2AROD

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroD00
3AZLB 4UUZA 1P3OA 3WKJB 1P3FA 3WTPA 3AZEA 1M1AA 3UTAC 3MGPD 4J8UA 3UT9D 3LJAD 3MGPC 5B33B 3LELA 1B67A 5CPJD 1N1JB 3UT9C 3W96B 3LZ0A 1HTAA 3AYWA 3AV2A 5B24B 4X23B 5CPJC 4WU8D 1EQZA 2PYOA 3B0DC 4M6BA 5AV5D 3REKD 4J8XD 3REIB 4WU8C 5B31D 4ZUXD 3AZMB 5AV5C 3REKC 4J8XC 2NZDD 4LD9D 4XZQD 5AV8A 2AROD 5B31C 5B1MB 4ZUXC 3MNNA 3X1UB 2NZDC 4LD9C 4XZQC 2AROC 5B2JB 5E5AA 3VH6T 3WKJA 3RELB 4JJND 1P3IB 3AZIB 5AY8D 4ZBJB 5DNNA 3W99D 4JJNC 5GXQD 5F99D 3UTBD 3C1BB 4HGAB 4KHAB 5AY8C 4E45A 3W96A 3W99C 5GXQC 5F99C 3UTBC 1P3GD 4X23A 5GT0A 5CPKB 3AZGD 3W98D 1P3GC 3REIA 3AZGC 3W98C 3AZKB 1ULYA 3AZLD 1ZLAB 1U35D 3X1UA 3KUYB 3AZLC 1U35C 4NE3A 2YFVB 2NQBD 4YM6D 2HIOA 5B33D 3AZJD 4H9PB 5GSUD 5B2IB 3AV1A 2NQBC 1P3IA 4YM6C 5B33C 3AZIA 2FJ7D 3AZJC 4XUJD 5B24D 4H9SA 5GSUC 3A6NB 1S32D 5B0ZA 3C1BA 4H9NB 2FJ7C 5BS7A 5CP6B 4XUJC 3MGQB 5B24C 1M18D 1S32C 3AZMD 3MGSB 4J8VB 3MGRB 2F8NK 3TU4A 3AN2B 5CPKA 5BNXA 3V9RB 5B1MD 3AZMC 1P3LB 5B2JD 3AZKA 5B1MC 1P3FB 3WTPB 3AZEB 1M1AB 4J8UB 4H9QB 1ZLAA 5B2JC 3RELD 3KUYA 3VH5A 3LELB 1P3KA 4CSRB 3RELC 4WU9D 5B0YA 2BYKB 1P34B 5KDMA 2HUEB 4H9PA 3C1CB 4KUDB 4ZBJC 2F8NB 4WU9C 1KX3B 5AV6D 3AZFB 2PYOB 3A6NA 4NE5A 3KXBB 1AOIB 5AV6C 3R45B 5CP6A 1P3BB 4KGCD 3VH5W 1H3OA 5AV8B 4EO5B 3AZNB 3MGSA 2L5AA 3MGRA 4G92C 3B6FB 4KGCC 4E44A 3AFAB 3V9RA 1ID3B 1P3LA 5AV9A 3LZ1B 5CHLB 5E5AB 4H9QA 5GT3D 1KX5D 5B2ID 1KX4B 5AVCD 5DNNB 5B1LD 5GT3C 3WTPE 1KX5C 4CSRA 5B2IC 5AVCC 2BYKA 1P34A 5B1LC 1F66D 3C1CA 4KUDA 3MGQD 5GT0B 2F8NA 1KX3A 5AVBD 3AZFA 1P3PA 1F66C 3KXBA 4J8VD 3MGQC 1AOIA 1WWIA 3AN2D 5AVBC 1P3AB 3R45A 1P3BA 4J8VC 1P3OD 3AN2C 5JRGB 3AZNA 5BO0A 3W97B 1P3FD 3WTPD 3AZED 5C3IB 1M1AD 3AZHA 4J8UD 4YS3A 2CV5B 3B6FA 3AFAA 1P3OC 3X1SA 1ID3A 4Z66B 1P3FC 3WTPC 3LZ1A 3AZEC 1M1AC 4J8UC 2HIOB 4Z5TA 3VH6A 3LELD 3AV1B 4AWLB 4J8WB 3LZ0D 1KX4A 3AYWD 3AV2D 3LELC 1M19A 1EQZD 5B0ZB 4G91B 2PYOD 3LZ0C 1TZYB 3X1VB 3AYWC 3AV2C 3B6GA 3X1TB 1EQZC 2PYOC 1HQ3B 3TU4B 5BNVB 3VH6W 5BNXB 5AV8D 3MNND 1P3AA 5AV8C 5CPIB 4WNNA 3MNNC 5JRGA 2IO5B 5E5AD 3W97A 4H9OB 3WKJD 3MVDB 5BT1D 5DNMA 2CV5A 3WA9B 5E5AC 4Z66A 1P3KB 3WKJC 3WAAA 5DNND 5BT1C 5B0YB 5B32G 5KDMB 3B0CT 5B40B 3W96D 5DNNC 4J8WA 3REHA 4X23D 5GT0D 3W96C 4QLCB 1TZYA 3X1VA 4X23C 5GT0C 3X1TA 3REID 1H3OB 3UTAB 3KWQA 4NFTA 1HQ3A 5BNVA 3REIC 3MGPB 4CAYA 2CWEA 5AV9B 3X1UD 2JSSA 4R8PA 3LJAB 5CPIA 5B32A 5C3IC 4WV4B 3X1UC 2HIOD 4H9OA 3MVDA 3AV1D 3B0DB 1BH9A 3WA9A 1P3ID 4DRAA 2HIOC 3AZID 4WU8B 3AV1C 1P3IC 3KSYA 5B0ZD 3O62A 5B40A 3C1BD 4J8XB 3REKB 3AZIC 3REJA 1P3MA 4H9SC 3UTAD 4ZUXB 1P3PB 5B0ZC 3C1BC 2NZDB 4HGAC 4LD9B 5BS7C 2AROB 3TU4D 1Q9CA 5CPKD 1R4VA 4QLCA 1BFMA 3TU4C 5B31G 5CPKC 3UTAA 5BO0B 3AZKD 2YFWB 3AZHB 4YS3B 1ZLAD 3X1SB 3MGPA 3AZKC 3KUYD 3UT9A 4Z5TB 5G49A 5AY8B 1ZLAC 3LJAA 3W99B 1P3KD 5GXQB 3KUYC 5B0YD 5CPJA 1P3KC 1M19B 5B0YC 1P3GB 4WU8A 3A6ND 3B6GB 3W98B 5AV5A 3REKA 4J8XA 5CP6D 3A6NC 5B31A 4ZUXA 1BH8A 2NZDA 3MGSD 4LD9A 4XZQA 5CP6C 2AROA 3MGRD 1U35B 1WWSA 4Z2MH 3MGSC 1P3LD 5AV9D 3MGRC 4WNNB 2NQBB 4YM6B 2YFWA 5DNMB 1P3LC 5AV9C 3AZJB 5GSUB 4JJNA 3LJAC 3WAAB 2FJ7B 5AY8A 2LY8A 4XUJB 1TAFA 3W99A 1S32B 5GXQA 5F99A 3REHB 3UTBA 1P34D 3B0BA 1M18B 3C1CD 3NQJB 4KUDD 2F8ND 1KX3D 1P3PD 3AZFD 1P34C 1P3GA 2HUEC 3KXBD 3C1CC 3AZGA 1JFIB 1AOID 3W98A 4KUDC 5JA4B 1KX3C 1P3PC 3AZFC 1P3BD 3KWQB 3KXBC 1AOIC 3AZND 3AZLA 1P3BC 1B6WA 4CAYB 1U35A 3B6FD 4YS3D 3AZHD 3AFAD 3X1SD 1ID3D 4EO5C 3AZNC 4R8PB 4DRBA 5B32B 3LZ1D 2RVQD 3B6FC 4YS3C 3AZHC 2NQBA 4Z5TD 3AFAC 3X1SC 1ID3C 4YM6A 4WU9B 5B33A 4H9RB 1BH9B 3LZ1C 2RVQC 3AZJA 5GSUA 1N1JA 4Z5TC 1KX4D 5AV6B 2FJ7A 1M19D 4XUJA 3O62B 5B24A 1S32A 3REJB 1P3MB 1KX4C 3B6GD 1M19C 1M18A 4G92B 3NQJA 4KGCB 3B6GC 3AZMA 2F8NH 1JFIA 5JA4A 5B1MA 4Z2MG 1P3AD 5B2JA 3B0CW 5JRGD 1P3AC 1F1EA 3W97D 5GT3B 5DNMD 5FUGB 2CV5D 1KX5B 1KU5A 3UT9B 5JRGC 5G49B 3RELA 5AVCB 4Z66D 5B1LB 3W97C 3WAAD 5DNMC 2CV5C 5CPJB 4WU9A 4Z66C 4H9RA 3WAAC 4J8WD 3REHD 1F66B 3NQUB 4KHAA 4NE6A 5AV6A 5AVBB 4AWLC 4J8WC 3REHC 5AV5B 1M18C 1TZYD 3X1VD 1A7WA 5B31B 3X1TD 1BH8B 2BYMB 4G91C 4KGCA 3KWQD 1TZYC 3X1VC 4UUZB 4XZQB 1P3OB 1HQ3D 3X1TC 3KWQC 1HQ3C 4R8PD 5CPID 4WZSB 5B32D 3VH5T 2YFVA 4JJNB 4R8PC 3MVDD 5CPIC 5GT3A 5FUGA 1KX5A 5B32C 3WA9D 3LZ0B 5B2IA 3AYWB 2IO5C 5AVCA 3AV2B 1TAFB 5B1LA 1EQZB 3MVDC 5F99B 3WA9C 3UTBB 3O62D 5B40D 3REJD 1P3MD 4H9NA 1F66A 3NQUA 3MGQA 3O62C 5B40C 5AVBA 3REJC 3AZGB 1P3MC 2F8NG 4QLCD 4J8VA 3MNNB 3AN2A 2BYMA 4QLCC
