2AROD

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroD00
5B31B 1P3KB 1P3PC 5JA4A 3AZKB 1ULYA 5B31G 1BFMA 5B40D 2BYKB 3AFAD 3LELC 4KUDD 3KWQD 5CPKA 3W96A 4Z5TB 5E5AA 2FJ7A 5BS7C 4KHAB 4M6BA 3KXBC 1P3MD 4H9SC 1P34D 5DNMA 3LZ1A 2NZDD 5F99A 4J8UB 5B2IB 1M19B 4R8PD 4LD9B 2NQBB 2JSSA 5AV5D 1P3BB 2FJ7C 3W98D 1P3FD 3TU4D 1TZYC 3AV1C 2RVQC 1P3OA 5DNMC 3LZ1C 4YS3A 2PYOC 3WA9D 4KGCA 1ZLAD 3UTBB 3B6GA 5B32G 1P3OC 2F8ND 3VH5W 1WWSA 5AV8D 3AZGA 1S32D 3MGSB 3AZJB 1P3LA 5B0YB 5C3IC 5B1LA 5B1MB 5GT3D 3MGRD 3AZNB 4G92B 4CAYA 3C1BB 3B6FA 1HQ3A 3AFAC 1U35D 4H9OA 5AV6B 3AV2A 3AZGC 4WU9A 2BYMB 1P3LC 3W99D 1M18D 5B31A 1P3KA 5AVCC 4WU8D 1P34C 1HQ3C 3AZKA 5B0ZD 3AZMB 4XUJD 2NZDC 4H9NB 4WU9C 3AV2C 2BYKA 3AZFD 2AROB 3KUYD 1P3FC 3LJAD 1P3KC 3X1SD 3WKJB 4KHAA 3AZKC 3WAAB 3REJA 3LELB 4JJNB 3MNNB 3B0CT 1B6WA 3REKB 3VH6W 3AZID 4J8UA 5B2IA 1M19A 4Z2MH 2NQBA 4LD9A 3KXBB 5DNNC 4Z5TC 1P3BA 4H9PB 5AV8C 4E45A 5CP6B 5GT3C 5AY8A 4J8UC 3AZHD 5B2IC 1P3BC 1TZYB 3AV1B 4X23D 3R45B 3C1CB 2PYOB 3W97C 5JRGD 2HUEB 3UTAB 4EO5C 1KX5B 5B33C 3AZJA 5B0YA 1M1AD 5B1MA 5B0ZC 2IO5C 3AZNA 3UTBC 3C1BA 1F1EA 1KX3D 4J8WD 5AV6A 5C3IB 4NE5A 3MGSC 2BYMA 3X1TD 5B1MC 1WWIA 3AFAB 4UUZA 3MVDD 3KWQB 3AZMA 4H9NA 5AV6C 3AZIC 3X1VD 3LZ0D 3REHD 1P34B 5GT0D 4AWLB 3WKJA 2NZDB 3WAAA 4R8PB 3LELA 4JJNA 5CPJD 3AZHC 3MNNA 5FUGB 2AROC 5AV5B 4NFTA 1P3FB 3TU4B 3WTPD 3X1UD 3REKA 1N1JB 1P3GC 5CPKD 4QLCD 5BS7A 3KXBA 3W96D 4H9SA 3WKJC 4H9PA 5E5AD 3B0DC 3WAAC 5CP6A 4JJNC 1KX4C 3MNNC 1ZLAB 3AZED 4G91B 3REKC 5DNNB 2F8NB 5F99D 5AV8B 1TZYA 1S32B 4Z66D 3AV1A 5AV9C 5CP6C 3AN2C 5GT3B 3MGRB 3C1CA 2PYOA 5BNXB 3UTAA 4H9QB 1KX5A 3MVDC 4YS3D 3MGQD 1U35B 1P3AD 5CPID 4KGCD 4ZUXD 3B6GD 3W99B 1M18B 3W97B 3C1CC 4EO5B 4NE6A 5B33B 2HUEC 4WU8B 3RELC 3UTAC 1KX5C 1B67A 5B0ZB 2IO5B 4J8VD 4XUJB 2HIOD 5GXQD 1F66C 4Z2MG 3AFAA 1EQZC 5B2JC 3UT9D 3KWQA 3NQUB 5BNVA 5BT1C 3LJAB 3KUYB 3WTPC 3X1UC 3X1SB 3AYWD 4QLCC 5B24D 5AVCA 2YFWB 5B40C 1P34A 5B31D 1AOID 4KUDC 3KWQC 2NZDA 3AZIB 4R8PA 5FUGA 5AV5A 1P3MC 1P3FA 3TU4A 1N1JA 4DRBA 4AWLC 2F8NH 5BO0B 4XZQD 3AZHB 4R8PC 3MGQC 3REJD 5CPIC 5AV5C 1ZLAA 3W98C 1P3ID 1P3GB 3TU4C 4X23B 5DNNA 2F8NA 4Z5TA 5AV8A 3B0DB 4CSRB 5JRGB 2NQBD 4LD9D 3WA9C 1KX4B 3O62D 5GT3A 4WNNB 1ID3D 1ZLAC 3MGRA 4WZSB 4G91C 4YM6D 5GXQC 4H9QA 5G49B 5B32D 1KX3B 3UT9C 5AY8D 4J8WB 5AV9B 1S32C 3AN2B 3X1TB 3W99A 3REID 3W97A 4J8XD 1M18A 3MGRC 5AVBD 5B33A 3MVDB 2LY8A 1U35C 5B0ZA 3AZJD 5B0YD 3UTBA 4XUJA 3AZLD 3X1VB 3A6ND 3LZ0B 3AZND 2CWEA 3W99C 3KUYA 1M18C 3LJAA 4HGAC 3REHB 3RELB 5GT0B 3MGSA 4WU8C 3X1SA 1F66B 4XUJC 1JFIB 2YFWA 5CPJB 1EQZB 5B2JB 3AZFC 3VH5A 3WTPB 3X1UB 3KUYC 1R4VA 5GSUD 3LJAC 1KU5A 3AZIA 3V9RB 2CV5D 4QLCB 3AZMD 3W96B 3X1SC 5B40B 3MGPD 4DRAA 4KUDB 3AZEB 1P3PD 3O62C 1ID3C 5BO0A 1BH9B 3AZHA 2AROA 1P3MB 3LELD 1HTAA 3NQJB 4Z66B 1P3GA 4X23A 4J8XC 4CSRA 5JRGA 1A7WA 5AVBC 3MGQB 1P3AB 1KX4A 5CPIB 3W98B 4WNNA 4ZUXB 3AZLC 2L5AA 5G49A 3A6NC 4X23C 1KX3A 4J8WA 3WA9B 2FJ7D 5JRGC 5AV9A 3AN2A 3X1TA 3AV1D 1M1AC 2RVQD 4J8VB 5DNMD 2HIOB 5GXQB 3VH6A 3MVDA 3LZ1D 2PYOD 4CAYB 3UT9B 1KX3C 4H9RB 4J8WC 5GSUC 3AYWB 3X1VA 3LZ0A 3R45A 3X1TC 1P3OD 2F8NG 5B24B 3MGPC 3RELA 1AOIB 5GT0A 1H3OB 1F66A 4WV4B 3KSYA 1JFIA 1EQZA 5CPJA 5B2JA 3X1VC 3LZ0C 4HGAB 3WTPA 3X1UA 3WTPE 3REHC 3V9RA 5GT0C 3AZGD 4QLCA 1P3LD 4XZQB 5B1LD 5B40A 3AZFB 3REJB 5CPJC 4KUDA 5AVCD 3B6FD 1Q9CA 3AZEA 1HQ3D 1P3IB 1TAFB 1BH9A 5CPKC 4WU9D 3AV2D 1P3MA 3W96C 3NQJA 5E5AC 4Z66A 1P3KD 3O62B 1ID3B 3AZEC 4YM6B 3AZKD 5B32B 3MGQA 1P3AA 5CPIA 5AY8B 5F99C 3W98A 5CHLB 4ZUXA 1BH8B 4Z66C 3REIB 4J8XB 5DNND 3WA9A 4Z5TD 5AVBB 4YS3C 1P3AC 4J8VA 2HIOA 5GXQA 3AZLB 4ZUXC 3A6NB 3B0CW 4KGCC 3B6GC 3UT9A 4ZBJC 3VH5T 4J8UD 5B2ID 1M19D 4H9RA 1S32A 1P3BD 3AYWA 1M1AB 4J8VC 5B24A 5B1LC 5BNXA 3W97D 2HIOC 1AOIA 1U35A 4UUZB 5B33D 3B6FC 1H3OA 2CV5B 5GSUB 2YFVB 4NE3A 3UTBD 3AYWC 3MGPB 5B24C 4WU8A 5B31C 1AOIC 1P3PB 5KDMB 3MGSD 4XZQA 5B1MD 3AZFA 3C1BD 3NQUA 1P3IA 1TAFA 5AV6D 5JA4B 4E44A 4XZQC 3O62A 3REJC 1ID3A 3VH6T 4YM6A 1P3IC 5CPKB 5B32A 2AROD 5E5AB 1M19C 2FJ7B 4LD9C 2NQBC 1BH8A 1P3GD 3REIA 4J8XA 5DNMB 5AVBA 4YM6C 3LZ1B 3WKJD 3WAAD 5F99B 5B32C 2F8NK 4JJND 5AY8C 1KX4D 3MNND 3AZLA 3A6NA 3REKD 1P3OB 3REIC 3KXBD 4YS3B 1M1AA 5AV9D 5CP6D 3AZJC 3AN2D 4KGCB 5B0YC 3B0BA 3B6GB 4ZBJB 3AZNC 4G92C 3C1BC 2CV5A 5GSUA 5BNVB 2YFVA 3AZGB 1TZYD 1P3LB 5B1LB 3MGPA 3C1CD 5AVCB 3B6FB 3UTAD 3RELD 1P3PA 5KDMA 1HQ3B 1KX5D 2CV5C 4H9OB 4WU9B 3AV2B 1F66D 3AZMC 1EQZD 5B2JD 3REHA 5BT1D
