BFMA 3W97B 1M1AA 4J8UC 2XD1A 3AZMA 4NE6A 1P3OC 3MGPC 4J8WC 3A1IA 5B2IC 4ZUXA 3B0DB 4CSRA 3AZIA 3WAAA 3WTPD 2NZDC 1EQZD 3B6GB 5DNNC 3EPLA 3RELD 4UPKA 5B1MD 1F66C 3AFAC 3H0MC 5E5AD 5B31G 3X1SB 3AZND 1JFIB 3X1UC 4LD9A 1P3GC 1P3AC 3A6NB 5GXQB 5AVCD 3AN2C 1P3BC 2G5HC 1KX4A 3X1VC 3MNNA 4KUDB 4KGCC 5B2JB 5AY8A 1ID3B 3AV2A 4YS3B 2F8ND 3W98A 4Z66D 3LZ0A 3B6FA 5GT3D 1P3IB 1M18A 2ZY2A 5DNMB 3AL0C 3AZFB 4H9OB 3MVDD 2BYMA 3AZJB 2YFWB 5CPID 5B1LB 5AV9A 4Z5TB 5AVBA 3W99A 2Y2NA 1TZYA 1B67A 1P3KC 4XZQD 4R8PD 2NQBD 4YM6A 3AZKA 4H9PA 3H0RC 1P3FC 1KX5D 1P3MC 4QLCA 4H9NB 5B40A 5BNXA 1M1AC 1TAFA 5JA4A 4EO5C 2YFVB 4WZSB 3AZMC 3LELB 1AOIA 4J8VD 3W97A 3UTAA 2FJ7B 2ZY4A 3C1BB 2F8NH 1P34B 5F99B 3W96C 4WU9A 2HIOD 5C3IB 5AV6A 3AZIC 3WAAC 3LJAB 5B31D 3MGQD 1P3PD 3X1TB 3REIA 1ZLAB 3AZMB 3B6GA 2ZM5A 4LD9C 2Y2GA 4NE5A 3MNNC 4ZUXB 1S32A 2RVQC 1JFIA 5AY8C 3AV2C 3W98C 1M19B 5GXQA 5B0ZD 3B6FC 1M18C 4KUDA 5B2JA 1ID3A 5KDMB 2CV5B 5GSUC 4G92B 1P3IA 5JRGD 4WU8B 5DNMA 5CP6B 3R45A 1HQ3A 5BT1C 5B33D 3AZFA 4H9OA 1P3LB 1KX4B 5AV9C 3AZJA 3W99C 3LZ0B 1TZYC 5B1LA 4Z5TA 5B32C 3UT9B 5B24D 4YM6C 3KWQD 3AZKC 1Q9CA 3WA9D 2BYMB 2Y2MA 3O62D 3AZGC 4ZBJB 5AV5D 2IO5B 3AZHD 1U35B 3MGRD 5AVBB 3REHD 4J8XD 1AOIC 1BH8A 4H9NA 3W97C 3WKJB 5CPKB 3FDDA 4WNNB 2YFVA 4X23B 3KXBD 3LELA 4KGCB 5GT0D 2AROB 3RELA 2FJ7A 2PYOA 4JJND 3C1CB 3B0DC 1P34A 5F99A 5BS7A 4QLCB 3AZNA 3P5JB 5B40B 5BNXB 4J8UD 1TAFB 1P3OD 5JA4B 3LJAA 3MGPD 3B6GC 4J8WD 5B2ID 3X1TA 3UTAB 3MGSB 1ZLAA 2XD5A 4UUZA 4YS3D 3X1SC 5BO0B 3VH5A 2JE5A 4WU9B 3UTBB 3A6NC 5GXQC 5AV6B 2NZDD 1ULYA 5DNND 4KUDC 5B2JC 1ID3C 1N1JB 4YS3C 1F66D 3VH6W 3REKB 1M19A 3AFAD 3KUYB 3H0LC 3REIB 3AYWB 1P3IC 2Y2IA 3X1UD 3AZLB 1P3BD 5DNMC 1P3GD 3AN2D 1P3AD 1KX3B 5KDMA 5B0YB 3X1VD 2CV5A 3AZFC 3AZJC 1S32B 4WU8A 5CP6A 4H9SC 1P3LA 5B1LC 4Z5TC 4H9RA 3NQJB 3LZ1B 3UT9A 3AZEB 3R45B 1HQ3B 2HUEB 5AV8B 4XUJB 1WWIA 3TU4B 1KU5A 4HGAB 1P3KD 1H3OB 1BH9A 3C1BD 1U35A 3LELC 3REJB 3AV1B 3MGQA 1P3PA 5B32G 3WKJA 1Z2CB 1P3FD 2FJ7C 2PYOC 5CPKA 1P3MD 4WNNA 4X23A 3C1BC 4Z2MG 1P34C 4KGCA 5F99C 4AWLB 1M1AD 2AROA 3V9RB 5C3IC 3AZMD 3LJAC 3C1CA 1BH8B 3X1TC 1ZLAC 3KSYA 3W96D 3WTPB 4H9QA 1EQZB 3AZID 3WAAD 3RELB 3MGSA 2PYOB 5B1MB 4ZUXC 5BO0A 5E5AB 3VH6T 4E44A 5CHLB 3AZNB 3UTBA 1M19C 5FUGB 5AVCB 5B33A 4LD9D 3A1KA 2Y2HA 1N1JA 2F8NB 3REKA 4Z66B 3MNND 2CV5C 3KUYA 3AYWA 2RVQD 4UUZB 5AY8D 4G92C 3AZLA 3VH6A 3AV2D 4WU8C 3W98D 5CP6C 1KX3A 4CAYB 5B0YA 2F8NK 3B6FD 1M18D 1P3LC 1KX4C 2W8SA 3MVDB 2ZY3A 5GSUD 3LZ0C 4DQYB 5CPJA 5CPIB 3UT9C 5BT1D 5AV9D 3NQJA 3LZ1A 3W99D 4XZQB 3AZEA 1TZYD 5AV8A 3KXBA 4R8PB 2NQBB 4XUJA 4ZBJC 5B32D 2IO5C 1U35C 5AVBC 3TU4A 4YM6D 4H9RB 1H3OA 3AZKD 4M6BA 3WKJC 5CPKC 4X23C 3AZGD 3REJA
chains in the Genus database with same CATH topology
3IP4C 3AV1A 2AROC 1F1EA 3B0BA 4J8VB 1AOID 2Y2PA 3C1CC 3W97D 4QLCC 1BH9B 5BNVA 3V9RA 5B40C 2HIOB 2NZDA 5B31B 3MGQB 1P3PB 3UTAC 3MGSC 3AFAA 3WTPA 1EQZA 2JCHA 1P3GA 4WU9C 2VQRA 3WTPE 2JSSA 5AV6C 3UTBC 3KFUG 3B6GD 5B1MA 1B6WA 5E5AA 2LY8A 3REKC 3REIC 5FUGA 3X1SD 5AVCA 3KUYC 3AYWC 1S32D 3AZLC 4H9QB 5GXQD 3A6ND 1KX3C 2Y2JA 2F8NA 5B0YC 4Z66A 4KUDD 5B2JD 1ID3D 1S32C 5GT3A 2BG1A 4Z2MH 5JRGB 2BYKA 3NQUB 1HTAA 4CAYA 1P3ID 5CPJC 5B33B 5DNMD 3MVDA 1WWSA 3AZFD 1A7WA 3AZJD 5CPIA 3LZ1C 3EPKA 2DF4C 3AZEC 1HQ3C 2HUEC 5AV8C 5B24B 4DRBA 5B1LD 4Z5TD 4XUJC 3KWQB 3TU4C 1P3FA 4HGAC 4XZQA 3O62B 4R8PA 5CPJB 2NQBA 5AV5B 3AZHB 3MGRB 3REJC 3REHB 4J8XB 3AV1C 1KX5A 2DQNC 2J8PA 4G91B 3W96A 4KHAA 2Y2OA 3KXBB 4AWLC 5GT0B 4J8VA 2UWXA 3LELD 4JJNB 2FJ7D 2PYOD 2HIOA 1P34D 4J8UB 5F99D 1P3OB 3WTPC 