chains in the Genus database with same CATH superfamily
2W8SA 3AZLB 4UUZA 1P3OA 3WKJB 1P3FA 3WTPA 3AZEA 1M1AA 3UTAC 3MGPD 4J8UA 3UT9D 4UPKA 3LJAD 3MGPC 5B33B 3LELA 1B67A 5CPJD 1N1JB 3UT9C 3W96B 3LZ0A 1HTAA 3AYWA 3AV2A 5B24B 4X23B 5CPJC 4WU8D 1EQZA 2PYOA 3B0DC 4M6BA 5AV5D 3REKD 4J8XD 3REIB 4WU8C 5B31D 4ZUXD 3AZMB 5AV5C 3REKC 4J8XC 2NZDD 4LD9D 2JCHA 5AV8A 2AROD 4XZQD 5B31C 5B1MB 4ZUXC 3MNNA 3X1UB 2NZDC 4LD9C 4XZQC 2AROC 5B2JB 2Y2NA 5E5AA 3VH6T 3WKJA 3RELB 4JJND 1P3IB 3AZIB 5AY8D 2Y2HA 4ZBJB 5DNNA 3W99D 4JJNC 5GXQD 5F99D 2FFFB 3C1BB 3UTBD 4HGAB 4KHAB 5AY8C 4E45A 3W96A 3EPKA 3W99C 5GXQC 5F99C 3UTBC 1P3GD 4X23A 5GT0A 5CPKB 3AZGD 3P5JB 3W98D 1P3GC 3REIA 1PZRA 2ZY4A 3AZGC 3W98C 3AZKB 1ULYA 3AZLD 1ZLAB 1U35D 3IP4C 2F2AC 3X1UA 3KUYB 3AZLC 1U35C 4NE3A 2YFVB 2NQBD 4YM6D 1Z2CB 2HIOA 5B33D 3H0RC 3AZJD 4H9PB 5GSUD 5B2IB 3AV1A 2NQBC 1P3IA 4YM6C 3H0LC 2Y2MA 5B33C 3AZIA 2FJ7D 3AZJC 4XUJD 5B24D 4H9SA 5GSUC 3A6NB 2ZM5A 1S32D 2XD1A 5B0ZA 3C1BA 4H9NB 2FJ7C 5BS7A 5CP6B 4XUJC 3MGQB 5B24C 1M18D 1S32C 3AZMD 3MGSB 3A1IA 4J8VB 3MGRB 2F8NK 3TU4A 3AN2B 5CPKA 5BNXA 3V9RB 5B1MD 3AZMC 2Y2KA 1P3LB 5B2JD 3AZKA 5B1MC 1P3FB 3WTPB 3AZEB 1M1AB 4WJ3C 4J8UB 4H9QB 1ZLAA 5B2JC 3RELD 3KUYA 3VH5A 3LELB 1P3KA 4CSRB 3RELC 4WU9D 5B0YA 2BYKB 1P34B 5KDMA 1T3UA 2HUEB 4H9PA 3C1CB 4KUDB 4ZBJC 2F8NB 4WU9C 1KX3B 5AV6D 3AZFB 2PYOB 3A6NA 4NE5A 3KXBB 1AOIB 5AV6C 3R45B 5CP6A 1P3BB 4KGCD 3VH5W 1H3OA 2Y2QA 5AV8B 4EO5B 3AZNB 3MGSA 3FDDA 2L5AA 3MGRA 4G92C 3B6FB 4KGCC 4E44A 3AFAB 3V9RA 1ID3B 2ZY2A 3EPJA 1P3LA 5AV9A 3LZ1B 5CHLB 5E5AB 2Y2LA 2Y2OA 4H9QA 5GT3D 1KX5D 5B2ID 1KX4B 5AVCD 5DNNB 5B1LD 5GT3C 3WTPE 1KX5C 4CSRA 5B2IC 5AVCC 2BYKA 3EPLA 5B1LC 1P34A 1F66D 3C1CA 4KUDA 3MGQD 5GT0B 2F8NA 1KX3A 5AVBD 3AZFA 1P3PA 1F66C 3KXBA 4J8VD 3MGQC 1AOIA 1WWIA 3AN2D 5AVBC 1P3AB 3R45A 1P3BA 4J8VC 1P3OD 3AN2C 5JRGB 3AZNA 5BO0A 3W97B 1P3FD 3WTPD 3AZED 5C3IB 1M1AD 3AZHA 4J8UD 4YS3A 2CV5B 3B6FA 3AFAA 1P3OC 3X1SA 1ID3A 4Z66B 1P3FC 3WTPC 3LZ1A 3AZEC 1M1AC 4J8UC 2HIOB 4Z5TA 3VH6A 2UWXA 3LELD 3AV1B 4AWLB 4J8WB 3LZ0D 2VQRA 1KX4A 3AYWD 3AV2D 3LELC 1M19A 1EQZD 5B0ZB 4G91B 2PYOD 3LZ0C 1TZYB 3X1VB 3AYWC 3AV2C 3B6GA 3X1TB 1EQZC 2PYOC 1HQ3B 3TU4B 5BNVB 3VH6W 5AV8D 5BNXB 3MNND 2Y2JA 1P3AA 5AV8C 3EG5B 5CPIB 4WNNA 3MNNC 5JRGA 2IO5B 5E5AD 3W97A 4H9OB 3WKJD 3MVDB 5BT1D 5DNMA 1W2EA 2CV5A 3WA9B 3AL0C 5E5AC 4Z66A 1P3KB 3WKJC 3WAAA 2DF4C 5DNND 5BT1C 5B0YB 2G5HC 5B32G 5KDMB 3B0CT 5B40B 3W96D 5DNNC 4J8WA 3REHA 3KFUG 4X23D 5GT0D 3W96C 4QLCB 1TZYA 3X1VA 4X23C 5GT0C 3X1TA 3REID 1H3OB 3UTAB 3KWQA 4NFTA 1HQ3A 5BNVA 3REIC 3MGPB 4CAYA 2CWEA 5AV9B 3X1UD 2JSSA 4R8PA 3LJAB 5CPIA 5B32A 5C3IC 4WV4B 3X1UC 2HIOD 2XD5A 4H9OA 3MVDA 3AV1D 3B0DB 1BH9A 3WA9A 1P3ID 4DRAA 2HIOC 3AZID 4WU8B 3AV1C 1P3IC 3KSYA 5B0ZD 3O62A 5B40A 3C1BD 4J8XB 3REKB 3AZIC 3REJA 1P3MA 4H9SC 3UTAD 4ZUXB 1P3PB 5B0ZC 3C1BC 2NZDB 4HGAC 4LD9B 5BS7C 2AROB 3TU4D 1Q9CA 5CPKD 1R4VA 4QLCA 1BFMA 3TU4C 5B31G 5CPKC 3UTAA 5BO0B 3AZKD 2YFWB 3AZHB 4YS3B 1ZLAD 3X1SB 3MGPA 3AZKC 3KUYD 3UT9A 4Z5TB 2DQNC 5G49A 5AY8B 1ZLAC 3LJAA 3W99B 1P3KD 5GXQB 3KUYC 5B0YD 5CPJA 1P3KC 2Y2GA 1M19B 5B0YC 1P3GB 4WU8A 3H0MC 3A6ND 3B6GB 3W98B 5AV5A 3REKA 4J8XA 5CP6D 3A6NC 5B31A 4ZUXA 1BH8A 2NZDA 3MGSD 4LD9A 4XZQA 5CP6C 2AROA 3MGRD 1U35B 1WWSA 4Z2MH 3MGSC 1P3LD 5AV9D 3MGRC 4WNNB 2NQBB 4YM6B 2YFWA 3F6TA 5DNMB 1P3LC 5AV9C 3AZJB 5GSUB 4JJNA 3LJAC 3WAAB 2FJ7B 5AY8A 2LY8A 4XUJB 1TAFA 3W99A 1S32B 5GXQA 5F99A 3REHB 3UTBA 1P34D 3B0BA 2BG1A 1M18B 3C1CD 3NQJB 4KUDD 2F8ND 1KX3D 1P3PD 3AZFD 1P34C 1P3GA 2HUEC 3EPHA 3KXBD 3C1CC 3AZGA 1JFIB 1AOID 3W98A 4KUDC 5JA4B 1KX3C 1P3PC 3AZFC 1P3BD 2J8PA 2Y2IA 3KWQB 3KXBC 1AOIC 3AZND 3AZLA 1P3BC 1B6WA 4CAYB 1U35A 3B6FD 4YS3D 3AZHD 3AFAD 3X1SD 1ID3D 4EO5C 3AZNC 4R8PB 4DRBA 5B32B 3LZ1D 2RVQD 3B6FC 4YS3C 3AZHC 2NQBA 4Z5TD 3AFAC 3X1SC 1ID3C 4YM6A 4WU9B 5B33A 4H9RB 1BH9B 2G5IC 2RVQC 3LZ1C 3AZJA 2Y2PA 5GSUA 1N1JA 4Z5TC 1KX4D 5AV6B 2FJ7A 1M19D 4XUJA 3A1KA 5B24A 3O62B 1S32A 3REJB 1P3MB 1KX4C 3B6GD 1M19C 1M18A 4G92B 3NQJA 4KGCB 3B6GC 3AZMA 2F8NH 2RIQA 2ZY5A 1JFIA 5JA4A 5B1MA 4Z2MG 1P3AD 5B2JA 3B0CW 5JRGD 1P3AC 1F1EA 3W97D 5GT3B 5DNMD 5FUGB 2CV5D 1KX5B 1KU5A 3UT9B 5JRGC 5G49B 3RELA 5AVCB 4Z66D 5B1LB 3W97C 3WAAD 5DNMC 2CV5C 5CPJB 4WU9A 4Z66C 4H9RA 3WAAC 4J8WD 3REHD 1F66B 3NQUB 4KHAA 4NE6A 5AV6A 5AVBB 4AWLC 4J8WC 3REHC 5AV5B 1M18C 1TZYD 3X1VD 1A7WA 5B31B 3X1TD 1BH8B 2BYMB 4G91C 4KGCA 3KWQD 1TZYC 3X1VC 4UUZB 4XZQB 1P3OB 1HQ3D 3X1TC 3KWQC 4DQYB 1HQ3C 4R8PD 5CPID 4WZSB 5B32D 3VH5T 2YFVA 4JJNB 4R8PC 3MVDD 5CPIC 5GT3A 5FUGA 1KX5A 5B32C 3WA9D 3LZ0B 5B2IA 3AYWB 2IO5C 5AVCA 3AV2B 1TAFB 5B1LA 1EQZB 3MVDC 5F99B 3WA9C 3UTBB 3O62D 5B40D 3REJD 1P3MD 4H9NA 1F66A 3NQUA 3MGQA 2JE5A 3O62C 5B40C 5AVBA 3REJC 3AZGB 1P3MC 2F8NG 4QLCD 2ZY3A 4J8VA 3MNNB 3AN2A 2BYMA 4QLCC
