2AROD

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroD00
3UTBD 2BYKB 3X1VA 4EO5C 1F1EA 4YS3D 1M1AC 3X1VD 3REIB 2PYOB 4LD9C 4J8XC 3C1BD 4H9RB 5CPKA 2HUEC 5CPKD 5CP6C 5B0YB 5BS7C 3X1UA 1EQZB 4Z5TC 4X23C 1A7WA 3LZ0B 3UTAB 3REJB 3X1TA 5B1MD 4G92C 4Z66A 3MGSA 3VH6W 3AZEA 5B2JB 3X1UC 3MGSD 1P3GA 3KWQA 3AYWA 1WWSA 1P3GD 2NQBB 3AYWD 5CPJA 5AV6A 3X1TC 4WV4B 5CPJD 1KX5A 3AZLA 5AV6D 1P34D 4Z66C 1KX5D 3REHA 3MGSC 1KX3D 5KDMA 3V9RB 3AZEC 3REHD 3W98C 4KHAB 3KWQC 3AYWC 3B0CW 1AOIB 1P3FA 3RELA 2HIOB 1P3MA 1P3FD 3AZGB 5AV6C 5AV9B 5AV5A 5BNVB 1KX5C 3AZLC 4WU8B 3VH5W 5AV5D 3KXBB 5C3IB 5B32A 1KU5A 3B0BA 1P3IB 5B32D 1P3FC 3RELC 1P3PA 1P3MC 2BYMA 3W97A 4Z2MH 5AV5C 1S32A 5B24B 3W97D 4KUDB 3WKJD 5GT0A 1S32D 1B67A 1HQ3B 2NZDB 4WNNB 4XUJD 3AZND 3KUYB 1N1JA 5AVCB 1P3PC 2IO5C 3A6NB 3MGPA 5B40B 1U35D 1S32C 3O62B 3MGPD 4J8VB 5GT0C 1TZYB 5AY8D 3AZKB 3AV1A 5GT3D 1P3LC 5DNMA 1P3OB 2CV5A 5DNNA 2YFWB 1BH8A 2YFVA 3AV2B 2CV5D 3TU4B 5DNND 3LJAC 3MGPC 3REKA 4G91C 4R8PB 3MGQD 3AZMB 4CSRA 3AV1C 5DNMC 3W99B 1M19D 4H9NA 4XZQA 5CPIB 5GXQB 3AZFB 2F8NA 5B0ZB 5DNNC 2BYKA 2CWEA 3AZHC 2AROB 3REKC 2PYOA 4ZUXA 4H9RA 3VH6T 5B33B 5B2IB 4ZUXD 5B31D 3NQJB 5F99C 1EQZA 4XZQC 3LZ0A 3UTAA 3AZIC 1JFIA 3REJA 4KGCB 1BH9B 3REIC 3REJD 1R4VA 2PYOC 3KSYA 1P3BB 3AFAB 3B0CT 5B0YC 2L5AA 5B2JA 4LD9A 4J8UB 1EQZC 4LD9D 3LZ0C 4DRAA 3UTAC 3WTPE 5CP6D 4X23A 3REJC 3WA9B 3VH5T 4Z5TD 4X23D 3B6FB 4J8WB 5B2JC 1P3AB 3C1CB 4KHAA 1AOIA 3NQUB 2NQBC 5BO0B 5FUGB 3AN2B 5AV9A 3X1UD 3LELB 4WU8A 3W96B 3MNNB 3AZJB 3R45B 2F8NH 1KX4B 3KXBA 3MVDB 3X1SB 3X1TD 5BT1C 5E5AB 1AOIC 4Z66D 4E44A 2RVQC 5B31G 3W98A 3AZGC 3AZED 5AV9C 3W98D 4NFTA 3KWQD 4KUDA 4WU8C 3KXBC 2NZDA 4H9SA 4WNNA 5C3IC 1P3IC 5AV8B 3KUYA 3AZLD 5AVCA 5G49B 4ZBJB 2FJ7B 5B40A 5B24C 3O62A 3LZ1B 4J8VA 5B40D 4KUDC 1TZYA 3RELD 1HQ3C 3AZKA 1P3MD 1F66B 2NZDC 4H9SC 3MGRB 3KUYC 4M6BA 5AVCC 2YFWA 3AV2A 4HGAB 2LY8A 3TU4A 3UTBB 3A6NC 4QLCA 5GSUB 5B40C 4YS3B 3X1VB 4QLCD 3O62C 4J8VC 4R8PA 3AZMA 3C1BB 1TZYC 4Z2MG 4CAYA 5JA4B 4R8PD 4JJNB 3AZKC 3AZMD 1P3KB 5CPKB 1P3PD 1P3OC 5CPIA 5GXQA 3AZFA 5B0ZA 3AV2C 5CPID 1P3LA 5GT0D 4E45A 3TU4C 1P3LD 2AROA 4QLCC 1Q9CA 5B1MB 4DRBA 4R8PC 5B33A 5B2IA 3AZMC 3LJAA 5B33D 3NQJA 5B2ID 3LJAD 1M18B 3W99C 5CPIC 5GXQC 3AZFC 5B0ZC 1P3GB 3AV1D 4KGCA 1BH9A 2AROC 5DNMD 3UT9B 5CPJB 1P3BA 3AZHA 5B2IC 5B33C 3AFAA 1P34B 1P3BD 3AZHD 3AFAD 4J8UA 3REKD 1KX3B 3REHB 2F8NK 5F99A 3B6GB 3WA9A 5F99D 4KGCC 3AZIA 4XZQD 3B6FA 1P3BC 2F8ND 3AZID 3AFAC 3WAAB 3REIA 5B32G 1P3AA 3REID 4J8UC 2PYOD 1P3AD 5B0YA 5B32B 5BO0A 5FUGA 5B0YD 4H9QB 3WA9C 1ID3B 1EQZD 1ZLAB 3B6FC 3W97B 3LZ0D 3MNNA 3UTAD 4J8WC 3AZJA 3R45A 3WKJB 4NE5A 1KX4A 3MVDA 5B1LB 3X1SA 1P3AC 3C1CC 5E5AA 3MVDD 4XUJB 3AZNB 3WTPB 5BNXB 4AWLB 3AN2C 1N1JB 5B2JD 2NQBA 3LELC 4YM6B 1U35B 3W96C 2NQBD 3MNNC 3AZJC 1KX4C 3MVDC 5AY8B 3X1SC 5GT3B 5E5AC 5AV8A 5G49A 5AV8D 3V9RA 2FJ7A 2CV5B 1BH8B 5BT1D 2FJ7D 2HIOA 3LZ1A 1AOID 5AVBB 3AZGA 2HIOD 2RVQD 4H9OB 3MGQB 4WU9B 5BNVA 3AZGD 1F66A 5AV9D 1F66D 5AV8C 1M19B 2F8NG 4WU8D 1TAFB 4H9PB 3UTBA 4ZBJC 2FJ7C 1P3IA 3KXBD 5GSUA 4UUZB 4YS3A 2HIOC 3LZ1C 5GSUD 1P3ID 3C1BA 5JA4A 4JJNA 3B0DB 1P3KA 4ZUXB 1F66C 5B24A 5B31B 4JJND 1P3KD 3MGRC 5B24D 4KUDD 1HQ3A 4HGAC 1HQ3D 3UTBC 2NZDD 5GSUC 4YS3C 5B1MA 3X1VC 1H3OB 1JFIB 3KUYD 5JRGB 5AVCD 3A6NA 3C1BC 4JJNC 1P3KC 3A6ND 5CPKC 1M18A 4EO5B 3VH6A 1M1AB 1B6WA 1M18D 3O62D 4J8VD 4LD9B 4J8XB 1TZYD 1P3OA 3AZKD 2HUEB 5CP6B 3UT9A 1P3OD 5B1MC 4Z5TB 4X23B 3UT9D 3AV2D 1P34A 3TU4D 1M18C 1KX3A 4G92B 1ULYA 1P3GC 4NE3A 3W99A 3B6GA 3UT9C 3W99D 3X1UB 3B6GD 5GXQD 1WWIA 3AZFD 5CPJC 5B0ZD 1P34C 3WAAA 3VH5A 3WAAD 2AROD 1KX3C 3REHC 3X1TB 4Z66B 4H9QA 3B6GC 1ID3A 3MGSB 3AZEB 1ZLAA 1ID3D 3W98B 3KWQB 3AYWB 3WAAC 1ZLAD 3WKJA 4NE6A 5B1LA 4KGCD 5B1LD 4XUJA 5AV6B 3AZNA 1KX5B 5B32C 3AZLB 5BNXA 3WTPA 3WTPD 1ID3C 4J8UD 5KDMB 4YM6A 1ZLAC 1U35A 3W97C 4YM6D 1P3FB 3WKJC 3RELB 5B1LC 5AY8A 1P3MB 3WA9D 5GT3A 4XUJC 3AZNC 4J8WA 3B6FD 5AV5B 3WTPC 4AWLC 4J8WD 3C1CA 3NQUA 2JSSA 3C1CD 4YM6C 1U35C 5AVBA 4QLCB 4H9OA 3AN2A 3MGQA 4WU9A 5AVBD 5AY8C 4WU9D 3LELA 2IO5B 2BYMB 1HTAA 5GT3C 3AN2D 1P3PB 3W96A 1BFMA 4CAYB 3LELD 1M19A 1S32B 3W96D 1TAFA 4H9PA 3MNND 3AZJD 5GT0B 2CV5C 1KX4D 3X1SD 4UUZA 1P3LB 5E5AD 5AVBC 4WU9C 3MGQC 5B31A 3LJAB 3MGPB 1M19C 4G91B 5CHLB 3AV1B 5DNMB 1H3OA 5JRGA 5DNNB 5JRGD 3B0DC 2YFVB 4ZUXC 3AZHB 5B31C 1M1AA 3LZ1D 3REKB 1M1AD 4J8XA 4J8XD 4CSRB 3MGRA 5CP6A 5BS7A 4WZSB 5F99B 3MGRD 4Z5TA 5JRGC 4H9NB 4XZQB 2F8NB 3AZIB
