2AROD

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Histone H2A-IV
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroD00
3X1SD 1BH8A 3X1TA 5GT0D 4YS3B 4CAYB 1M19B 2FJ7C 3REIA 3AZKB 3X1SB 1P3KB 3AZFD 3WKJD 2YFVA 3KXBB 1BH8B 3X1TB 1KX5D 3MNNC 3W98A 3AZFB 1P34D 3WKJB 4G91C 3NQJA 3X1UA 1KX5B 4XZQC 1P34B 1P3BD 4J8VD 5AY8A 2NZDA 5DNNA 4KHAB 4JJNB 1M18A 1R4VA 1P3KC 5C3IB 4J8VB 1ULYA 2RVQC 1TZYA 1KX4D 4JJND 3AFAB 3REHC 5DNNB 3AV2D 3A6NA 5AVBA 1KX4B 3W96A 2IO5C 3B6GB 1P3AD 5BNVA 4WU9A 3MGSC 3AZIB 3AZJD 5B1MA 4WU8C 1P3OA 1HQ3C 4YM6B 5CPJB 3B6FC 5B1LA 3WAAC 5G49B 1M19C 3C1BD 3WAAB 3LZ1A 3REKB 3KUYC 3MGSD 4X23B 5AV8A 4YM6A 5CPJA 1P3GD 1P3ID 1P3LB 3MGPB 1P3OC 3KWQC 5CPKB 3VH6W 1P3MA 3MGSB 4X23D 3AZIC 2AROB 1P3PC 1EQZA 1P3IB 2F8NA 3MNNA 1P3PB 3W98C 3WA9B 5CPKD 3X1VD 2HIOC 3AZGB 3W97B 4LD9A 2AROD 3W99D 1P3LC 3WA9D 4AWLB 2CV5D 5B31A 3AZGD 3W97D 4H9PB 4WU8D 5AVCA 2LY8A 3MGRB 5AV5A 4XZQD 5B0ZA 2PYOB 2NQBA 1M18C 4KUDB 4HGAB 4YS3A 3MGRD 2NZDC 4XZQB 5B32C 3AN2B 3MVDA 2PYOA 3AZFC 3REHD 3WKJC 4Z5TA 5GXQC 3B6GC 2HIOD 3KXBA 2RVQD 3RELA 3B0DC 3AFAC 3REHB 3X1SC 1F66B 3AZKC 1ID3B 2BYKB 5GSUC 4CAYA 2NZDB 4HGAC 3MGQA 1M18B 2PYOC 5GT0A 3O62C 1KX5C 3AZLD 1U35D 3V9RB 3AZFA 3WKJA 3AZLB 3UTBA 5GT0B 3AZHC 3LJAA 4WNNA 3W98D 5GT0C 3AZHB 3AZKD 1H3OB 3AV1A 1P3GC 3AZHD 4KGCA 4QLCC 1TZYB 2IO5B 3VH6T 1BFMA 4H9QB 1TZYD 1BH9A 1B6WA 3W96B 1P3BB 5B2JB 4DRAA 3WTPC 5AVBD 3MGPA 3W96D 4H9QA 4J8WC 1P3AA 5B2JD 4AWLC 5JA4B 3KWQA 3C1CA 5AVBB 1AOIC 3AFAD 4NE6A 4J8XB 3W99C 3B6GD 1TAFA 4H9OA 3KSYA 3TU4C 4J8WA 5CPKC 4WZSB 2HUEC 1P3FD 4J8UC 4J8XA 3AZID 5B40D 3LZ1D 5JRGB 5KDMA 5AV6A 1B67A 1P3BC 3W96C 1P3FB 4KUDA 5CPJD 4YM6D 3TU4A 5BT1D 5JRGD 3NQUA 2F8NG 5B33B 4X23A 4J8UA 3W97C 3WAAD 3VH5T 2FJ7A 3LELA 3REKD 3A6NC 2L5AA 5B24D 5CPKA 2CV5C 1P3GB 2AROC 1P3LD 3W99A 4NE3A 1F66C 1M19A 3NQUB 5AVCB 5AV9A 5B33C 1HQ3A 3B6FA 4X23C 1P3PD 5B2IA 3X1VB 4WU8A 5DNNC 5AVCD 4XZQA 4ZUXB 5AV5D 2YFWB 4NE5A 5B31G 1N1JA 4Z2MG 3R45A 3VH5A 4ZUXD 5AV5B 4WU8B 4XUJB 2BYMB 5B24C 3UTAA 3WTPE 3LZ0A 5GT3D 1AOID 2PYOD 3REHA 3X1SA 4H9SC 3UTBB 4NFTA 4G92B 5BO0B 5GT3B 1AOIB 4XUJA 3RELD 3AN2D 3REJA 2HIOB 3AZGC 2JSSA 1KX5A 3UTBC 4R8PC 4ZBJB 5B32A 3B0CW 2YFVB 1ID3D 5B32G 5AV5C 5B0YA 3AYWA 1M1AC 4J8VA 3MGRC 2NZDD 4E44A 1M18D 3RELC 3AZKA 4JJNA 1U35B 4H9NB 1M1AA 4WNNB 3AV2A 4R8PA 5BNVB 3A6ND 3WTPB 3W98B 3WA9C 3AZMB 1EQZB 3A6NB 3AZMD 5B1MD 5B1LB 3AZED 3AZMC 3UTAC 1ID3C 5B1LD 3AZEB 5AV8B 5DNMA 4J8UB 4UUZA 2HUEB 3C1CD 3LELB 1U35C 4M6BA 3MGSA 1S32D 3O62D 5AV8D 1P3IA 2F8NB 5AV6C 5CP6B 4Z66A 3AZNC 3B6GA 1P3MD 4G91B 3VH6A 4J8XC 2CWEA 4J8WD 1S32B 3AZJC 2F8ND 5CP6D 3X1VA 4J8XD 3AZIA 1P3MB 5B40A 3LZ1C 4J8WB 2AROA 3UT9D 5AV8C 2CV5A 5B31D 1P3KA 3W97A 3TU4D 1F66A 1ZLAA 5BS7C 1KU5A 5B40B 3X1VC 3LZ1B 5B31B 3TU4B 2NQBD 4QLCB 1P3LA 4Z66C 5F99D 3AN2C 5B33D 5AV9D 5AVBC 5AY8B 4WU9C 3KUYD 5B24B 2YFWA 4QLCA 1ZLAC 5AV9B 5CPIA 2BYKA 3UTAB 3MGQB 5BS7A 5FUGB 5B1LC 3X1UB 3UTAD 3MGQD 5F99C 3R45B 4EO5C 4WU9B 5AY8C 3X1UD 1P3IC 3REJB 1BH9B 4XUJD 3AN2A 1U35A 5DNMC 5BO0A 3REJD 3AZLC 3UTBD 3REKC 3LJAD 4KHAA 5GXQB 5B32D 3UT9C 1KX4A 3RELB 3AYWB 3AZHA 5B0YD 3AYWD 1H3OA 5E5AC 4Z5TC 5E5AB 5GXQA 3AZND 5GSUB 3NQJB 3LJAC 4CSRB 4R8PB 5AV6B 3V9RA 5E5AA 1KX3B 4R8PD 5GSUA 1Q9CA 4H9PA 5BNXA 3C1BA 3AZEC 1KX3D 3KWQD 2FJ7B 4J8VC 3AFAA 5C3IC 5B0YC 3AZMA 3WTPD 3KWQB 1EQZD 3MNND 1S32C 1P3FA 4ZUXC 5DNMD 5B1MB 3VH5W 5BT1C 5JRGC 3MNNB 3WA9A 5B0ZC 3O62A 5DNMB 5B0ZB 4UUZB 5AVCC 4Z66D 4H9SA 1HTAA 1WWIA 4J8UD 3WAAA 2NQBC 3C1CB 3LELD 5B0ZD 3REKA 5B24A 4EO5B 4WV4B 3O62B 4YS3D 3UT9A 1M19D 4Z5TB 1KX4C 1EQZC 1P3KD 1HQ3D 3B6FD 1P3PA 1ZLAD 4ZBJC 4Z5TD 2HIOA 5B2IC 5B2JC 3X1TD 3KXBD 4LD9C 1N1JB 1HQ3B 4YM6C 3UT9B 5AV9C 5CPJC 3B0DB 5CHLB 3REID 1ZLAB 3B6FB 1KX3C 1P3MC 3LZ0B 4H9RA 1TZYC 3REIB 5B33A 5CPIC 3LZ0D 5CPIB 3C1CC 1AOIA 1P34A 2NQBB 4QLCD 2BYMA 3LZ0C 5F99B 5B31C 4KUDC 5CPID 3B0BA 3AZLA 1P3BA 5AY8D 3X1UC 2F8NH 5DNND 3KUYB 3AV2B 5B1MC 1P3AB 5FUGA 1P34C 4KGCC 3AZJB 3AV1D 1ID3A 4KGCD 1TAFB 3AV1B 4WU9D 3MGPC 3LELC 1P3OB 3AZJA 4KGCB 3C1BB 5B40C 1P3AC 1P3OD 1M1AD 4DRBA 3MGPD 3AV2C 3LJAB 5B2JA 4CSRA 5GXQD 4H9NA 5B32B 4JJNC 3AZNA 1M1AB 1WWSA 4H9OB 5G49A 3AV1C 1P3GA 5JA4A 3W99B 5B0YB 3AZEA 2CV5B 5E5AD 4E45A 5CP6C 3AZNB 5GSUD 1A7WA 3KXBC 4LD9D 1KX3A 5AV6D 1P3FC 1S32A 4KUDD 5BNXB 3AZGA 4LD9B 3WTPA 3REJC 5JRGA 1F1EA 2FJ7D 5CP6A 3MVDB 2F8NK 3MGRA 3MGQC 3AYWC 3B0CT 3REIC 3MVDD 4H9RB 5B2ID 3X1TC 1F66D 3C1BC 5GT3C 1JFIB 4G92C 5KDMB 5B2IB 4YS3C 5F99A 4Z66B 4ZUXA 4Z2MH 4XUJC 3MVDC 1JFIA 3KUYA 5GT3A