chains in the Genus database with same CATH superfamily
5B31B 1P3KB 3EPHA 1P3PC 5JA4A 3AZKB 1ULYA 5B31G 1BFMA 5B40D 2BYKB 3A1IA 3AFAD 3LELC 4KUDD 3KWQD 5CPKA 3W96A 4Z5TB 5E5AA 2FJ7A 5BS7C 4KHAB 4M6BA 3KXBC 1P3MD 4H9SC 1P34D 5DNMA 1W2EA 3LZ1A 2NZDD 5F99A 4J8UB 5B2IB 1M19B 2Y2QA 4R8PD 4LD9B 2NQBB 2JSSA 5AV5D 1P3BB 2FJ7C 3W98D 2XD5A 1P3FD 3TU4D 1TZYC 3AV1C 2RVQC 1P3OA 5DNMC 1T3UA 3LZ1C 4YS3A 2PYOC 3WA9D 4KGCA 2G5HC 1ZLAD 3UTBB 3B6GA 5B32G 1P3OC 2F8ND 2DQNC 3VH5W 1WWSA 5AV8D 3AZGA 1S32D 3MGSB 3AZJB 1P3LA 5B0YB 5C3IC 5B1LA 5B1MB 5GT3D 3MGRD 3AZNB 4G92B 4CAYA 3C1BB 3B6FA 1HQ3A 3AFAC 1U35D 2W8SA 4H9OA 5AV6B 3AV2A 3AZGC 4WU9A 2BYMB 1P3LC 3W99D 1M18D 5B31A 1P3KA 5AVCC 4WU8D 1P34C 1HQ3C 3AZKA 5B0ZD 3AZMB 4XUJD 2NZDC 4H9NB 4WU9C 3AV2C 2BYKA 3AZFD 2AROB 3KUYD 1P3FC 3LJAD 1P3KC 3X1SD 3WKJB 4KHAA 3AZKC 3WAAB 3REJA 3LELB 4JJNB 3MNNB 3B0CT 1B6WA 3REKB 3VH6W 3AZID 4J8UA 5B2IA 1M19A 4Z2MH 2NQBA 4LD9A 3KXBB 5DNNC 4Z5TC 1P3BA 4H9PB 5AV8C 4E45A 5CP6B 5GT3C 5AY8A 4J8UC 3AZHD 5B2IC 1P3BC 1TZYB 3AV1B 4X23D 3R45B 3C1CB 2PYOB 3EPJA 3W97C 5JRGD 2HUEB 3UTAB 4EO5C 1KX5B 5B33C 3AZJA 5B0YA 1M1AD 5B1MA 5B0ZC 2IO5C 3AZNA 3UTBC 2ZY5A 3C1BA 1F1EA 1KX3D 4J8WD 5AV6A 5C3IB 4NE5A 3MGSC 2BYMA 3X1TD 5B1MC 1WWIA 3AFAB 4UUZA 3MVDD 3KWQB 3AZMA 4H9NA 5AV6C 3AZIC 3X1VD 3LZ0D 3REHD 1P34B 5GT0D 4AWLB 3WKJA 2NZDB 2BG1A 3WAAA 4R8PB 3LELA 4JJNA 5CPJD 3AZHC 3MNNA 5FUGB 2AROC 5AV5B 4NFTA 3EPLA 2J8PA 1P3FB 3TU4B 3WTPD 3X1UD 3REKA 1N1JB 1P3GC 5CPKD 4QLCD 5BS7A 3KXBA 3W96D 4H9SA 3WKJC 4H9PA 5E5AD 3B0DC 3WAAC 5CP6A 4JJNC 1KX4C 3MNNC 1ZLAB 3AZED 4G91B 3AL0C 3REKC 5DNNB 2F8NB 5F99D 5AV8B 2F2AC 1TZYA 1S32B 4Z66D 3AV1A 5AV9C 5CP6C 3AN2C 5GT3B 3MGRB 3C1CA 2PYOA 5BNXB 3UTAA 3KFUG 4H9QB 1KX5A 3MVDC 4YS3D 3MGQD 1U35B 1P3AD 5CPID 4KGCD 4ZUXD 3B6GD 3W99B 1M18B 3W97B 3C1CC 4EO5B 4NE6A 5B33B 2HUEC 4WU8B 3RELC 3UTAC 1KX5C 1B67A 5B0ZB 2IO5B 4J8VD 4XUJB 2HIOD 5GXQD 1F66C 4Z2MG 3AFAA 2ZY2A 1EQZC 5B2JC 3UT9D 3KWQA 3NQUB 5BNVA 5BT1C 3LJAB 3KUYB 3WTPC 3X1UC 3X1SB 3AYWD 4QLCC 5B24D 3H0LC 5AVCA 2YFWB 5B40C 1P34A 5B31D 1AOID 4KUDC 3KWQC 2NZDA 2Y2IA 3AZIB 4R8PA 5FUGA 5AV5A 2VQRA 1P3MC 1P3FA 3TU4A 1N1JA 3FDDA 4DRBA 3EG5B 4AWLC 2F8NH 5BO0B 4XZQD 3AZHB 4R8PC 3MGQC 3REJD 2ZY3A 5CPIC 5AV5C 1ZLAA 3W98C 3H0MC 1P3GB 3TU4C 1P3ID 4X23B 5DNNA 2F8NA 4Z5TA 4WJ3C 5AV8A 3B0DB 4CSRB 5JRGB 1PZRA 2NQBD 3WA9C 4LD9D 1KX4B 3O62D 5GT3A 4WNNB 1ID3D 1ZLAC 3MGRA 2Y2LA 4G91C 4WZSB 4YM6D 5GXQC 4H9QA 5G49B 5B32D 1KX3B 3UT9C 5AY8D 4J8WB 5AV9B 1S32C 3AN2B 3X1TB 3IP4C 3W99A 3REID 3W97A 4J8XD 1M18A 3MGRC 5AVBD 5B33A 3MVDB 2LY8A 1U35C 5B0ZA 3AZJD 5B0YD 3UTBA 4XUJA 3AZLD 3X1VB 3A6ND 3LZ0B 3AZND 2CWEA 3W99C 3KUYA 1M18C 3LJAA 4HGAC 3REHB 3RELB 5GT0B 2Y2MA 3MGSA 4WU8C 3X1SA 1F66B 4XUJC 1JFIB 2YFWA 5CPJB 1EQZB 5B2JB 3AZFC 3VH5A 3WTPB 3X1UB 4UPKA 3KUYC 1R4VA 5GSUD 3LJAC 1KU5A 3AZIA 3V9RB 2CV5D 4QLCB 3AZMD 3W96B 3X1SC 2Y2OA 5B40B 3MGPD 4DRAA 4KUDB 3AZEB 1P3PD 3O62C 1ID3C 2ZY4A 5BO0A 1BH9B 3AZHA 2AROA 1P3MB 3LELD 1HTAA 3NQJB 4Z66B 1P3GA 4X23A 4J8XC 4CSRA 5JRGA 2Y2HA 1A7WA 5AVBC 3MGQB 1P3AB 1KX4A 5CPIB 3W98B 4WNNA 2Y2PA 4ZUXB 3AZLC 2L5AA 5G49A 3A6NC 4X23C 1KX3A 2DF4C 4J8WA 3WA9B 2FJ7D 5JRGC 5AV9A 3AN2A 2Y2GA 3X1TA 3AV1D 1M1AC 2RVQD 4J8VB 5DNMD 2HIOB 5GXQB 3VH6A 2UWXA 3MVDA 3LZ1D 2PYOD 4CAYB 3UT9B 1KX3C 4H9RB 4J8WC 5GSUC 3AYWB 3X1VA 3LZ0A 3R45A 3X1TC 1P3OD 2F8NG 5B24B 3MGPC 3RELA 1AOIB 5GT0A 2JE5A 1H3OB 1F66A 4WV4B 3KSYA 1JFIA 1EQZA 5CPJA 5B2JA 3X1VC 3LZ0C 4HGAB 3WTPA 3X1UA 3WTPE 3REHC 3V9RA 5GT0C 3AZGD 4QLCA 2JCHA 1P3LD 4XZQB 5B1LD 5B40A 3AZFB 3REJB 5CPJC 4KUDA 5AVCD 3B6FD 1Q9CA 3AZEA 1HQ3D 1P3IB 1TAFB 1BH9A 5CPKC 4WU9D 3AV2D 1P3MA 3W96C 3NQJA 3F6TA 5E5AC 4Z66A 2RIQA 1P3KD 3O62B 1ID3B 3AZEC 4YM6B 3AZKD 2ZM5A 5B32B 3MGQA 1P3AA 5CPIA 5AY8B 5F99C 3W98A 5CHLB 4ZUXA 1BH8B 4Z66C 3REIB 4J8XB 5DNND 3WA9A 4Z5TD 5AVBB 4YS3C 1P3AC 4J8VA 3A1KA 2HIOA 5GXQA 3AZLB 4ZUXC 3A6NB 3B0CW 4KGCC 2Y2NA 3B6GC 3UT9A 4ZBJC 3VH5T 4J8UD 5B2ID 1M19D 4H9RA 1S32A 1Z2CB 1P3BD 3AYWA 1M1AB 4J8VC 5B24A 5B1LC 5BNXA 3H0RC 2HIOC 3W97D 1AOIA 1U35A 4UUZB 5B33D 3B6FC 1H3OA 2CV5B 5GSUB 2YFVB 4NE3A 3UTBD 3AYWC 3MGPB 5B24C 4WU8A 5B31C 1AOIC 1P3PB 5KDMB 3MGSD 4XZQA 5B1MD 3AZFA 3C1BD 3NQUA 1P3IA 1TAFA 5AV6D 5JA4B 4E44A 4XZQC 3O62A 3REJC 1ID3A 3VH6T 4YM6A 1P3IC 5CPKB 5B32A 2AROD 5E5AB 4DQYB 1M19C 2FJ7B 4LD9C 2NQBC 1BH8A 1P3GD 3REIA 4J8XA 5DNMB 5AVBA 4YM6C 3LZ1B 3WKJD 3WAAD 5F99B 5B32C 2F8NK 4JJND 5AY8C 1KX4D 3MNND 3AZLA 3A6NA 3REKD 1P3OB 3REIC 3KXBD 4YS3B 1M1AA 3P5JB 2Y2JA 5AV9D 5CP6D 3AZJC 3AN2D 4KGCB 5B0YC 3B0BA 3B6GB 4ZBJB 3AZNC 4G92C 3C1BC 2CV5A 5GSUA 5BNVB 2YFVA 2FFFB 3AZGB 1TZYD 2XD1A 1P3LB 5B1LB 3MGPA 3C1CD 5AVCB 3B6FB 2G5IC 3EPKA 3RELD 5KDMA 3UTAD 1HQ3B 1P3PA 1KX5D 2CV5C 2Y2KA 4H9OB 4WU9B 3AV2B 1F66D 3AZMC 1EQZD 5B2JD 3REHA 5BT1D