chains in the Genus database with same CATH topology
2W8SA 3AZLB 4UUZA 1P3OA 3WKJB 1P3FA 3WTPA 3AZEA 1M1AA 3UTAC 3MGPD 4J8UA 3UT9D 4UPKA 3LJAD 3MGPC 5B33B 3LELA 1B67A 5CPJD 1N1JB 3UT9C 3W96B 3LZ0A 1HTAA 3AYWA 3AV2A 5B24B 4X23B 5CPJC 4WU8D 1EQZA 2PYOA 3B0DC 4M6BA 5AV5D 3REKD 4J8XD 3REIB 4WU8C 5B31D 4ZUXD 3AZMB 5AV5C 3REKC 4J8XC 2NZDD 4LD9D 2JCHA 5AV8A 2AROD 4XZQD 5B31C 5B1MB 4ZUXC 3MNNA 3X1UB 2NZDC 4LD9C 4XZQC 2AROC 5B2JB 2Y2NA 5E5AA 3VH6T 3WKJA 3RELB 4JJND 1P3IB 3AZIB 5AY8D 2Y2HA 4ZBJB 5DNNA 3W99D 4JJNC 5GXQD 5F99D 2FFFB 3C1BB 3UTBD 4HGAB 4KHAB 5AY8C 4E45A 3W96A 3EPKA 3W99C 5GXQC 5F99C 3UTBC 1P3GD 4X23A 5GT0A 5CPKB 3AZGD 3P5JB 3W98D 1P3GC 3REIA 1PZRA 2ZY4A 3AZGC 3W98C 3AZKB 1ULYA 3AZLD 1ZLAB 1U35D 3IP4C 2F2AC 3X1UA 3KUYB 3AZLC 1U35C 4NE3A 2YFVB 2NQBD 4YM6D 1Z2CB 2HIOA 5B33D 3H0RC 3AZJD 4H9PB 5GSUD 5B2IB 3AV1A 2NQBC 1P3IA 4YM6C 3H0LC 2Y2MA 5B33C 3AZIA 2FJ7D 3AZJC 4XUJD 5B24D 4H9SA 5GSUC 3A6NB 2ZM5A 1S32D 2XD1A 5B0ZA 3C1BA 4H9NB 2FJ7C 5BS7A 5CP6B 4XUJC 3MGQB 5B24C 1M18D 1S32C 3AZMD 3MGSB 3A1IA 4J8VB 3MGRB 2F8NK 3TU4A 3AN2B 5CPKA 5BNXA 3V9RB 5B1MD 3AZMC 2Y2KA 1P3LB 5B2JD 3AZKA 5B1MC 1P3FB 3WTPB 3AZEB 1M1AB 4WJ3C 4J8UB 4H9QB 1ZLAA 5B2JC 3RELD 3KUYA 3VH5A 3LELB 1P3KA 4CSRB 3RELC 4WU9D 5B0YA 2BYKB 1P34B 5KDMA 1T3UA 2HUEB 4H9PA 3C1CB 4KUDB 4ZBJC 2F8NB 4WU9C 1KX3B 5AV6D 3AZFB 2PYOB 3A6NA 4NE5A 3KXBB 1AOIB 5AV6C 3R45B 5CP6A 1P3BB 4KGCD 3VH5W 1H3OA 2Y2QA 5AV8B 4EO5B 3AZNB 3MGSA 3FDDA 2L5AA 3MGRA 4G92C 3B6FB 4KGCC 4E44A 3AFAB 3V9RA 1ID3B 2ZY2A 3EPJA 1P3LA 5AV9A 3LZ1B 5CHLB 5E5AB 2Y2LA 2Y2OA 4H9QA 5GT3D 1KX5D 5B2ID 1KX4B 5AVCD 5DNNB 5B1LD 5GT3C 3WTPE 1KX5C 4CSRA 5B2IC 5AVCC 2BYKA 3EPLA 5B1LC 1P34A 1F66D 3C1CA 4KUDA 3MGQD 5GT0B 2F8NA 1KX3A 5AVBD 3AZFA 1P3PA 1F66C 3KXBA 4J8VD 3MGQC 1AOIA 1WWIA 3AN2D 5AVBC 1P3AB 3R45A 1P3BA 4J8VC 1P3OD 3AN2C 5JRGB 3AZNA 5BO0A 3W97B 1P3FD 3WTPD 3AZED 5C3IB 1M1AD 3AZHA 4J8UD 4YS3A 2CV5B 3B6FA 3AFAA 1P3OC 3X1SA 1ID3A 4Z66B 1P3FC 3WTPC 3LZ1A 3AZEC 1M1AC 4J8UC 2HIOB 4Z5TA 3VH6A 2UWXA 3LELD 3AV1B 4AWLB 4J8WB 3LZ0D 2VQRA 1KX4A 3AYWD 3AV2D 3LELC 1M19A 1EQZD 5B0ZB 4G91B 2PYOD 3LZ0C 1TZYB 3X1VB 3AYWC 3AV2C 3B6GA 3X1TB 1EQZC 2PYOC 1HQ3B 3TU4B 5BNVB 3VH6W 5AV8D 5BNXB 3MNND 2Y2JA 1P3AA 5AV8C 3EG5B 5CPIB 4WNNA 3MNNC 5JRGA 2IO5B 5E5AD 3W97A 4H9OB 3WKJD 3MVDB 5BT1D 5DNMA 1W2EA 2CV5A 3WA9B 3AL0C 5E5AC 4Z66A 1P3KB 3WKJC 3WAAA 2DF4C 5DNND 5BT1C 5B0YB 2G5HC 5B32G 5KDMB 3B0CT 5B40B 3W96D 5DNNC 4J8WA 3REHA 3KFUG 4X23D 5GT0D 3W96C 4QLCB 1TZYA 3X1VA 4X23C 5GT0C 3X1TA 3REID 1H3OB 3UTAB 3KWQA 4NFTA 1HQ3A 5BNVA 3REIC 3MGPB 4CAYA 2CWEA 5AV9B 3X1UD 2JSSA 4R8PA 3LJAB 5CPIA 5B32A 5C3IC 4WV4B 3X1UC 2HIOD 2XD5A 4H9OA 3MVDA 3AV1D 3B0DB 1BH9A 3WA9A 1P3ID 4DRAA 2HIOC 3AZID 4WU8B 3AV1C 1P3IC 3KSYA 5B0ZD 3O62A 5B40A 3C1BD 4J8XB 3REKB 3AZIC 3REJA 1P3MA 4H9SC 3UTAD 4ZUXB 1P3PB 5B0ZC 3C1BC 2NZDB 4HGAC 4LD9B 5BS7C 2AROB 3TU4D 1Q9CA 5CPKD 1R4VA 4QLCA 1BFMA 3TU4C 5B31G 5CPKC 3UTAA 5BO0B 3AZKD 2YFWB 3AZHB 4YS3B 1ZLAD 3X1SB 3MGPA 3AZKC 3KUYD 3UT9A 4Z5TB 2DQNC 5G49A 5AY8B 1ZLAC 3LJAA 3W99B 1P3KD 5GXQB 3KUYC 5B0YD 5CPJA 1P3KC 2Y2GA 1M19B 5B0YC 1P3GB 4WU8A 3H0MC 3A6ND 3B6GB 3W98B 5AV5A 3REKA 4J8XA 5CP6D 3A6NC 5B31A 4ZUXA 1BH8A 2NZDA 3MGSD 4LD9A 4XZQA 5CP6C 2AROA 3MGRD 1U35B 1WWSA 4Z2MH 3MGSC 1P3LD 5AV9D 3MGRC 4WNNB 2NQBB 4YM6B 2YFWA 3F6TA 5DNMB 1P3LC 5AV9C 3AZJB 5GSUB 4JJNA 3LJAC 3WAAB 2FJ7B 5AY8A 2LY8A 4XUJB 1TAFA 3W99A 1S32B 5GXQA 5F99A 3REHB 3UTBA 1P34D 3B0BA 2BG1A 1M18B 3C1CD 3NQJB 4KUDD 2F8ND 1KX3D 1P3PD 3AZFD 1P34C 1P3GA 2HUEC 3EPHA 3KXBD 3C1CC 3AZGA 1JFIB 1AOID 3W98A 4KUDC 5JA4B 1KX3C 1P3PC 3AZFC 1P3BD 2J8PA 2Y2IA 3KWQB 3KXBC 1AOIC 3AZND 3AZLA 1P3BC 1B6WA 4CAYB 1U35A 3B6FD 4YS3D 3AZHD 3AFAD 3X1SD 1ID3D 4EO5C 3AZNC 4R8PB 4DRBA 5B32B 3LZ1D 2RVQD 3B6FC 4YS3C 3AZHC 2NQBA 4Z5TD 3AFAC 3X1SC 1ID3C 4YM6A 4WU9B 5B33A 4H9RB 1BH9B 2G5IC 2RVQC 3LZ1C 3AZJA 2Y2PA 