chains in the Genus database with same CATH superfamily
3X1SD 1BH8A 3X1TA 5GT0D 4YS3B 4CAYB 1M19B 2FJ7C 3REIA 3AZKB 2Y2NA 3X1SB 1P3KB 3AZFD 3WKJD 2YFVA 2Y2GA 1BH8B 3KXBB 3X1TB 1KX5D 3MNNC 3W98A 3AZFB 2Y2JA 1P34D 3WKJB 4G91C 3NQJA 3X1UA 1KX5B 4XZQC 1P34B 1P3BD 4J8VD 5AY8A 2NZDA 5DNNA 4KHAB 2Y2LA 4JJNB 1M18A 1R4VA 1P3KC 5C3IB 4J8VB 1ULYA 3A1IA 2RVQC 1TZYA 1KX4D 4JJND 3AFAB 3REHC 5DNNB 3AV2D 3A6NA 5AVBA 1KX4B 3W96A 2IO5C 3B6GB 1P3AD 2Y2HA 5BNVA 4WU9A 3MGSC 3AZIB 3AZJD 5B1MA 4WU8C 1P3OA 1HQ3C 4YM6B 5CPJB 3B6FC 5B1LA 3WAAC 5G49B 1M19C 3C1BD 3EPKA 3WAAB 3LZ1A 3REKB 3KUYC 2J8PA 3MGSD 4X23B 5AV8A 4YM6A 5CPJA 1P3GD 1P3ID 1P3LB 3MGPB 1P3OC 3KWQC 5CPKB 3VH6W 1P3MA 3MGSB 4X23D 3AZIC 2AROB 1P3PC 1EQZA 1P3IB 2F8NA 3MNNA 1P3PB 3W98C 3WA9B 5CPKD 2JE5A 3X1VD 2HIOC 3AZGB 3W97B 4LD9A 2AROD 3W99D 1P3LC 3WA9D 4AWLB 2Y2IA 2CV5D 5B31A 3AZGD 3W97D 4H9PB 4WU8D 5AVCA 2LY8A 3MGRB 5AV5A 4XZQD 5B0ZA 2PYOB 2NQBA 1M18C 4KUDB 4HGAB 4YS3A 3MGRD 2NZDC 4XZQB 2DQNC 5B32C 3AN2B 2W8SA 3MVDA 2PYOA 3AZFC 3REHD 3WKJC 4Z5TA 5GXQC 3B6GC 2HIOD 3KXBA 2RVQD 3EPLA 3RELA 3B0DC 3AFAC 3REHB 3X1SC 1F66B 3AZKC 1ID3B 2BYKB 5GSUC 4CAYA 2NZDB 4HGAC 3MGQA 2ZY5A 1M18B 2PYOC 5GT0A 3O62C 1KX5C 3AZLD 1U35D 3V9RB 3AZFA 3WKJA 3AZLB 3UTBA 5GT0B 3AZHC 3LJAA 4WNNA 3W98D 5GT0C 3AZHB 3AZKD 1H3OB 3AV1A 1P3GC 3AZHD 4KGCA 4QLCC 1TZYB 2IO5B 3VH6T 1BFMA 4H9QB 1TZYD 1BH9A 1B6WA 3W96B 1P3BB 5B2JB 4DRAA 3WTPC 5AVBD 3MGPA 3W96D 4H9QA 4J8WC 1P3AA 5B2JD 4AWLC 5JA4B 3AL0C 1T3UA 3KWQA 3C1CA 5AVBB 1AOIC 3AFAD 4NE6A 4J8XB 3W99C 3B6GD 1TAFA 4H9OA 3KSYA 3TU4C 4J8WA 5CPKC 4WZSB 2HUEC 1P3FD 4J8UC 4J8XA 3AZID 5B40D 2RIQA 3LZ1D 5JRGB 5KDMA 5AV6A 1B67A 1P3BC 2XD1A 3W96C 1P3FB 4KUDA 5CPJD 4YM6D 3TU4A 5BT1D 5JRGD 3NQUA 2F8NG 5B33B 2VQRA 4X23A 4J8UA 3W97C 3VH5T 3WAAD 2FJ7A 3LELA 3REKD 3A6NC 2L5AA 5B24D 5CPKA 2CV5C 2ZM5A 3H0RC 1P3GB 2AROC 1P3LD 3W99A 4NE3A 1F66C 1M19A 3NQUB 5AVCB 1PZRA 2JCHA 5AV9A 5B33C 1HQ3A 3B6FA 4X23C 1P3PD 5B2IA 3X1VB 4WU8A 5DNNC 5AVCD 3P5JB 4XZQA 4ZUXB 5AV5D 2YFWB 4NE5A 5B31G 1N1JA 4Z2MG 3R45A 3VH5A 4ZUXD 5AV5B 4WU8B 4XUJB 2BYMB 5B24C 3UTAA 3WTPE 3LZ0A 5GT3D 1AOID 2PYOD 3REHA 3X1SA 4H9SC 3UTBB 4NFTA 4G92B 5BO0B 5GT3B 1AOIB 4XUJA 3RELD 3AN2D 2BG1A 3REJA 2HIOB 3F6TA 3AZGC 2JSSA 1KX5A 3UTBC 4R8PC 4ZBJB 5B32A 3B0CW 2YFVB 1ID3D 5B32G 5AV5C 5B0YA 3AYWA 1M1AC 4J8VA 3MGRC 2NZDD 4E44A 2FFFB 1M18D 3RELC 3AZKA 4JJNA 1U35B 4DQYB 4H9NB 1M1AA 4WNNB 3AV2A 4R8PA 5BNVB 3A6ND 3WTPB 3W98B 3WA9C 3EPJA 3AZMB 1EQZB 3A6NB 3AZMD 5B1MD 5B1LB 3AZED 3AZMC 3UTAC 1ID3C 5B1LD 3AZEB 5AV8B 5DNMA 4J8UB 4UUZA 2HUEB 2ZY2A 3C1CD 3LELB 1U35C 4M6BA 3MGSA 1S32D 3O62D 5AV8D 1P3IA 2F8NB 2Y2KA 5AV6C 5CP6B 4Z66A 3AZNC 3B6GA 1P3MD 4G91B 3VH6A 4J8XC 2CWEA 4J8WD 1S32B 3AZJC 2F8ND 5CP6D 3X1VA 4J8XD 3AZIA 1P3MB 5B40A 3LZ1C 4J8WB 2AROA 3UT9D 2ZY4A 5AV8C 2CV5A 5B31D 1P3KA 3W97A 3TU4D 1F66A 1ZLAA 5BS7C 1KU5A 5B40B 3X1VC 3LZ1B 5B31B 3TU4B 2NQBD 4QLCB 1P3LA 4Z66C 2Y2OA 5F99D 3AN2C 5B33D 5AV9D 5AVBC 5AY8B 4WU9C 3KUYD 5B24B 2YFWA 4QLCA 1ZLAC 5AV9B 4UPKA 5CPIA 2BYKA 3UTAB 3MGQB 5BS7A 2XD5A 5FUGB 5B1LC 3X1UB 3UTAD 2Y2MA 3MGQD 5F99C 3R45B 4EO5C 4WU9B 5AY8C 3X1UD 1P3IC 3REJB 1BH9B 4XUJD 3AN2A 1U35A 3EPHA 3EG5B 5DNMC 5BO0A 3REJD 3AZLC 3UTBD 3REKC 3LJAD 1W2EA 4KHAA 5GXQB 5B32D 3UT9C 1KX4A 3RELB 3AYWB 3AZHA 5B0YD 3AYWD 1H3OA 5E5AC 4Z5TC 5E5AB 5GXQA 3AZND 5GSUB 3NQJB 3LJAC 4CSRB 4R8PB 5AV6B 3V9RA 5E5AA 1KX3B 4R8PD 5GSUA 2DF4C 1Q9CA 4H9PA 2ZY3A 5BNXA 3C1BA 3AZEC 1KX3D 3KWQD 2FJ7B 4J8VC 3AFAA 5C3IC 5B0YC 3H0MC 3AZMA 3WTPD 3KWQB 1EQZD 3MNND 1S32C 1P3FA 4ZUXC 5DNMD 5B1MB 3VH5W 5BT1C 5JRGC 3MNNB 3WA9A 5B0ZC 3O62A 5DNMB 5B0ZB 4UUZB 5AVCC 4Z66D 4H9SA 1HTAA 1WWIA 4J8UD 3WAAA 2NQBC 3C1CB 3LELD 5B0ZD 3REKA 5B24A 4EO5B 4WV4B 3O62B 3IP4C 4YS3D 2Y2QA 2F2AC 3UT9A 4Z5TB 1M19D 1KX4C 1EQZC 1P3KD 1HQ3D 3B6FD 1P3PA 1ZLAD 2G5IC 4ZBJC 4Z5TD 2HIOA 5B2IC 5B2JC 3X1TD 3KXBD 4LD9C 1N1JB 1HQ3B 4YM6C 3UT9B 5AV9C 5CPJC 3B0DB 5CHLB 3REID 1ZLAB 3B6FB 1KX3C 1P3MC 3LZ0B 4H9RA 1TZYC 3REIB 5B33A 5CPIC 3LZ0D 5CPIB 3C1CC 1AOIA 1P34A 2NQBB 1Z2CB 4QLCD 2BYMA 3LZ0C 5F99B 5B31C 4KUDC 5CPID 3B0BA 3AZLA 1P3BA 5AY8D 3X1UC 2F8NH 5DNND 3KUYB 3AV2B 5B1MC 1P3AB 5FUGA 1P34C 4KGCC 3AZJB 3AV1D 1ID3A 4KGCD 1TAFB 2Y2PA 3AV1B 4WU9D 3MGPC 3LELC 1P3OB 3AZJA 4KGCB 3C1BB 2G5HC 3FDDA 5B40C 1P3AC 1P3OD 1M1AD 4WJ3C 4DRBA 3MGPD 3AV2C 3LJAB 2UWXA 5B2JA 4CSRA 5GXQD 4H9NA 5B32B 4JJNC 3AZNA 1M1AB 1WWSA 4H9OB 5G49A 3AV1C 1P3GA 5JA4A 3W99B 5B0YB 3AZEA 2CV5B 5E5AD 3KFUG 4E45A 5CP6C 3AZNB 5GSUD 1A7WA 3KXBC 4LD9D 1KX3A 5AV6D 1P3FC 1S32A 4KUDD 5BNXB 3AZGA 4LD9B 3WTPA 3REJC 5JRGA 3A1KA 3H0LC 1F1EA 2FJ7D 5CP6A 3MVDB 2F8NK 3MGRA 3MGQC 3AYWC 3B0CT 3REIC 3MVDD 4H9RB 5B2ID 3X1TC 1F66D 3C1BC 5GT3C 1JFIB 4G92C 5KDMB 5B2IB 4YS3C 5F99A 4Z66B 4ZUXA 4Z2MH 4XUJC 3MVDC 1JFIA 3KUYA 5GT3A