chains in the Genus database with same CATH topology
5B31B 1P3KB 3EPHA 1P3PC 5JA4A 3AZKB 1ULYA 5B31G 1BFMA 5B40D 2BYKB 3A1IA 3AFAD 3LELC 4KUDD 3KWQD 5CPKA 3W96A 4Z5TB 5E5AA 2FJ7A 5BS7C 4KHAB 4M6BA 3KXBC 1P3MD 4H9SC 1P34D 5DNMA 1W2EA 3LZ1A 2NZDD 5F99A 4J8UB 5B2IB 1M19B 2Y2QA 4R8PD 4LD9B 2NQBB 2JSSA 5AV5D 1P3BB 2FJ7C 3W98D 2XD5A 1P3FD 3TU4D 1TZYC 3AV1C 2RVQC 1P3OA 5DNMC 1T3UA 3LZ1C 4YS3A 2PYOC 3WA9D 4KGCA 2G5HC 1ZLAD 3UTBB 3B6GA 5B32G 1P3OC 2F8ND 2DQNC 3VH5W 1WWSA 5AV8D 3AZGA 1S32D 3MGSB 3AZJB 1P3LA 5B0YB 5C3IC 5B1LA 5B1MB 5GT3D 3MGRD 3AZNB 4G92B 4CAYA 3C1BB 3B6FA 1HQ3A 3AFAC 1U35D 2W8SA 4H9OA 5AV6B 3AV2A 3AZGC 4WU9A 2BYMB 1P3LC 3W99D 1M18D 5B31A 1P3KA 5AVCC 4WU8D 1P34C 1HQ3C 3AZKA 5B0ZD 3AZMB 4XUJD 2NZDC 4H9NB 4WU9C 3AV2C 2BYKA 3AZFD 2AROB 3KUYD 1P3FC 3LJAD 1P3KC 3X1SD 3WKJB 4KHAA 3AZKC 3WAAB 3REJA 3LELB 4JJNB 3MNNB 3B0CT 1B6WA 3REKB 3VH6W 3AZID 4J8UA 5B2IA 1M19A 4Z2MH 2NQBA 4LD9A 3KXBB 5DNNC 4Z5TC 1P3BA 4H9PB 5AV8C 4E45A 5CP6B 5GT3C 5AY8A 4J8UC 3AZHD 5B2IC 1P3BC 1TZYB 3AV1B 4X23D 3R45B 3C1CB 2PYOB 3EPJA 3W97C 5JRGD 2HUEB 3UTAB 4EO5C 1KX5B 5B33C 3AZJA 5B0YA 1M1AD 5B1MA 5B0ZC 2IO5C 3AZNA 3UTBC 2ZY5A 3C1BA 1F1EA 1KX3D 4J8WD 5AV6A 5C3IB 4NE5A 3MGSC 2BYMA 3X1TD 5B1MC 1WWIA 3AFAB 4UUZA 3MVDD 3KWQB 3AZMA 4H9NA 5AV6C 3AZIC 3X1VD 3LZ0D 3REHD 1P34B 5GT0D 4AWLB 3WKJA 2NZDB 2BG1A 3WAAA 4R8PB 3LELA 4JJNA 5CPJD 3AZHC 3MNNA 5FUGB 2AROC 5AV5B 4NFTA 3EPLA 2J8PA 1P3FB 3TU4B 3WTPD 3X1UD 3REKA 1N1JB 1P3GC 5CPKD 4QLCD 5BS7A 3KXBA 3W96D 4H9SA 3WKJC 4H9PA 5E5AD 3B0DC 3WAAC 5CP6A 4JJNC 1KX4C 3MNNC 1ZLAB 3AZED 4G91B 3AL0C 3REKC 5DNNB 2F8NB 5F99D 5AV8B 2F2AC 1TZYA 1S32B 4Z66D 3AV1A 5AV9C 5CP6C 3AN2C 5GT3B 3MGRB 3C1CA 2PYOA 5BNXB 3UTAA 3KFUG 4H9QB 1KX5A 3MVDC 4YS3D 3MGQD 1U35B 1P3AD 5CPID 4KGCD 4ZUXD 3B6GD 3W99B 1M18B 3W97B 3C1CC 4EO5B 4NE6A 5B33B 2HUEC 4WU8B 3RELC 3UTAC 1KX5C 1B67A 5B0ZB 2IO5B 4J8VD 4XUJB 2HIOD 5GXQD 1F66C 4Z2MG 3AFAA 2ZY2A 1EQZC 5B2JC 3UT9D 3KWQA 3NQUB 5BNVA 5BT1C 3LJAB 3KUYB 3WTPC 3X1UC 3X1SB 3AYWD 4QLCC 5B24D 3H0LC 5AVCA 2YFWB 5B40C 1P34A 5B31D 1AOID 4KUDC 3KWQC 2NZDA 2Y2IA 3AZIB 4R8PA 5FUGA 5AV5A 2VQRA 1P3MC 1P3FA 3TU4A 1N1JA 3FDDA 4DRBA 3EG5B 4AWLC 2F8NH 5BO0B 4XZQD 3AZHB 4R8PC 3MGQC 3REJD 2ZY3A 5CPIC 5AV5C 1ZLAA 3W98C 3H0MC 1P3GB 3TU4C 1P3ID 4X23B 5DNNA 2F8NA 4Z5TA 4WJ3C 5AV8A 3B0DB 4CSRB 5JRGB 1PZRA 2NQBD 3WA9C 4LD9D 1KX4B 3O62D 5GT3A 4WNNB 1ID3D 1ZLAC 3MGRA 2Y2LA 4G91C 4WZSB 4YM6D 5GXQC 4H9QA 5G49B 5B32D 1KX3B 3UT9C 5AY8D 4J8WB 5AV9B 1S32C 3AN2B 3X1TB 3IP4C 3W99A 3REID 3W97A 4J8XD 1M18A 3MGRC 5AVBD 5B33A 3MVDB 2LY8A 1U35C 5B0ZA 3AZJD 5B0YD 3UTBA 4XUJA 3AZLD 3X1VB 3A6ND 3LZ0B 3AZND 2CWEA 3W99C 3KUYA 1M18C 3LJAA 4HGAC 3REHB 3RELB 5GT0B 2Y2MA 3MGSA 4WU8C 3X1SA 1F66B 4XUJC 1JFIB 2YFWA 5CPJB 1EQZB 5B2JB 3AZFC 3VH5A 3WTPB 3X1UB 4UPKA 3KUYC 1R4VA 5GSUD 3LJAC 1KU5A 3AZIA 3V9RB 2CV5D 4QLCB 3AZMD 3W96B 3X1SC 2Y2OA 5B40B 3MGPD 4DRAA 4KUDB 3AZEB 1P3PD 3O62C 1ID3C 2ZY4A 5BO0A 1BH9B 3AZHA 2AROA 1P3MB 3LELD 1HTAA 3NQJB 4Z66B 1P3GA 4X23A 4J8XC 4CSRA 5JRGA 2Y2HA 1A7WA 5AVBC 3MGQB 1P3AB 1KX4A 5CPIB 3W98B 4WNNA 2Y2PA 4ZUXB 3AZLC 2L5AA 5G49A 3A6NC 4X23C 1KX3A 2DF4C 4J8WA 3WA9B 2FJ7D 5JRGC 5AV9A 3AN2A 2Y2GA 3X1TA 3AV1D 1M1AC 2RVQD 4J8VB 5DNMD 2HIOB 5GXQB 3VH6A 2UWXA 3MVDA 3LZ1D 2PYOD 4CAYB 3UT9B 1KX3C 4H9RB 4J8WC 5GSUC 3AYWB 3X1VA 3LZ0A 3R45A 3X1TC 1P3OD 2F8NG 5B24B 3MGPC 3RELA 1AOIB 5GT0A 2JE5A 1H3OB 1F66A 4WV4B 3KSYA 1JFIA 1EQZA 5CPJA 5B2JA 3X1VC 3LZ0C 4HGAB 3WTPA 3X1UA 3WTPE 3REHC 3V9RA 5GT0C 3AZGD 4QLCA 2JCHA 1P3LD 4XZQB 5B1LD 5B40A 3AZFB 3REJB 5CPJC 4KUDA 5AVCD 3B6FD 1Q9CA 3AZEA 1HQ3D 1P3IB 1TAFB 1BH9A 5CPKC 4WU9D 3AV2D 1P3MA 3W96C 3NQJA 3F6TA 5E5AC 4Z66A 2RIQA 1P3KD 3O62B 1ID3B 3AZEC 4YM6B 3AZKD 2ZM5A 5B32B 3MGQA 1P3AA 5CPIA 5AY8B 5F99C 3W98A 5CHLB 4ZUXA 1BH8B 4Z66C 3REIB 4J8XB 5DNND 3WA9A 4Z5TD 5AVBB 4YS3C 1P3AC 4J8VA 3A1KA 2HIOA 5GXQA 3AZLB 4ZUXC 