5GSUA 1N1JA 4Z5TC 1KX4D 5AV6B 2FJ7A 1M19D 4XUJA 3A1KA 5B24A 3O62B 1S32A 3REJB 1P3MB 1KX4C 3B6GD 1M19C 1M18A 4G92B 3NQJA 4KGCB 3B6GC 3AZMA 2F8NH 2RIQA 2ZY5A 1JFIA 5JA4A 5B1MA 4Z2MG 1P3AD 5B2JA 3B0CW 5JRGD 1P3AC 1F1EA 3W97D 5GT3B 5DNMD 5FUGB 2CV5D 1KX5B 1KU5A 3UT9B 5JRGC 5G49B 3RELA 5AVCB 4Z66D 5B1LB 3W97C 3WAAD 5DNMC 2CV5C 5CPJB 4WU9A 4Z66C 4H9RA 3WAAC 4J8WD 3REHD 1F66B 3NQUB 4KHAA 4NE6A 5AV6A 5AVBB 4AWLC 4J8WC 3REHC 5AV5B 1M18C 1TZYD 3X1VD 1A7WA 5B31B 3X1TD 1BH8B 2BYMB 4G91C 4KGCA 3KWQD 1TZYC 3X1VC 4UUZB 4XZQB 1P3OB 1HQ3D 3X1TC 3KWQC 4DQYB 1HQ3C 4R8PD 5CPID 4WZSB 5B32D 3VH5T 2YFVA 4JJNB 4R8PC 3MVDD 5CPIC 5GT3A 5FUGA 1KX5A 5B32C 3WA9D 3LZ0B 5B2IA 3AYWB 2IO5C 5AVCA 3AV2B 1TAFB 5B1LA 1EQZB 3MVDC 5F99B 3WA9C 3UTBB 3O62D 5B40D 3REJD 1P3MD 4H9NA 1F66A 3NQUA 3MGQA 2JE5A 3O62C 5B40C 5AVBA 3REJC 3AZGB 1P3MC 2F8NG 4QLCD 2ZY3A 4J8VA 3MNNB 3AN2A 2BYMA 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  4UUZ A;  1P3O A;  3WKJ B;  1P3F A;  3WTP A;  3AZE A;  1M1A A;  3UTA C;  3MGP D;  4J8U A;  3UT9 D;  3LJA D;  3MGP C;  5B33 B;  3LEL A;  1B67 A;  5CPJ D;  1N1J B;  3UT9 C;  3W96 B;  3LZ0 A;  1HTA A;  3AYW A;  3AV2 A;  5B24 B;  4X23 B;  5CPJ C;  4WU8 D;  1EQZ A;  2PYO A;  3B0D C;  4M6B A;  5AV5 D;  3REK D;  4J8X D;  3REI B;  4WU8 C;  5B31 D;  4ZUX D;  3AZM B;  5AV5 C;  3REK C;  4J8X C;  2NZD D;  4LD9 D;  4XZQ D;  5AV8 A;  2ARO D;  5B31 C;  5B1M B;  4ZUX C;  3MNN A;  3X1U B;  2NZD C;  4LD9 C;  4XZQ C;  2ARO C;  5B2J B;  5E5A A;  3VH6 T;  3WKJ A;  3REL B;  4JJN D;  1P3I B;  3AZI B;  5AY8 D;  4ZBJ B;  5DNN A;  3W99 D;  4JJN C;  5GXQ D;  5F99 D;  3UTB D;  3C1B B;  4HGA B;  4KHA B;  5AY8 C;  4E45 A;  3W96 A;  3W99 C;  5GXQ C;  5F99 C;  3UTB C;  1P3G D;  4X23 A;  5GT0 A;  5CPK B;  3AZG D;  3W98 D;  1P3G C;  3REI A;  3AZG C;  3W98 C;  3AZK B;  1ULY A;  3AZL D;  1ZLA B;  1U35 D;  3X1U A;  3KUY B;  3AZL C;  1U35 C;  4NE3 A;  2YFV B;  2NQB D;  4YM6 D;  2HIO A;  5B33 D;  3AZJ D;  4H9P B;  5GSU D;  5B2I B;  3AV1 A;  2NQB C;  1P3I A;  4YM6 C;  5B33 C;  3AZI A;  2FJ7 D;  3AZJ C;  4XUJ D;  5B24 D;  4H9S A;  5GSU C;  3A6N B;  1S32 D;  5B0Z A;  3C1B A;  4H9N B;  2FJ7 C;  5BS7 A;  5CP6 B;  4XUJ C;  3MGQ B;  5B24 C;  1M18 D;  1S32 C;  3AZM D;  3MGS B;  4J8V B;  3MGR B;  2F8N K;  3TU4 A;  3AN2 B;  5CPK A;  5BNX A;  3V9R B;  5B1M D;  3AZM C;  1P3L B;  5B2J D;  3AZK A;  5B1M C;  1P3F B;  3WTP B;  3AZE B;  1M1A B;  4J8U B;  4H9Q B;  1ZLA A;  5B2J C;  3REL D;  3KUY A;  3VH5 A;  3LEL B;  1P3K A;  4CSR B;  3REL C;  4WU9 D;  5B0Y A;  2BYK B;  1P34 B;  5KDM A;  2HUE B;  4H9P A;  3C1C B;  4KUD B;  4ZBJ C;  2F8N B;  4WU9 C;  1KX3 B;  5AV6 D;  3AZF B;  2PYO B;  3A6N A;  4NE5 A;  3KXB B;  1AOI B;  5AV6 C;  3R45 B;  5CP6 A;  1P3B B;  4KGC D;  3VH5 W;  1H3O A;  5AV8 B;  4EO5 B;  3AZN B;  3MGS A;  2L5A A;  3MGR A;  4G92 C;  3B6F B;  4KGC C;  4E44 A;  3AFA B;  3V9R A;  1ID3 B;  1P3L A;  5AV9 A;  3LZ1 B;  5CHL B;  5E5A B;  4H9Q A;  5GT3 D;  1KX5 D;  5B2I D;  1KX4 B;  5AVC D;  5DNN B;  5B1L D;  5GT3 C;  3WTP E;  1KX5 C;  4CSR A;  5B2I C;  5AVC C;  2BYK A;  1P34 A;  5B1L C;  1F66 D;  3C1C A;  4KUD A;  3MGQ D;  5GT0 B;  2F8N A;  1KX3 A;  5AVB D;  3AZF A;  1P3P A;  1F66 C;  3KXB A;  4J8V D;  3MGQ C;  1AOI A;  1WWI A;  3AN2 D;  5AVB C;  1P3A B;  3R45 A;  1P3B A;  4J8V C;  1P3O D;  3AN2 C;  5JRG B;  3AZN A;  5BO0 A;  3W97 B;  1P3F D;  3WTP D;  3AZE D;  5C3I B;  1M1A D;  3AZH A;  4J8U D;  4YS3 A;  2CV5 B;  3B6F A;  3AFA A;  1P3O C;  3X1S A;  1ID3 A;  4Z66 B;  1P3F C;  3WTP C;  3LZ1 A;  3AZE C;  1M1A C;  4J8U C;  2HIO B;  4Z5T A;  3VH6 A;  3LEL D;  3AV1 B;  4AWL B;  4J8W B;  3LZ0 D;  1KX4 A;  3AYW D;  3AV2 D;  3LEL C;  1M19 A;  1EQZ D;  5B0Z B;  4G91 B;  2PYO D;  3LZ0 C;  1TZY B;  3X1V B;  3AYW C;  3AV2 C;  3B6G A;  3X1T B;  1EQZ C;  2PYO C;  1HQ3 B;  3TU4 B;  5BNV B;  3VH6 W;  5BNX B;  5AV8 D;  3MNN D;  1P3A A;  5AV8 C;  5CPI B;  4WNN A;  3MNN C;  5JRG A;  2IO5 B;  5E5A D;  3W97 A;  4H9O B;  3WKJ D;  3MVD B;  5BT1 D;  5DNM A;  2CV5 A;  3WA9 B;  5E5A C;  4Z66 A;  1P3K B;  3WKJ C;  3WAA A;  5DNN D;  5BT1 C;  5B0Y B;  5B32 G;  5KDM B;  3B0C T;  5B40 B;  3W96 D;  5DNN C;  4J8W A;  3REH A;  4X23 D;  5GT0 D;  3W96 C;  4QLC B;  1TZY A;  3X1V A;  4X23 C;  5GT0 C;  3X1T A;  3REI D;  1H3O B;  3UTA B;  3KWQ A;  4NFT A;  1HQ3 A;  5BNV A;  3REI C;  3MGP