chains in the Genus database with same CATH superfamily
3UTBD 2BYKB 2DQNC 3X1VA 4EO5C 1F1EA 4YS3D 1M1AC 3X1VD 3REIB 2PYOB 4LD9C 4J8XC 3C1BD 4H9RB 5CPKA 2HUEC 5CPKD 3A1IA 5CP6C 5B0YB 5BS7C 3X1UA 1EQZB 4Z5TC 4X23C 1A7WA 3LZ0B 3UTAB 3REJB 3X1TA 5B1MD 4G92C 4Z66A 2FFFB 3MGSA 3VH6W 3AZEA 5B2JB 3X1UC 3MGSD 1P3GA 3KWQA 3AYWA 1WWSA 1P3GD 2NQBB 3AYWD 3A1KA 5CPJA 5AV6A 3X1TC 4WV4B 5CPJD 1KX5A 3AZLA 5AV6D 1P34D 4Z66C 1KX5D 3H0RC 3REHA 3MGSC 1KX3D 5KDMA 3V9RB 3AZEC 3REHD 3W98C 4KHAB 3KWQC 3AYWC 3B0CW 1AOIB 1P3FA 3RELA 2HIOB 1P3MA 1P3FD 3AZGB 4DQYB 5AV6C 5AV9B 5AV5A 5BNVB 1KX5C 3AZLC 4WU8B 3VH5W 5AV5D 3KXBB 5C3IB 5B32A 1KU5A 3B0BA 1P3IB 5B32D 1P3FC 3RELC 1P3PA 1P3MC 2BYMA 2Y2HA 3W97A 4Z2MH 5AV5C 1S32A 5B24B 3W97D 4KUDB 3WKJD 5GT0A 1S32D 1B67A 1HQ3B 2NZDB 4WNNB 3EPHA 4XUJD 3AZND 3KUYB 1N1JA 2Y2LA 5AVCB 1P3PC 2IO5C 3A6NB 3MGPA 5B40B 1U35D 1S32C 3O62B 3MGPD 4J8VB 5GT0C 1TZYB 5AY8D 3AZKB 3AV1A 5GT3D 1P3LC 5DNMA 2Y2KA 1P3OB 2J8PA 2CV5A 5DNNA 2YFWB 1BH8A 2YFVA 3AV2B 2CV5D 3TU4B 5DNND 3LJAC 3MGPC 3REKA 3KFUG 4G91C 4R8PB 3MGQD 3AZMB 4CSRA 3AV1C 5DNMC 3W99B 1M19D 4H9NA 4XZQA 5CPIB 5GXQB 3AZFB 2F8NA 5B0ZB 5DNNC 2XD1A 2BYKA 2CWEA 3AZHC 1T3UA 2AROB 3REKC 2PYOA 4ZUXA 4H9RA 3VH6T 5B33B 5B2IB 4ZUXD 5B31D 3NQJB 5F99C 1EQZA 2VQRA 4XZQC 3LZ0A 3UTAA 3AZIC 1JFIA 3REJA 4KGCB 1BH9B 3REIC 3REJD 1R4VA 2PYOC 3KSYA 1P3BB 2XD5A 3AFAB 3B0CT 5B0YC 2L5AA 5B2JA 4LD9A 2Y2IA 4J8UB 1EQZC 4LD9D 3LZ0C 4DRAA 3UTAC 2ZM5A 3WTPE 5CP6D 4X23A 3REJC 3WA9B 3VH5T 4Z5TD 4X23D 3H0LC 3B6FB 4J8WB 2Y2JA 5B2JC 1P3AB 3C1CB 4KHAA 1AOIA 3NQUB 1W2EA 2NQBC 5BO0B 5FUGB 3AN2B 5AV9A 3X1UD 3LELB 4WU8A 3W96B 3MNNB 3H0MC 3AZJB 3R45B 2F8NH 3EPJA 3KXBA 3MVDB 1KX4B 2BG1A 3X1SB 3X1TD 2ZY3A 5BT1C 5E5AB 1AOIC 2Y2QA 4Z66D 4E44A 2RVQC 5B31G 3W98A 3AZGC 3AZED 5AV9C 3W98D 4NFTA 3KWQD 4KUDA 4WU8C 3KXBC 2NZDA 4H9SA 4WNNA 5C3IC 1P3IC 5AV8B 3KUYA 3AZLD 3IP4C 5AVCA 5G49B 4ZBJB 2FJ7B 5B40A 5B24C 1PZRA 3O62A 2ZY5A 5B40D 3LZ1B 4J8VA 4KUDC 1TZYA 3RELD 1HQ3C 3AZKA 1P3MD 1F66B 2NZDC 4H9SC 3MGRB 3KUYC 4M6BA 5AVCC 2YFWA 3AV2A 4HGAB 2LY8A 3TU4A 3UTBB 3A6NC 4QLCA 5GSUB 5B40C 4YS3B 3X1VB 4QLCD 3O62C 4J8VC 4R8PA 3AZMA 3C1BB 1TZYC 4Z2MG 4CAYA 5JA4B 4R8PD 4JJNB 3AZKC 3AZMD 1P3KB 5CPKB 1P3PD 1P3OC 5CPIA 5GXQA 3AZFA 5B0ZA 3AV2C 5CPID 1P3LA 5GT0D 4E45A 2Y2MA 3TU4C 1P3LD 2AROA 4QLCC 1Q9CA 5B1MB 4DRBA 4R8PC 5B33A 5B2IA 3AZMC 3LJAA 5B2ID 3NQJA 5B33D 3LJAD 2RIQA 1M18B 3W99C 5CPIC 5GXQC 3AZFC 5B0ZC 1P3GB 3AV1D 4KGCA 1BH9A 2AROC 5DNMD 3UT9B 5CPJB 1P3BA 3AZHA 5B2IC 5B33C 3AFAA 1P34B 2JE5A 3AZHD 1P3BD 3AFAD 4J8UA 3REKD 1KX3B 3REHB 2F8NK 5F99A 3B6GB 3WA9A 5F99D 4KGCC 3AZIA 4XZQD 3B6FA 1P3BC 2F8ND 3AZID 4WJ3C 3AFAC 3WAAB 3REIA 2F2AC 5B32G 1P3AA 3REID 4J8UC 2PYOD 1P3AD 5B0YA 5B32B 5BO0A 5FUGA 5B0YD 4H9QB 3WA9C 1ID3B 1EQZD 1ZLAB 3B6FC 3W97B 3LZ0D 3MNNA 3UTAD 4J8WC 3AZJA 3R45A 3WKJB 4NE5A 1KX4A 3MVDA 5B1LB 3X1SA 1P3AC 3C1CC 5E5AA 3MVDD 4XUJB 3AZNB 3WTPB 5BNXB 4AWLB 3AN2C 1N1JB 5B2JD 2NQBA 3LELC 4YM6B 1U35B 3W96C 2NQBD 3MNNC 3AZJC 1KX4C 3MVDC 5AY8B 3X1SC 5GT3B 5E5AC 5AV8A 5G49A 5AV8D 3V9RA 2FJ7A 2ZY2A 2CV5B 1BH8B 5BT1D 2FJ7D 2HIOA 3LZ1A 1AOID 5AVBB 3AZGA 2HIOD 2RVQD 4H9OB 3MGQB 4WU9B 5BNVA 3AZGD 1F66A 5AV9D 1Z2CB 2G5HC 1F66D 5AV8C 1M19B 2F8NG 4WU8D 3EPLA 1TAFB 4H9PB 3UTBA 4ZBJC 2FJ7C 1P3IA 3KXBD 5GSUA 4UUZB 4YS3A 2HIOC 3LZ1C 5GSUD 1P3ID 3C1BA 5JA4A 4JJNA 3B0DB 1P3KA 4ZUXB 1F66C 5B24A 5B31B 4JJND 1P3KD 3MGRC 5B24D 4KUDD 1HQ3A 2UWXA 4HGAC 1HQ3D 3UTBC 2NZDD 5GSUC 4YS3C 5B1MA 3X1VC 1H3OB 1JFIB 3KUYD 5JRGB 5AVCD 3A6NA 3C1BC 4JJNC 1P3KC 3A6ND 5CPKC 1M18A 3P5JB 4EO5B 3VH6A 1M1AB 1B6WA 1M18D 3O62D 4J8VD 4LD9B 4J8XB 1TZYD 1P3OA 3AZKD 2DF4C 3AL0C 2HUEB 3FDDA 5CP6B 3UT9A 1P3OD 3EPKA 5B1MC 4Z5TB 4X23B 3UT9D 3AV2D 1P34A 3TU4D 2ZY4A 1M18C 2Y2OA 1KX3A 4G92B 1ULYA 1P3GC 4NE3A 3W99A 3B6GA 3UT9C 3W99D 3X1UB 3B6GD 2Y2GA 1WWIA 5GXQD 3AZFD 5B0ZD 2Y2PA 5CPJC 1P34C 3WAAA 3VH5A 3WAAD 2AROD 1KX3C 3REHC 3X1TB 2Y2NA 4Z66B 4H9QA 3B6GC 1ID3A 3MGSB 3AZEB 1ZLAA 1ID3D 3W98B 3KWQB 3AYWB 2G5IC 3WAAC 1ZLAD 3WKJA 4NE6A 5B1LA 4KGCD 5B1LD 4XUJA 5AV6B 3AZNA 1KX5B 5B32C 3AZLB 5BNXA 3WTPA 3WTPD 1ID3C 4J8UD 5KDMB 4YM6A 1ZLAC 1U35A 3W97C 2W8SA 4YM6D 1P3FB 3WKJC 3RELB 5B1LC 5AY8A 1P3MB 3F6TA 5GT3A 3WA9D 4XUJC 3AZNC 4J8WA 3B6FD 5AV5B 3WTPC 4AWLC 4J8WD 3C1CA 3NQUA 2JSSA 3C1CD 4YM6C 1U35C 5AVBA 4QLCB 4H9OA 3AN2A 3MGQA 4WU9A 5AVBD 5AY8C 4WU9D 3LELA 2IO5B 2BYMB 1HTAA 5GT3C 3AN2D 1P3PB 3W96A 1BFMA 4CAYB 3LELD 1M19A 1S32B 3W96D 1TAFA 4H9PA 3MNND 3AZJD 5GT0B 2CV5C 1KX4D 3X1SD 4UUZA 1P3LB 5E5AD 5AVBC 4WU9C 3MGQC 5B31A 3LJAB 3MGPB 1M19C 4G91B 5CHLB 4UPKA 3EG5B 3AV1B 5DNMB 1H3OA 5JRGA 2JCHA 5DNNB 5JRGD 3B0DC 2YFVB 4ZUXC 3AZHB 5B31C 1M1AA 3LZ1D 3REKB 1M1AD 4J8XA 4J8XD 4CSRB 3MGRA 5CP6A 5BS7A 4WZSB 5F99B 3MGRD 4Z5TA 5JRGC 4H9NB 4XZQB 2F8NB 3AZIB