chains in the Genus database with same CATH topology
3X1SD 1BH8A 3X1TA 5GT0D 4YS3B 4CAYB 1M19B 2FJ7C 3REIA 3AZKB 2Y2NA 3X1SB 1P3KB 3AZFD 3WKJD 2YFVA 2Y2GA 1BH8B 3KXBB 3X1TB 1KX5D 3MNNC 3W98A 3AZFB 2Y2JA 1P34D 3WKJB 4G91C 3NQJA 3X1UA 1KX5B 4XZQC 1P34B 1P3BD 4J8VD 5AY8A 2NZDA 5DNNA 4KHAB 2Y2LA 4JJNB 1M18A 1R4VA 1P3KC 5C3IB 4J8VB 1ULYA 3A1IA 2RVQC 1TZYA 1KX4D 4JJND 3AFAB 3REHC 5DNNB 3AV2D 3A6NA 5AVBA 1KX4B 3W96A 2IO5C 3B6GB 1P3AD 2Y2HA 5BNVA 4WU9A 3MGSC 3AZIB 3AZJD 5B1MA 4WU8C 1P3OA 1HQ3C 4YM6B 5CPJB 3B6FC 5B1LA 3WAAC 5G49B 1M19C 3C1BD 3EPKA 3WAAB 3LZ1A 3REKB 3KUYC 2J8PA 3MGSD 4X23B 5AV8A 4YM6A 5CPJA 1P3GD 1P3ID 1P3LB 3MGPB 1P3OC 3KWQC 5CPKB 3VH6W 1P3MA 3MGSB 4X23D 3AZIC 2AROB 1P3PC 1EQZA 1P3IB 2F8NA 3MNNA 1P3PB 3W98C 3WA9B 5CPKD 2JE5A 3X1VD 2HIOC 3AZGB 3W97B 4LD9A 2AROD 3W99D 1P3LC 3WA9D 4AWLB 2Y2IA 2CV5D 5B31A 3AZGD 3W97D 4H9PB 4WU8D 5AVCA 2LY8A 3MGRB 5AV5A 4XZQD 5B0ZA 2PYOB 2NQBA 1M18C 4KUDB 4HGAB 4YS3A 3MGRD 2NZDC 4XZQB 2DQNC 5B32C 3AN2B 2W8SA 3MVDA 2PYOA 3AZFC 3REHD 3WKJC 4Z5TA 5GXQC 3B6GC 2HIOD 3KXBA 2RVQD 3EPLA 3RELA 3B0DC 3AFAC 3REHB 3X1SC 1F66B 3AZKC 1ID3B 2BYKB 5GSUC 4CAYA 2NZDB 4HGAC 3MGQA 2ZY5A 1M18B 2PYOC 5GT0A 3O62C 1KX5C 3AZLD 1U35D 3V9RB 3AZFA 3WKJA 3AZLB 3UTBA 5GT0B 3AZHC 3LJAA 4WNNA 3W98D 5GT0C 3AZHB 3AZKD 1H3OB 3AV1A 1P3GC 3AZHD 4KGCA 4QLCC 1TZYB 2IO5B 3VH6T 1BFMA 4H9QB 1TZYD 1BH9A 1B6WA 3W96B 1P3BB 5B2JB 4DRAA 3WTPC 5AVBD 3MGPA 3W96D 4H9QA 4J8WC 1P3AA 5B2JD 4AWLC 5JA4B 3AL0C 1T3UA 3KWQA 3C1CA 5AVBB 1AOIC 3AFAD 4NE6A 4J8XB 3W99C 3B6GD 1TAFA 4H9OA 3KSYA 3TU4C 4J8WA 5CPKC 4WZSB 2HUEC 1P3FD 4J8UC 4J8XA 3AZID 5B40D 2RIQA 3LZ1D 5JRGB 5KDMA 5AV6A 1B67A 1P3BC 2XD1A 3W96C 1P3FB 4KUDA 5CPJD 4YM6D 3TU4A 5BT1D 5JRGD 3NQUA 2F8NG 5B33B 2VQRA 4X23A 4J8UA 3W97C 3VH5T 3WAAD 2FJ7A 3LELA 3REKD 3A6NC 2L5AA 5B24D 5CPKA 2CV5C 2ZM5A 3H0RC 1P3GB 2AROC 1P3LD 3W99A 4NE3A 1F66C 1M19A 3NQUB 5AVCB 1PZRA 2JCHA 5AV9A 5B33C 1HQ3A 3B6FA 4X23C 1P3PD 5B2IA 3X1VB 4WU8A 5DNNC 5AVCD 3P5JB 4XZQA 4ZUXB 5AV5D 2YFWB 4NE5A 5B31G 1N1JA 4Z2MG 3R45A 3VH5A 4ZUXD 5AV5B 4WU8B 4XUJB 2BYMB 5B24C 3UTAA 3WTPE 3LZ0A 5GT3D 1AOID 2PYOD 3REHA 3X1SA 4H9SC 3UTBB 4NFTA 4G92B 5BO0B 5GT3B 1AOIB 4XUJA 3RELD 3AN2D 2BG1A 3REJA 2HIOB 3F6TA 3AZGC 2JSSA 1KX5A 3UTBC 4R8PC 4ZBJB 5B32A 3B0CW 2YFVB 1ID3D 5B32G 5AV5C 5B0YA 3AYWA 1M1AC 4J8VA 3MGRC 2NZDD 4E44A 2FFFB 1M18D 3RELC 3AZKA 4JJNA 1U35B 4DQYB 4H9NB 1M1AA 4WNNB 3AV2A 4R8PA 5BNVB 3A6ND 3WTPB 3W98B 3WA9C 3EPJA 3AZMB 1EQZB 3A6NB 3AZMD 5B1MD 5B1LB 3AZED 3AZMC 3UTAC 1ID3C 5B1LD 3AZEB 5AV8B 5DNMA 4J8UB 4UUZA 2HUEB 2ZY2A 3C1CD 3LELB 1U35C 4M6BA 3MGSA 1S32D 3O62D 5AV8D 1P3IA 2F8NB 2Y2KA 5AV6C 5CP6B 4Z66A 3AZNC 3B6GA 1P3MD 4G91B 3VH6A 4J8XC 2CWEA 4J8WD 1S32B 3AZJC 2F8ND 5CP6D 3X1VA 4J8XD 3AZIA 1P3MB 5B40A 3LZ1C 4J8WB 2AROA 3UT9D 2ZY4A 5AV8C 2CV5A 5B31D 1P3KA 3W97A 3TU4D 1F66A 1ZLAA 5BS7C 1KU5A 5B40B 3X1VC 3LZ1B 5B31B 3TU4B 2NQBD 4QLCB 1P3LA 4Z66C 2Y2OA 5F99D 3AN2C 5B33D 5AV9D 5AVBC 5AY8B 4WU9C 3KUYD 5B24B 2YFWA 4QLCA 1ZLAC 5AV9B 4UPKA 5CPIA 2BYKA 3UTAB 3MGQB 5BS7A 2XD5A 5FUGB 5B1LC 3X1UB 3UTAD 2Y2MA 3MGQD 5F99C 3R45B 4EO5C 4WU9B 5AY8C 3X1UD 1P3IC 3REJB 1BH9B 4XUJD 3AN2A 1U35A 3EPHA 3EG5B 5DNMC 5BO0A 3REJD 3AZLC 3UTBD 3REKC 3LJAD 1W2EA 4KHAA 5GXQB 5B32D 3UT9C 1KX4A 3RELB 3AYWB 3AZHA 5B0YD 3AYWD 1H3OA 5E5AC 4Z5TC 5E5AB 5GXQA 3AZND 5GSUB 3NQJB 3LJAC 4CSRB 4R8PB 5AV6B 3V9RA 5E5AA 1KX3B 4R8PD 5GSUA 2DF4C 1Q9CA 4H9PA 2ZY3A 5BNXA 3C1BA 3AZEC 1KX3D 3KWQD 2FJ7B 4J8VC 3AFAA 5C3IC 5B0YC 3H0MC 3AZMA 3WTPD 3KWQB 1EQZD 3MNND 1S32C 1P3FA 4ZUXC 5DNMD 5B1MB 3VH5W 5BT1C 5JRGC 3MNNB 3WA9A 5B0ZC 3O62A 5DNMB 5B0ZB 4UUZB 5AVCC 4Z66D 4H9SA 1HTAA 1WWIA 4J8UD 3WAAA 2NQBC 3C1CB 3LELD 5B0ZD 3REKA 5B24A 4EO5B 4WV4B 3O62B 3IP4C 4YS3D 2Y2QA 2F2AC 3UT9A 4Z5TB 1M19D 1KX4C 1EQZC 1P3KD 1HQ3D 3B6FD 1P3PA 1ZLAD 2G5IC 4ZBJC 4Z5TD 