B;  4CAY A;  2CWE A;  5AV9 B;  3X1U D;  2JSS A;  4R8P A;  3LJA B;  5CPI A;  5B32 A;  5C3I C;  4WV4 B;  3X1U C;  2HIO D;  4H9O A;  3MVD A;  3AV1 D;  3B0D B;  1BH9 A;  3WA9 A;  1P3I D;  4DRA A;  2HIO C;  3AZI D;  4WU8 B;  3AV1 C;  1P3I C;  3KSY A;  5B0Z D;  3O62 A;  5B40 A;  3C1B D;  4J8X B;  3REK B;  3AZI C;  3REJ A;  1P3M A;  4H9S C;  3UTA D;  4ZUX B;  1P3P B;  5B0Z C;  3C1B C;  2NZD B;  4HGA C;  4LD9 B;  5BS7 C;  2ARO B;  3TU4 D;  1Q9C A;  5CPK D;  1R4V A;  4QLC A;  1BFM A;  3TU4 C;  5B31 G;  5CPK C;  3UTA A;  5BO0 B;  3AZK D;  2YFW B;  3AZH B;  4YS3 B;  1ZLA D;  3X1S B;  3MGP A;  3AZK C;  3KUY D;  3UT9 A;  4Z5T B;  5G49 A;  5AY8 B;  1ZLA C;  3LJA A;  3W99 B;  1P3K D;  5GXQ B;  3KUY C;  5B0Y D;  5CPJ A;  1P3K C;  1M19 B;  5B0Y C;  1P3G B;  4WU8 A;  3A6N D;  3B6G B;  3W98 B;  5AV5 A;  3REK A;  4J8X A;  5CP6 D;  3A6N C;  5B31 A;  4ZUX A;  1BH8 A;  2NZD A;  3MGS D;  4LD9 A;  4XZQ A;  5CP6 C;  2ARO A;  3MGR D;  1U35 B;  1WWS A;  4Z2M H;  3MGS C;  1P3L D;  5AV9 D;  3MGR C;  4WNN B;  2NQB B;  4YM6 B;  2YFW A;  5DNM B;  1P3L C;  5AV9 C;  3AZJ B;  5GSU B;  4JJN A;  3LJA C;  3WAA B;  2FJ7 B;  5AY8 A;  2LY8 A;  4XUJ B;  1TAF A;  3W99 A;  1S32 B;  5GXQ A;  5F99 A;  3REH B;  3UTB A;  1P34 D;  3B0B A;  1M18 B;  3C1C D;  3NQJ B;  4KUD D;  2F8N D;  1KX3 D;  1P3P D;  3AZF D;  1P34 C;  1P3G A;  2HUE C;  3KXB D;  3C1C C;  3AZG A;  1JFI B;  1AOI D;  3W98 A;  4KUD C;  5JA4 B;  1KX3 C;  1P3P C;  3AZF C;  1P3B D;  3KWQ B;  3KXB C;  1AOI C;  3AZN D;  3AZL A;  1P3B C;  1B6W A;  4CAY B;  1U35 A;  3B6F D;  4YS3 D;  3AZH D;  3AFA D;  3X1S D;  1ID3 D;  4EO5 C;  3AZN C;  4R8P B;  4DRB A;  5B32 B;  3LZ1 D;  2RVQ D;  3B6F C;  4YS3 C;  3AZH C;  2NQB A;  4Z5T D;  3AFA C;  3X1S C;  1ID3 C;  4YM6 A;  4WU9 B;  5B33 A;  4H9R B;  1BH9 B;  3LZ1 C;  2RVQ C;  3AZJ A;  5GSU A;  1N1J A;  4Z5T C;  1KX4 D;  5AV6 B;  2FJ7 A;  1M19 D;  4XUJ A;  3O62 B;  5B24 A;  1S32 A;  3REJ B;  1P3M B;  1KX4 C;  3B6G D;  1M19 C;  1M18 A;  4G92 B;  3NQJ A;  4KGC B;  3B6G C;  3AZM A;  2F8N H;  1JFI A;  5JA4 A;  5B1M A;  4Z2M G;  1P3A D;  5B2J A;  3B0C W;  5JRG D;  1P3A C;  1F1E A;  3W97 D;  5GT3 B;  5DNM D;  5FUG B;  2CV5 D;  1KX5 B;  1KU5 A;  3UT9 B;  5JRG C;  5G49 B;  3REL A;  5AVC B;  4Z66 D;  5B1L B;  3W97 C;  3WAA D;  5DNM C;  2CV5 C;  5CPJ B;  4WU9 A;  4Z66 C;  4H9R A;  3WAA C;  4J8W D;  3REH D;  1F66 B;  3NQU B;  4KHA A;  4NE6 A;  5AV6 A;  5AVB B;  4AWL C;  4J8W C;  3REH C;  5AV5 B;  1M18 C;  1TZY D;  3X1V D;  1A7W A;  5B31 B;  3X1T D;  1BH8 B;  2BYM B;  4G91 C;  4KGC A;  3KWQ D;  1TZY C;  3X1V C;  4UUZ B;  4XZQ B;  1P3O B;  1HQ3 D;  3X1T C;  3KWQ C;  1HQ3 C;  4R8P D;  5CPI D;  4WZS B;  5B32 D;  3VH5 T;  2YFV A;  4JJN B;  4R8P C;  3MVD D;  5CPI C;  5GT3 A;  5FUG A;  1KX5 A;  5B32 C;  3WA9 D;  3LZ0 B;  5B2I A;  3AYW B;  2IO5 C;  5AVC A;  3AV2 B;  1TAF B;  5B1L A;  1EQZ B;  3MVD C;  5F99 B;  3WA9 C;  3UTB B;  3O62 D;  5B40 D;  3REJ D;  1P3M D;  4H9N A;  1F66 A;  3NQU A;  3MGQ A;  3O62 C;  5B40 C;  5AVB A;  3REJ C;  3AZG B;  1P3M C;  2F8N G;  4QLC D;  4J8V A;  3MNN B;  3AN2 A;  2BYM A;  4QLC C; 
#chains in the Genus database with same CATH topology
 2W8S A;  3AZL B;  4UUZ A;  1P3O A;  3WKJ B;  1P3F A;  3WTP A;  3AZE A;  1M1A A;  3UTA C;  3MGP D;  4J8U A;  3UT9 D;  4UPK A;  3LJA D;  3MGP C;  5B33 B;  3LEL A;  1B67 A;  5CPJ D;  1N1J B;  3UT9 C;  3W96 B;  3LZ0 A;  1HTA A;  3AYW A;  3AV2 A;  5B24 B;  4X23 B;  5CPJ C;  4WU8 D;  1EQZ A;  2PYO A;  3B0D C;  4M6B A;  5AV5 D;  3REK D;  4J8X D;  3REI B;  4WU8 C;  5B31 D;  4ZUX D;  3AZM B;  5AV5 C;  3REK C;  4J8X C;  2NZD D;  4LD9 D;  2JCH A;  5AV8 A;  2ARO D;  4XZQ D;  5B31 C;  5B1M B;  4ZUX C;  3MNN A;  3X1U B;  2NZD C;  4LD9 C;  4XZQ C;  2ARO C;  5B2J B;  2Y2N A;  5E5A A;  3VH6 T;  3WKJ A;  3REL B;  4JJN D;  1P3I B;  3AZI B;  5AY8 D;  2Y2H A;  4ZBJ B;  5DNN A;  3W99 D;  4JJN C;  5GXQ D;  5F99 D;  2FFF B;  3C1B B;  3UTB D;  4HGA B;  4KHA B;  5AY8 C;  4E45 A;  3W96 A;  3EPK A;  3W99 C;  5GXQ C;  5F99 C;  3UTB C;  1P3G D;  4X23 A;  5GT0 A;  5CPK B;  3AZG D;  3P5J B;  3W98 D;  1P3G C;  3REI A;  1PZR A;  2ZY4 A;  3AZG C;  3W98 C;  3AZK B;  1ULY A;  3AZL D;  1ZLA B;  1U35 D;  3IP4 C;  2F2A C;  3X1U A;  3KUY B;  3AZL C;  1U35 C;  4NE3 A;  2YFV B;  2NQB D;  4YM6 D;  1Z2C B;  2HIO A;  5B33 D;  3H0R C;  3AZJ D;  