3A6NB 3B0CW 4KGCC 2Y2NA 3B6GC 3UT9A 4ZBJC 3VH5T 4J8UD 5B2ID 1M19D 4H9RA 1S32A 1Z2CB 1P3BD 3AYWA 1M1AB 4J8VC 5B24A 5B1LC 5BNXA 3H0RC 2HIOC 3W97D 1AOIA 1U35A 4UUZB 5B33D 3B6FC 1H3OA 2CV5B 5GSUB 2YFVB 4NE3A 3UTBD 3AYWC 3MGPB 5B24C 4WU8A 5B31C 1AOIC 1P3PB 5KDMB 3MGSD 4XZQA 5B1MD 3AZFA 3C1BD 3NQUA 1P3IA 1TAFA 5AV6D 5JA4B 4E44A 4XZQC 3O62A 3REJC 1ID3A 3VH6T 4YM6A 1P3IC 5CPKB 5B32A 2AROD 5E5AB 4DQYB 1M19C 2FJ7B 4LD9C 2NQBC 1BH8A 1P3GD 3REIA 4J8XA 5DNMB 5AVBA 4YM6C 3LZ1B 3WKJD 3WAAD 5F99B 5B32C 2F8NK 4JJND 5AY8C 1KX4D 3MNND 3AZLA 3A6NA 3REKD 1P3OB 3REIC 3KXBD 4YS3B 1M1AA 3P5JB 2Y2JA 5AV9D 5CP6D 3AZJC 3AN2D 4KGCB 5B0YC 3B0BA 3B6GB 4ZBJB 3AZNC 4G92C 3C1BC 2CV5A 5GSUA 5BNVB 2YFVA 2FFFB 3AZGB 1TZYD 2XD1A 1P3LB 5B1LB 3MGPA 3C1CD 5AVCB 3B6FB 2G5IC 3EPKA 3RELD 5KDMA 3UTAD 1HQ3B 1P3PA 1KX5D 2CV5C 2Y2KA 4H9OB 4WU9B 3AV2B 1F66D 3AZMC 1EQZD 5B2JD 3REHA 5BT1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 B;  1P3K B;  1P3P C;  5JA4 A;  3AZK B;  1ULY A;  5B31 G;  1BFM A;  5B40 D;  2BYK B;  3AFA D;  3LEL C;  4KUD D;  3KWQ D;  5CPK A;  3W96 A;  4Z5T B;  5E5A A;  2FJ7 A;  5BS7 C;  4KHA B;  4M6B A;  3KXB C;  1P3M D;  4H9S C;  1P34 D;  5DNM A;  3LZ1 A;  2NZD D;  5F99 A;  4J8U B;  5B2I B;  1M19 B;  4R8P D;  4LD9 B;  2NQB B;  2JSS A;  5AV5 D;  1P3B B;  2FJ7 C;  3W98 D;  1P3F D;  3TU4 D;  1TZY C;  3AV1 C;  2RVQ C;  1P3O A;  5DNM C;  3LZ1 C;  4YS3 A;  2PYO C;  3WA9 D;  4KGC A;  1ZLA D;  3UTB B;  3B6G A;  5B32 G;  1P3O C;  2F8N D;  3VH5 W;  1WWS A;  5AV8 D;  3AZG A;  1S32 D;  3MGS B;  3AZJ B;  1P3L A;  5B0Y B;  5C3I C;  5B1L A;  5B1M B;  5GT3 D;  3MGR D;  3AZN B;  4G92 B;  4CAY A;  3C1B B;  3B6F A;  1HQ3 A;  3AFA C;  1U35 D;  4H9O A;  5AV6 B;  3AV2 A;  3AZG C;  4WU9 A;  2BYM B;  1P3L C;  3W99 D;  1M18 D;  5B31 A;  1P3K A;  5AVC C;  4WU8 D;  1P34 C;  1HQ3 C;  3AZK A;  5B0Z D;  3AZM B;  4XUJ D;  2NZD C;  4H9N B;  4WU9 C;  3AV2 C;  2BYK A;  3AZF D;  2ARO B;  3KUY D;  1P3F C;  3LJA D;  1P3K C;  3X1S D;  3WKJ B;  4KHA A;  3AZK C;  3WAA B;  3REJ A;  3LEL B;  4JJN B;  3MNN B;  3B0C T;  1B6W A;  3REK B;  3VH6 W;  3AZI D;  4J8U A;  5B2I A;  1M19 A;  4Z2M H;  2NQB A;  4LD9 A;  3KXB B;  5DNN C;  4Z5T C;  1P3B A;  4H9P B;  5AV8 C;  4E45 A;  5CP6 B;  5GT3 C;  5AY8 A;  4J8U C;  3AZH D;  5B2I C;  1P3B C;  1TZY B;  3AV1 B;  4X23 D;  3R45 B;  3C1C B;  2PYO B;  3W97 C;  5JRG D;  2HUE B;  3UTA B;  4EO5 C;  1KX5 B;  5B33 C;  3AZJ A;  5B0Y A;  1M1A D;  5B1M A;  5B0Z C;  2IO5 C;  3AZN A;  3UTB C;  3C1B A;  1F1E A;  1KX3 D;  4J8W D;  5AV6 A;  5C3I B;  4NE5 A;  3MGS C;  2BYM A;  3X1T D;  5B1M C;  1WWI A;  3AFA B;  4UUZ A;  3MVD D;  3KWQ B;  3AZM A;  4H9N A;  5AV6 C;  3AZI C;  3X1V D;  3LZ0 D;  3REH D;  1P34 B;  5GT0 D;  4AWL B;  3WKJ A;  2NZD B;  3WAA A;  4R8P B;  3LEL A;  4JJN A;  5CPJ D;  3AZH C;  3MNN A;  5FUG B;  2ARO C;  5AV5 B;  4NFT A;  1P3F B;  3TU4 B;  3WTP D;  3X1U D;  3REK A;  1N1J B;  1P3G C;  5CPK D;  4QLC D;  5BS7 A;  3KXB A;  3W96 D;  4H9S A;  3WKJ C;  4H9P A;  5E5A D;  3B0D C;  3WAA C;  5CP6 A;  4JJN C;  1KX4 C;  3MNN C;  1ZLA B;  3AZE D;  4G91 B;  3REK C;  5DNN B;  2F8N B;  5F99 D;  5AV8 B;  1TZY A;  1S32 B;  4Z66 D;  3AV1 A;  5AV9 C;  5CP6 C;  3AN2 C;  5GT3 B;  3MGR B;  3C1C A;  2PYO A;  5BNX B;  3UTA A;  4H9Q B;  1KX5 A;  3MVD C;  4YS3 D;  3MGQ D;  1U35 B;  1P3A D;  5CPI D;  4KGC D;  4ZUX D;  3B6G D;  3W99 B;  1M18 B;  3W97 B;  3C1C C;  4EO5 B;  4NE6 A;  5B33 B;  2HUE C;  4WU8 B;  3REL C;  3UTA C;  1KX5 C;  1B67 A;  5B0Z B;  2IO5 B;  4J8V D;  4XUJ B;  2HIO D;  5GXQ D;  1F66 C;  4Z2M G;  3AFA A;  1EQZ C;  5B2J C;  3UT9 D;  3KWQ A;  3NQU B;  5BNV A;  5BT1 C;  3LJA B;  3KUY B;  3WTP C;  3X1U C;  3X1S B;  3AYW D;  4QLC C;  5B24 D;  5AVC A;  2YFW B;  5B40 C;  1P34 A;  5B31 D;  1AOI D;  4KUD C;  3KWQ C;  2NZD A;  3AZI B;  4R8P A;  5FUG A;  5AV5 A;  1P3M C;  1P3F A;  3TU4 A;  1N1J A;  4DRB A;  4AWL C;  2F8N H;  5BO0 B;  4XZQ D;  3AZH B;  4R8P C;  3MGQ C;  3REJ D;  5CPI C;  5AV5 C;  1ZLA A;  3W98 C;  1P3I D;  1P3G B;  3TU4 C;  4X23 B;  5DNN A;  2F8N A;  4Z5T A;  5AV8 A;  3B0D B;  4CSR B;  5JRG B;  2NQB D;  4LD9 D;  3WA9 C;  1KX4 B;  3O62 D;  5GT3 A;  4WNN B;  1ID3 D;  1ZLA C;  3MGR A;  4WZS B;  4G91 C;  4YM6 D;  5GXQ C;  4H9Q A;  5G49 B;  5B32 D;  1KX3 B;  3UT9 C;  5AY8 D;  4J8W B;  5AV9 B;  1S32 C;  3AN2 B;  3X1T B;  3W99 