chains in the Genus database with same CATH topology
3UTBD 2BYKB 2DQNC 3X1VA 4EO5C 1F1EA 4YS3D 1M1AC 3X1VD 3REIB 2PYOB 4LD9C 4J8XC 3C1BD 4H9RB 5CPKA 2HUEC 5CPKD 3A1IA 5CP6C 5B0YB 5BS7C 3X1UA 1EQZB 4Z5TC 4X23C 1A7WA 3LZ0B 3UTAB 3REJB 3X1TA 5B1MD 4G92C 4Z66A 2FFFB 3MGSA 3VH6W 3AZEA 5B2JB 3X1UC 3MGSD 1P3GA 3KWQA 3AYWA 1WWSA 1P3GD 2NQBB 3AYWD 3A1KA 5CPJA 5AV6A 3X1TC 4WV4B 5CPJD 1KX5A 3AZLA 5AV6D 1P34D 4Z66C 1KX5D 3H0RC 3REHA 3MGSC 1KX3D 5KDMA 3V9RB 3AZEC 3REHD 3W98C 4KHAB 3KWQC 3AYWC 3B0CW 1AOIB 1P3FA 3RELA 2HIOB 1P3MA 1P3FD 3AZGB 4DQYB 5AV6C 5AV9B 5AV5A 5BNVB 1KX5C 3AZLC 4WU8B 3VH5W 5AV5D 3KXBB 5C3IB 5B32A 1KU5A 3B0BA 1P3IB 5B32D 1P3FC 3RELC 1P3PA 1P3MC 2BYMA 2Y2HA 3W97A 4Z2MH 5AV5C 1S32A 5B24B 3W97D 4KUDB 3WKJD 5GT0A 1S32D 1B67A 1HQ3B 2NZDB 4WNNB 3EPHA 4XUJD 3AZND 3KUYB 1N1JA 2Y2LA 5AVCB 1P3PC 2IO5C 3A6NB 3MGPA 5B40B 1U35D 1S32C 3O62B 3MGPD 4J8VB 5GT0C 1TZYB 5AY8D 3AZKB 3AV1A 5GT3D 1P3LC 5DNMA 2Y2KA 1P3OB 2J8PA 2CV5A 5DNNA 2YFWB 1BH8A 2YFVA 3AV2B 2CV5D 3TU4B 5DNND 3LJAC 3MGPC 3REKA 3KFUG 4G91C 4R8PB 3MGQD 3AZMB 4CSRA 3AV1C 5DNMC 3W99B 1M19D 4H9NA 4XZQA 5CPIB 5GXQB 3AZFB 2F8NA 5B0ZB 5DNNC 2XD1A 2BYKA 2CWEA 3AZHC 1T3UA 2AROB 3REKC 2PYOA 4ZUXA 4H9RA 3VH6T 5B33B 5B2IB 4ZUXD 5B31D 3NQJB 5F99C 1EQZA 2VQRA 4XZQC 3LZ0A 3UTAA 3AZIC 1JFIA 3REJA 4KGCB 1BH9B 3REIC 3REJD 1R4VA 2PYOC 3KSYA 1P3BB 2XD5A 3AFAB 3B0CT 5B0YC 2L5AA 5B2JA 4LD9A 2Y2IA 4J8UB 1EQZC 4LD9D 3LZ0C 4DRAA 3UTAC 2ZM5A 3WTPE 5CP6D 4X23A 3REJC 3WA9B 3VH5T 4Z5TD 4X23D 3H0LC 3B6FB 4J8WB 2Y2JA 5B2JC 1P3AB 3C1CB 4KHAA 1AOIA 3NQUB 1W2EA 2NQBC 5BO0B 5FUGB 3AN2B 5AV9A 3X1UD 3LELB 4WU8A 3W96B 3MNNB 3H0MC 3AZJB 3R45B 2F8NH 3EPJA 3KXBA 3MVDB 1KX4B 2BG1A 3X1SB 3X1TD 2ZY3A 5BT1C 5E5AB 1AOIC 2Y2QA 4Z66D 4E44A 2RVQC 5B31G 3W98A 3AZGC 3AZED 5AV9C 3W98D 4NFTA 3KWQD 4KUDA 4WU8C 3KXBC 2NZDA 4H9SA 4WNNA 5C3IC 1P3IC 5AV8B 3KUYA 3AZLD 3IP4C 5AVCA 5G49B 4ZBJB 2FJ7B 5B40A 5B24C 1PZRA 3O62A 2ZY5A 5B40D 3LZ1B 4J8VA 4KUDC 1TZYA 3RELD 1HQ3C 3AZKA 1P3MD 1F66B 2NZDC 4H9SC 3MGRB 3KUYC 4M6BA 5AVCC 2YFWA 3AV2A 4HGAB 2LY8A 3TU4A 3UTBB 3A6NC 4QLCA 5GSUB 5B40C 4YS3B 3X1VB 4QLCD 3O62C 4J8VC 4R8PA 3AZMA 3C1BB 1TZYC 4Z2MG 4CAYA 5JA4B 4R8PD 4JJNB 3AZKC 3AZMD 1P3KB 5CPKB 1P3PD 1P3OC 5CPIA 5GXQA 3AZFA 5B0ZA 3AV2C 5CPID 1P3LA 5GT0D 4E45A 2Y2MA 3TU4C 1P3LD 2AROA 4QLCC 1Q9CA 5B1MB 4DRBA 4R8PC 5B33A 5B2IA 3AZMC 3LJAA 5B2ID 3NQJA 5B33D 3LJAD 2RIQA 1M18B 3W99C 5CPIC 5GXQC 3AZFC 5B0ZC 1P3GB 3AV1D 4KGCA 1BH9A 2AROC 5DNMD 3UT9B 5CPJB 1P3BA 3AZHA 5B2IC 5B33C 3AFAA 1P34B 2JE5A 3AZHD 1P3BD 3AFAD 4J8UA 3REKD 1KX3B 3REHB 2F8NK 5F99A 3B6GB 3WA9A 5F99D 4KGCC 3AZIA 4XZQD 3B6FA 1P3BC 2F8ND 3AZID 4WJ3C 3AFAC 3WAAB 3REIA 2F2AC 5B32G 1P3AA 3REID 4J8UC 2PYOD 1P3AD 5B0YA 5B32B 5BO0A 5FUGA 5B0YD 4H9QB 3WA9C 1ID3B 1EQZD 1ZLAB 3B6FC 3W97B 3LZ0D 3MNNA 3UTAD 4J8WC 3AZJA 3R45A 3WKJB 4NE5A 1KX4A 3MVDA 5B1LB 3X1SA 1P3AC 3C1CC 5E5AA 3MVDD 4XUJB 3AZNB 3WTPB 5BNXB 4AWLB 3AN2C 1N1JB 5B2JD 2NQBA 3LELC 4YM6B 1U35B 3W96C 2NQBD 3MNNC 3AZJC 1KX4C 3MVDC 5AY8B 3X1SC 5GT3B 5E5AC 5AV8A 5G49A 5AV8D 3V9RA 2FJ7A 2ZY2A 2CV5B 1BH8B 5BT1D 2FJ7D 2HIOA 3LZ1A 1AOID 5AVBB 3AZGA 2HIOD 2RVQD 4H9OB 3MGQB 4WU9B 5BNVA 3AZGD 1F66A 5AV9D 1Z2CB 2G5HC 1F66D 5AV8C 1M19B 2F8NG 4WU8D 3EPLA 1TAFB 4H9PB 3UTBA 4ZBJC 2FJ7C 1P3IA 3KXBD 5GSUA 4UUZB 4YS3A 2HIOC 3LZ1C 5GSUD 1P3ID 3C1BA 5JA4A 4JJNA 3B0DB 1P3KA 4ZUXB 1F66C 5B24A 5B31B 4JJND 1P3KD 3MGRC 5B24D 4KUDD 1HQ3A 2UWXA 4HGAC 1HQ3D 3UTBC 2NZDD 5GSUC 4YS3C 5B1MA 3X1VC 1H3OB 1JFIB 3KUYD 5JRGB 5AVCD 3A6NA 3C1BC 4JJNC 1P3KC 3A6ND 5CPKC 1M18A 3P5JB 4EO5B 3VH6A 1M1AB 1B6WA 1M18D 3O62D 4J8VD 4LD9B 4J8XB 1TZYD 1P3OA 3AZKD 2DF4C 3AL0C 2HUEB 3FDDA 5CP6B 3UT9A 1P3OD 3EPKA 5B1MC 4Z5TB 4X23B 3UT9D 3AV2D 1P34A 3TU4D 2ZY4A 1M18C 2Y2OA 1KX3A 4G92B 1ULYA 1P3GC 4NE3A 3W99A 3B6GA 3UT9C 3W99D 3X1UB 3B6GD 2Y2GA 1WWIA 5GXQD 3AZFD 5B0ZD 2Y2PA 5CPJC 1P34C 3WAAA 3VH5A 