4H9P B;  5GSU D;  5B2I B;  3AV1 A;  2NQB C;  1P3I A;  4YM6 C;  3H0L C;  2Y2M A;  5B33 C;  3AZI A;  2FJ7 D;  3AZJ C;  4XUJ D;  5B24 D;  4H9S A;  5GSU C;  3A6N B;  2ZM5 A;  1S32 D;  2XD1 A;  5B0Z A;  3C1B A;  4H9N B;  2FJ7 C;  5BS7 A;  5CP6 B;  4XUJ C;  3MGQ B;  5B24 C;  1M18 D;  1S32 C;  3AZM D;  3MGS B;  3A1I A;  4J8V B;  3MGR B;  2F8N K;  3TU4 A;  3AN2 B;  5CPK A;  5BNX A;  3V9R B;  5B1M D;  3AZM C;  2Y2K A;  1P3L B;  5B2J D;  3AZK A;  5B1M C;  1P3F B;  3WTP B;  3AZE B;  1M1A B;  4WJ3 C;  4J8U B;  4H9Q B;  1ZLA A;  5B2J C;  3REL D;  3KUY A;  3VH5 A;  3LEL B;  1P3K A;  4CSR B;  3REL C;  4WU9 D;  5B0Y A;  2BYK B;  1P34 B;  5KDM A;  1T3U A;  2HUE B;  4H9P A;  3C1C B;  4KUD B;  4ZBJ C;  2F8N B;  4WU9 C;  1KX3 B;  5AV6 D;  3AZF B;  2PYO B;  3A6N A;  4NE5 A;  3KXB B;  1AOI B;  5AV6 C;  3R45 B;  5CP6 A;  1P3B B;  4KGC D;  3VH5 W;  1H3O A;  2Y2Q A;  5AV8 B;  4EO5 B;  3AZN B;  3MGS A;  3FDD A;  2L5A A;  3MGR A;  4G92 C;  3B6F B;  4KGC C;  4E44 A;  3AFA B;  3V9R A;  1ID3 B;  2ZY2 A;  3EPJ A;  1P3L A;  5AV9 A;  3LZ1 B;  5CHL B;  5E5A B;  2Y2L A;  2Y2O A;  4H9Q A;  5GT3 D;  1KX5 D;  5B2I D;  1KX4 B;  5AVC D;  5DNN B;  5B1L D;  5GT3 C;  3WTP E;  1KX5 C;  4CSR A;  5B2I C;  5AVC C;  2BYK A;  3EPL A;  5B1L C;  1P34 A;  1F66 D;  3C1C A;  4KUD A;  3MGQ D;  5GT0 B;  2F8N A;  1KX3 A;  5AVB D;  3AZF A;  1P3P A;  1F66 C;  3KXB A;  4J8V D;  3MGQ C;  1AOI A;  1WWI A;  3AN2 D;  5AVB C;  1P3A B;  3R45 A;  1P3B A;  4J8V C;  1P3O D;  3AN2 C;  5JRG B;  3AZN A;  5BO0 A;  3W97 B;  1P3F D;  3WTP D;  3AZE D;  5C3I B;  1M1A D;  3AZH A;  4J8U D;  4YS3 A;  2CV5 B;  3B6F A;  3AFA A;  1P3O C;  3X1S A;  1ID3 A;  4Z66 B;  1P3F C;  3WTP C;  3LZ1 A;  3AZE C;  1M1A C;  4J8U C;  2HIO B;  4Z5T A;  3VH6 A;  2UWX A;  3LEL D;  3AV1 B;  4AWL B;  4J8W B;  3LZ0 D;  2VQR A;  1KX4 A;  3AYW D;  3AV2 D;  3LEL C;  1M19 A;  1EQZ D;  5B0Z B;  4G91 B;  2PYO D;  3LZ0 C;  1TZY B;  3X1V B;  3AYW C;  3AV2 C;  3B6G A;  3X1T B;  1EQZ C;  2PYO C;  1HQ3 B;  3TU4 B;  5BNV B;  3VH6 W;  5AV8 D;  5BNX B;  3MNN D;  2Y2J A;  1P3A A;  5AV8 C;  3EG5 B;  5CPI B;  4WNN A;  3MNN C;  5JRG A;  2IO5 B;  5E5A D;  3W97 A;  4H9O B;  3WKJ D;  3MVD B;  5BT1 D;  5DNM A;  1W2E A;  2CV5 A;  3WA9 B;  3AL0 C;  5E5A C;  4Z66 A;  1P3K B;  3WKJ C;  3WAA A;  2DF4 C;  5DNN D;  5BT1 C;  5B0Y B;  2G5H C;  5B32 G;  5KDM B;  3B0C T;  5B40 B;  3W96 D;  5DNN C;  4J8W A;  3REH A;  3KFU G;  4X23 D;  5GT0 D;  3W96 C;  4QLC B;  1TZY A;  3X1V A;  4X23 C;  5GT0 C;  3X1T A;  3REI D;  1H3O B;  3UTA B;  3KWQ A;  4NFT A;  1HQ3 A;  5BNV A;  3REI C;  3MGP B;  4CAY A;  2CWE A;  5AV9 B;  3X1U D;  2JSS A;  4R8P A;  3LJA B;  5CPI A;  5B32 A;  5C3I C;  4WV4 B;  3X1U C;  2HIO D;  2XD5 A;  4H9O A;  3MVD A;  3AV1 D;  3B0D B;  1BH9 A;  3WA9 A;  1P3I D;  4DRA A;  2HIO C;  3AZI D;  4WU8 B;  3AV1 C;  1P3I C;  3KSY A;  5B0Z D;  3O62 A;  5B40 A;  3C1B D;  4J8X B;  3REK B;  3AZI C;  3REJ A;  1P3M A;  4H9S C;  3UTA D;  4ZUX B;  1P3P B;  5B0Z C;  3C1B C;  2NZD B;  4HGA C;  4LD9 B;  5BS7 C;  2ARO B;  3TU4 D;  1Q9C A;  5CPK D;  1R4V A;  4QLC A;  1BFM A;  3TU4 C;  5B31 G;  5CPK C;  3UTA A;  5BO0 B;  3AZK D;  2YFW B;  3AZH B;  4YS3 B;  1ZLA D;  3X1S B;  3MGP A;  3AZK C;  3KUY D;  3UT9 A;  4Z5T B;  2DQN C;  5G49 A;  5AY8 B;  1ZLA C;  3LJA A;  3W99 B;  1P3K D;  5GXQ B;  3KUY C;  5B0Y D;  5CPJ A;  1P3K C;  2Y2G A;  1M19 B;  5B0Y C;  1P3G B;  4WU8 A;  3H0M C;  3A6N D;  3B6G B;  3W98 B;  5AV5 A;  3REK A;  4J8X A;  5CP6 D;  3A6N C;  5B31 A;  4ZUX A;  1BH8 A;  2NZD A;  3MGS D;  4LD9 A;  4XZQ A;  5CP6 C;  2ARO A;  3MGR D;  1U35 B;  1WWS A;  4Z2M H;  3MGS C;  1P3L D;  5AV9 D;  3MGR C;  4WNN B;  2NQB B;  4YM6 B;  2YFW A;  3F6T A;  5DNM B;  1P3L C;  5AV9 C;  3AZJ B;  5GSU B;  4JJN A;  3LJA C;  3WAA B;  2FJ7 B;  5AY8 A;  2LY8 A;  4XUJ B;  1TAF A;  3W99 A;  1S32 B;  5GXQ A;  5F99 A;  3REH B;  3UTB A;  1P34 D;  3B0B A;  2BG1 A;  1M18 B;  3C1C D;  3NQJ B;  4KUD D;  2F8N D;  1KX3 D;  1P3P D;  3AZF D;  1P34 C;  1P3G A;  2HUE C;  3EPH A;  3KXB D;  3C1C C;  3AZG A;  1JFI B;  1AOI D;  3W98 A;  4KUD C;  5JA4 B;  1KX3 C;  1P3P C;  3AZF C;  1P3B D;  2J8P A;  2Y2I A;  3KWQ B;  3KXB C;  1AOI C;  3AZN D;  3AZL A;  1P3B C;  1B6W A;  4CAY B;  1U35 A;  3B6F D;  4YS3 D;  3AZH D;  3AFA D;  3X1S D;  1ID3 D;  4EO5 C;  3AZN C;  4R8P B;  4DRB A;  