A;  3REI D;  3W97 A;  4J8X D;  1M18 A;  3MGR C;  5AVB D;  5B33 A;  3MVD B;  2LY8 A;  1U35 C;  5B0Z A;  3AZJ D;  5B0Y D;  3UTB A;  4XUJ A;  3AZL D;  3X1V B;  3A6N D;  3LZ0 B;  3AZN D;  2CWE A;  3W99 C;  3KUY A;  1M18 C;  3LJA A;  4HGA C;  3REH B;  3REL B;  5GT0 B;  3MGS A;  4WU8 C;  3X1S A;  1F66 B;  4XUJ C;  1JFI B;  2YFW A;  5CPJ B;  1EQZ B;  5B2J B;  3AZF C;  3VH5 A;  3WTP B;  3X1U B;  3KUY C;  1R4V A;  5GSU D;  3LJA C;  1KU5 A;  3AZI A;  3V9R B;  2CV5 D;  4QLC B;  3AZM D;  3W96 B;  3X1S C;  5B40 B;  3MGP D;  4DRA A;  4KUD B;  3AZE B;  1P3P D;  3O62 C;  1ID3 C;  5BO0 A;  1BH9 B;  3AZH A;  2ARO A;  1P3M B;  3LEL D;  1HTA A;  3NQJ B;  4Z66 B;  1P3G A;  4X23 A;  4J8X C;  4CSR A;  5JRG A;  1A7W A;  5AVB C;  3MGQ B;  1P3A B;  1KX4 A;  5CPI B;  3W98 B;  4WNN A;  4ZUX B;  3AZL C;  2L5A A;  5G49 A;  3A6N C;  4X23 C;  1KX3 A;  4J8W A;  3WA9 B;  2FJ7 D;  5JRG C;  5AV9 A;  3AN2 A;  3X1T A;  3AV1 D;  1M1A C;  2RVQ D;  4J8V B;  5DNM D;  2HIO B;  5GXQ B;  3VH6 A;  3MVD A;  3LZ1 D;  2PYO D;  4CAY B;  3UT9 B;  1KX3 C;  4H9R B;  4J8W C;  5GSU C;  3AYW B;  3X1V A;  3LZ0 A;  3R45 A;  3X1T C;  1P3O D;  2F8N G;  5B24 B;  3MGP C;  3REL A;  1AOI B;  5GT0 A;  1H3O B;  1F66 A;  4WV4 B;  3KSY A;  1JFI A;  1EQZ A;  5CPJ A;  5B2J A;  3X1V C;  3LZ0 C;  4HGA B;  3WTP A;  3X1U A;  3WTP E;  3REH C;  3V9R A;  5GT0 C;  3AZG D;  4QLC A;  1P3L D;  4XZQ B;  5B1L D;  5B40 A;  3AZF B;  3REJ B;  5CPJ C;  4KUD A;  5AVC D;  3B6F D;  1Q9C A;  3AZE A;  1HQ3 D;  1P3I B;  1TAF B;  1BH9 A;  5CPK C;  4WU9 D;  3AV2 D;  1P3M A;  3W96 C;  3NQJ A;  5E5A C;  4Z66 A;  1P3K D;  3O62 B;  1ID3 B;  3AZE C;  4YM6 B;  3AZK D;  5B32 B;  3MGQ A;  1P3A A;  5CPI A;  5AY8 B;  5F99 C;  3W98 A;  5CHL B;  4ZUX A;  1BH8 B;  4Z66 C;  3REI B;  4J8X B;  5DNN D;  3WA9 A;  4Z5T D;  5AVB B;  4YS3 C;  1P3A C;  4J8V A;  2HIO A;  5GXQ A;  3AZL B;  4ZUX C;  3A6N B;  3B0C W;  4KGC C;  3B6G C;  3UT9 A;  4ZBJ C;  3VH5 T;  4J8U D;  5B2I D;  1M19 D;  4H9R A;  1S32 A;  1P3B D;  3AYW A;  1M1A B;  4J8V C;  5B24 A;  5B1L C;  5BNX A;  3W97 D;  2HIO C;  1AOI A;  1U35 A;  4UUZ B;  5B33 D;  3B6F C;  1H3O A;  2CV5 B;  5GSU B;  2YFV B;  4NE3 A;  3UTB D;  3AYW C;  3MGP B;  5B24 C;  4WU8 A;  5B31 C;  1AOI C;  1P3P B;  5KDM B;  3MGS D;  4XZQ A;  5B1M D;  3AZF A;  3C1B D;  3NQU A;  1P3I A;  1TAF A;  5AV6 D;  5JA4 B;  4E44 A;  4XZQ C;  3O62 A;  3REJ C;  1ID3 A;  3VH6 T;  4YM6 A;  1P3I C;  5CPK B;  5B32 A;  2ARO D;  5E5A B;  1M19 C;  2FJ7 B;  4LD9 C;  2NQB C;  1BH8 A;  1P3G D;  3REI A;  4J8X A;  5DNM B;  5AVB A;  4YM6 C;  3LZ1 B;  3WKJ D;  3WAA D;  5F99 B;  5B32 C;  2F8N K;  4JJN D;  5AY8 C;  1KX4 D;  3MNN D;  3AZL A;  3A6N A;  3REK D;  1P3O B;  3REI C;  3KXB D;  4YS3 B;  1M1A A;  5AV9 D;  5CP6 D;  3AZJ C;  3AN2 D;  4KGC B;  5B0Y C;  3B0B A;  3B6G B;  4ZBJ B;  3AZN C;  4G92 C;  3C1B C;  2CV5 A;  5GSU A;  5BNV B;  2YFV A;  3AZG B;  1TZY D;  1P3L B;  5B1L B;  3MGP A;  3C1C D;  5AVC B;  3B6F B;  3UTA D;  3REL D;  1P3P A;  5KDM A;  1HQ3 B;  1KX5 D;  2CV5 C;  4H9O B;  4WU9 B;  3AV2 B;  1F66 D;  3AZM C;  1EQZ D;  5B2J D;  3REH A;  5BT1 D; 
#chains in the Genus database with same CATH topology
 5B31 B;  1P3K B;  3EPH A;  1P3P C;  5JA4 A;  3AZK B;  1ULY A;  5B31 G;  1BFM A;  5B40 D;  2BYK B;  3A1I A;  3AFA D;  3LEL C;  4KUD D;  3KWQ D;  5CPK A;  3W96 A;  4Z5T B;  5E5A A;  2FJ7 A;  5BS7 C;  4KHA B;  4M6B A;  3KXB C;  1P3M D;  4H9S C;  1P34 D;  5DNM A;  1W2E A;  3LZ1 A;  2NZD D;  5F99 A;  4J8U B;  5B2I B;  1M19 B;  2Y2Q A;  4R8P D;  4LD9 B;  2NQB B;  2JSS A;  5AV5 D;  1P3B B;  2FJ7 C;  3W98 D;  2XD5 A;  1P3F D;  3TU4 D;  1TZY C;  3AV1 C;  2RVQ C;  1P3O A;  5DNM C;  1T3U A;  3LZ1 C;  4YS3 A;  2PYO C;  3WA9 D;  4KGC A;  2G5H C;  1ZLA D;  3UTB B;  3B6G A;  5B32 G;  1P3O C;  2F8N D;  2DQN C;  3VH5 W;  1WWS A;  5AV8 D;  3AZG A;  1S32 D;  3MGS B;  3AZJ B;  1P3L A;  5B0Y B;  5C3I C;  5B1L A;  5B1M B;  5GT3 D;  3MGR D;  3AZN B;  4G92 B;  4CAY A;  3C1B B;  3B6F A;  1HQ3 A;  3AFA C;  1U35 D;  2W8S A;  4H9O A;  5AV6 B;  3AV2 A;  3AZG C;  4WU9 A;  2BYM B;  1P3L C;  3W99 D;  1M18 D;  5B31 A;  1P3K A;  5AVC C;  4WU8 D;  1P34 C;  1HQ3 C;  3AZK A;  5B0Z D;  3AZM B;  4XUJ D;  2NZD C;  4H9N B;  4WU9 C;  3AV2 C;  2BYK A;  3AZF D;  2ARO B;  3KUY D;  1P3F C;  3LJA D;  1P3K C;  3X1S D;  3WKJ B;  4KHA A;  3AZK C;  