3WAAD 2AROD 1KX3C 3REHC 3X1TB 2Y2NA 4Z66B 4H9QA 3B6GC 1ID3A 3MGSB 3AZEB 1ZLAA 1ID3D 3W98B 3KWQB 3AYWB 2G5IC 3WAAC 1ZLAD 3WKJA 4NE6A 5B1LA 4KGCD 5B1LD 4XUJA 5AV6B 3AZNA 1KX5B 5B32C 3AZLB 5BNXA 3WTPA 3WTPD 1ID3C 4J8UD 5KDMB 4YM6A 1ZLAC 1U35A 3W97C 2W8SA 4YM6D 1P3FB 3WKJC 3RELB 5B1LC 5AY8A 1P3MB 3F6TA 5GT3A 3WA9D 4XUJC 3AZNC 4J8WA 3B6FD 5AV5B 3WTPC 4AWLC 4J8WD 3C1CA 3NQUA 2JSSA 3C1CD 4YM6C 1U35C 5AVBA 4QLCB 4H9OA 3AN2A 3MGQA 4WU9A 5AVBD 5AY8C 4WU9D 3LELA 2IO5B 2BYMB 1HTAA 5GT3C 3AN2D 1P3PB 3W96A 1BFMA 4CAYB 3LELD 1M19A 1S32B 3W96D 1TAFA 4H9PA 3MNND 3AZJD 5GT0B 2CV5C 1KX4D 3X1SD 4UUZA 1P3LB 5E5AD 5AVBC 4WU9C 3MGQC 5B31A 3LJAB 3MGPB 1M19C 4G91B 5CHLB 4UPKA 3EG5B 3AV1B 5DNMB 1H3OA 5JRGA 2JCHA 5DNNB 5JRGD 3B0DC 2YFVB 4ZUXC 3AZHB 5B31C 1M1AA 3LZ1D 3REKB 1M1AD 4J8XA 4J8XD 4CSRB 3MGRA 5CP6A 5BS7A 4WZSB 5F99B 3MGRD 4Z5TA 5JRGC 4H9NB 4XZQB 2F8NB 3AZIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB D;  2BYK B;  3X1V A;  4EO5 C;  1F1E A;  4YS3 D;  1M1A C;  3X1V D;  3REI B;  2PYO B;  4LD9 C;  4J8X C;  3C1B D;  4H9R B;  5CPK A;  2HUE C;  5CPK D;  5CP6 C;  5B0Y B;  5BS7 C;  3X1U A;  1EQZ B;  4Z5T C;  4X23 C;  1A7W A;  3LZ0 B;  3UTA B;  3REJ B;  3X1T A;  5B1M D;  4G92 C;  4Z66 A;  3MGS A;  3VH6 W;  3AZE A;  5B2J B;  3X1U C;  3MGS D;  1P3G A;  3KWQ A;  3AYW A;  1WWS A;  1P3G D;  2NQB B;  3AYW D;  5CPJ A;  5AV6 A;  3X1T C;  4WV4 B;  5CPJ D;  1KX5 A;  3AZL A;  5AV6 D;  1P34 D;  4Z66 C;  1KX5 D;  3REH A;  3MGS C;  1KX3 D;  5KDM A;  3V9R B;  3AZE C;  3REH D;  3W98 C;  4KHA B;  3KWQ C;  3AYW C;  3B0C W;  1AOI B;  1P3F A;  3REL A;  2HIO B;  1P3M A;  1P3F D;  3AZG B;  5AV6 C;  5AV9 B;  5AV5 A;  5BNV B;  1KX5 C;  3AZL C;  4WU8 B;  3VH5 W;  5AV5 D;  3KXB B;  5C3I B;  5B32 A;  1KU5 A;  3B0B A;  1P3I B;  5B32 D;  1P3F C;  3REL C;  1P3P A;  1P3M C;  2BYM A;  3W97 A;  4Z2M H;  5AV5 C;  1S32 A;  5B24 B;  3W97 D;  4KUD B;  3WKJ D;  5GT0 A;  1S32 D;  1B67 A;  1HQ3 B;  2NZD B;  4WNN B;  4XUJ D;  3AZN D;  3KUY B;  1N1J A;  5AVC B;  1P3P C;  2IO5 C;  3A6N B;  3MGP A;  5B40 B;  1U35 D;  1S32 C;  3O62 B;  3MGP D;  4J8V B;  5GT0 C;  1TZY B;  5AY8 D;  3AZK B;  3AV1 A;  5GT3 D;  1P3L C;  5DNM A;  1P3O B;  2CV5 A;  5DNN A;  2YFW B;  1BH8 A;  2YFV A;  3AV2 B;  2CV5 D;  3TU4 B;  5DNN D;  3LJA C;  3MGP C;  3REK A;  4G91 C;  4R8P B;  3MGQ D;  3AZM B;  4CSR A;  3AV1 C;  5DNM C;  3W99 B;  1M19 D;  4H9N A;  4XZQ A;  5CPI B;  5GXQ B;  3AZF B;  2F8N A;  5B0Z B;  5DNN C;  2BYK A;  2CWE A;  3AZH C;  2ARO B;  3REK C;  2PYO A;  4ZUX A;  4H9R A;  3VH6 T;  5B33 B;  5B2I B;  4ZUX D;  5B31 D;  3NQJ B;  5F99 C;  1EQZ A;  4XZQ C;  3LZ0 A;  3UTA A;  3AZI C;  1JFI A;  3REJ A;  4KGC B;  1BH9 B;  3REI C;  3REJ D;  1R4V A;  2PYO C;  3KSY A;  1P3B B;  3AFA B;  3B0C T;  5B0Y C;  2L5A A;  5B2J A;  4LD9 A;  4J8U B;  1EQZ C;  4LD9 D;  3LZ0 C;  4DRA A;  3UTA C;  3WTP E;  5CP6 D;  4X23 A;  3REJ C;  3WA9 B;  3VH5 T;  4Z5T D;  4X23 D;  3B6F B;  4J8W B;  5B2J C;  1P3A B;  3C1C B;  4KHA A;  1AOI A;  3NQU B;  2NQB C;  5BO0 B;  5FUG B;  3AN2 B;  5AV9 A;  3X1U D;  3LEL B;  4WU8 A;  3W96 B;  3MNN B;  3AZJ B;  3R45 B;  2F8N H;  1KX4 B;  3KXB A;  3MVD B;  3X1S B;  3X1T D;  5BT1 C;  5E5A B;  1AOI C;  4Z66 D;  4E44 A;  2RVQ C;  5B31 G;  3W98 A;  3AZG C;  3AZE D;  5AV9 C;  3W98 D;  4NFT A;  3KWQ D;  4KUD A;  4WU8 C;  3KXB C;  2NZD A;  4H9S A;  4WNN A;  5C3I C;  1P3I C;  5AV8 B;  3KUY A;  3AZL D;  5AVC A;  5G49 B;  4ZBJ B;  2FJ7 B;  5B40 A;  5B24 C;  3O62 A;  3LZ1 B;  4J8V A;  5B40 D;  4KUD C;  1TZY A;  3REL D;  1HQ3 C;  3AZK A;  1P3M D;  1F66 B;  2NZD C;  4H9S C;  3MGR B;  3KUY C;  4M6B A;  5AVC C;  2YFW A;  3AV2 A;  4HGA B;  2LY8 A;  3TU4 A;  3UTB B;  3A6N C;  4QLC A;  5GSU B;  5B40 C;  4YS3 B;  3X1V B;  4QLC D;  3O62 C;  4J8V C;  4R8P A;  3AZM A;  3C1B B;  1TZY C;  4Z2M G;  4CAY A;  5JA4 B;  4R8P D;  4JJN B;  3AZK C;  3AZM D;  1P3K B;  5CPK B;  1P3P D;  1P3O C;  5CPI A;  5GXQ A;  3AZF A;  5B0Z A;  3AV2 C;  5CPI D;  1P3L A;  5GT0 D;  4E45 A;  3TU4 C;  1P3L D;  2ARO A;  4QLC C;  1Q9C A;  5B1M B;  4DRB A;  4R8P C;  5B33 A;  5B2I A;  3AZM C;  3LJA A;  5B33 D;  3NQJ A;  5B2I D;  3LJA D;  1M18 B;  3W99 C;  5CPI C;  5GXQ C;  3AZF C;  5B0Z C;  1P3G B;  3AV1 D;  4KGC A;  1BH9 A;  2ARO C;  5DNM D;  3UT9 B;  5CPJ B;  1P3B A;  3AZH A;  5B2I C;  5B33 C;  3AFA A;  1P34 B;  1P3B