1EQZC 3MGPB 5B31A 4J8WB 3RELC 5B2IB 3LJAD 5B1MC 5E5AC 3X1TD 3AZNC 5BS7C 1ZLAD 1PZRA 5BNVB 3F6TA 5AVCC 2NZDB 4WJ3C 5DNNB 2Y2LA 1F66B 4Z66C 4ZUXD 5GSUA 2RIQA 3AFAB 5B0ZA 5GT3C 3X1UB 1M19D 3EPJA 1P3AB 1P3GB 3AN2B 1P3BB 2L5AA 3B0CW 3X1VB 5G49B 3MVDC 2F2AC 5JRGA 2CV5D 3NQUA 4WU8D 5CPIC 5CP6D 5B32A 1W2EA 2Y2KA 1P3LD 1KX4D 5GT3B 4XZQC 3LZ0D 2BYKB 3AZGA 5B24A 1R4VA 4R8PC 2NQBC 3UT9D 3KWQA 2CWEA 3WA9A 3O62A 1P3KB 1KX5C 5AV5A 3AZHA 3MGRA 3REHA 4J8XA 1U35D 5AVBD 4J8VC 1P3FB 1P3MB 3WKJD 4NE3A 5CPKD 1M1AB 5GT0A 2HIOC 3VH5W 4X23D 4EO5B 4KGCD 2FFFB 2AROD 4JJNA 4DRAA 5B31C 1KX5B 3MGQC 1P3PC 3C1CD 4J8UA 3X1SA 3EG5B 4QLCD 1P3OA 5B40D 4CSRB 4KHAB 3MGPA 4J8WA 3A6NA 3W96B 3AZIB 3WAAB 5B2IA 4YS3A 3UTAD 3MGSD 5B0ZC 5DNNA 4WU9D 3UTBD 4LD9B 5AV6D 3B0CT 1F66A 3MNNB 4WV4B 2Y2QA 5AY8B 3AV2B 5JRGC 3X1UA 3REKD 3W98B 3REID 2YFWA 2ZY5A 3KUYD 3AYWD 3AN2A 4H9SA 1P3AA 3AZLD 1P3BA 3B6FB 3X1VA 5B33C 1M18B 5G49A 1KX3D 5B0YD 5GSUB 4NFTA 5B0ZB 2F8NG 5CPJD 5B24C 5AV9B 3KWQC 3WA9C 3W99B 3O62C 1T3UA 1TZYB 3LZ1D 5B32B 5AV5C 1HQ3D 3AZED 3AZHC 5AV8D 3EPHA 3MGRC 3REHC 4XUJD 4YM6B 4J8XC 1P3KA 3AZKB 4H9PB 3TU4D 3C1BA 2G5IC 4G91C 4E45A 3AZGB 3KXBC 3VH5T 5GT0C 3REJD 3WA9B 3AV1D 1P3MA 4JJNC 1AOIB 1BFMA 3W97B 1M1AA 4J8UC 2XD1A 3AZMA 4NE6A 1P3OC 3MGPC 4J8WC 3A1IA 5B2IC 4ZUXA 3B0DB 4CSRA 3AZIA 3WAAA 3WTPD 2NZDC 1EQZD 3B6GB 5DNNC 3EPLA 3RELD 4UPKA 5B1MD 1F66C 3AFAC 3H0MC 5E5AD 5B31G 3X1SB 3AZND 1JFIB 3X1UC 4LD9A 1P3GC 1P3AC 3A6NB 5GXQB 5AVCD 3AN2C 1P3BC 2G5HC 1KX4A 3X1VC 3MNNA 4KUDB 4KGCC 5B2JB 5AY8A 1ID3B 3AV2A 4YS3B 2F8ND 3W98A 4Z66D 3LZ0A 3B6FA 5GT3D 1P3IB 1M18A 2ZY2A 5DNMB 3AL0C 3AZFB 4H9OB 3MVDD 2BYMA 3AZJB 2YFWB 5CPID 5B1LB 5AV9A 4Z5TB 5AVBA 3W99A 2Y2NA 1TZYA 1B67A 1P3KC 4XZQD 4R8PD 2NQBD 4YM6A 3AZKA 4H9PA 3H0RC 1P3FC 1KX5D 1P3MC 4QLCA 4H9NB 5B40A 5BNXA 1M1AC 1TAFA 5JA4A 4EO5C 2YFVB 4WZSB 3AZMC 3LELB 1AOIA 4J8VD 3W97A 3UTAA 2FJ7B 2ZY4A 3C1BB 2F8NH 1P34B 5F99B 3W96C 4WU9A 2HIOD 5C3IB 5AV6A 3AZIC 3WAAC 3LJAB 5B31D 3MGQD 1P3PD 3X1TB 3REIA 1ZLAB 3AZMB 3B6GA 2ZM5A 4LD9C 2Y2GA 4NE5A 3MNNC 4ZUXB 1S32A 2RVQC 1JFIA 5AY8C 3AV2C 3W98C 1M19B 5GXQA 5B0ZD 3B6FC 1M18C 4KUDA 5B2JA 1ID3A 5KDMB 2CV5B 5GSUC 4G92B 1P3IA 5JRGD 4WU8B 5DNMA 5CP6B 3R45A 1HQ3A 5BT1C 5B33D 3AZFA 4H9OA 1P3LB 1KX4B 5AV9C 3AZJA 3W99C 3LZ0B 1TZYC 5B1LA 4Z5TA 5B32C 3UT9B 5B24D 4YM6C 3KWQD 3AZKC 1Q9CA 3WA9D 2BYMB 2Y2MA 3O62D 3AZGC 4ZBJB 5AV5D 2IO5B 3AZHD 1U35B 3MGRD 5AVBB 3REHD 4J8XD 1AOIC 1BH8A 4H9NA 3W97C 3WKJB 5CPKB 3FDDA 4WNNB 2YFVA 4X23B 3KXBD 3LELA 4KGCB 5GT0D 2AROB 3RELA 2FJ7A 2PYOA 4JJND 3C1CB 3B0DC 1P34A 5F99A 5BS7A 4QLCB 3AZNA 3P5JB 5B40B 5BNXB 4J8UD 1TAFB 1P3OD 5JA4B 3LJAA 3MGPD 3B6GC 4J8WD 5B2ID 3X1TA 3UTAB 3MGSB 1ZLAA 2XD5A 4UUZA 4YS3D 3X1SC 5BO0B 3VH5A 2JE5A 4WU9B 3UTBB 3A6NC 5GXQC 5AV6B 2NZDD 1ULYA 5DNND 4KUDC 5B2JC 1ID3C 1N1JB 4YS3C 1F66D 3VH6W 3REKB 1M19A 3AFAD 3KUYB 3H0LC 3REIB 3AYWB 1P3IC 2Y2IA 3X1UD 3AZLB 1P3BD 5DNMC 1P3GD 3AN2D 1P3AD 1KX3B 5KDMA 5B0YB 3X1VD 2CV5A 3AZFC 3AZJC 1S32B 4WU8A 5CP6A 4H9SC 1P3LA 5B1LC 4Z5TC 4H9RA 3NQJB 3LZ1B 3UT9A 3AZEB 3R45B 1HQ3B 2HUEB 5AV8B 4XUJB 1WWIA 3TU4B 1KU5A 4HGAB 1P3KD 1H3OB 1BH9A 3C1BD 1U35A 3LELC 3REJB 3AV1B 3MGQA 1P3PA 5B32G 3WKJA 1Z2CB 1P3FD 2FJ7C 2PYOC 5CPKA 1P3MD 4WNNA 4X23A 3C1BC 4Z2MG 1P34C 4KGCA 5F99C 4AWLB 1M1AD 2AROA 3V9RB 5C3IC 3AZMD 3LJAC 3C1CA 1BH8B 3X1TC 1ZLAC 3KSYA 3W96D 3WTPB 4H9QA 1EQZB 3AZID 3WAAD 3RELB 3MGSA 2PYOB 5B1MB 4ZUXC 5BO0A 5E5AB 3VH6T 4E44A 5CHLB 3AZNB 3UTBA 1M19C 5FUGB 5AVCB 5B33A 4LD9D 3A1KA 2Y2HA 1N1JA 2F8NB 3REKA 4Z66B 3MNND 2CV5C 