3WAA B;  3REJ A;  3LEL B;  4JJN B;  3MNN B;  3B0C T;  1B6W A;  3REK B;  3VH6 W;  3AZI D;  4J8U A;  5B2I A;  1M19 A;  4Z2M H;  2NQB A;  4LD9 A;  3KXB B;  5DNN C;  4Z5T C;  1P3B A;  4H9P B;  5AV8 C;  4E45 A;  5CP6 B;  5GT3 C;  5AY8 A;  4J8U C;  3AZH D;  5B2I C;  1P3B C;  1TZY B;  3AV1 B;  4X23 D;  3R45 B;  3C1C B;  2PYO B;  3EPJ A;  3W97 C;  5JRG D;  2HUE B;  3UTA B;  4EO5 C;  1KX5 B;  5B33 C;  3AZJ A;  5B0Y A;  1M1A D;  5B1M A;  5B0Z C;  2IO5 C;  3AZN A;  3UTB C;  2ZY5 A;  3C1B A;  1F1E A;  1KX3 D;  4J8W D;  5AV6 A;  5C3I B;  4NE5 A;  3MGS C;  2BYM A;  3X1T D;  5B1M C;  1WWI A;  3AFA B;  4UUZ A;  3MVD D;  3KWQ B;  3AZM A;  4H9N A;  5AV6 C;  3AZI C;  3X1V D;  3LZ0 D;  3REH D;  1P34 B;  5GT0 D;  4AWL B;  3WKJ A;  2NZD B;  2BG1 A;  3WAA A;  4R8P B;  3LEL A;  4JJN A;  5CPJ D;  3AZH C;  3MNN A;  5FUG B;  2ARO C;  5AV5 B;  4NFT A;  3EPL A;  2J8P A;  1P3F B;  3TU4 B;  3WTP D;  3X1U D;  3REK A;  1N1J B;  1P3G C;  5CPK D;  4QLC D;  5BS7 A;  3KXB A;  3W96 D;  4H9S A;  3WKJ C;  4H9P A;  5E5A D;  3B0D C;  3WAA C;  5CP6 A;  4JJN C;  1KX4 C;  3MNN C;  1ZLA B;  3AZE D;  4G91 B;  3AL0 C;  3REK C;  5DNN B;  2F8N B;  5F99 D;  5AV8 B;  2F2A C;  1TZY A;  1S32 B;  4Z66 D;  3AV1 A;  5AV9 C;  5CP6 C;  3AN2 C;  5GT3 B;  3MGR B;  3C1C A;  2PYO A;  5BNX B;  3UTA A;  3KFU G;  4H9Q B;  1KX5 A;  3MVD C;  4YS3 D;  3MGQ D;  1U35 B;  1P3A D;  5CPI D;  4KGC D;  4ZUX D;  3B6G D;  3W99 B;  1M18 B;  3W97 B;  3C1C C;  4EO5 B;  4NE6 A;  5B33 B;  2HUE C;  4WU8 B;  3REL C;  3UTA C;  1KX5 C;  1B67 A;  5B0Z B;  2IO5 B;  4J8V D;  4XUJ B;  2HIO D;  5GXQ D;  1F66 C;  4Z2M G;  3AFA A;  2ZY2 A;  1EQZ C;  5B2J C;  3UT9 D;  3KWQ A;  3NQU B;  5BNV A;  5BT1 C;  3LJA B;  3KUY B;  3WTP C;  3X1U C;  3X1S B;  3AYW D;  4QLC C;  5B24 D;  3H0L C;  5AVC A;  2YFW B;  5B40 C;  1P34 A;  5B31 D;  1AOI D;  4KUD C;  3KWQ C;  2NZD A;  2Y2I A;  3AZI B;  4R8P A;  5FUG A;  5AV5 A;  2VQR A;  1P3M C;  1P3F A;  3TU4 A;  1N1J A;  3FDD A;  4DRB A;  3EG5 B;  4AWL C;  2F8N H;  5BO0 B;  4XZQ D;  3AZH B;  4R8P C;  3MGQ C;  3REJ D;  2ZY3 A;  5CPI C;  5AV5 C;  1ZLA A;  3W98 C;  3H0M C;  1P3G B;  3TU4 C;  1P3I D;  4X23 B;  5DNN A;  2F8N A;  4Z5T A;  4WJ3 C;  5AV8 A;  3B0D B;  4CSR B;  5JRG B;  1PZR A;  2NQB D;  3WA9 C;  4LD9 D;  1KX4 B;  3O62 D;  5GT3 A;  4WNN B;  1ID3 D;  1ZLA C;  3MGR A;  2Y2L A;  4G91 C;  4WZS B;  4YM6 D;  5GXQ C;  4H9Q A;  5G49 B;  5B32 D;  1KX3 B;  3UT9 C;  5AY8 D;  4J8W B;  5AV9 B;  1S32 C;  3AN2 B;  3X1T B;  3IP4 C;  3W99 A;  3REI D;  3W97 A;  4J8X D;  1M18 A;  3MGR C;  5AVB D;  5B33 A;  3MVD B;  2LY8 A;  1U35 C;  5B0Z A;  3AZJ D;  5B0Y D;  3UTB A;  4XUJ A;  3AZL D;  3X1V B;  3A6N D;  3LZ0 B;  3AZN D;  2CWE A;  3W99 C;  3KUY A;  1M18 C;  3LJA A;  4HGA C;  3REH B;  3REL B;  5GT0 B;  2Y2M A;  3MGS A;  4WU8 C;  3X1S A;  1F66 B;  4XUJ C;  1JFI B;  2YFW A;  5CPJ B;  1EQZ B;  5B2J B;  3AZF C;  3VH5 A;  3WTP B;  3X1U B;  4UPK A;  3KUY C;  1R4V A;  5GSU D;  3LJA C;  1KU5 A;  3AZI A;  3V9R B;  2CV5 D;  4QLC B;  3AZM D;  3W96 B;  3X1S C;  2Y2O A;  5B40 B;  3MGP D;  4DRA A;  4KUD B;  3AZE B;  1P3P D;  3O62 C;  1ID3 C;  2ZY4 A;  5BO0 A;  1BH9 B;  3AZH A;  2ARO A;  1P3M B;  3LEL D;  1HTA A;  3NQJ B;  4Z66 B;  1P3G A;  4X23 A;  4J8X C;  4CSR A;  5JRG A;  2Y2H A;  1A7W A;  5AVB C;  3MGQ B;  1P3A B;  1KX4 A;  5CPI B;  3W98 B;  4WNN A;  2Y2P A;  4ZUX B;  3AZL C;  2L5A A;  5G49 A;  3A6N C;  4X23 C;  1KX3 A;  2DF4 C;  4J8W A;  3WA9 B;  2FJ7 D;  5JRG C;  5AV9 A;  3AN2 A;  2Y2G A;  3X1T A;  3AV1 D;  1M1A C;  2RVQ D;  4J8V B;  5DNM D;  2HIO B;  5GXQ B;  3VH6 A;  2UWX A;  3MVD A;  3LZ1 D;  2PYO D;  4CAY B;  3UT9 B;  1KX3 C;  4H9R B;  4J8W C;  5GSU C;  3AYW B;  3X1V A;  3LZ0 A;  3R45 A;  3X1T C;  1P3O D;  2F8N G;  5B24 B;  3MGP C;  3REL A;  1AOI B;  5GT0 A;  2JE5 A;  1H3O B;  1F66 A;  4WV4 B;  3KSY A;  1JFI A;  1EQZ A;  5CPJ A;  5B2J A;  3X1V C;  3LZ0 C;  4HGA B;  3WTP A;  3X1U A;  3WTP E;  3REH C;  3V9R A;  5GT0 C;  3AZG D;  4QLC A;  2JCH A;  1P3L D;  4XZQ B;  5B1L D;  5B40 A;  3AZF B;  3REJ B;  5CPJ C;  4KUD A;  5AVC D;  3B6F D;  1Q9C A;  3AZE A;  1HQ3 D;  1P3I B;  1TAF B;  1BH9 A;  5CPK C;  4WU9 D;  3AV2 D;  1P3M A;  3W96 C;  3NQJ A;  3F6T A;  5E5A C;  4Z66 A;  2RIQ A;  1P3K D;  3O62 B;  1ID3 B;  3AZE C;  4YM6 B;  3AZK D;  2ZM5 A;  5B32 B;  3MGQ A;  1P3A A;  5CPI