D;  3AZH D;  3AFA D;  4J8U A;  3REK D;  1KX3 B;  3REH B;  2F8N K;  5F99 A;  3B6G B;  3WA9 A;  5F99 D;  4KGC C;  3AZI A;  4XZQ D;  3B6F A;  1P3B C;  2F8N D;  3AZI D;  3AFA C;  3WAA B;  3REI A;  5B32 G;  1P3A A;  3REI D;  4J8U C;  2PYO D;  1P3A D;  5B0Y A;  5B32 B;  5BO0 A;  5FUG A;  5B0Y D;  4H9Q B;  3WA9 C;  1ID3 B;  1EQZ D;  1ZLA B;  3B6F C;  3W97 B;  3LZ0 D;  3MNN A;  3UTA D;  4J8W C;  3AZJ A;  3R45 A;  3WKJ B;  4NE5 A;  1KX4 A;  3MVD A;  5B1L B;  3X1S A;  1P3A C;  3C1C C;  5E5A A;  3MVD D;  4XUJ B;  3AZN B;  3WTP B;  5BNX B;  4AWL B;  3AN2 C;  1N1J B;  5B2J D;  2NQB A;  3LEL C;  4YM6 B;  1U35 B;  3W96 C;  2NQB D;  3MNN C;  3AZJ C;  1KX4 C;  3MVD C;  5AY8 B;  3X1S C;  5GT3 B;  5E5A C;  5AV8 A;  5G49 A;  5AV8 D;  3V9R A;  2FJ7 A;  2CV5 B;  1BH8 B;  5BT1 D;  2FJ7 D;  2HIO A;  3LZ1 A;  1AOI D;  5AVB B;  3AZG A;  2HIO D;  2RVQ D;  4H9O B;  3MGQ B;  4WU9 B;  5BNV A;  3AZG D;  1F66 A;  5AV9 D;  1F66 D;  5AV8 C;  1M19 B;  2F8N G;  4WU8 D;  1TAF B;  4H9P B;  3UTB A;  4ZBJ C;  2FJ7 C;  1P3I A;  3KXB D;  5GSU A;  4UUZ B;  4YS3 A;  2HIO C;  3LZ1 C;  5GSU D;  1P3I D;  3C1B A;  5JA4 A;  4JJN A;  3B0D B;  1P3K A;  4ZUX B;  1F66 C;  5B24 A;  5B31 B;  4JJN D;  1P3K D;  3MGR C;  5B24 D;  4KUD D;  1HQ3 A;  4HGA C;  1HQ3 D;  3UTB C;  2NZD D;  5GSU C;  4YS3 C;  5B1M A;  3X1V C;  1H3O B;  1JFI B;  3KUY D;  5JRG B;  5AVC D;  3A6N A;  3C1B C;  4JJN C;  1P3K C;  3A6N D;  5CPK C;  1M18 A;  4EO5 B;  3VH6 A;  1M1A B;  1B6W A;  1M18 D;  3O62 D;  4J8V D;  4LD9 B;  4J8X B;  1TZY D;  1P3O A;  3AZK D;  2HUE B;  5CP6 B;  3UT9 A;  1P3O D;  5B1M C;  4Z5T B;  4X23 B;  3UT9 D;  3AV2 D;  1P34 A;  3TU4 D;  1M18 C;  1KX3 A;  4G92 B;  1ULY A;  1P3G C;  4NE3 A;  3W99 A;  3B6G A;  3UT9 C;  3W99 D;  3X1U B;  3B6G D;  5GXQ D;  1WWI A;  3AZF D;  5CPJ C;  5B0Z D;  1P34 C;  3WAA A;  3VH5 A;  3WAA D;  2ARO D;  1KX3 C;  3REH C;  3X1T B;  4Z66 B;  4H9Q A;  3B6G C;  1ID3 A;  3MGS B;  3AZE B;  1ZLA A;  1ID3 D;  3W98 B;  3KWQ B;  3AYW B;  3WAA C;  1ZLA D;  3WKJ A;  4NE6 A;  5B1L A;  4KGC D;  5B1L D;  4XUJ A;  5AV6 B;  3AZN A;  1KX5 B;  5B32 C;  3AZL B;  5BNX A;  3WTP A;  3WTP D;  1ID3 C;  4J8U D;  5KDM B;  4YM6 A;  1ZLA C;  1U35 A;  3W97 C;  4YM6 D;  1P3F B;  3WKJ C;  3REL B;  5B1L C;  5AY8 A;  1P3M B;  3WA9 D;  5GT3 A;  4XUJ C;  3AZN C;  4J8W A;  3B6F D;  5AV5 B;  3WTP C;  4AWL C;  4J8W D;  3C1C A;  3NQU A;  2JSS A;  3C1C D;  4YM6 C;  1U35 C;  5AVB A;  4QLC B;  4H9O A;  3AN2 A;  3MGQ A;  4WU9 A;  5AVB D;  5AY8 C;  4WU9 D;  3LEL A;  2IO5 B;  2BYM B;  1HTA A;  5GT3 C;  3AN2 D;  1P3P B;  3W96 A;  1BFM A;  4CAY B;  3LEL D;  1M19 A;  1S32 B;  3W96 D;  1TAF A;  4H9P A;  3MNN D;  3AZJ D;  5GT0 B;  2CV5 C;  1KX4 D;  3X1S D;  4UUZ A;  1P3L B;  5E5A D;  5AVB C;  4WU9 C;  3MGQ C;  5B31 A;  3LJA B;  3MGP B;  1M19 C;  4G91 B;  5CHL B;  3AV1 B;  5DNM B;  1H3O A;  5JRG A;  5DNN B;  5JRG D;  3B0D C;  2YFV B;  4ZUX C;  3AZH B;  5B31 C;  1M1A A;  3LZ1 D;  3REK B;  1M1A D;  4J8X A;  4J8X D;  4CSR B;  3MGR A;  5CP6 A;  5BS7 A;  4WZS B;  5F99 B;  3MGR D;  4Z5T A;  5JRG C;  4H9N B;  4XZQ B;  2F8N B;  3AZI B; 
#chains in the Genus database with same CATH topology
 3UTB D;  2BYK B;  2DQN C;  3X1V A;  4EO5 C;  1F1E A;  4YS3 D;  1M1A C;  3X1V D;  3REI B;  2PYO B;  4LD9 C;  4J8X C;  3C1B D;  4H9R B;  5CPK A;  2HUE C;  5CPK D;  3A1I A;  5CP6 C;  5B0Y B;  5BS7 C;  3X1U A;  1EQZ B;  4Z5T C;  4X23 C;  1A7W A;  3LZ0 B;  3UTA B;  3REJ B;  3X1T A;  5B1M D;  4G92 C;  4Z66 A;  2FFF B;  3MGS A;  3VH6 W;  3AZE A;  5B2J B;  3X1U C;  3MGS D;  1P3G A;  3KWQ A;  3AYW A;  1WWS A;  1P3G D;  2NQB B;  3AYW D;  3A1K A;  5CPJ A;  5AV6 A;  3X1T C;  4WV4 B;  5CPJ D;  1KX5 A;  3AZL A;  5AV6 D;  1P34 D;  4Z66 C;  1KX5 D;  3H0R C;  3REH A;  3MGS C;  1KX3 D;  5KDM A;  3V9R B;  3AZE C;  3REH D;  3W98 C;  4KHA B;  3KWQ C;  3AYW C;  3B0C W;  1AOI B;  1P3F A;  3REL A;  2HIO B;  1P3M A;  1P3F D;  3AZG B;  4DQY B;  5AV6 C;  5AV9 B;  5AV5 A;  5BNV B;  1KX5 C;  3AZL C;  4WU8 B;  3VH5 W;  5AV5 D;  3KXB B;  5C3I B;  5B32 A;  1KU5 A;  3B0B A;  1P3I B;  5B32 D;  1P3F C;  3REL C;  1P3P A;  1P3M C;  2BYM A;  2Y2H A;  3W97 A;  4Z2M H;  5AV5 C;  1S32 A;  5B24 B;  3W97 D;  4KUD B;  3WKJ D;  5GT0 A;  1S32 D;  1B67 A;  1HQ3 B;  2NZD B;  4WNN B;  3EPH A;  4XUJ D;  3AZN D;  3KUY B;  1N1J A;  2Y2L A;  5AVC B;  