2HIOA 5B2IC 5B2JC 3X1TD 3KXBD 4LD9C 1N1JB 1HQ3B 4YM6C 3UT9B 5AV9C 5CPJC 3B0DB 5CHLB 3REID 1ZLAB 3B6FB 1KX3C 1P3MC 3LZ0B 4H9RA 1TZYC 3REIB 5B33A 5CPIC 3LZ0D 5CPIB 3C1CC 1AOIA 1P34A 2NQBB 1Z2CB 4QLCD 2BYMA 3LZ0C 5F99B 5B31C 4KUDC 5CPID 3B0BA 3AZLA 1P3BA 5AY8D 3X1UC 2F8NH 5DNND 3KUYB 3AV2B 5B1MC 1P3AB 5FUGA 1P34C 4KGCC 3AZJB 3AV1D 1ID3A 4KGCD 1TAFB 2Y2PA 3AV1B 4WU9D 3MGPC 3LELC 1P3OB 3AZJA 4KGCB 3C1BB 2G5HC 3FDDA 5B40C 1P3AC 1P3OD 1M1AD 4WJ3C 4DRBA 3MGPD 3AV2C 3LJAB 2UWXA 5B2JA 4CSRA 5GXQD 4H9NA 5B32B 4JJNC 3AZNA 1M1AB 1WWSA 4H9OB 5G49A 3AV1C 1P3GA 5JA4A 3W99B 5B0YB 3AZEA 2CV5B 5E5AD 3KFUG 4E45A 5CP6C 3AZNB 5GSUD 1A7WA 3KXBC 4LD9D 1KX3A 5AV6D 1P3FC 1S32A 4KUDD 5BNXB 3AZGA 4LD9B 3WTPA 3REJC 5JRGA 3A1KA 3H0LC 1F1EA 2FJ7D 5CP6A 3MVDB 2F8NK 3MGRA 3MGQC 3AYWC 3B0CT 3REIC 3MVDD 4H9RB 5B2ID 3X1TC 1F66D 3C1BC 5GT3C 1JFIB 4G92C 5KDMB 5B2IB 4YS3C 5F99A 4Z66B 4ZUXA 4Z2MH 4XUJC 3MVDC 1JFIA 3KUYA 5GT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  1BH8 A;  3X1T A;  5GT0 D;  4YS3 B;  4CAY B;  1M19 B;  2FJ7 C;  3REI A;  3AZK B;  3X1S B;  1P3K B;  3AZF D;  3WKJ D;  2YFV A;  3KXB B;  1BH8 B;  3X1T B;  1KX5 D;  3MNN C;  3W98 A;  3AZF B;  1P34 D;  3WKJ B;  4G91 C;  3NQJ A;  3X1U A;  1KX5 B;  4XZQ C;  1P34 B;  1P3B D;  4J8V D;  5AY8 A;  2NZD A;  5DNN A;  4KHA B;  4JJN B;  1M18 A;  1R4V A;  1P3K C;  5C3I B;  4J8V B;  1ULY A;  2RVQ C;  1TZY A;  1KX4 D;  4JJN D;  3AFA B;  3REH C;  5DNN B;  3AV2 D;  3A6N A;  5AVB A;  1KX4 B;  3W96 A;  2IO5 C;  3B6G B;  1P3A D;  5BNV A;  4WU9 A;  3MGS C;  3AZI B;  3AZJ D;  5B1M A;  4WU8 C;  1P3O A;  1HQ3 C;  4YM6 B;  5CPJ B;  3B6F C;  5B1L A;  3WAA C;  5G49 B;  1M19 C;  3C1B D;  3WAA B;  3LZ1 A;  3REK B;  3KUY C;  3MGS D;  4X23 B;  5AV8 A;  4YM6 A;  5CPJ A;  1P3G D;  1P3I D;  1P3L B;  3MGP B;  1P3O C;  3KWQ C;  5CPK B;  3VH6 W;  1P3M A;  3MGS B;  4X23 D;  3AZI C;  2ARO B;  1P3P C;  1EQZ A;  1P3I B;  2F8N A;  3MNN A;  1P3P B;  3W98 C;  3WA9 B;  5CPK D;  3X1V D;  2HIO C;  3AZG B;  3W97 B;  4LD9 A;  2ARO D;  3W99 D;  1P3L C;  3WA9 D;  4AWL B;  2CV5 D;  5B31 A;  3AZG D;  3W97 D;  4H9P B;  4WU8 D;  5AVC A;  2LY8 A;  3MGR B;  5AV5 A;  4XZQ D;  5B0Z A;  2PYO B;  2NQB A;  1M18 C;  4KUD B;  4HGA B;  4YS3 A;  3MGR D;  2NZD C;  4XZQ B;  5B32 C;  3AN2 B;  3MVD A;  2PYO A;  3AZF C;  3REH D;  3WKJ C;  4Z5T A;  5GXQ C;  3B6G C;  2HIO D;  3KXB A;  2RVQ D;  3REL A;  3B0D C;  3AFA C;  3REH B;  3X1S C;  1F66 B;  3AZK C;  1ID3 B;  2BYK B;  5GSU C;  4CAY A;  2NZD B;  4HGA C;  3MGQ A;  1M18 B;  2PYO C;  5GT0 A;  3O62 C;  1KX5 C;  3AZL D;  1U35 D;  3V9R B;  3AZF A;  3WKJ A;  3AZL B;  3UTB A;  5GT0 B;  3AZH C;  3LJA A;  4WNN A;  3W98 D;  5GT0 C;  3AZH B;  3AZK D;  1H3O B;  3AV1 A;  1P3G C;  3AZH D;  4KGC A;  4QLC C;  1TZY B;  2IO5 B;  3VH6 T;  1BFM A;  4H9Q B;  1TZY D;  1BH9 A;  1B6W A;  3W96 B;  1P3B B;  5B2J B;  4DRA A;  3WTP C;  5AVB D;  3MGP A;  3W96 D;  4H9Q A;  4J8W C;  1P3A A;  5B2J D;  4AWL C;  5JA4 B;  3KWQ A;  3C1C A;  5AVB B;  1AOI C;  3AFA D;  4NE6 A;  4J8X B;  3W99 C;  3B6G D;  1TAF A;  4H9O A;  3KSY A;  3TU4 C;  4J8W A;  5CPK C;  4WZS B;  2HUE C;  1P3F D;  4J8U C;  4J8X A;  3AZI D;  5B40 D;  3LZ1 D;  5JRG B;  5KDM A;  5AV6 A;  1B67 A;  1P3B C;  3W96 C;  1P3F B;  4KUD A;  5CPJ D;  4YM6 D;  3TU4 A;  5BT1 D;  5JRG D;  3NQU A;  2F8N G;  5B33 B;  4X23 A;  4J8U A;  3W97 C;  3WAA D;  3VH5 T;  2FJ7 A;  3LEL A;  3REK D;  3A6N C;  2L5A A;  5B24 D;  5CPK A;  2CV5 C;  1P3G B;  2ARO C;  1P3L D;  3W99 A;  4NE3 A;  1F66 C;  1M19 A;  3NQU B;  5AVC B;  5AV9 A;  5B33 C;  1HQ3 A;  3B6F A;  4X23 C;  1P3P D;  5B2I A;  3X1V B;  4WU8 A;  5DNN C;  5AVC D;  4XZQ A;  4ZUX B;  5AV5 D;  2YFW B;  4NE5 A;  5B31 G;  1N1J A;  4Z2M G;  3R45 A;  3VH5 A;  4ZUX D;  5AV5 B;  4WU8 B;  4XUJ B;  2BYM B;  5B24 C;  3UTA A;  3WTP E;  3LZ0 A;  5GT3 D;  1AOI D;  2PYO D;  3REH A;  3X1S A;  4H9S C;  3UTB B;  4NFT A;  4G92 B;  5BO0 B;  5GT3 B;  1AOI B;  4XUJ A;  3REL D;  3AN2 D;  3REJ A;  2HIO B;  3AZG C;  2JSS A;  1KX5 A;  3UTB C;  4R8P C;  4ZBJ B;  5B32 A;  3B0C W;  2YFV B;  1ID3 D;  5B32 G;  5AV5 C;  5B0Y A;  3AYW A;  1M1A C;  4J8V A;  3MGR C;  2NZD D;  4E44 A;  1M18 D;  3REL C;  3AZK A;  4JJN A;  1U35 B;  4H9N B;  1M1A A;  4WNN B;  3AV2 A;  4R8P A;  5BNV B;  3A6N D;  3WTP B;  3W98 B;  3WA9 C;  3AZM B;  1EQZ B;  3A6N B;  3AZM D;  5B1M D;  