A;  5AY8 B;  5F99 C;  3W98 A;  5CHL B;  4ZUX A;  1BH8 B;  4Z66 C;  3REI B;  4J8X B;  5DNN D;  3WA9 A;  4Z5T D;  5AVB B;  4YS3 C;  1P3A C;  4J8V A;  3A1K A;  2HIO A;  5GXQ A;  3AZL B;  4ZUX C;  3A6N B;  3B0C W;  4KGC C;  2Y2N A;  3B6G C;  3UT9 A;  4ZBJ C;  3VH5 T;  4J8U D;  5B2I D;  1M19 D;  4H9R A;  1S32 A;  1Z2C B;  1P3B D;  3AYW A;  1M1A B;  4J8V C;  5B24 A;  5B1L C;  5BNX A;  3H0R C;  2HIO C;  3W97 D;  1AOI A;  1U35 A;  4UUZ B;  5B33 D;  3B6F C;  1H3O A;  2CV5 B;  5GSU B;  2YFV B;  4NE3 A;  3UTB D;  3AYW C;  3MGP B;  5B24 C;  4WU8 A;  5B31 C;  1AOI C;  1P3P B;  5KDM B;  3MGS D;  4XZQ A;  5B1M D;  3AZF A;  3C1B D;  3NQU A;  1P3I A;  1TAF A;  5AV6 D;  5JA4 B;  4E44 A;  4XZQ C;  3O62 A;  3REJ C;  1ID3 A;  3VH6 T;  4YM6 A;  1P3I C;  5CPK B;  5B32 A;  2ARO D;  5E5A B;  4DQY B;  1M19 C;  2FJ7 B;  4LD9 C;  2NQB C;  1BH8 A;  1P3G D;  3REI A;  4J8X A;  5DNM B;  5AVB A;  4YM6 C;  3LZ1 B;  3WKJ D;  3WAA D;  5F99 B;  5B32 C;  2F8N K;  4JJN D;  5AY8 C;  1KX4 D;  3MNN D;  3AZL A;  3A6N A;  3REK D;  1P3O B;  3REI C;  3KXB D;  4YS3 B;  1M1A A;  3P5J B;  2Y2J A;  5AV9 D;  5CP6 D;  3AZJ C;  3AN2 D;  4KGC B;  5B0Y C;  3B0B A;  3B6G B;  4ZBJ B;  3AZN C;  4G92 C;  3C1B C;  2CV5 A;  5GSU A;  5BNV B;  2YFV A;  2FFF B;  3AZG B;  1TZY D;  2XD1 A;  1P3L B;  5B1L B;  3MGP A;  3C1C D;  5AVC B;  3B6F B;  2G5I C;  3EPK A;  3REL D;  5KDM A;  3UTA D;  1HQ3 B;  1P3P A;  1KX5 D;  2CV5 C;  2Y2K A;  4H9O B;  4WU9 B;  3AV2 B;  1F66 D;  3AZM C;  1EQZ D;  5B2J D;  3REH A;  5BT1 D; 
#chains in the Genus database with same CATH homology
 5B31 B;  1P3K B;  3EPH A;  1P3P C;  5JA4 A;  3AZK B;  1ULY A;  5B31 G;  1BFM A;  5B40 D;  2BYK B;  3A1I A;  3AFA D;  3LEL C;  4KUD D;  3KWQ D;  5CPK A;  3W96 A;  4Z5T B;  5E5A A;  2FJ7 A;  5BS7 C;  4KHA B;  4M6B A;  3KXB C;  1P3M D;  4H9S C;  1P34 D;  5DNM A;  1W2E A;  3LZ1 A;  2NZD D;  5F99 A;  4J8U B;  5B2I B;  1M19 B;  2Y2Q A;  4R8P D;  4LD9 B;  2NQB B;  2JSS A;  5AV5 D;  1P3B B;  2FJ7 C;  3W98 D;  2XD5 A;  1P3F D;  3TU4 D;  1TZY C;  3AV1 C;  2RVQ C;  1P3O A;  5DNM C;  1T3U A;  3LZ1 C;  4YS3 A;  2PYO C;  3WA9 D;  4KGC A;  2G5H C;  1ZLA D;  3UTB B;  3B6G A;  5B32 G;  1P3O C;  2F8N D;  2DQN C;  3VH5 W;  1WWS A;  5AV8 D;  3AZG A;  1S32 D;  3MGS B;  3AZJ B;  1P3L A;  5B0Y B;  5C3I C;  5B1L A;  5B1M B;  5GT3 D;  3MGR D;  3AZN B;  4G92 B;  4CAY A;  3C1B B;  3B6F A;  1HQ3 A;  3AFA C;  1U35 D;  2W8S A;  4H9O A;  5AV6 B;  3AV2 A;  3AZG C;  4WU9 A;  2BYM B;  1P3L C;  3W99 D;  1M18 D;  5B31 A;  1P3K A;  5AVC C;  4WU8 D;  1P34 C;  1HQ3 C;  3AZK A;  5B0Z D;  3AZM B;  4XUJ D;  2NZD C;  4H9N B;  4WU9 C;  3AV2 C;  2BYK A;  3AZF D;  2ARO B;  3KUY D;  1P3F C;  3LJA D;  1P3K C;  3X1S D;  3WKJ B;  4KHA A;  3AZK C;  3WAA B;  3REJ A;  3LEL B;  4JJN B;  3MNN B;  3B0C T;  1B6W A;  3REK B;  3VH6 W;  3AZI D;  4J8U A;  5B2I A;  1M19 A;  4Z2M H;  2NQB A;  4LD9 A;  3KXB B;  5DNN C;  4Z5T C;  1P3B A;  4H9P B;  5AV8 C;  4E45 A;  5CP6 B;  5GT3 C;  5AY8 A;  4J8U C;  3AZH D;  5B2I C;  1P3B C;  1TZY B;  3AV1 B;  4X23 D;  3R45 B;  3C1C B;  2PYO B;  3EPJ A;  3W97 C;  5JRG D;  2HUE B;  3UTA B;  4EO5 C;  1KX5 B;  5B33 C;  3AZJ A;  5B0Y A;  1M1A D;  5B1M A;  5B0Z C;  2IO5 C;  3AZN A;  3UTB C;  2ZY5 A;  3C1B A;  1F1E A;  1KX3 D;  4J8W D;  5AV6 A;  5C3I B;  4NE5 A;  3MGS C;  2BYM A;  3X1T D;  5B1M C;  1WWI A;  3AFA B;  4UUZ A;  3MVD D;  3KWQ B;  3AZM A;  4H9N A;  5AV6 C;  3AZI C;  3X1V D;  3LZ0 D;  3REH D;  1P34 B;  5GT0 D;  4AWL B;  3WKJ A;  2NZD B;  2BG1 A;  3WAA A;  4R8P B;  3LEL A;  4JJN A;  5CPJ D;  3AZH C;  3MNN A;  5FUG B;  2ARO C;  5AV5 B;  4NFT A;  3EPL A;  2J8P A;  1P3F B;  3TU4 B;  3WTP D;  3X1U D;  3REK A;  1N1J B;  1P3G C;  5CPK D;  4QLC D;  5BS7 A;  3KXB A;  3W96 D;  4H9S A;  3WKJ C;  4H9P A;  5E5A D;  3B0D C;  3WAA C;  5CP6 A;  4JJN C;  1KX4 C;  3MNN C;  1ZLA B;  3AZE D;  4G91 B;  3AL0 C;  3REK C;  5DNN B;  2F8N B;  5F99 D;  5AV8 B;  2F2A C;  1TZY A;  1S32 B;  4Z66 D;  3AV1 A;  5AV9 C;  5CP6 C;  3AN2 C;  5GT3 B;  3MGR B;  3C1C A;  2PYO A;  5BNX B;  3UTA A;  3KFU G;  4H9Q B;  1KX5 A;  3MVD C;  4YS3 D;  3MGQ D;  1U35 B;  1P3A D;  5CPI D;  4KGC D;  4ZUX D;  3B6G D;  3W99 B;  1M18 B;  3W97 B;  3C1C C;  4EO5 B;  4NE6 A;  5B33 B;  2HUE C;  4WU8 B;  3REL C;  3UTA C;  1KX5 C;  1B67 A;  5B0Z B;  2IO5 B;  4J8V D;  4XUJ B;  