1P3P C;  2IO5 C;  3A6N B;  3MGP A;  5B40 B;  1U35 D;  1S32 C;  3O62 B;  3MGP D;  4J8V B;  5GT0 C;  1TZY B;  5AY8 D;  3AZK B;  3AV1 A;  5GT3 D;  1P3L C;  5DNM A;  2Y2K A;  1P3O B;  2J8P A;  2CV5 A;  5DNN A;  2YFW B;  1BH8 A;  2YFV A;  3AV2 B;  2CV5 D;  3TU4 B;  5DNN D;  3LJA C;  3MGP C;  3REK A;  3KFU G;  4G91 C;  4R8P B;  3MGQ D;  3AZM B;  4CSR A;  3AV1 C;  5DNM C;  3W99 B;  1M19 D;  4H9N A;  4XZQ A;  5CPI B;  5GXQ B;  3AZF B;  2F8N A;  5B0Z B;  5DNN C;  2XD1 A;  2BYK A;  2CWE A;  3AZH C;  1T3U A;  2ARO B;  3REK C;  2PYO A;  4ZUX A;  4H9R A;  3VH6 T;  5B33 B;  5B2I B;  4ZUX D;  5B31 D;  3NQJ B;  5F99 C;  1EQZ A;  2VQR A;  4XZQ C;  3LZ0 A;  3UTA A;  3AZI C;  1JFI A;  3REJ A;  4KGC B;  1BH9 B;  3REI C;  3REJ D;  1R4V A;  2PYO C;  3KSY A;  1P3B B;  2XD5 A;  3AFA B;  3B0C T;  5B0Y C;  2L5A A;  5B2J A;  4LD9 A;  2Y2I A;  4J8U B;  1EQZ C;  4LD9 D;  3LZ0 C;  4DRA A;  3UTA C;  2ZM5 A;  3WTP E;  5CP6 D;  4X23 A;  3REJ C;  3WA9 B;  3VH5 T;  4Z5T D;  4X23 D;  3H0L C;  3B6F B;  4J8W B;  2Y2J A;  5B2J C;  1P3A B;  3C1C B;  4KHA A;  1AOI A;  3NQU B;  1W2E A;  2NQB C;  5BO0 B;  5FUG B;  3AN2 B;  5AV9 A;  3X1U D;  3LEL B;  4WU8 A;  3W96 B;  3MNN B;  3H0M C;  3AZJ B;  3R45 B;  2F8N H;  3EPJ A;  3KXB A;  3MVD B;  1KX4 B;  2BG1 A;  3X1S B;  3X1T D;  2ZY3 A;  5BT1 C;  5E5A B;  1AOI C;  2Y2Q A;  4Z66 D;  4E44 A;  2RVQ C;  5B31 G;  3W98 A;  3AZG C;  3AZE D;  5AV9 C;  3W98 D;  4NFT A;  3KWQ D;  4KUD A;  4WU8 C;  3KXB C;  2NZD A;  4H9S A;  4WNN A;  5C3I C;  1P3I C;  5AV8 B;  3KUY A;  3AZL D;  3IP4 C;  5AVC A;  5G49 B;  4ZBJ B;  2FJ7 B;  5B40 A;  5B24 C;  1PZR A;  3O62 A;  2ZY5 A;  5B40 D;  3LZ1 B;  4J8V A;  4KUD C;  1TZY A;  3REL D;  1HQ3 C;  3AZK A;  1P3M D;  1F66 B;  2NZD C;  4H9S C;  3MGR B;  3KUY C;  4M6B A;  5AVC C;  2YFW A;  3AV2 A;  4HGA B;  2LY8 A;  3TU4 A;  3UTB B;  3A6N C;  4QLC A;  5GSU B;  5B40 C;  4YS3 B;  3X1V B;  4QLC D;  3O62 C;  4J8V C;  4R8P A;  3AZM A;  3C1B B;  1TZY C;  4Z2M G;  4CAY A;  5JA4 B;  4R8P D;  4JJN B;  3AZK C;  3AZM D;  1P3K B;  5CPK B;  1P3P D;  1P3O C;  5CPI A;  5GXQ A;  3AZF A;  5B0Z A;  3AV2 C;  5CPI D;  1P3L A;  5GT0 D;  4E45 A;  2Y2M A;  3TU4 C;  1P3L D;  2ARO A;  4QLC C;  1Q9C A;  5B1M B;  4DRB A;  4R8P C;  5B33 A;  5B2I A;  3AZM C;  3LJA A;  5B2I D;  3NQJ A;  5B33 D;  3LJA D;  2RIQ A;  1M18 B;  3W99 C;  5CPI C;  5GXQ C;  3AZF C;  5B0Z C;  1P3G B;  3AV1 D;  4KGC A;  1BH9 A;  2ARO C;  5DNM D;  3UT9 B;  5CPJ B;  1P3B A;  3AZH A;  5B2I C;  5B33 C;  3AFA A;  1P34 B;  2JE5 A;  3AZH D;  1P3B D;  3AFA D;  4J8U A;  3REK D;  1KX3 B;  3REH B;  2F8N K;  5F99 A;  3B6G B;  3WA9 A;  5F99 D;  4KGC C;  3AZI A;  4XZQ D;  3B6F A;  1P3B C;  2F8N D;  3AZI D;  4WJ3 C;  3AFA C;  3WAA B;  3REI A;  2F2A C;  5B32 G;  1P3A A;  3REI D;  4J8U C;  2PYO D;  1P3A D;  5B0Y A;  5B32 B;  5BO0 A;  5FUG A;  5B0Y D;  4H9Q B;  3WA9 C;  1ID3 B;  1EQZ D;  1ZLA B;  3B6F C;  3W97 B;  3LZ0 D;  3MNN A;  3UTA D;  4J8W C;  3AZJ A;  3R45 A;  3WKJ B;  4NE5 A;  1KX4 A;  3MVD A;  5B1L B;  3X1S A;  1P3A C;  3C1C C;  5E5A A;  3MVD D;  4XUJ B;  3AZN B;  3WTP B;  5BNX B;  4AWL B;  3AN2 C;  1N1J B;  5B2J D;  2NQB A;  3LEL C;  4YM6 B;  1U35 B;  3W96 C;  2NQB D;  3MNN C;  3AZJ C;  1KX4 C;  3MVD C;  5AY8 B;  3X1S C;  5GT3 B;  5E5A C;  5AV8 A;  5G49 A;  5AV8 D;  3V9R A;  2FJ7 A;  2ZY2 A;  2CV5 B;  1BH8 B;  5BT1 D;  2FJ7 D;  2HIO A;  3LZ1 A;  1AOI D;  5AVB B;  3AZG A;  2HIO D;  2RVQ D;  4H9O B;  3MGQ B;  4WU9 B;  5BNV A;  3AZG D;  1F66 A;  5AV9 D;  1Z2C B;  2G5H C;  1F66 D;  5AV8 C;  1M19 B;  2F8N G;  4WU8 D;  3EPL A;  1TAF B;  4H9P B;  3UTB A;  4ZBJ C;  2FJ7 C;  1P3I A;  3KXB D;  5GSU A;  4UUZ B;  4YS3 A;  2HIO C;  3LZ1 C;  5GSU D;  1P3I D;  3C1B A;  5JA4 A;  4JJN A;  3B0D B;  1P3K A;  4ZUX B;  1F66 C;  5B24 A;  5B31 B;  4JJN D;  1P3K D;  3MGR C;  5B24 D;  4KUD D;  1HQ3 A;  2UWX A;  4HGA C;  1HQ3 D;  3UTB C;  2NZD D;  5GSU C;  4YS3 C;  5B1M A;  3X1V C;  1H3O B;  1JFI B;  3KUY D;  5JRG B;  5AVC D;  3A6N A;  3C1B C;  4JJN C;  1P3K C;  3A6N D;  5CPK C;  1M18 A;  3P5J B;  4EO5 B;  3VH6 A;  1M1A B;  1B6W A;  1M18 D;  3O62 D;  4J8V D;  4LD9 B;  4J8X B;  1TZY D;  1P3O A;  3AZK D;  2DF4 C;  3AL0 C;  2HUE B;  3FDD A;  5CP6 B;  3UT9 A;  1P3O D;  3EPK A;  5B1M C;  4Z5T B;  4X23 B;  3UT9 D;  3AV2 D;  1P34 A;  3TU4 D;  2ZY4 A;  1M18 C;  2Y2O