5B32 B;  3LZ1 D;  2RVQ D;  3B6F C;  4YS3 C;  3AZH C;  2NQB A;  4Z5T D;  3AFA C;  3X1S C;  1ID3 C;  4YM6 A;  4WU9 B;  5B33 A;  4H9R B;  1BH9 B;  2G5I C;  2RVQ C;  3LZ1 C;  3AZJ A;  2Y2P A;  5GSU A;  1N1J A;  4Z5T C;  1KX4 D;  5AV6 B;  2FJ7 A;  1M19 D;  4XUJ A;  3A1K A;  5B24 A;  3O62 B;  1S32 A;  3REJ B;  1P3M B;  1KX4 C;  3B6G D;  1M19 C;  1M18 A;  4G92 B;  3NQJ A;  4KGC B;  3B6G C;  3AZM A;  2F8N H;  2RIQ A;  2ZY5 A;  1JFI A;  5JA4 A;  5B1M A;  4Z2M G;  1P3A D;  5B2J A;  3B0C W;  5JRG D;  1P3A C;  1F1E A;  3W97 D;  5GT3 B;  5DNM D;  5FUG B;  2CV5 D;  1KX5 B;  1KU5 A;  3UT9 B;  5JRG C;  5G49 B;  3REL A;  5AVC B;  4Z66 D;  5B1L B;  3W97 C;  3WAA D;  5DNM C;  2CV5 C;  5CPJ B;  4WU9 A;  4Z66 C;  4H9R A;  3WAA C;  4J8W D;  3REH D;  1F66 B;  3NQU B;  4KHA A;  4NE6 A;  5AV6 A;  5AVB B;  4AWL C;  4J8W C;  3REH C;  5AV5 B;  1M18 C;  1TZY D;  3X1V D;  1A7W A;  5B31 B;  3X1T D;  1BH8 B;  2BYM B;  4G91 C;  4KGC A;  3KWQ D;  1TZY C;  3X1V C;  4UUZ B;  4XZQ B;  1P3O B;  1HQ3 D;  3X1T C;  3KWQ C;  4DQY B;  1HQ3 C;  4R8P D;  5CPI D;  4WZS B;  5B32 D;  3VH5 T;  2YFV A;  4JJN B;  4R8P C;  3MVD D;  5CPI C;  5GT3 A;  5FUG A;  1KX5 A;  5B32 C;  3WA9 D;  3LZ0 B;  5B2I A;  3AYW B;  2IO5 C;  5AVC A;  3AV2 B;  1TAF B;  5B1L A;  1EQZ B;  3MVD C;  5F99 B;  3WA9 C;  3UTB B;  3O62 D;  5B40 D;  3REJ D;  1P3M D;  4H9N A;  1F66 A;  3NQU A;  3MGQ A;  2JE5 A;  3O62 C;  5B40 C;  5AVB A;  3REJ C;  3AZG B;  1P3M C;  2F8N G;  4QLC D;  2ZY3 A;  4J8V A;  3MNN B;  3AN2 A;  2BYM A;  4QLC C; 
#chains in the Genus database with same CATH homology
 2W8S A;  3AZL B;  4UUZ A;  1P3O A;  3WKJ B;  1P3F A;  3WTP A;  3AZE A;  1M1A A;  3UTA C;  3MGP D;  4J8U A;  3UT9 D;  4UPK A;  3LJA D;  3MGP C;  5B33 B;  3LEL A;  1B67 A;  5CPJ D;  1N1J B;  3UT9 C;  3W96 B;  3LZ0 A;  1HTA A;  3AYW A;  3AV2 A;  5B24 B;  4X23 B;  5CPJ C;  4WU8 D;  1EQZ A;  2PYO A;  3B0D C;  4M6B A;  5AV5 D;  3REK D;  4J8X D;  3REI B;  4WU8 C;  5B31 D;  4ZUX D;  3AZM B;  5AV5 C;  3REK C;  4J8X C;  2NZD D;  4LD9 D;  2JCH A;  5AV8 A;  2ARO D;  4XZQ D;  5B31 C;  5B1M B;  4ZUX C;  3MNN A;  3X1U B;  2NZD C;  4LD9 C;  4XZQ C;  2ARO C;  5B2J B;  2Y2N A;  5E5A A;  3VH6 T;  3WKJ A;  3REL B;  4JJN D;  1P3I B;  3AZI B;  5AY8 D;  2Y2H A;  4ZBJ B;  5DNN A;  3W99 D;  4JJN C;  5GXQ D;  5F99 D;  2FFF B;  3C1B B;  3UTB D;  4HGA B;  4KHA B;  5AY8 C;  4E45 A;  3W96 A;  3EPK A;  3W99 C;  5GXQ C;  5F99 C;  3UTB C;  1P3G D;  4X23 A;  5GT0 A;  5CPK B;  3AZG D;  3P5J B;  3W98 D;  1P3G C;  3REI A;  1PZR A;  2ZY4 A;  3AZG C;  3W98 C;  3AZK B;  1ULY A;  3AZL D;  1ZLA B;  1U35 D;  3IP4 C;  2F2A C;  3X1U A;  3KUY B;  3AZL C;  1U35 C;  4NE3 A;  2YFV B;  2NQB D;  4YM6 D;  1Z2C B;  2HIO A;  5B33 D;  3H0R C;  3AZJ D;  4H9P B;  5GSU D;  5B2I B;  3AV1 A;  2NQB C;  1P3I A;  4YM6 C;  3H0L C;  2Y2M A;  5B33 C;  3AZI A;  2FJ7 D;  3AZJ C;  4XUJ D;  5B24 D;  4H9S A;  5GSU C;  3A6N B;  2ZM5 A;  1S32 D;  2XD1 A;  5B0Z A;  3C1B A;  4H9N B;  2FJ7 C;  5BS7 A;  5CP6 B;  4XUJ C;  3MGQ B;  5B24 C;  1M18 D;  1S32 C;  3AZM D;  3MGS B;  3A1I A;  4J8V B;  3MGR B;  2F8N K;  3TU4 A;  3AN2 B;  5CPK A;  5BNX A;  3V9R B;  5B1M D;  3AZM C;  2Y2K A;  1P3L B;  5B2J D;  3AZK A;  5B1M C;  1P3F B;  3WTP B;  3AZE B;  1M1A B;  4WJ3 C;  4J8U B;  4H9Q B;  1ZLA A;  5B2J C;  3REL D;  3KUY A;  3VH5 A;  3LEL B;  1P3K A;  4CSR B;  3REL C;  4WU9 D;  5B0Y A;  2BYK B;  1P34 B;  5KDM A;  1T3U A;  2HUE B;  4H9P A;  3C1C B;  4KUD B;  4ZBJ C;  2F8N B;  4WU9 C;  1KX3 B;  5AV6 D;  3AZF B;  2PYO B;  3A6N A;  4NE5 A;  3KXB B;  1AOI B;  5AV6 C;  3R45 B;  5CP6 A;  1P3B B;  4KGC D;  3VH5 W;  1H3O A;  2Y2Q A;  5AV8 B;  4EO5 B;  3AZN B;  3MGS A;  3FDD A;  2L5A A;  3MGR A;  4G92 C;  3B6F B;  4KGC C;  4E44 A;  3AFA B;  3V9R A;  1ID3 B;  2ZY2 A;  3EPJ A;  1P3L A;  5AV9 A;  3LZ1 B;  5CHL B;  5E5A B;  2Y2L A;  2Y2O A;  4H9Q A;  5GT3 D;  1KX5 D;  5B2I D;  1KX4 B;  5AVC D;  5DNN B;  5B1L D;  5GT3 C;  3WTP E;  1KX5 C;  4CSR A;  5B2I C;  5AVC C;  2BYK A;  3EPL A;  5B1L C;  1P34 A;  1F66 D;  3C1C A;  4KUD A;  3MGQ D;  5GT0 B;  2F8N A;  1KX3 A;  5AVB D;  3AZF A;  1P3P A;  1F66 C;  3KXB A;  4J8V D;  3MGQ C;  1AOI A;  1WWI A;  3AN2 D;  5AVB C;  1P3A B;  3R45 A;  1P3B A;  4J8V C;  1P3O D;  3AN2 C;  5JRG B;  3AZN A;  5BO0 A;  3W97 B;  1P3F D;  3WTP D;  3AZE D;  5C3I B;  1M1A