5B1L B;  3AZE D;  3AZM C;  3UTA C;  1ID3 C;  5B1L D;  3AZE B;  5AV8 B;  5DNM A;  4J8U B;  4UUZ A;  2HUE B;  3C1C D;  3LEL B;  1U35 C;  4M6B A;  3MGS A;  1S32 D;  3O62 D;  5AV8 D;  1P3I A;  2F8N B;  5AV6 C;  5CP6 B;  4Z66 A;  3AZN C;  3B6G A;  1P3M D;  4G91 B;  3VH6 A;  4J8X C;  2CWE A;  4J8W D;  1S32 B;  3AZJ C;  2F8N D;  5CP6 D;  3X1V A;  4J8X D;  3AZI A;  1P3M B;  5B40 A;  3LZ1 C;  4J8W B;  2ARO A;  3UT9 D;  5AV8 C;  2CV5 A;  5B31 D;  1P3K A;  3W97 A;  3TU4 D;  1F66 A;  1ZLA A;  5BS7 C;  1KU5 A;  5B40 B;  3X1V C;  3LZ1 B;  5B31 B;  3TU4 B;  2NQB D;  4QLC B;  1P3L A;  4Z66 C;  5F99 D;  3AN2 C;  5B33 D;  5AV9 D;  5AVB C;  5AY8 B;  4WU9 C;  3KUY D;  5B24 B;  2YFW A;  4QLC A;  1ZLA C;  5AV9 B;  5CPI A;  2BYK A;  3UTA B;  3MGQ B;  5BS7 A;  5FUG B;  5B1L C;  3X1U B;  3UTA D;  3MGQ D;  5F99 C;  3R45 B;  4EO5 C;  4WU9 B;  5AY8 C;  3X1U D;  1P3I C;  3REJ B;  1BH9 B;  4XUJ D;  3AN2 A;  1U35 A;  5DNM C;  5BO0 A;  3REJ D;  3AZL C;  3UTB D;  3REK C;  3LJA D;  4KHA A;  5GXQ B;  5B32 D;  3UT9 C;  1KX4 A;  3REL B;  3AYW B;  3AZH A;  5B0Y D;  3AYW D;  1H3O A;  5E5A C;  4Z5T C;  5E5A B;  5GXQ A;  3AZN D;  5GSU B;  3NQJ B;  3LJA C;  4CSR B;  4R8P B;  5AV6 B;  3V9R A;  5E5A A;  1KX3 B;  4R8P D;  5GSU A;  1Q9C A;  4H9P A;  5BNX A;  3C1B A;  3AZE C;  1KX3 D;  3KWQ D;  2FJ7 B;  4J8V C;  3AFA A;  5C3I C;  5B0Y C;  3AZM A;  3WTP D;  3KWQ B;  1EQZ D;  3MNN D;  1S32 C;  1P3F A;  4ZUX C;  5DNM D;  5B1M B;  3VH5 W;  5BT1 C;  5JRG C;  3MNN B;  3WA9 A;  5B0Z C;  3O62 A;  5DNM B;  5B0Z B;  4UUZ B;  5AVC C;  4Z66 D;  4H9S A;  1HTA A;  1WWI A;  4J8U D;  3WAA A;  2NQB C;  3C1C B;  3LEL D;  5B0Z D;  3REK A;  5B24 A;  4EO5 B;  4WV4 B;  3O62 B;  4YS3 D;  3UT9 A;  1M19 D;  4Z5T B;  1KX4 C;  1EQZ C;  1P3K D;  1HQ3 D;  3B6F D;  1P3P A;  1ZLA D;  4ZBJ C;  4Z5T D;  2HIO A;  5B2I C;  5B2J C;  3X1T D;  3KXB D;  4LD9 C;  1N1J B;  1HQ3 B;  4YM6 C;  3UT9 B;  5AV9 C;  5CPJ C;  3B0D B;  5CHL B;  3REI D;  1ZLA B;  3B6F B;  1KX3 C;  1P3M C;  3LZ0 B;  4H9R A;  1TZY C;  3REI B;  5B33 A;  5CPI C;  3LZ0 D;  5CPI B;  3C1C C;  1AOI A;  1P34 A;  2NQB B;  4QLC D;  2BYM A;  3LZ0 C;  5F99 B;  5B31 C;  4KUD C;  5CPI D;  3B0B A;  3AZL A;  1P3B A;  5AY8 D;  3X1U C;  2F8N H;  5DNN D;  3KUY B;  3AV2 B;  5B1M C;  1P3A B;  5FUG A;  1P34 C;  4KGC C;  3AZJ B;  3AV1 D;  1ID3 A;  4KGC D;  1TAF B;  3AV1 B;  4WU9 D;  3MGP C;  3LEL C;  1P3O B;  3AZJ A;  4KGC B;  3C1B B;  5B40 C;  1P3A C;  1P3O D;  1M1A D;  4DRB A;  3MGP D;  3AV2 C;  3LJA B;  5B2J A;  4CSR A;  5GXQ D;  4H9N A;  5B32 B;  4JJN C;  3AZN A;  1M1A B;  1WWS A;  4H9O B;  5G49 A;  3AV1 C;  1P3G A;  5JA4 A;  3W99 B;  5B0Y B;  3AZE A;  2CV5 B;  5E5A D;  4E45 A;  5CP6 C;  3AZN B;  5GSU D;  1A7W A;  3KXB C;  4LD9 D;  1KX3 A;  5AV6 D;  1P3F C;  1S32 A;  4KUD D;  5BNX B;  3AZG A;  4LD9 B;  3WTP A;  3REJ C;  5JRG A;  1F1E A;  2FJ7 D;  5CP6 A;  3MVD B;  2F8N K;  3MGR A;  3MGQ C;  3AYW C;  3B0C T;  3REI C;  3MVD D;  4H9R B;  5B2I D;  3X1T C;  1F66 D;  3C1B C;  5GT3 C;  1JFI B;  4G92 C;  5KDM B;  5B2I B;  4YS3 C;  5F99 A;  4Z66 B;  4ZUX A;  4Z2M H;  4XUJ C;  3MVD C;  1JFI A;  3KUY A;  5GT3 A; 
#chains in the Genus database with same CATH topology
 3X1S D;  1BH8 A;  3X1T A;  5GT0 D;  4YS3 B;  4CAY B;  1M19 B;  2FJ7 C;  3REI A;  3AZK B;  2Y2N A;  3X1S B;  1P3K B;  3AZF D;  3WKJ D;  2YFV A;  2Y2G A;  1BH8 B;  3KXB B;  3X1T B;  1KX5 D;  3MNN C;  3W98 A;  3AZF B;  2Y2J A;  1P34 D;  3WKJ B;  4G91 C;  3NQJ A;  3X1U A;  1KX5 B;  4XZQ C;  1P34 B;  1P3B D;  4J8V D;  5AY8 A;  2NZD A;  5DNN A;  4KHA B;  2Y2L A;  4JJN B;  1M18 A;  1R4V A;  1P3K C;  5C3I B;  4J8V B;  1ULY A;  3A1I A;  2RVQ C;  1TZY A;  1KX4 D;  4JJN D;  3AFA B;  3REH C;  5DNN B;  3AV2 D;  3A6N A;  5AVB A;  1KX4 B;  3W96 A;  2IO5 C;  3B6G B;  1P3A D;  2Y2H A;  5BNV A;  4WU9 A;  3MGS C;  3AZI B;  3AZJ D;  5B1M A;  4WU8 C;  1P3O A;  1HQ3 C;  4YM6 B;  5CPJ B;  3B6F C;  5B1L A;  3WAA C;  5G49 B;  1M19 C;  3C1B D;  3EPK A;  3WAA B;  3LZ1 A;  3REK B;  3KUY C;  2J8P A;  3MGS D;  4X23 B;  5AV8 A;  4YM6 A;  5CPJ A;  1P3G D;  1P3I D;  1P3L B;  3MGP B;  1P3O C;  3KWQ C;  5CPK B;  3VH6 W;  1P3M A;  3MGS B;  4X23 D;  3AZI C;  2ARO B;  1P3P C;  1EQZ A;  1P3I B;  2F8N A;  3MNN A;  1P3P B;  3W98 C;  3WA9 B;  5CPK D;  2JE5 A;  3X1V D;  2HIO C;  3AZG B;  3W97 B;  4LD9 A;  2ARO D;  