3KUYA 3AYWA 2RVQD 4UUZB 5AY8D 4G92C 3AZLA 3VH6A 3AV2D 4WU8C 3W98D 5CP6C 1KX3A 4CAYB 5B0YA 2F8NK 3B6FD 1M18D 1P3LC 1KX4C 2W8SA 3MVDB 2ZY3A 5GSUD 3LZ0C 4DQYB 5CPJA 5CPIB 3UT9C 5BT1D 5AV9D 3NQJA 3LZ1A 3W99D 4XZQB 3AZEA 1TZYD 5AV8A 3KXBA 4R8PB 2NQBB 4XUJA 4ZBJC 5B32D 2IO5C 1U35C 5AVBC 3TU4A 4YM6D 4H9RB 1H3OA 3AZKD 4M6BA 3WKJC 5CPKC 4X23C 3AZGD 3REJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 A;  2ARO C;  1F1E A;  3B0B A;  4J8V B;  1AOI D;  3C1C C;  3W97 D;  4QLC C;  1BH9 B;  5BNV A;  3V9R A;  5B40 C;  2HIO B;  2NZD A;  5B31 B;  3MGQ B;  1P3P B;  3UTA C;  3MGS C;  3AFA A;  3WTP A;  1EQZ A;  1P3G A;  4WU9 C;  3WTP E;  2JSS A;  5AV6 C;  3UTB C;  3B6G D;  5B1M A;  1B6W A;  5E5A A;  2LY8 A;  3REK C;  3REI C;  5FUG A;  3X1S D;  5AVC A;  3KUY C;  3AYW C;  1S32 D;  3AZL C;  4H9Q B;  5GXQ D;  3A6N D;  1KX3 C;  2F8N A;  5B0Y C;  4Z66 A;  4KUD D;  5B2J D;  1ID3 D;  1S32 C;  5GT3 A;  5JRG B;  4Z2M H;  2BYK A;  3NQU B;  1HTA A;  4CAY A;  1P3I D;  5CPJ C;  5B33 B;  5DNM D;  3MVD A;  1WWS A;  3AZF D;  1A7W A;  3AZJ D;  5CPI A;  3LZ1 C;  3AZE C;  1HQ3 C;  2HUE C;  5AV8 C;  5B24 B;  4DRB A;  5B1L D;  4Z5T D;  4XUJ C;  3KWQ B;  3TU4 C;  1P3F A;  4HGA C;  4XZQ A;  3O62 B;  4R8P A;  5CPJ B;  2NQB A;  5AV5 B;  3AZH B;  3MGR B;  3REJ C;  3REH B;  4J8X B;  3AV1 C;  1KX5 A;  4G91 B;  3W96 A;  4KHA A;  3KXB B;  4AWL C;  5GT0 B;  4J8V A;  3LEL D;  4JJN B;  2FJ7 D;  2PYO D;  2HIO A;  1P34 D;  4J8U B;  5F99 D;  1P3O B;  3WTP C;  1EQZ C;  3MGP B;  5B31 A;  4J8W B;  3REL C;  5B2I B;  3LJA D;  5B1M C;  5E5A C;  3X1T D;  3AZN C;  5BS7 C;  1ZLA D;  5BNV B;  5AVC C;  2NZD B;  5DNN B;  1F66 B;  4Z66 C;  4ZUX D;  5GSU A;  3AFA B;  5B0Z A;  5GT3 C;  3X1U B;  1M19 D;  1P3G B;  1P3A B;  1P3B B;  3AN2 B;  2L5A A;  3B0C W;  3X1V B;  5G49 B;  3MVD C;  5JRG A;  2CV5 D;  3NQU A;  4WU8 D;  5CPI C;  5CP6 D;  5B32 A;  1P3L D;  1KX4 D;  5GT3 B;  4XZQ C;  3LZ0 D;  2BYK B;  3AZG A;  5B24 A;  1R4V A;  4R8P C;  2NQB C;  3UT9 D;  3KWQ A;  2CWE A;  3WA9 A;  3O62 A;  1P3K B;  1KX5 C;  5AV5 A;  3AZH A;  3MGR A;  3REH A;  4J8X A;  1U35 D;  5AVB D;  4J8V C;  1P3F B;  1P3M B;  3WKJ D;  4NE3 A;  5CPK D;  1M1A B;  5GT0 A;  2HIO C;  3VH5 W;  4X23 D;  4EO5 B;  4KGC D;  2ARO D;  4JJN A;  4DRA A;  5B31 C;  1KX5 B;  3MGQ C;  1P3P C;  3C1C D;  4J8U A;  3X1S A;  4QLC D;  1P3O A;  5B40 D;  4CSR B;  4KHA B;  3MGP A;  4J8W A;  3A6N A;  3W96 B;  3AZI B;  3WAA B;  5B2I A;  4YS3 A;  3UTA D;  3MGS D;  5B0Z C;  5DNN A;  4WU9 D;  3UTB D;  4LD9 B;  5AV6 D;  3B0C T;  1F66 A;  3MNN B;  4WV4 B;  5AY8 B;  3AV2 B;  5JRG C;  3X1U A;  3REK D;  3W98 B;  3REI D;  2YFW A;  3KUY D;  3AYW D;  3AN2 A;  1P3A A;  4H9S A;  1P3B A;  3AZL D;  3B6F B;  3X1V A;  5B33 C;  1M18 B;  5G49 A;  1KX3 D;  5B0Y D;  5GSU B;  4NFT A;  5B0Z B;  2F8N G;  5CPJ D;  5B24 C;  5AV9 B;  3KWQ C;  3WA9 C;  3W99 B;  3O62 C;  1TZY B;  3LZ1 D;  5B32 B;  5AV5 C;  1HQ3 D;  3AZE D;  3AZH C;  5AV8 D;  3MGR C;  3REH C;  4XUJ D;  4YM6 B;  4J8X C;  1P3K A;  3AZK B;  4H9P B;  3TU4 D;  3C1B A;  4G91 C;  4E45 A;  3AZG B;  3KXB C;  3VH5 T;  5GT0 C;  3REJ D;  3WA9 B;  3AV1 D;  1P3M A;  4JJN C;  1AOI B;  1BFM A;  3W97 B;  1M1A A;  4J8U C;  3AZM A;  4NE6 A;  1P3O C;  3MGP C;  4J8W C;  5B2I C;  4ZUX A;  3B0D B;  4CSR A;  3AZI A;  3WAA A;  3WTP D;  2NZD C;  1EQZ D;  3B6G B;  5DNN C;  3REL D;  1F66 C;  5B1M D;  3AFA C;  5E5A D;  5B31 G;  3X1S B;  3AZN D;  1JFI B;  3X1U C;  4LD9 A;  1P3G C;  1P3A C;  3A6N B;  5GXQ B;  5AVC D;  3AN2 C;  1P3B C;  1KX4 A;  