A;  1KX3 A;  4G92 B;  1ULY A;  1P3G C;  4NE3 A;  3W99 A;  3B6G A;  3UT9 C;  3W99 D;  3X1U B;  3B6G D;  2Y2G A;  1WWI A;  5GXQ D;  3AZF D;  5B0Z D;  2Y2P A;  5CPJ C;  1P34 C;  3WAA A;  3VH5 A;  3WAA D;  2ARO D;  1KX3 C;  3REH C;  3X1T B;  2Y2N A;  4Z66 B;  4H9Q A;  3B6G C;  1ID3 A;  3MGS B;  3AZE B;  1ZLA A;  1ID3 D;  3W98 B;  3KWQ B;  3AYW B;  2G5I C;  3WAA C;  1ZLA D;  3WKJ A;  4NE6 A;  5B1L A;  4KGC D;  5B1L D;  4XUJ A;  5AV6 B;  3AZN A;  1KX5 B;  5B32 C;  3AZL B;  5BNX A;  3WTP A;  3WTP D;  1ID3 C;  4J8U D;  5KDM B;  4YM6 A;  1ZLA C;  1U35 A;  3W97 C;  2W8S A;  4YM6 D;  1P3F B;  3WKJ C;  3REL B;  5B1L C;  5AY8 A;  1P3M B;  3F6T A;  5GT3 A;  3WA9 D;  4XUJ C;  3AZN C;  4J8W A;  3B6F D;  5AV5 B;  3WTP C;  4AWL C;  4J8W D;  3C1C A;  3NQU A;  2JSS A;  3C1C D;  4YM6 C;  1U35 C;  5AVB A;  4QLC B;  4H9O A;  3AN2 A;  3MGQ A;  4WU9 A;  5AVB D;  5AY8 C;  4WU9 D;  3LEL A;  2IO5 B;  2BYM B;  1HTA A;  5GT3 C;  3AN2 D;  1P3P B;  3W96 A;  1BFM A;  4CAY B;  3LEL D;  1M19 A;  1S32 B;  3W96 D;  1TAF A;  4H9P A;  3MNN D;  3AZJ D;  5GT0 B;  2CV5 C;  1KX4 D;  3X1S D;  4UUZ A;  1P3L B;  5E5A D;  5AVB C;  4WU9 C;  3MGQ C;  5B31 A;  3LJA B;  3MGP B;  1M19 C;  4G91 B;  5CHL B;  4UPK A;  3EG5 B;  3AV1 B;  5DNM B;  1H3O A;  5JRG A;  2JCH A;  5DNN B;  5JRG D;  3B0D C;  2YFV B;  4ZUX C;  3AZH B;  5B31 C;  1M1A A;  3LZ1 D;  3REK B;  1M1A D;  4J8X A;  4J8X D;  4CSR B;  3MGR A;  5CP6 A;  5BS7 A;  4WZS B;  5F99 B;  3MGR D;  4Z5T A;  5JRG C;  4H9N B;  4XZQ B;  2F8N B;  3AZI B; 
#chains in the Genus database with same CATH homology
 3UTB D;  2BYK B;  2DQN C;  3X1V A;  4EO5 C;  1F1E A;  4YS3 D;  1M1A C;  3X1V D;  3REI B;  2PYO B;  4LD9 C;  4J8X C;  3C1B D;  4H9R B;  5CPK A;  2HUE C;  5CPK D;  3A1I A;  5CP6 C;  5B0Y B;  5BS7 C;  3X1U A;  1EQZ B;  4Z5T C;  4X23 C;  1A7W A;  3LZ0 B;  3UTA B;  3REJ B;  3X1T A;  5B1M D;  4G92 C;  4Z66 A;  2FFF B;  3MGS A;  3VH6 W;  3AZE A;  5B2J B;  3X1U C;  3MGS D;  1P3G A;  3KWQ A;  3AYW A;  1WWS A;  1P3G D;  2NQB B;  3AYW D;  3A1K A;  5CPJ A;  5AV6 A;  3X1T C;  4WV4 B;  5CPJ D;  1KX5 A;  3AZL A;  5AV6 D;  1P34 D;  4Z66 C;  1KX5 D;  3H0R C;  3REH A;  3MGS C;  1KX3 D;  5KDM A;  3V9R B;  3AZE C;  3REH D;  3W98 C;  4KHA B;  3KWQ C;  3AYW C;  3B0C W;  1AOI B;  1P3F A;  3REL A;  2HIO B;  1P3M A;  1P3F D;  3AZG B;  4DQY B;  5AV6 C;  5AV9 B;  5AV5 A;  5BNV B;  1KX5 C;  3AZL C;  4WU8 B;  3VH5 W;  5AV5 D;  3KXB B;  5C3I B;  5B32 A;  1KU5 A;  3B0B A;  1P3I B;  5B32 D;  1P3F C;  3REL C;  1P3P A;  1P3M C;  2BYM A;  2Y2H A;  3W97 A;  4Z2M H;  5AV5 C;  1S32 A;  5B24 B;  3W97 D;  4KUD B;  3WKJ D;  5GT0 A;  1S32 D;  1B67 A;  1HQ3 B;  2NZD B;  4WNN B;  3EPH A;  4XUJ D;  3AZN D;  3KUY B;  1N1J A;  2Y2L A;  5AVC B;  1P3P C;  2IO5 C;  3A6N B;  3MGP A;  5B40 B;  1U35 D;  1S32 C;  3O62 B;  3MGP D;  4J8V B;  5GT0 C;  1TZY B;  5AY8 D;  3AZK B;  3AV1 A;  5GT3 D;  1P3L C;  5DNM A;  2Y2K A;  1P3O B;  2J8P A;  2CV5 A;  5DNN A;  2YFW B;  1BH8 A;  2YFV A;  3AV2 B;  2CV5 D;  3TU4 B;  5DNN D;  3LJA C;  3MGP C;  3REK A;  3KFU G;  4G91 C;  4R8P B;  3MGQ D;  3AZM B;  4CSR A;  3AV1 C;  5DNM C;  3W99 B;  1M19 D;  4H9N A;  4XZQ A;  5CPI B;  5GXQ B;  3AZF B;  2F8N A;  5B0Z B;  5DNN C;  2XD1 A;  2BYK A;  2CWE A;  3AZH C;  1T3U A;  2ARO B;  3REK C;  2PYO A;  4ZUX A;  4H9R A;  3VH6 T;  5B33 B;  5B2I B;  4ZUX D;  5B31 D;  3NQJ B;  5F99 C;  1EQZ A;  2VQR A;  4XZQ C;  3LZ0 A;  3UTA A;  3AZI C;  1JFI A;  3REJ A;  4KGC B;  1BH9 B;  3REI C;  3REJ D;  1R4V A;  2PYO C;  3KSY A;  1P3B B;  2XD5 A;  3AFA B;  3B0C T;  5B0Y C;  2L5A A;  5B2J A;  4LD9 A;  2Y2I A;  4J8U B;  1EQZ C;  4LD9 D;  3LZ0 C;  4DRA A;  3UTA C;  2ZM5 A;  3WTP E;  5CP6 D;  4X23 A;  3REJ C;  3WA9 B;  3VH5 T;  4Z5T D;  4X23 D;  3H0L C;  3B6F B;  4J8W B;  2Y2J A;  5B2J C;  1P3A B;  3C1C B;  4KHA A;  1AOI A;  3NQU B;  1W2E A;  2NQB C;  5BO0 B;  5FUG B;  3AN2 B;  5AV9 A;  3X1U D;  3LEL B;  4WU8 A;  3W96 B;  3MNN B;  3H0M C;  3AZJ B;  3R45 B;  2F8N H;  3EPJ A;  3KXB A;  3MVD B;  1KX4 B;  2BG1 A;  3X1S B;  3X1T D;  2ZY3 A;  5BT1 C;  5E5A B;  1AOI C;  2Y2Q A;  4Z66 D;  4E44 A;  2RVQ C;  5B31 G;  3W98 A;  3AZG C;  3AZE D;  5AV9 C;  3W98 D;  4NFT A;  3KWQ D;  4KUD A;  4WU8 C;  3KXB C;  2NZD A;  4H9S A;  4WNN A;  5C3I C;  1P3I C;  5AV8 B;  3KUY A;  3AZL D;  3IP4 C;  5AVC A;  5G49 B;  