3W99 D;  1P3L C;  3WA9 D;  4AWL B;  2Y2I A;  2CV5 D;  5B31 A;  3AZG D;  3W97 D;  4H9P B;  4WU8 D;  5AVC A;  2LY8 A;  3MGR B;  5AV5 A;  4XZQ D;  5B0Z A;  2PYO B;  2NQB A;  1M18 C;  4KUD B;  4HGA B;  4YS3 A;  3MGR D;  2NZD C;  4XZQ B;  2DQN C;  5B32 C;  3AN2 B;  2W8S A;  3MVD A;  2PYO A;  3AZF C;  3REH D;  3WKJ C;  4Z5T A;  5GXQ C;  3B6G C;  2HIO D;  3KXB A;  2RVQ D;  3EPL A;  3REL A;  3B0D C;  3AFA C;  3REH B;  3X1S C;  1F66 B;  3AZK C;  1ID3 B;  2BYK B;  5GSU C;  4CAY A;  2NZD B;  4HGA C;  3MGQ A;  2ZY5 A;  1M18 B;  2PYO C;  5GT0 A;  3O62 C;  1KX5 C;  3AZL D;  1U35 D;  3V9R B;  3AZF A;  3WKJ A;  3AZL B;  3UTB A;  5GT0 B;  3AZH C;  3LJA A;  4WNN A;  3W98 D;  5GT0 C;  3AZH B;  3AZK D;  1H3O B;  3AV1 A;  1P3G C;  3AZH D;  4KGC A;  4QLC C;  1TZY B;  2IO5 B;  3VH6 T;  1BFM A;  4H9Q B;  1TZY D;  1BH9 A;  1B6W A;  3W96 B;  1P3B B;  5B2J B;  4DRA A;  3WTP C;  5AVB D;  3MGP A;  3W96 D;  4H9Q A;  4J8W C;  1P3A A;  5B2J D;  4AWL C;  5JA4 B;  3AL0 C;  1T3U A;  3KWQ A;  3C1C A;  5AVB B;  1AOI C;  3AFA D;  4NE6 A;  4J8X B;  3W99 C;  3B6G D;  1TAF A;  4H9O A;  3KSY A;  3TU4 C;  4J8W A;  5CPK C;  4WZS B;  2HUE C;  1P3F D;  4J8U C;  4J8X A;  3AZI D;  5B40 D;  2RIQ A;  3LZ1 D;  5JRG B;  5KDM A;  5AV6 A;  1B67 A;  1P3B C;  2XD1 A;  3W96 C;  1P3F B;  4KUD A;  5CPJ D;  4YM6 D;  3TU4 A;  5BT1 D;  5JRG D;  3NQU A;  2F8N G;  5B33 B;  2VQR A;  4X23 A;  4J8U A;  3W97 C;  3VH5 T;  3WAA D;  2FJ7 A;  3LEL A;  3REK D;  3A6N C;  2L5A A;  5B24 D;  5CPK A;  2CV5 C;  2ZM5 A;  3H0R C;  1P3G B;  2ARO C;  1P3L D;  3W99 A;  4NE3 A;  1F66 C;  1M19 A;  3NQU B;  5AVC B;  1PZR A;  2JCH A;  5AV9 A;  5B33 C;  1HQ3 A;  3B6F A;  4X23 C;  1P3P D;  5B2I A;  3X1V B;  4WU8 A;  5DNN C;  5AVC D;  3P5J B;  4XZQ A;  4ZUX B;  5AV5 D;  2YFW B;  4NE5 A;  5B31 G;  1N1J A;  4Z2M G;  3R45 A;  3VH5 A;  4ZUX D;  5AV5 B;  4WU8 B;  4XUJ B;  2BYM B;  5B24 C;  3UTA A;  3WTP E;  3LZ0 A;  5GT3 D;  1AOI D;  2PYO D;  3REH A;  3X1S A;  4H9S C;  3UTB B;  4NFT A;  4G92 B;  5BO0 B;  5GT3 B;  1AOI B;  4XUJ A;  3REL D;  3AN2 D;  2BG1 A;  3REJ A;  2HIO B;  3F6T A;  3AZG C;  2JSS A;  1KX5 A;  3UTB C;  4R8P C;  4ZBJ B;  5B32 A;  3B0C W;  2YFV B;  1ID3 D;  5B32 G;  5AV5 C;  5B0Y A;  3AYW A;  1M1A C;  4J8V A;  3MGR C;  2NZD D;  4E44 A;  2FFF B;  1M18 D;  3REL C;  3AZK A;  4JJN A;  1U35 B;  4DQY B;  4H9N B;  1M1A A;  4WNN B;  3AV2 A;  4R8P A;  5BNV B;  3A6N D;  3WTP B;  3W98 B;  3WA9 C;  3EPJ A;  3AZM B;  1EQZ B;  3A6N B;  3AZM D;  5B1M D;  5B1L B;  3AZE D;  3AZM C;  3UTA C;  1ID3 C;  5B1L D;  3AZE B;  5AV8 B;  5DNM A;  4J8U B;  4UUZ A;  2HUE B;  2ZY2 A;  3C1C D;  3LEL B;  1U35 C;  4M6B A;  3MGS A;  1S32 D;  3O62 D;  5AV8 D;  1P3I A;  2F8N B;  2Y2K A;  5AV6 C;  5CP6 B;  4Z66 A;  3AZN C;  3B6G A;  1P3M D;  4G91 B;  3VH6 A;  4J8X C;  2CWE A;  4J8W D;  1S32 B;  3AZJ C;  2F8N D;  5CP6 D;  3X1V A;  4J8X D;  3AZI A;  1P3M B;  5B40 A;  3LZ1 C;  4J8W B;  2ARO A;  3UT9 D;  2ZY4 A;  5AV8 C;  2CV5 A;  5B31 D;  1P3K A;  3W97 A;  3TU4 D;  1F66 A;  1ZLA A;  5BS7 C;  1KU5 A;  5B40 B;  3X1V C;  3LZ1 B;  5B31 B;  3TU4 B;  2NQB D;  4QLC B;  1P3L A;  4Z66 C;  2Y2O A;  5F99 D;  3AN2 C;  5B33 D;  5AV9 D;  5AVB C;  5AY8 B;  4WU9 C;  3KUY D;  5B24 B;  2YFW A;  4QLC A;  1ZLA C;  5AV9 B;  4UPK A;  5CPI A;  2BYK A;  3UTA B;  3MGQ B;  5BS7 A;  2XD5 A;  5FUG B;  5B1L C;  3X1U B;  3UTA D;  2Y2M A;  3MGQ D;  5F99 C;  3R45 B;  4EO5 C;  4WU9 B;  5AY8 C;  3X1U D;  1P3I C;  3REJ B;  1BH9 B;  4XUJ D;  3AN2 A;  1U35 A;  3EPH A;  3EG5 B;  5DNM C;  5BO0 A;  3REJ D;  3AZL C;  3UTB D;  3REK C;  3LJA D;  1W2E A;  4KHA A;  5GXQ B;  5B32 D;  3UT9 C;  1KX4 A;  3REL B;  3AYW B;  3AZH A;  5B0Y D;  3AYW D;  1H3O A;  5E5A C;  4Z5T C;  5E5A B;  5GXQ A;  3AZN D;  5GSU B;  3NQJ B;  3LJA C;  4CSR B;  4R8P B;  5AV6 B;  3V9R A;  5E5A A;  1KX3 B;  4R8P D;  5GSU A;  2DF4 C;  1Q9C A;  4H9P A;  2ZY3 A;  5BNX A;  3C1B A;  3AZE C;  1KX3 D;  3KWQ D;  2FJ7 B;  4J8V C;  3AFA A;  5C3I C;  5B0Y C;  3H0M C;  3AZM A;  3WTP D;  3KWQ B;  1EQZ D;  3MNN D;  1S32 C;  1P3F A;  4ZUX C;  5DNM D;  5B1M B;  3VH5 W;  5BT1 C;  5JRG C;  3MNN B;  3WA9 A;  5B0Z C;  3O62 A;  5DNM B;  5B0Z B;  4UUZ B;  5AVC C;  4Z66 D;  4H9S A;  1HTA A;  1WWI A;  4J8U D;  3WAA A;  2NQB C;  3C1C B;  3LEL D;  5B0Z D;  3REK A;  5B24 A;  4EO5 B;  4WV4 B;  3O62 B;  3IP4 C;  4YS3 