3X1V C;  3MNN A;  4KUD B;  4KGC C;  5B2J B;  5AY8 A;  1ID3 B;  3AV2 A;  4YS3 B;  2F8N D;  3W98 A;  4Z66 D;  3LZ0 A;  3B6F A;  5GT3 D;  1P3I B;  1M18 A;  5DNM B;  3AZF B;  4H9O B;  3MVD D;  2BYM A;  3AZJ B;  2YFW B;  5CPI D;  5B1L B;  5AV9 A;  4Z5T B;  5AVB A;  3W99 A;  1TZY A;  1B67 A;  1P3K C;  4XZQ D;  4R8P D;  2NQB D;  4YM6 A;  3AZK A;  4H9P A;  1P3F C;  1KX5 D;  1P3M C;  4QLC A;  4H9N B;  5B40 A;  5BNX A;  1M1A C;  1TAF A;  5JA4 A;  4EO5 C;  2YFV B;  4WZS B;  3AZM C;  3LEL B;  1AOI A;  4J8V D;  3W97 A;  3UTA A;  2FJ7 B;  3C1B B;  2F8N H;  1P34 B;  5F99 B;  3W96 C;  4WU9 A;  2HIO D;  5C3I B;  5AV6 A;  3AZI C;  3WAA C;  3LJA B;  5B31 D;  3MGQ D;  1P3P D;  3X1T B;  3REI A;  1ZLA B;  3AZM B;  3B6G A;  4LD9 C;  4NE5 A;  3MNN C;  4ZUX B;  1S32 A;  2RVQ C;  1JFI A;  5AY8 C;  3AV2 C;  3W98 C;  1M19 B;  5GXQ A;  5B0Z D;  3B6F C;  1M18 C;  4KUD A;  5B2J A;  1ID3 A;  5KDM B;  2CV5 B;  5GSU C;  4G92 B;  1P3I A;  5JRG D;  4WU8 B;  5DNM A;  5CP6 B;  3R45 A;  1HQ3 A;  5BT1 C;  5B33 D;  3AZF A;  4H9O A;  1P3L B;  1KX4 B;  5AV9 C;  3AZJ A;  3W99 C;  3LZ0 B;  1TZY C;  5B1L A;  4Z5T A;  5B32 C;  3UT9 B;  5B24 D;  4YM6 C;  3KWQ D;  3AZK C;  1Q9C A;  3WA9 D;  2BYM B;  3O62 D;  3AZG C;  4ZBJ B;  5AV5 D;  2IO5 B;  3AZH D;  1U35 B;  3MGR D;  5AVB B;  3REH D;  4J8X D;  1AOI C;  1BH8 A;  4H9N A;  3W97 C;  3WKJ B;  5CPK B;  4WNN B;  4X23 B;  2YFV A;  3KXB D;  3LEL A;  4KGC B;  5GT0 D;  2ARO B;  3REL A;  2FJ7 A;  2PYO A;  4JJN D;  3C1C B;  3B0D C;  1P34 A;  5F99 A;  5BS7 A;  4QLC B;  3AZN A;  5B40 B;  5BNX B;  4J8U D;  1TAF B;  1P3O D;  5JA4 B;  3LJA A;  3MGP D;  3B6G C;  4J8W D;  5B2I D;  3X1T A;  3UTA B;  3MGS B;  1ZLA A;  4UUZ A;  4YS3 D;  3X1S C;  5BO0 B;  3VH5 A;  4WU9 B;  3UTB B;  3A6N C;  5GXQ C;  5AV6 B;  2NZD D;  1ULY A;  5DNN D;  4KUD C;  5B2J C;  1ID3 C;  1N1J B;  4YS3 C;  1F66 D;  3VH6 W;  3REK B;  1M19 A;  3AFA D;  3KUY B;  3REI B;  3AYW B;  1P3I C;  3AZL B;  3X1U D;  1P3B D;  5DNM C;  1P3G D;  3AN2 D;  1P3A D;  1KX3 B;  5KDM A;  5B0Y B;  3X1V D;  2CV5 A;  3AZF C;  3AZJ C;  1S32 B;  4WU8 A;  5CP6 A;  4H9S C;  1P3L A;  5B1L C;  4Z5T C;  4H9R A;  3NQJ B;  3LZ1 B;  3UT9 A;  3AZE B;  3R45 B;  1HQ3 B;  2HUE B;  5AV8 B;  4XUJ B;  1WWI A;  3TU4 B;  1KU5 A;  4HGA B;  1P3K D;  1H3O B;  1BH9 A;  3C1B D;  1U35 A;  3LEL C;  3REJ B;  3AV1 B;  3MGQ A;  1P3P A;  5B32 G;  3WKJ A;  2FJ7 C;  1P3F D;  2PYO C;  5CPK A;  1P3M D;  4WNN A;  4X23 A;  3C1B C;  4Z2M G;  1P34 C;  4KGC A;  5F99 C;  4AWL B;  1M1A D;  2ARO A;  3V9R B;  5C3I C;  3AZM D;  3LJA C;  3C1C A;  1BH8 B;  3X1T C;  1ZLA C;  3KSY A;  3W96 D;  3WTP B;  4H9Q A;  1EQZ B;  3AZI D;  3WAA D;  3REL B;  3MGS A;  2PYO B;  5B1M B;  4ZUX C;  5BO0 A;  5E5A B;  3VH6 T;  4E44 A;  5CHL B;  3AZN B;  3UTB A;  1M19 C;  5FUG B;  5AVC B;  5B33 A;  4LD9 D;  1N1J A;  2F8N B;  3REK A;  4Z66 B;  3MNN D;  2CV5 C;  3KUY A;  3AYW A;  2RVQ D;  4UUZ B;  5AY8 D;  4G92 C;  3AZL A;  3VH6 A;  3AV2 D;  4WU8 C;  3W98 D;  5CP6 C;  1KX3 A;  4CAY B;  5B0Y A;  2F8N K;  3B6F D;  1M18 D;  1P3L C;  1KX4 C;  3MVD B;  5GSU D;  3LZ0 C;  5CPJ A;  5CPI B;  3UT9 C;  5BT1 D;  5AV9 D;  3NQJ A;  3LZ1 A;  3W99 D;  4XZQ B;  3AZE A;  1TZY D;  5AV8 A;  3KXB A;  4R8P B;  2NQB B;  4XUJ A;  4ZBJ C;  5B32 D;  2IO5 C;  1U35 C;  5AVB C;  3TU4 A;  4YM6 D;  4H9R B;  1H3O A;  3AZK D;  4M6B A;  3WKJ C;  5CPK C;  4X23 C;  3AZG D;  3REJ A; 
#chains in the Genus database with same CATH topology