D;  3AZH A;  4J8U D;  4YS3 A;  2CV5 B;  3B6F A;  3AFA A;  1P3O C;  3X1S A;  1ID3 A;  4Z66 B;  1P3F C;  3WTP C;  3LZ1 A;  3AZE C;  1M1A C;  4J8U C;  2HIO B;  4Z5T A;  3VH6 A;  2UWX A;  3LEL D;  3AV1 B;  4AWL B;  4J8W B;  3LZ0 D;  2VQR A;  1KX4 A;  3AYW D;  3AV2 D;  3LEL C;  1M19 A;  1EQZ D;  5B0Z B;  4G91 B;  2PYO D;  3LZ0 C;  1TZY B;  3X1V B;  3AYW C;  3AV2 C;  3B6G A;  3X1T B;  1EQZ C;  2PYO C;  1HQ3 B;  3TU4 B;  5BNV B;  3VH6 W;  5AV8 D;  5BNX B;  3MNN D;  2Y2J A;  1P3A A;  5AV8 C;  3EG5 B;  5CPI B;  4WNN A;  3MNN C;  5JRG A;  2IO5 B;  5E5A D;  3W97 A;  4H9O B;  3WKJ D;  3MVD B;  5BT1 D;  5DNM A;  1W2E A;  2CV5 A;  3WA9 B;  3AL0 C;  5E5A C;  4Z66 A;  1P3K B;  3WKJ C;  3WAA A;  2DF4 C;  5DNN D;  5BT1 C;  5B0Y B;  2G5H C;  5B32 G;  5KDM B;  3B0C T;  5B40 B;  3W96 D;  5DNN C;  4J8W A;  3REH A;  3KFU G;  4X23 D;  5GT0 D;  3W96 C;  4QLC B;  1TZY A;  3X1V A;  4X23 C;  5GT0 C;  3X1T A;  3REI D;  1H3O B;  3UTA B;  3KWQ A;  4NFT A;  1HQ3 A;  5BNV A;  3REI C;  3MGP B;  4CAY A;  2CWE A;  5AV9 B;  3X1U D;  2JSS A;  4R8P A;  3LJA B;  5CPI A;  5B32 A;  5C3I C;  4WV4 B;  3X1U C;  2HIO D;  2XD5 A;  4H9O A;  3MVD A;  3AV1 D;  3B0D B;  1BH9 A;  3WA9 A;  1P3I D;  4DRA A;  2HIO C;  3AZI D;  4WU8 B;  3AV1 C;  1P3I C;  3KSY A;  5B0Z D;  3O62 A;  5B40 A;  3C1B D;  4J8X B;  3REK B;  3AZI C;  3REJ A;  1P3M A;  4H9S C;  3UTA D;  4ZUX B;  1P3P B;  5B0Z C;  3C1B C;  2NZD B;  4HGA C;  4LD9 B;  5BS7 C;  2ARO B;  3TU4 D;  1Q9C A;  5CPK D;  1R4V A;  4QLC A;  1BFM A;  3TU4 C;  5B31 G;  5CPK C;  3UTA A;  5BO0 B;  3AZK D;  2YFW B;  3AZH B;  4YS3 B;  1ZLA D;  3X1S B;  3MGP A;  3AZK C;  3KUY D;  3UT9 A;  4Z5T B;  2DQN C;  5G49 A;  5AY8 B;  1ZLA C;  3LJA A;  3W99 B;  1P3K D;  5GXQ B;  3KUY C;  5B0Y D;  5CPJ A;  1P3K C;  2Y2G A;  1M19 B;  5B0Y C;  1P3G B;  4WU8 A;  3H0M C;  3A6N D;  3B6G B;  3W98 B;  5AV5 A;  3REK A;  4J8X A;  5CP6 D;  3A6N C;  5B31 A;  4ZUX A;  1BH8 A;  2NZD A;  3MGS D;  4LD9 A;  4XZQ A;  5CP6 C;  2ARO A;  3MGR D;  1U35 B;  1WWS A;  4Z2M H;  3MGS C;  1P3L D;  5AV9 D;  3MGR C;  4WNN B;  2NQB B;  4YM6 B;  2YFW A;  3F6T A;  5DNM B;  1P3L C;  5AV9 C;  3AZJ B;  5GSU B;  4JJN A;  3LJA C;  3WAA B;  2FJ7 B;  5AY8 A;  2LY8 A;  4XUJ B;  1TAF A;  3W99 A;  1S32 B;  5GXQ A;  5F99 A;  3REH B;  3UTB A;  1P34 D;  3B0B A;  2BG1 A;  1M18 B;  3C1C D;  3NQJ B;  4KUD D;  2F8N D;  1KX3 D;  1P3P D;  3AZF D;  1P34 C;  1P3G A;  2HUE C;  3EPH A;  3KXB D;  3C1C C;  3AZG A;  1JFI B;  1AOI D;  3W98 A;  4KUD C;  5JA4 B;  1KX3 C;  1P3P C;  3AZF C;  1P3B D;  2J8P A;  2Y2I A;  3KWQ B;  3KXB C;  1AOI C;  3AZN D;  3AZL A;  1P3B C;  1B6W A;  4CAY B;  1U35 A;  3B6F D;  4YS3 D;  3AZH D;  3AFA D;  3X1S D;  1ID3 D;  4EO5 C;  3AZN C;  4R8P B;  4DRB A;  5B32 B;  3LZ1 D;  2RVQ D;  3B6F C;  4YS3 C;  3AZH C;  2NQB A;  4Z5T D;  3AFA C;  3X1S C;  1ID3 C;  4YM6 A;  4WU9 B;  5B33 A;  4H9R B;  1BH9 B;  2G5I C;  2RVQ C;  3LZ1 C;  3AZJ A;  2Y2P A;  5GSU A;  1N1J A;  4Z5T C;  1KX4 D;  5AV6 B;  2FJ7 A;  1M19 D;  4XUJ A;  3A1K A;  5B24 A;  3O62 B;  1S32 A;  3REJ B;  1P3M B;  1KX4 C;  3B6G D;  1M19 C;  1M18 A;  4G92 B;  3NQJ A;  4KGC B;  3B6G C;  3AZM A;  2F8N H;  2RIQ A;  2ZY5 A;  1JFI A;  5JA4 A;  5B1M A;  4Z2M G;  1P3A D;  5B2J A;  3B0C W;  5JRG D;  1P3A C;  1F1E A;  3W97 D;  5GT3 B;  5DNM D;  5FUG B;  2CV5 D;  1KX5 B;  1KU5 A;  3UT9 B;  5JRG C;  5G49 B;  3REL A;  5AVC B;  4Z66 D;  5B1L B;  3W97 C;  3WAA D;  5DNM C;  2CV5 C;  5CPJ B;  4WU9 A;  4Z66 C;  4H9R A;  3WAA C;  4J8W D;  3REH D;  1F66 B;  3NQU B;  4KHA A;  4NE6 A;  5AV6 A;  5AVB B;  4AWL C;  4J8W C;  3REH C;  5AV5 B;  1M18 C;  1TZY D;  3X1V D;  1A7W A;  5B31 B;  3X1T D;  1BH8 B;  2BYM B;  4G91 C;  4KGC A;  3KWQ D;  1TZY C;  3X1V C;  4UUZ B;  4XZQ B;  1P3O B;  1HQ3 D;  3X1T C;  3KWQ C;  4DQY B;  1HQ3 C;  4R8P D;  5CPI D;  4WZS B;  5B32 D;  3VH5 T;  2YFV A;  4JJN B;  4R8P C;  3MVD D;  5CPI C;  5GT3 A;  5FUG A;  1KX5 A;  5B32 C;  3WA9 D;  3LZ0 B;  5B2I A;  3AYW B;  2IO5 C;  5AVC A;  3AV2 B;  1TAF B;  5B1L A;  1EQZ B;  3MVD C;  5F99 B;  3WA9 C;  3UTB B;  3O62 D;  5B40 D;  3REJ D;  1P3M D;  4H9N A;  1F66 A;  3NQU A;  3MGQ A;  2JE5 A;  3O62 C;  5B40 C;  5AVB A;  3REJ C;  3AZG B;  1P3M C;  2F8N G;  4QLC D;  2ZY3 A;  4J8V A;  3MNN B;  3AN2 A;  2BYM A;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...