2HIO D;  5GXQ D;  1F66 C;  4Z2M G;  3AFA A;  2ZY2 A;  1EQZ C;  5B2J C;  3UT9 D;  3KWQ A;  3NQU B;  5BNV A;  5BT1 C;  3LJA B;  3KUY B;  3WTP C;  3X1U C;  3X1S B;  3AYW D;  4QLC C;  5B24 D;  3H0L C;  5AVC A;  2YFW B;  5B40 C;  1P34 A;  5B31 D;  1AOI D;  4KUD C;  3KWQ C;  2NZD A;  2Y2I A;  3AZI B;  4R8P A;  5FUG A;  5AV5 A;  2VQR A;  1P3M C;  1P3F A;  3TU4 A;  1N1J A;  3FDD A;  4DRB A;  3EG5 B;  4AWL C;  2F8N H;  5BO0 B;  4XZQ D;  3AZH B;  4R8P C;  3MGQ C;  3REJ D;  2ZY3 A;  5CPI C;  5AV5 C;  1ZLA A;  3W98 C;  3H0M C;  1P3G B;  3TU4 C;  1P3I D;  4X23 B;  5DNN A;  2F8N A;  4Z5T A;  4WJ3 C;  5AV8 A;  3B0D B;  4CSR B;  5JRG B;  1PZR A;  2NQB D;  3WA9 C;  4LD9 D;  1KX4 B;  3O62 D;  5GT3 A;  4WNN B;  1ID3 D;  1ZLA C;  3MGR A;  2Y2L A;  4G91 C;  4WZS B;  4YM6 D;  5GXQ C;  4H9Q A;  5G49 B;  5B32 D;  1KX3 B;  3UT9 C;  5AY8 D;  4J8W B;  5AV9 B;  1S32 C;  3AN2 B;  3X1T B;  3IP4 C;  3W99 A;  3REI D;  3W97 A;  4J8X D;  1M18 A;  3MGR C;  5AVB D;  5B33 A;  3MVD B;  2LY8 A;  1U35 C;  5B0Z A;  3AZJ D;  5B0Y D;  3UTB A;  4XUJ A;  3AZL D;  3X1V B;  3A6N D;  3LZ0 B;  3AZN D;  2CWE A;  3W99 C;  3KUY A;  1M18 C;  3LJA A;  4HGA C;  3REH B;  3REL B;  5GT0 B;  2Y2M A;  3MGS A;  4WU8 C;  3X1S A;  1F66 B;  4XUJ C;  1JFI B;  2YFW A;  5CPJ B;  1EQZ B;  5B2J B;  3AZF C;  3VH5 A;  3WTP B;  3X1U B;  4UPK A;  3KUY C;  1R4V A;  5GSU D;  3LJA C;  1KU5 A;  3AZI A;  3V9R B;  2CV5 D;  4QLC B;  3AZM D;  3W96 B;  3X1S C;  2Y2O A;  5B40 B;  3MGP D;  4DRA A;  4KUD B;  3AZE B;  1P3P D;  3O62 C;  1ID3 C;  2ZY4 A;  5BO0 A;  1BH9 B;  3AZH A;  2ARO A;  1P3M B;  3LEL D;  1HTA A;  3NQJ B;  4Z66 B;  1P3G A;  4X23 A;  4J8X C;  4CSR A;  5JRG A;  2Y2H A;  1A7W A;  5AVB C;  3MGQ B;  1P3A B;  1KX4 A;  5CPI B;  3W98 B;  4WNN A;  2Y2P A;  4ZUX B;  3AZL C;  2L5A A;  5G49 A;  3A6N C;  4X23 C;  1KX3 A;  2DF4 C;  4J8W A;  3WA9 B;  2FJ7 D;  5JRG C;  5AV9 A;  3AN2 A;  2Y2G A;  3X1T A;  3AV1 D;  1M1A C;  2RVQ D;  4J8V B;  5DNM D;  2HIO B;  5GXQ B;  3VH6 A;  2UWX A;  3MVD A;  3LZ1 D;  2PYO D;  4CAY B;  3UT9 B;  1KX3 C;  4H9R B;  4J8W C;  5GSU C;  3AYW B;  3X1V A;  3LZ0 A;  3R45 A;  3X1T C;  1P3O D;  2F8N G;  5B24 B;  3MGP C;  3REL A;  1AOI B;  5GT0 A;  2JE5 A;  1H3O B;  1F66 A;  4WV4 B;  3KSY A;  1JFI A;  1EQZ A;  5CPJ A;  5B2J A;  3X1V C;  3LZ0 C;  4HGA B;  3WTP A;  3X1U A;  3WTP E;  3REH C;  3V9R A;  5GT0 C;  3AZG D;  4QLC A;  2JCH A;  1P3L D;  4XZQ B;  5B1L D;  5B40 A;  3AZF B;  3REJ B;  5CPJ C;  4KUD A;  5AVC D;  3B6F D;  1Q9C A;  3AZE A;  1HQ3 D;  1P3I B;  1TAF B;  1BH9 A;  5CPK C;  4WU9 D;  3AV2 D;  1P3M A;  3W96 C;  3NQJ A;  3F6T A;  5E5A C;  4Z66 A;  2RIQ A;  1P3K D;  3O62 B;  1ID3 B;  3AZE C;  4YM6 B;  3AZK D;  2ZM5 A;  5B32 B;  3MGQ A;  1P3A A;  5CPI A;  5AY8 B;  5F99 C;  3W98 A;  5CHL B;  4ZUX A;  1BH8 B;  4Z66 C;  3REI B;  4J8X B;  5DNN D;  3WA9 A;  4Z5T D;  5AVB B;  4YS3 C;  1P3A C;  4J8V A;  3A1K A;  2HIO A;  5GXQ A;  3AZL B;  4ZUX C;  3A6N B;  3B0C W;  4KGC C;  2Y2N A;  3B6G C;  3UT9 A;  4ZBJ C;  3VH5 T;  4J8U D;  5B2I D;  1M19 D;  4H9R A;  1S32 A;  1Z2C B;  1P3B D;  3AYW A;  1M1A B;  4J8V C;  5B24 A;  5B1L C;  5BNX A;  3H0R C;  2HIO C;  3W97 D;  1AOI A;  1U35 A;  4UUZ B;  5B33 D;  3B6F C;  1H3O A;  2CV5 B;  5GSU B;  2YFV B;  4NE3 A;  3UTB D;  3AYW C;  3MGP B;  5B24 C;  4WU8 A;  5B31 C;  1AOI C;  1P3P B;  5KDM B;  3MGS D;  4XZQ A;  5B1M D;  3AZF A;  3C1B D;  3NQU A;  1P3I A;  1TAF A;  5AV6 D;  5JA4 B;  4E44 A;  4XZQ C;  3O62 A;  3REJ C;  1ID3 A;  3VH6 T;  4YM6 A;  1P3I C;  5CPK B;  5B32 A;  2ARO D;  5E5A B;  4DQY B;  1M19 C;  2FJ7 B;  4LD9 C;  2NQB C;  1BH8 A;  1P3G D;  3REI A;  4J8X A;  5DNM B;  5AVB A;  4YM6 C;  3LZ1 B;  3WKJ D;  3WAA D;  5F99 B;  5B32 C;  2F8N K;  4JJN D;  5AY8 C;  1KX4 D;  3MNN D;  3AZL A;  3A6N A;  3REK D;  1P3O B;  3REI C;  3KXB D;  4YS3 B;  1M1A A;  3P5J B;  2Y2J A;  5AV9 D;  5CP6 D;  3AZJ C;  3AN2 D;  4KGC B;  5B0Y C;  3B0B A;  3B6G B;  4ZBJ B;  3AZN C;  4G92 C;  3C1B C;  2CV5 A;  5GSU A;  5BNV B;  2YFV A;  2FFF B;  3AZG B;  1TZY D;  2XD1 A;  1P3L B;  5B1L B;  3MGP A;  3C1C D;  5AVC B;  3B6F B;  2G5I C;  3EPK A;  3REL D;  5KDM A;  3UTA D;  1HQ3 B;  1P3P A;  1KX5 D;  2CV5 C;  2Y2K A;  4H9O B;  4WU9 B;  3AV2 B;  1F66 D;  3AZM C;  1EQZ D;  5B2J D;  3REH A;  5BT1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...