 3IP4 C;  3AV1 A;  2ARO C;  1F1E A;  3B0B A;  4J8V B;  1AOI D;  2Y2P A;  3C1C C;  3W97 D;  4QLC C;  1BH9 B;  5BNV A;  3V9R A;  5B40 C;  2HIO B;  2NZD A;  5B31 B;  3MGQ B;  1P3P B;  3UTA C;  3MGS C;  3AFA A;  3WTP A;  1EQZ A;  2JCH A;  1P3G A;  4WU9 C;  2VQR A;  3WTP E;  2JSS A;  5AV6 C;  3UTB C;  3KFU G;  3B6G D;  5B1M A;  1B6W A;  5E5A A;  2LY8 A;  3REK C;  3REI C;  5FUG A;  3X1S D;  5AVC A;  3KUY C;  3AYW C;  1S32 D;  3AZL C;  4H9Q B;  5GXQ D;  3A6N D;  1KX3 C;  2Y2J A;  2F8N A;  5B0Y C;  4Z66 A;  4KUD D;  5B2J D;  1ID3 D;  1S32 C;  5GT3 A;  2BG1 A;  4Z2M H;  5JRG B;  2BYK A;  3NQU B;  1HTA A;  4CAY A;  1P3I D;  5CPJ C;  5B33 B;  5DNM D;  3MVD A;  1WWS A;  3AZF D;  1A7W A;  3AZJ D;  5CPI A;  3LZ1 C;  3EPK A;  2DF4 C;  3AZE C;  1HQ3 C;  2HUE C;  5AV8 C;  5B24 B;  4DRB A;  5B1L D;  4Z5T D;  4XUJ C;  3KWQ B;  3TU4 C;  1P3F A;  4HGA C;  4XZQ A;  3O62 B;  4R8P A;  5CPJ B;  2NQB A;  5AV5 B;  3AZH B;  3MGR B;  3REJ C;  3REH B;  4J8X B;  3AV1 C;  1KX5 A;  2DQN C;  2J8P A;  4G91 B;  3W96 A;  4KHA A;  2Y2O A;  3KXB B;  4AWL C;  5GT0 B;  4J8V A;  2UWX A;  3LEL D;  4JJN B;  2FJ7 D;  2PYO D;  2HIO A;  1P34 D;  4J8U B;  5F99 D;  1P3O B;  3WTP C;  1EQZ C;  3MGP B;  5B31 A;  4J8W B;  3REL C;  5B2I B;  3LJA D;  5B1M C;  5E5A C;  3X1T D;  3AZN C;  5BS7 C;  1ZLA D;  1PZR A;  5BNV B;  3F6T A;  5AVC C;  2NZD B;  4WJ3 C;  5DNN B;  2Y2L A;  1F66 B;  4Z66 C;  4ZUX D;  5GSU A;  2RIQ A;  3AFA B;  5B0Z A;  5GT3 C;  3X1U B;  1M19 D;  3EPJ A;  1P3A B;  1P3G B;  3AN2 B;  1P3B B;  2L5A A;  3B0C W;  3X1V B;  5G49 B;  3MVD C;  2F2A C;  5JRG A;  2CV5 D;  3NQU A;  4WU8 D;  5CPI C;  5CP6 D;  5B32 A;  1W2E A;  2Y2K A;  1P3L D;  1KX4 D;  5GT3 B;  4XZQ C;  3LZ0 D;  2BYK B;  3AZG A;  5B24 A;  1R4V A;  4R8P C;  2NQB C;  3UT9 D;  3KWQ A;  2CWE A;  3WA9 A;  3O62 A;  1P3K B;  1KX5 C;  5AV5 A;  3AZH A;  3MGR A;  3REH A;  4J8X A;  1U35 D;  5AVB D;  4J8V C;  1P3F B;  1P3M B;  3WKJ D;  4NE3 A;  5CPK D;  1M1A B;  5GT0 A;  2HIO C;  3VH5 W;  4X23 D;  4EO5 B;  4KGC D;  2FFF B;  2ARO D;  4JJN A;  4DRA A;  5B31 C;  1KX5 B;  3MGQ C;  1P3P C;  3C1C D;  4J8U A;  3X1S A;  3EG5 B;  4QLC D;  1P3O A;  5B40 D;  4CSR B;  4KHA B;  3MGP A;  4J8W A;  3A6N A;  3W96 B;  3AZI B;  3WAA B;  5B2I A;  4YS3 A;  3UTA D;  3MGS D;  5B0Z C;  5DNN A;  4WU9 D;  3UTB D;  4LD9 B;  5AV6 D;  3B0C T;  1F66 A;  3MNN B;  4WV4 B;  2Y2Q A;  5AY8 B;  3AV2 B;  5JRG C;  3X1U A;  3REK D;  3W98 B;  3REI D;  2YFW A;  2ZY5 A;  3KUY D;  3AYW D;  3AN2 A;  4H9S A;  1P3A A;  3AZL D;  1P3B A;  3B6F B;  3X1V A;  5B33 C;  1M18 B;  5G49 A;  1KX3 D;  5B0Y D;  5GSU B;  4NFT A;  5B0Z B;  2F8N G;  5CPJ D;  5B24 C;  5AV9 B;  3KWQ C;  3WA9 C;  3W99 B;  3O62 C;  1T3U A;  1TZY B;  3LZ1 D;  5B32 B;  5AV5 C;  1HQ3 D;  3AZE D;  3AZH C;  5AV8 D;  3EPH A;  3MGR C;  3REH C;  4XUJ D;  4YM6 B;  4J8X C;  1P3K A;  3AZK B;  4H9P B;  3TU4 D;  3C1B A;  2G5I C;  4G91 C;  4E45 A;  3AZG B;  3KXB C;  3VH5 T;  5GT0 C;  3REJ D;  3WA9 B;  3AV1 D;  1P3M A;  4JJN C;  1AOI B;  1BFM A;  3W97 B;  1M1A A;  4J8U C;  2XD1 A;  3AZM A;  4NE6 A;  1P3O C;  3MGP C;  4J8W C;  3A1I A;  5B2I C;  4ZUX A;  3B0D B;  4CSR A;  3AZI A;  3WAA A;  3WTP D;  2NZD C;  1EQZ D;  3B6G B;  5DNN C;  3EPL A;  3REL D;  4UPK A;  5B1M D;  1F66 C;  3AFA C;  3H0M C;  5E5A D;  5B31 G;  3X1S B;  3AZN D;  1JFI B;  3X1U C;  4LD9 A;  1P3G C;  1P3A C;  3A6N B;  5GXQ B;  5AVC D;  3AN2 C;  1P3B C;  2G5H C;  1KX4 A;  3X1V C;  3MNN A;  4KUD B;  4KGC C;  5B2J B;  5AY8 A;  1ID3 B;  3AV2 A;  4YS3 B;  2F8N D;  3W98 A;  4Z66 D;  3LZ0 A;  3B6F A;  5GT3 D;  1P3I B;  1M18 