4ZBJ B;  2FJ7 B;  5B40 A;  5B24 C;  1PZR A;  3O62 A;  2ZY5 A;  5B40 D;  3LZ1 B;  4J8V A;  4KUD C;  1TZY A;  3REL D;  1HQ3 C;  3AZK A;  1P3M D;  1F66 B;  2NZD C;  4H9S C;  3MGR B;  3KUY C;  4M6B A;  5AVC C;  2YFW A;  3AV2 A;  4HGA B;  2LY8 A;  3TU4 A;  3UTB B;  3A6N C;  4QLC A;  5GSU B;  5B40 C;  4YS3 B;  3X1V B;  4QLC D;  3O62 C;  4J8V C;  4R8P A;  3AZM A;  3C1B B;  1TZY C;  4Z2M G;  4CAY A;  5JA4 B;  4R8P D;  4JJN B;  3AZK C;  3AZM D;  1P3K B;  5CPK B;  1P3P D;  1P3O C;  5CPI A;  5GXQ A;  3AZF A;  5B0Z A;  3AV2 C;  5CPI D;  1P3L A;  5GT0 D;  4E45 A;  2Y2M A;  3TU4 C;  1P3L D;  2ARO A;  4QLC C;  1Q9C A;  5B1M B;  4DRB A;  4R8P C;  5B33 A;  5B2I A;  3AZM C;  3LJA A;  5B2I D;  3NQJ A;  5B33 D;  3LJA D;  2RIQ A;  1M18 B;  3W99 C;  5CPI C;  5GXQ C;  3AZF C;  5B0Z C;  1P3G B;  3AV1 D;  4KGC A;  1BH9 A;  2ARO C;  5DNM D;  3UT9 B;  5CPJ B;  1P3B A;  3AZH A;  5B2I C;  5B33 C;  3AFA A;  1P34 B;  2JE5 A;  3AZH D;  1P3B D;  3AFA D;  4J8U A;  3REK D;  1KX3 B;  3REH B;  2F8N K;  5F99 A;  3B6G B;  3WA9 A;  5F99 D;  4KGC C;  3AZI A;  4XZQ D;  3B6F A;  1P3B C;  2F8N D;  3AZI D;  4WJ3 C;  3AFA C;  3WAA B;  3REI A;  2F2A C;  5B32 G;  1P3A A;  3REI D;  4J8U C;  2PYO D;  1P3A D;  5B0Y A;  5B32 B;  5BO0 A;  5FUG A;  5B0Y D;  4H9Q B;  3WA9 C;  1ID3 B;  1EQZ D;  1ZLA B;  3B6F C;  3W97 B;  3LZ0 D;  3MNN A;  3UTA D;  4J8W C;  3AZJ A;  3R45 A;  3WKJ B;  4NE5 A;  1KX4 A;  3MVD A;  5B1L B;  3X1S A;  1P3A C;  3C1C C;  5E5A A;  3MVD D;  4XUJ B;  3AZN B;  3WTP B;  5BNX B;  4AWL B;  3AN2 C;  1N1J B;  5B2J D;  2NQB A;  3LEL C;  4YM6 B;  1U35 B;  3W96 C;  2NQB D;  3MNN C;  3AZJ C;  1KX4 C;  3MVD C;  5AY8 B;  3X1S C;  5GT3 B;  5E5A C;  5AV8 A;  5G49 A;  5AV8 D;  3V9R A;  2FJ7 A;  2ZY2 A;  2CV5 B;  1BH8 B;  5BT1 D;  2FJ7 D;  2HIO A;  3LZ1 A;  1AOI D;  5AVB B;  3AZG A;  2HIO D;  2RVQ D;  4H9O B;  3MGQ B;  4WU9 B;  5BNV A;  3AZG D;  1F66 A;  5AV9 D;  1Z2C B;  2G5H C;  1F66 D;  5AV8 C;  1M19 B;  2F8N G;  4WU8 D;  3EPL A;  1TAF B;  4H9P B;  3UTB A;  4ZBJ C;  2FJ7 C;  1P3I A;  3KXB D;  5GSU A;  4UUZ B;  4YS3 A;  2HIO C;  3LZ1 C;  5GSU D;  1P3I D;  3C1B A;  5JA4 A;  4JJN A;  3B0D B;  1P3K A;  4ZUX B;  1F66 C;  5B24 A;  5B31 B;  4JJN D;  1P3K D;  3MGR C;  5B24 D;  4KUD D;  1HQ3 A;  2UWX A;  4HGA C;  1HQ3 D;  3UTB C;  2NZD D;  5GSU C;  4YS3 C;  5B1M A;  3X1V C;  1H3O B;  1JFI B;  3KUY D;  5JRG B;  5AVC D;  3A6N A;  3C1B C;  4JJN C;  1P3K C;  3A6N D;  5CPK C;  1M18 A;  3P5J B;  4EO5 B;  3VH6 A;  1M1A B;  1B6W A;  1M18 D;  3O62 D;  4J8V D;  4LD9 B;  4J8X B;  1TZY D;  1P3O A;  3AZK D;  2DF4 C;  3AL0 C;  2HUE B;  3FDD A;  5CP6 B;  3UT9 A;  1P3O D;  3EPK A;  5B1M C;  4Z5T B;  4X23 B;  3UT9 D;  3AV2 D;  1P34 A;  3TU4 D;  2ZY4 A;  1M18 C;  2Y2O A;  1KX3 A;  4G92 B;  1ULY A;  1P3G C;  4NE3 A;  3W99 A;  3B6G A;  3UT9 C;  3W99 D;  3X1U B;  3B6G D;  2Y2G A;  1WWI A;  5GXQ D;  3AZF D;  5B0Z D;  2Y2P A;  5CPJ C;  1P34 C;  3WAA A;  3VH5 A;  3WAA D;  2ARO D;  1KX3 C;  3REH C;  3X1T B;  2Y2N A;  4Z66 B;  4H9Q A;  3B6G C;  1ID3 A;  3MGS B;  3AZE B;  1ZLA A;  1ID3 D;  3W98 B;  3KWQ B;  3AYW B;  2G5I C;  3WAA C;  1ZLA D;  3WKJ A;  4NE6 A;  5B1L A;  4KGC D;  5B1L D;  4XUJ A;  5AV6 B;  3AZN A;  1KX5 B;  5B32 C;  3AZL B;  5BNX A;  3WTP A;  3WTP D;  1ID3 C;  4J8U D;  5KDM B;  4YM6 A;  1ZLA C;  1U35 A;  3W97 C;  2W8S A;  4YM6 D;  1P3F B;  3WKJ C;  3REL B;  5B1L C;  5AY8 A;  1P3M B;  3F6T A;  5GT3 A;  3WA9 D;  4XUJ C;  3AZN C;  4J8W A;  3B6F D;  5AV5 B;  3WTP C;  4AWL C;  4J8W D;  3C1C A;  3NQU A;  2JSS A;  3C1C D;  4YM6 C;  1U35 C;  5AVB A;  4QLC B;  4H9O A;  3AN2 A;  3MGQ A;  4WU9 A;  5AVB D;  5AY8 C;  4WU9 D;  3LEL A;  2IO5 B;  2BYM B;  1HTA A;  5GT3 C;  3AN2 D;  1P3P B;  3W96 A;  1BFM A;  4CAY B;  3LEL D;  1M19 A;  1S32 B;  3W96 D;  1TAF A;  4H9P A;  3MNN D;  3AZJ D;  5GT0 B;  2CV5 C;  1KX4 D;  3X1S D;  4UUZ A;  1P3L B;  5E5A D;  5AVB C;  4WU9 C;  3MGQ C;  5B31 A;  3LJA B;  3MGP B;  1M19 C;  4G91 B;  5CHL B;  4UPK A;  3EG5 B;  3AV1 B;  5DNM B;  1H3O A;  5JRG A;  2JCH A;  5DNN B;  5JRG D;  3B0D C;  2YFV B;  4ZUX C;  3AZH B;  5B31 C;  1M1A A;  3LZ1 D;  3REK B;  1M1A D;  4J8X A;  4J8X D;  4CSR B;  3MGR A;  5CP6 A;  5BS7 A;  4WZS B;  5F99 B;  3MGR D;  4Z5T A;  5JRG C;  4H9N B;  4XZQ B;  2F8N B;  3AZI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...