D;  2Y2Q A;  2F2A C;  3UT9 A;  4Z5T B;  1M19 D;  1KX4 C;  1EQZ C;  1P3K D;  1HQ3 D;  3B6F D;  1P3P A;  1ZLA D;  2G5I C;  4ZBJ C;  4Z5T D;  2HIO A;  5B2I C;  5B2J C;  3X1T D;  3KXB D;  4LD9 C;  1N1J B;  1HQ3 B;  4YM6 C;  3UT9 B;  5AV9 C;  5CPJ C;  3B0D B;  5CHL B;  3REI D;  1ZLA B;  3B6F B;  1KX3 C;  1P3M C;  3LZ0 B;  4H9R A;  1TZY C;  3REI B;  5B33 A;  5CPI C;  3LZ0 D;  5CPI B;  3C1C C;  1AOI A;  1P34 A;  2NQB B;  1Z2C B;  4QLC D;  2BYM A;  3LZ0 C;  5F99 B;  5B31 C;  4KUD C;  5CPI D;  3B0B A;  3AZL A;  1P3B A;  5AY8 D;  3X1U C;  2F8N H;  5DNN D;  3KUY B;  3AV2 B;  5B1M C;  1P3A B;  5FUG A;  1P34 C;  4KGC C;  3AZJ B;  3AV1 D;  1ID3 A;  4KGC D;  1TAF B;  2Y2P A;  3AV1 B;  4WU9 D;  3MGP C;  3LEL C;  1P3O B;  3AZJ A;  4KGC B;  3C1B B;  2G5H C;  3FDD A;  5B40 C;  1P3A C;  1P3O D;  1M1A D;  4WJ3 C;  4DRB A;  3MGP D;  3AV2 C;  3LJA B;  2UWX A;  5B2J A;  4CSR A;  5GXQ D;  4H9N A;  5B32 B;  4JJN C;  3AZN A;  1M1A B;  1WWS A;  4H9O B;  5G49 A;  3AV1 C;  1P3G A;  5JA4 A;  3W99 B;  5B0Y B;  3AZE A;  2CV5 B;  5E5A D;  3KFU G;  4E45 A;  5CP6 C;  3AZN B;  5GSU D;  1A7W A;  3KXB C;  4LD9 D;  1KX3 A;  5AV6 D;  1P3F C;  1S32 A;  4KUD D;  5BNX B;  3AZG A;  4LD9 B;  3WTP A;  3REJ C;  5JRG A;  3A1K A;  3H0L C;  1F1E A;  2FJ7 D;  5CP6 A;  3MVD B;  2F8N K;  3MGR A;  3MGQ C;  3AYW C;  3B0C T;  3REI C;  3MVD D;  4H9R B;  5B2I D;  3X1T C;  1F66 D;  3C1B C;  5GT3 C;  1JFI B;  4G92 C;  5KDM B;  5B2I B;  4YS3 C;  5F99 A;  4Z66 B;  4ZUX A;  4Z2M H;  4XUJ C;  3MVD C;  1JFI A;  3KUY A;  5GT3 A; 
#chains in the Genus database with same CATH homology
 3X1S D;  1BH8 A;  3X1T A;  5GT0 D;  4YS3 B;  4CAY B;  1M19 B;  2FJ7 C;  3REI A;  3AZK B;  2Y2N A;  3X1S B;  1P3K B;  3AZF D;  3WKJ D;  2YFV A;  2Y2G A;  1BH8 B;  3KXB B;  3X1T B;  1KX5 D;  3MNN C;  3W98 A;  3AZF B;  2Y2J A;  1P34 D;  3WKJ B;  4G91 C;  3NQJ A;  3X1U A;  1KX5 B;  4XZQ C;  1P34 B;  1P3B D;  4J8V D;  5AY8 A;  2NZD A;  5DNN A;  4KHA B;  2Y2L A;  4JJN B;  1M18 A;  1R4V A;  1P3K C;  5C3I B;  4J8V B;  1ULY A;  3A1I A;  2RVQ C;  1TZY A;  1KX4 D;  4JJN D;  3AFA B;  3REH C;  5DNN B;  3AV2 D;  3A6N A;  5AVB A;  1KX4 B;  3W96 A;  2IO5 C;  3B6G B;  1P3A D;  2Y2H A;  5BNV A;  4WU9 A;  3MGS C;  3AZI B;  3AZJ D;  5B1M A;  4WU8 C;  1P3O A;  1HQ3 C;  4YM6 B;  5CPJ B;  3B6F C;  5B1L A;  3WAA C;  5G49 B;  1M19 C;  3C1B D;  3EPK A;  3WAA B;  3LZ1 A;  3REK B;  3KUY C;  2J8P A;  3MGS D;  4X23 B;  5AV8 A;  4YM6 A;  5CPJ A;  1P3G D;  1P3I D;  1P3L B;  3MGP B;  1P3O C;  3KWQ C;  5CPK B;  3VH6 W;  1P3M A;  3MGS B;  4X23 D;  3AZI C;  2ARO B;  1P3P C;  1EQZ A;  1P3I B;  2F8N A;  3MNN A;  1P3P B;  3W98 C;  3WA9 B;  5CPK D;  2JE5 A;  3X1V D;  2HIO C;  3AZG B;  3W97 B;  4LD9 A;  2ARO D;  3W99 D;  1P3L C;  3WA9 D;  4AWL B;  2Y2I A;  2CV5 D;  5B31 A;  3AZG D;  3W97 D;  4H9P B;  4WU8 D;  5AVC A;  2LY8 A;  3MGR B;  5AV5 A;  4XZQ D;  5B0Z A;  2PYO B;  2NQB A;  1M18 C;  4KUD B;  4HGA B;  4YS3 A;  3MGR D;  2NZD C;  4XZQ B;  2DQN C;  5B32 C;  3AN2 B;  2W8S A;  3MVD A;  2PYO A;  3AZF C;  3REH D;  3WKJ C;  4Z5T A;  5GXQ C;  3B6G C;  2HIO D;  3KXB A;  2RVQ D;  3EPL A;  3REL A;  3B0D C;  3AFA C;  3REH B;  3X1S C;  1F66 B;  3AZK C;  1ID3 B;  2BYK B;  5GSU C;  4CAY A;  2NZD B;  4HGA C;  3MGQ A;  2ZY5 A;  1M18 B;  2PYO C;  5GT0 A;  3O62 C;  1KX5 C;  3AZL D;  1U35 D;  3V9R B;  3AZF A;  3WKJ A;  3AZL B;  3UTB A;  5GT0 B;  3AZH C;  3LJA A;  4WNN A;  3W98 D;  5GT0 C;  3AZH B;  3AZK D;  1H3O B;  3AV1 A;  1P3G C;  3AZH D;  4KGC A;  4QLC C;  1TZY B;  2IO5 B;  3VH6 T;  1BFM A;  4H9Q B;  1TZY D;  1BH9 A;  1B6W A;  3W96 B;  1P3B B;  5B2J B;  4DRA A;  3WTP C;  5AVB D;  3MGP A;  3W96 D;  4H9Q A;  4J8W C;  1P3A A;  5B2J D;  4AWL C;  5JA4 B;  3AL0 C;  1T3U A;  3KWQ A;  3C1C A;  5AVB B;  1AOI C;  3AFA D;  4NE6 A;  4J8X B;  3W99 C;  3B6G D;  1TAF A;  4H9O A;  3KSY A;  3TU4 C;  4J8W A;  5CPK C;  4WZS B;  2HUE C;  1P3F D;  4J8U C;  4J8X A;  3AZI D;  5B40 D;  2RIQ A;  3LZ1 D;  5JRG B;  5KDM A;  5AV6 A;  1B67 A;  1P3B C;  2XD1 A;  3W96 C;  1P3F B;  4KUD A;  5CPJ D;  4YM6 D;  3TU4 A;  5BT1 D;  5JRG D;  3NQU A;  2F8N G;  5B33 B;  2VQR A;  4X23 A;  4J8U A;  3W97 C;  3VH5 T;  3WAA D;  2FJ7 A;  3LEL A;  3REK D;  3A6N C;  2L5A A;  5B24 D;  5CPK A;  2CV5 C;  2ZM5 A;  3H0R C;  1P3G B;  2ARO C;  1P3L D;  3W99 A;  4NE3 A;  1F66 C;  1M19 A;  