A;  2ZY2 A;  5DNM B;  3AL0 C;  3AZF B;  4H9O B;  3MVD D;  2BYM A;  3AZJ B;  2YFW B;  5CPI D;  5B1L B;  5AV9 A;  4Z5T B;  5AVB A;  3W99 A;  2Y2N A;  1TZY A;  1B67 A;  1P3K C;  4XZQ D;  4R8P D;  2NQB D;  4YM6 A;  3AZK A;  4H9P A;  3H0R C;  1P3F C;  1KX5 D;  1P3M C;  4QLC A;  4H9N B;  5B40 A;  5BNX A;  1M1A C;  1TAF A;  5JA4 A;  4EO5 C;  2YFV B;  4WZS B;  3AZM C;  3LEL B;  1AOI A;  4J8V D;  3W97 A;  3UTA A;  2FJ7 B;  2ZY4 A;  3C1B B;  2F8N H;  1P34 B;  5F99 B;  3W96 C;  4WU9 A;  2HIO D;  5C3I B;  5AV6 A;  3AZI C;  3WAA C;  3LJA B;  5B31 D;  3MGQ D;  1P3P D;  3X1T B;  3REI A;  1ZLA B;  3AZM B;  3B6G A;  2ZM5 A;  4LD9 C;  2Y2G A;  4NE5 A;  3MNN C;  4ZUX B;  1S32 A;  2RVQ C;  1JFI A;  5AY8 C;  3AV2 C;  3W98 C;  1M19 B;  5GXQ A;  5B0Z D;  3B6F C;  1M18 C;  4KUD A;  5B2J A;  1ID3 A;  5KDM B;  2CV5 B;  5GSU C;  4G92 B;  1P3I A;  5JRG D;  4WU8 B;  5DNM A;  5CP6 B;  3R45 A;  1HQ3 A;  5BT1 C;  5B33 D;  3AZF A;  4H9O A;  1P3L B;  1KX4 B;  5AV9 C;  3AZJ A;  3W99 C;  3LZ0 B;  1TZY C;  5B1L A;  4Z5T A;  5B32 C;  3UT9 B;  5B24 D;  4YM6 C;  3KWQ D;  3AZK C;  1Q9C A;  3WA9 D;  2BYM B;  2Y2M A;  3O62 D;  3AZG C;  4ZBJ B;  5AV5 D;  2IO5 B;  3AZH D;  1U35 B;  3MGR D;  5AVB B;  3REH D;  4J8X D;  1AOI C;  1BH8 A;  4H9N A;  3W97 C;  3WKJ B;  5CPK B;  3FDD A;  4WNN B;  2YFV A;  4X23 B;  3KXB D;  3LEL A;  4KGC B;  5GT0 D;  2ARO B;  3REL A;  2FJ7 A;  2PYO A;  4JJN D;  3C1C B;  3B0D C;  1P34 A;  5F99 A;  5BS7 A;  4QLC B;  3AZN A;  3P5J B;  5B40 B;  5BNX B;  4J8U D;  1TAF B;  1P3O D;  5JA4 B;  3LJA A;  3MGP D;  3B6G C;  4J8W D;  5B2I D;  3X1T A;  3UTA B;  3MGS B;  1ZLA A;  2XD5 A;  4UUZ A;  4YS3 D;  3X1S C;  5BO0 B;  3VH5 A;  2JE5 A;  4WU9 B;  3UTB B;  3A6N C;  5GXQ C;  5AV6 B;  2NZD D;  1ULY A;  5DNN D;  4KUD C;  5B2J C;  1ID3 C;  1N1J B;  4YS3 C;  1F66 D;  3VH6 W;  3REK B;  1M19 A;  3AFA D;  3KUY B;  3H0L C;  3REI B;  3AYW B;  1P3I C;  2Y2I A;  3X1U D;  3AZL B;  1P3B D;  5DNM C;  1P3G D;  3AN2 D;  1P3A D;  1KX3 B;  5KDM A;  5B0Y B;  3X1V D;  2CV5 A;  3AZF C;  3AZJ C;  1S32 B;  4WU8 A;  5CP6 A;  4H9S C;  1P3L A;  5B1L C;  4Z5T C;  4H9R A;  3NQJ B;  3LZ1 B;  3UT9 A;  3AZE B;  3R45 B;  1HQ3 B;  2HUE B;  5AV8 B;  4XUJ B;  1WWI A;  3TU4 B;  1KU5 A;  4HGA B;  1P3K D;  1H3O B;  1BH9 A;  3C1B D;  1U35 A;  3LEL C;  3REJ B;  3AV1 B;  3MGQ A;  1P3P A;  5B32 G;  3WKJ A;  1Z2C B;  1P3F D;  2FJ7 C;  2PYO C;  5CPK A;  1P3M D;  4WNN A;  4X23 A;  3C1B C;  4Z2M G;  1P34 C;  4KGC A;  5F99 C;  4AWL B;  1M1A D;  2ARO A;  3V9R B;  5C3I C;  3AZM D;  3LJA C;  3C1C A;  1BH8 B;  3X1T C;  1ZLA C;  3KSY A;  3W96 D;  3WTP B;  4H9Q A;  1EQZ B;  3AZI D;  3WAA D;  3REL B;  3MGS A;  2PYO B;  5B1M B;  4ZUX C;  5BO0 A;  5E5A B;  3VH6 T;  4E44 A;  5CHL B;  3AZN B;  3UTB A;  1M19 C;  5FUG B;  5AVC B;  5B33 A;  4LD9 D;  3A1K A;  2Y2H A;  1N1J A;  2F8N B;  3REK A;  4Z66 B;  3MNN D;  2CV5 C;  3KUY A;  3AYW A;  2RVQ D;  4UUZ B;  5AY8 D;  4G92 C;  3AZL A;  3VH6 A;  3AV2 D;  4WU8 C;  3W98 D;  5CP6 C;  1KX3 A;  4CAY B;  5B0Y A;  2F8N K;  3B6F D;  1M18 D;  1P3L C;  1KX4 C;  2W8S A;  3MVD B;  2ZY3 A;  5GSU D;  3LZ0 C;  4DQY B;  5CPJ A;  5CPI B;  3UT9 C;  5BT1 D;  5AV9 D;  3NQJ A;  3LZ1 A;  3W99 D;  4XZQ B;  3AZE A;  1TZY D;  5AV8 A;  3KXB A;  4R8P B;  2NQB B;  4XUJ A;  4ZBJ C;  5B32 D;  2IO5 C;  1U35 C;  5AVB C;  3TU4 A;  4YM6 D;  4H9R B;  1H3O A;  3AZK D;  4M6B A;  3WKJ C;  5CPK C;  4X23 C;  3AZG D;  3REJ A; 
#chains in the Genus database with same CATH homology
 3IP4 C;  3AV1 A;  2ARO C;  1F1E A;  3B0B A;  4J8V B;  1AOI D;  2Y2P A;  3C1C C;  3W97 D;  4QLC C;  1BH9 B;  5BNV A;  3V9R A;  5B40 C;  2HIO B;  2NZD A;  5B31 B;  3MGQ B;  1P3P B;  3UTA C;  3MGS C;  3AFA A;  3WTP A;  1EQZ A;  2JCH A;  1P3G A;  4WU9 C;  2VQR A;  3WTP E;  2JSS A;  5AV6 C;  3UTB C;  3KFU G;  3B6G D;  5B1M A;  1B6W A;  5E5A A;  2LY8 A;  3REK C;  3REI C;  5FUG A;  3X1S D;  5AVC A;  3KUY C;  3AYW C;  1S32 D;  3AZL C;  4H9Q B;  5GXQ D;  3A6N D;  1KX3 C;  2Y2J A;  2F8N A;  5B0Y C;  4Z66 A;  4KUD D;  5B2J D;  1ID3 D;  1S32 C;  5GT3 A;  2BG1 A;  4Z2M H;  5JRG B;  2BYK A;  3NQU B;  1HTA A;  4CAY A;  1P3I D;  5CPJ C;  5B33 B;  5DNM D;  3MVD A;  1WWS A;  3AZF D;  1A7W A;  3AZJ D;  5CPI A;  3LZ1 C;  3EPK A;  2DF4 C;  3AZE C;  1HQ3 C;  2HUE C;  5AV8 C;  5B24 B;  4DRB A;  5B1L D;  4Z5T D;  4XUJ C;  3KWQ B;  3TU4 C;  1P3F A;  4HGA C;  4XZQ A;  3O62 B;  4R8P A;  5CPJ B;  2NQB A;  5AV5 B;  3AZH B;  3MGR B;  3REJ C;  3REH B;  4J8X B;  3AV1 C;  1KX5 A;  2DQN C;  2J8P A;  4G91 B;  3W96 A;  4KHA A;  2Y2O A;  3KXB B;  4AWL C;  5GT0 B;  4J8V A;  2UWX A;  3LEL D;  4JJN B;  2FJ7 D;  2PYO D;  2HIO A;  1P34 D;  4J8U B;  5F99 D;  1P3O B;  3WTP C;  1EQZ C;  3MGP B;  5B31 A;  4J8W B;  3REL C;  5B2I B;  3LJA D;  5B1M C;  5E5A C;  3X1T D;  3AZN C;  5BS7 C;  1ZLA D;  1PZR A;  5BNV B;  3F6T A;  5AVC C;  2NZD B;  4WJ3 C;  5DNN B;  2Y2L A;  1F66 B;  4Z66 C;  4ZUX D;  5GSU A;  2RIQ A;  3AFA B;  5B0Z A;  5GT3 C;  3X1U B;  1M19 D;  3EPJ A;  1P3A B;  1P3G B;  3AN2 B;  1P3B B;  2L5A A;  3B0C W;  3X1V B;  5G49 B;  3MVD C;  2F2A C;  5JRG A;  2CV5 D;  3NQU A;  4WU8 D;  5CPI C;  5CP6 D;  5B32 A;  1W2E A;  2Y2K A;  1P3L D;  1KX4 D;  5GT3 B;  4XZQ C;  3LZ0 D;  2BYK B;  3AZG A;  5B24 A;  1R4V A;  4R8P C;  2NQB C;  3UT9 D;  3KWQ A;  2CWE A;  3WA9 A;  3O62 A;  1P3K B;  1KX5 C;  5AV5 A;  3AZH A;  3MGR A;  3REH A;  4J8X A;  1U35 D;  5AVB D;  4J8V C;  1P3F B;  1P3M B;  3WKJ D;  4NE3 A;  5CPK D;  1M1A B;  5GT0 A;  2HIO C;  3VH5 W;  4X23 D;  4EO5 B;  4KGC D;  2FFF B;  2ARO D;  4JJN A;  4DRA A;  5B31 C;  1KX5 B;  3MGQ C;  1P3P C;  3C1C D;  4J8U A;  3X1S A;  3EG5 B;  4QLC D;  1P3O A;  5B40 D;  4CSR B;  4KHA B;  3MGP A;  4J8W A;  3A6N A;  3W96 B;  3AZI B;  3WAA B;  5B2I A;  4YS3 A;  3UTA D;  3MGS D;  5B0Z C;  5DNN A;  4WU9 D;  3UTB D;  4LD9 B;  5AV6 D;  3B0C T;  1F66 A;  3MNN B;  4WV4 B;  2Y2Q A;  5AY8 B;  3AV2 B;  5JRG C;  3X1U A;  3REK D;  3W98 B;  3REI D;  2YFW A;  2ZY5 A;  3KUY D;  3AYW D;  3AN2 A;  4H9S A;  1P3A A;  3AZL D;  1P3B A;  3B6F B;  3X1V A;  5B33 C;  1M18 B;  5G49 A;  1KX3 D;  5B0Y D;  5GSU B;  4NFT A;  5B0Z B;  2F8N G;  5CPJ D;  5B24 C;  5AV9 B;  3KWQ C;  3WA9 C;  3W99 B;  3O62 C;  1T3U A;  1TZY B;  3LZ1 D;  5B32 B;  5AV5 C;  1HQ3 D;  3AZE D;  3AZH C;  5AV8 D;  3EPH A;  3MGR C;  3REH C;  4XUJ D;  4YM6 B;  4J8X C;  1P3K A;  3AZK B;  4H9P B;  3TU4 D;  3C1B A;  2G5I C;  4G91 C;  4E45 A;  3AZG B;  3KXB C;  3VH5 T;  5GT0 C;  3REJ D;  3WA9 B;  3AV1 D;  1P3M A;  4JJN C;  1AOI B;  1BFM A;  3W97 B;  1M1A A;  4J8U C;  2XD1 A;  3AZM A;  4NE6 A;  1P3O C;  3MGP C;  4J8W C;  3A1I A;  5B2I C;  4ZUX A;  3B0D B;  4CSR A;  3AZI A;  3WAA A;  3WTP D;  2NZD C;  1EQZ D;  3B6G B;  5DNN C;  3EPL A;  3REL D;  4UPK A;  5B1M D;  1F66 C;  3AFA C;  3H0M C;  5E5A D;  5B31 G;  3X1S B;  3AZN D;  1JFI B;  3X1U C;  4LD9 A;  1P3G C;  1P3A C;  3A6N B;  5GXQ B;  5AVC D;  3AN2 C;  1P3B C;  2G5H C;  1KX4 A;  3X1V C;  3MNN A;  4KUD B;  4KGC C;  5B2J B;  5AY8 A;  1ID3 B;  3AV2 A;  4YS3 B;  2F8N D;  3W98 A;  4Z66 D;  3LZ0 