3NQU B;  5AVC B;  1PZR A;  2JCH A;  5AV9 A;  5B33 C;  1HQ3 A;  3B6F A;  4X23 C;  1P3P D;  5B2I A;  3X1V B;  4WU8 A;  5DNN C;  5AVC D;  3P5J B;  4XZQ A;  4ZUX B;  5AV5 D;  2YFW B;  4NE5 A;  5B31 G;  1N1J A;  4Z2M G;  3R45 A;  3VH5 A;  4ZUX D;  5AV5 B;  4WU8 B;  4XUJ B;  2BYM B;  5B24 C;  3UTA A;  3WTP E;  3LZ0 A;  5GT3 D;  1AOI D;  2PYO D;  3REH A;  3X1S A;  4H9S C;  3UTB B;  4NFT A;  4G92 B;  5BO0 B;  5GT3 B;  1AOI B;  4XUJ A;  3REL D;  3AN2 D;  2BG1 A;  3REJ A;  2HIO B;  3F6T A;  3AZG C;  2JSS A;  1KX5 A;  3UTB C;  4R8P C;  4ZBJ B;  5B32 A;  3B0C W;  2YFV B;  1ID3 D;  5B32 G;  5AV5 C;  5B0Y A;  3AYW A;  1M1A C;  4J8V A;  3MGR C;  2NZD D;  4E44 A;  2FFF B;  1M18 D;  3REL C;  3AZK A;  4JJN A;  1U35 B;  4DQY B;  4H9N B;  1M1A A;  4WNN B;  3AV2 A;  4R8P A;  5BNV B;  3A6N D;  3WTP B;  3W98 B;  3WA9 C;  3EPJ A;  3AZM B;  1EQZ B;  3A6N B;  3AZM D;  5B1M D;  5B1L B;  3AZE D;  3AZM C;  3UTA C;  1ID3 C;  5B1L D;  3AZE B;  5AV8 B;  5DNM A;  4J8U B;  4UUZ A;  2HUE B;  2ZY2 A;  3C1C D;  3LEL B;  1U35 C;  4M6B A;  3MGS A;  1S32 D;  3O62 D;  5AV8 D;  1P3I A;  2F8N B;  2Y2K A;  5AV6 C;  5CP6 B;  4Z66 A;  3AZN C;  3B6G A;  1P3M D;  4G91 B;  3VH6 A;  4J8X C;  2CWE A;  4J8W D;  1S32 B;  3AZJ C;  2F8N D;  5CP6 D;  3X1V A;  4J8X D;  3AZI A;  1P3M B;  5B40 A;  3LZ1 C;  4J8W B;  2ARO A;  3UT9 D;  2ZY4 A;  5AV8 C;  2CV5 A;  5B31 D;  1P3K A;  3W97 A;  3TU4 D;  1F66 A;  1ZLA A;  5BS7 C;  1KU5 A;  5B40 B;  3X1V C;  3LZ1 B;  5B31 B;  3TU4 B;  2NQB D;  4QLC B;  1P3L A;  4Z66 C;  2Y2O A;  5F99 D;  3AN2 C;  5B33 D;  5AV9 D;  5AVB C;  5AY8 B;  4WU9 C;  3KUY D;  5B24 B;  2YFW A;  4QLC A;  1ZLA C;  5AV9 B;  4UPK A;  5CPI A;  2BYK A;  3UTA B;  3MGQ B;  5BS7 A;  2XD5 A;  5FUG B;  5B1L C;  3X1U B;  3UTA D;  2Y2M A;  3MGQ D;  5F99 C;  3R45 B;  4EO5 C;  4WU9 B;  5AY8 C;  3X1U D;  1P3I C;  3REJ B;  1BH9 B;  4XUJ D;  3AN2 A;  1U35 A;  3EPH A;  3EG5 B;  5DNM C;  5BO0 A;  3REJ D;  3AZL C;  3UTB D;  3REK C;  3LJA D;  1W2E A;  4KHA A;  5GXQ B;  5B32 D;  3UT9 C;  1KX4 A;  3REL B;  3AYW B;  3AZH A;  5B0Y D;  3AYW D;  1H3O A;  5E5A C;  4Z5T C;  5E5A B;  5GXQ A;  3AZN D;  5GSU B;  3NQJ B;  3LJA C;  4CSR B;  4R8P B;  5AV6 B;  3V9R A;  5E5A A;  1KX3 B;  4R8P D;  5GSU A;  2DF4 C;  1Q9C A;  4H9P A;  2ZY3 A;  5BNX A;  3C1B A;  3AZE C;  1KX3 D;  3KWQ D;  2FJ7 B;  4J8V C;  3AFA A;  5C3I C;  5B0Y C;  3H0M C;  3AZM A;  3WTP D;  3KWQ B;  1EQZ D;  3MNN D;  1S32 C;  1P3F A;  4ZUX C;  5DNM D;  5B1M B;  3VH5 W;  5BT1 C;  5JRG C;  3MNN B;  3WA9 A;  5B0Z C;  3O62 A;  5DNM B;  5B0Z B;  4UUZ B;  5AVC C;  4Z66 D;  4H9S A;  1HTA A;  1WWI A;  4J8U D;  3WAA A;  2NQB C;  3C1C B;  3LEL D;  5B0Z D;  3REK A;  5B24 A;  4EO5 B;  4WV4 B;  3O62 B;  3IP4 C;  4YS3 D;  2Y2Q A;  2F2A C;  3UT9 A;  4Z5T B;  1M19 D;  1KX4 C;  1EQZ C;  1P3K D;  1HQ3 D;  3B6F D;  1P3P A;  1ZLA D;  2G5I C;  4ZBJ C;  4Z5T D;  2HIO A;  5B2I C;  5B2J C;  3X1T D;  3KXB D;  4LD9 C;  1N1J B;  1HQ3 B;  4YM6 C;  3UT9 B;  5AV9 C;  5CPJ C;  3B0D B;  5CHL B;  3REI D;  1ZLA B;  3B6F B;  1KX3 C;  1P3M C;  3LZ0 B;  4H9R A;  1TZY C;  3REI B;  5B33 A;  5CPI C;  3LZ0 D;  5CPI B;  3C1C C;  1AOI A;  1P34 A;  2NQB B;  1Z2C B;  4QLC D;  2BYM A;  3LZ0 C;  5F99 B;  5B31 C;  4KUD C;  5CPI D;  3B0B A;  3AZL A;  1P3B A;  5AY8 D;  3X1U C;  2F8N H;  5DNN D;  3KUY B;  3AV2 B;  5B1M C;  1P3A B;  5FUG A;  1P34 C;  4KGC C;  3AZJ B;  3AV1 D;  1ID3 A;  4KGC D;  1TAF B;  2Y2P A;  3AV1 B;  4WU9 D;  3MGP C;  3LEL C;  1P3O B;  3AZJ A;  4KGC B;  3C1B B;  2G5H C;  3FDD A;  5B40 C;  1P3A C;  1P3O D;  1M1A D;  4WJ3 C;  4DRB A;  3MGP D;  3AV2 C;  3LJA B;  2UWX A;  5B2J A;  4CSR A;  5GXQ D;  4H9N A;  5B32 B;  4JJN C;  3AZN A;  1M1A B;  1WWS A;  4H9O B;  5G49 A;  3AV1 C;  1P3G A;  5JA4 A;  3W99 B;  5B0Y B;  3AZE A;  2CV5 B;  5E5A D;  3KFU G;  4E45 A;  5CP6 C;  3AZN B;  5GSU D;  1A7W A;  3KXB C;  4LD9 D;  1KX3 A;  5AV6 D;  1P3F C;  1S32 A;  4KUD D;  5BNX B;  3AZG A;  4LD9 B;  3WTP A;  3REJ C;  5JRG A;  3A1K A;  3H0L C;  1F1E A;  2FJ7 D;  5CP6 A;  3MVD B;  2F8N K;  3MGR A;  3MGQ C;  3AYW C;  3B0C T;  3REI C;  3MVD D;  4H9R B;  5B2I D;  3X1T C;  1F66 D;  3C1B C;  5GT3 C;  1JFI B;  4G92 C;  5KDM B;  5B2I B;  4YS3 C;  5F99 A;  4Z66 B;  4ZUX A;  4Z2M H;  4XUJ C;  3MVD C;  1JFI A;  3KUY A;  5GT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...