A;  3B6F A;  5GT3 D;  1P3I B;  1M18 A;  2ZY2 A;  5DNM B;  3AL0 C;  3AZF B;  4H9O B;  3MVD D;  2BYM A;  3AZJ B;  2YFW B;  5CPI D;  5B1L B;  5AV9 A;  4Z5T B;  5AVB A;  3W99 A;  2Y2N A;  1TZY A;  1B67 A;  1P3K C;  4XZQ D;  4R8P D;  2NQB D;  4YM6 A;  3AZK A;  4H9P A;  3H0R C;  1P3F C;  1KX5 D;  1P3M C;  4QLC A;  4H9N B;  5B40 A;  5BNX A;  1M1A C;  1TAF A;  5JA4 A;  4EO5 C;  2YFV B;  4WZS B;  3AZM C;  3LEL B;  1AOI A;  4J8V D;  3W97 A;  3UTA A;  2FJ7 B;  2ZY4 A;  3C1B B;  2F8N H;  1P34 B;  5F99 B;  3W96 C;  4WU9 A;  2HIO D;  5C3I B;  5AV6 A;  3AZI C;  3WAA C;  3LJA B;  5B31 D;  3MGQ D;  1P3P D;  3X1T B;  3REI A;  1ZLA B;  3AZM B;  3B6G A;  2ZM5 A;  4LD9 C;  2Y2G A;  4NE5 A;  3MNN C;  4ZUX B;  1S32 A;  2RVQ C;  1JFI A;  5AY8 C;  3AV2 C;  3W98 C;  1M19 B;  5GXQ A;  5B0Z D;  3B6F C;  1M18 C;  4KUD A;  5B2J A;  1ID3 A;  5KDM B;  2CV5 B;  5GSU C;  4G92 B;  1P3I A;  5JRG D;  4WU8 B;  5DNM A;  5CP6 B;  3R45 A;  1HQ3 A;  5BT1 C;  5B33 D;  3AZF A;  4H9O A;  1P3L B;  1KX4 B;  5AV9 C;  3AZJ A;  3W99 C;  3LZ0 B;  1TZY C;  5B1L A;  4Z5T A;  5B32 C;  3UT9 B;  5B24 D;  4YM6 C;  3KWQ D;  3AZK C;  1Q9C A;  3WA9 D;  2BYM B;  2Y2M A;  3O62 D;  3AZG C;  4ZBJ B;  5AV5 D;  2IO5 B;  3AZH D;  1U35 B;  3MGR D;  5AVB B;  3REH D;  4J8X D;  1AOI C;  1BH8 A;  4H9N A;  3W97 C;  3WKJ B;  5CPK B;  3FDD A;  4WNN B;  2YFV A;  4X23 B;  3KXB D;  3LEL A;  4KGC B;  5GT0 D;  2ARO B;  3REL A;  2FJ7 A;  2PYO A;  4JJN D;  3C1C B;  3B0D C;  1P34 A;  5F99 A;  5BS7 A;  4QLC B;  3AZN A;  3P5J B;  5B40 B;  5BNX B;  4J8U D;  1TAF B;  1P3O D;  5JA4 B;  3LJA A;  3MGP D;  3B6G C;  4J8W D;  5B2I D;  3X1T A;  3UTA B;  3MGS B;  1ZLA A;  2XD5 A;  4UUZ A;  4YS3 D;  3X1S C;  5BO0 B;  3VH5 A;  2JE5 A;  4WU9 B;  3UTB B;  3A6N C;  5GXQ C;  5AV6 B;  2NZD D;  1ULY A;  5DNN D;  4KUD C;  5B2J C;  1ID3 C;  1N1J B;  4YS3 C;  1F66 D;  3VH6 W;  3REK B;  1M19 A;  3AFA D;  3KUY B;  3H0L C;  3REI B;  3AYW B;  1P3I C;  2Y2I A;  3X1U D;  3AZL B;  1P3B D;  5DNM C;  1P3G D;  3AN2 D;  1P3A D;  1KX3 B;  5KDM A;  5B0Y B;  3X1V D;  2CV5 A;  3AZF C;  3AZJ C;  1S32 B;  4WU8 A;  5CP6 A;  4H9S C;  1P3L A;  5B1L C;  4Z5T C;  4H9R A;  3NQJ B;  3LZ1 B;  3UT9 A;  3AZE B;  3R45 B;  1HQ3 B;  2HUE B;  5AV8 B;  4XUJ B;  1WWI A;  3TU4 B;  1KU5 A;  4HGA B;  1P3K D;  1H3O B;  1BH9 A;  3C1B D;  1U35 A;  3LEL C;  3REJ B;  3AV1 B;  3MGQ A;  1P3P A;  5B32 G;  3WKJ A;  1Z2C B;  1P3F D;  2FJ7 C;  2PYO C;  5CPK A;  1P3M D;  4WNN A;  4X23 A;  3C1B C;  4Z2M G;  1P34 C;  4KGC A;  5F99 C;  4AWL B;  1M1A D;  2ARO A;  3V9R B;  5C3I C;  3AZM D;  3LJA C;  3C1C A;  1BH8 B;  3X1T C;  1ZLA C;  3KSY A;  3W96 D;  3WTP B;  4H9Q A;  1EQZ B;  3AZI D;  3WAA D;  3REL B;  3MGS A;  2PYO B;  5B1M B;  4ZUX C;  5BO0 A;  5E5A B;  3VH6 T;  4E44 A;  5CHL B;  3AZN B;  3UTB A;  1M19 C;  5FUG B;  5AVC B;  5B33 A;  4LD9 D;  3A1K A;  2Y2H A;  1N1J A;  2F8N B;  3REK A;  4Z66 B;  3MNN D;  2CV5 C;  3KUY A;  3AYW A;  2RVQ D;  4UUZ B;  5AY8 D;  4G92 C;  3AZL A;  3VH6 A;  3AV2 D;  4WU8 C;  3W98 D;  5CP6 C;  1KX3 A;  4CAY B;  5B0Y A;  2F8N K;  3B6F D;  1M18 D;  1P3L C;  1KX4 C;  2W8S A;  3MVD B;  2ZY3 A;  5GSU D;  3LZ0 C;  4DQY B;  5CPJ A;  5CPI B;  3UT9 C;  5BT1 D;  5AV9 D;  3NQJ A;  3LZ1 A;  3W99 D;  4XZQ B;  3AZE A;  1TZY D;  5AV8 A;  3KXB A;  4R8P B;  2NQB B;  4XUJ A;  4ZBJ C;  5B32 D;  2IO5 C;  1U35 C;  5AVB C;  3TU4 A;  4YM6 D;  4H9R B;  1H3O A;  3AZK D;  4M6B A;  3WKJ C;  5CPK C;  4X23 C;  3AZG D;  3REJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...