2AROD

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 24
structure length 83
sequence length 83
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroD00
3MGQC 4J8UD 3LZ0B 2PYOD 3AZLD 2NQBC 5B33C 3REID 5CPJB 1ULYA 4H9QA 5BNXB 3MVDA 3AV2B 1P34B 2BYMB 3W99C 5E5AA 5DNMD 5F99A 5GT3A 4JJND 4XZQD 3MGRC 4WU8A 3AZMB 1P3OB 3KWQA 3REKD 5AV5C 1KX4C 4KHAB 1P3LD 3LJAD 3NQJB 2YFVB 1KX5A 3O62D 1HQ3B 4Z5TC 5BO0A 4J8XA 3MGQB 3AYWC 4KUDD 4ZUXC 3W97A 5GT0D 1P3MD 1EQZD 2NQBB 3AFAD 2F8NK 3WTPE 5B2IA 5B31A 4WV4B 3W99B 2HUEC 5AV8C 3MGRB 4E45A 3X1SC 2HIOA 5AV5B 3MGSC 1KX4B 2IO5B 1ID3A 5CPKA 4YS3D 4Z5TB 4QLCA 5B2JA 1AOIA 4ZUXB 3RELA 2F8NB 2AROC 3AZJA 2NZDA 1ZLAC 4J8UA 3LZ1C 2PYOA 2HUEB 5JRGD 3MNNA 5AV8B 5AVBA 5B1LC 3AZLA 1M18C 5KDMA 5FUGB 5B32G 3NQUA 3UTAC 3VH5A 3AZHD 3MGSB 3B0DC 4JJNA 2BYKB 4XZQA 4H9SA 1KX3C 3REKA 4J8WD 4Z66D 2LY8A 1P3LA 3O62A 2AROB 5GXQB 2RVQC 3REJC 3AZGA 1TAFB 1ZLAB 3WAAD 4KGCB 3KSYA 1Q9CA 3LZ1B 4KUDA 1P3MA 5GT0A 1EQZA 1F66D 5B1LB 4WU9D 1M18B 3AZED 1P3BC 3UTAB 1P3AA 4CSRA 3B0DB 3X1TA 3C1BC 3WKJC 3LZ0A 5B24D 3WTPC 1KX3B 3AN2D 1S32B 2BYMA 4HGAC 4G91B 3TU4C 4YS3A 3REJB 3W98B 3VH6A 3AZMA 4M6BA 1P3OA 3VH5W 1KX5D 3W96B 5B0YD 5BNVB 3C1CC 5AY8C 3W97D 3A6NC 3WKJB 1N1JB 5AVCD 3X1UC 3AZND 5DNMC 3AZHA 1M1AC 3LELC 1P3PB 4HGAB 3TU4B 3LJAC 4LD9D 4J8WA 4Z66A 1P3FC 1B67A 3UTBC 2FJ7D 4Z2MH 3B6GC 3V9RB 4YM6D 4WZSB 4CAYA 4J8VC 3WAAA 4QLCD 3REHB 1M19D 1P3KC 1AOID 3C1CB 4Z5TA 5BS7A 5AY8B 3A6NB 5DNND 1F66A 4WU9A 5B31G 3AZEA 3X1UB 2NZDD 3AZJD 4ZUXA 4XUJC 4H9RA 1M1AB 4NE3A 3MNND 5B32C 5AVBD 1R4VA 3VH6W 5AV6B 5CPIB 3LELB 5B24A 5B1MD 5GSUD 3AZIC 3AN2A 1P3FB 3X1VC 5AV9B 3UTBB 5FUGA 1U35C 3B6GB 4X23C 3AZFC 1WWSA 4H9PA 1JFIB 4J8VB 2BYKA 1P3KB 1F1EA 3KXBB 3AZKC 5B0YA 3AZGD 3AV1C 5CP6C 3B6FC 4XUJB 5GXQA 1BH9B 3KUYD 1TAFA 5B32B 5B33B 4KGCA 1TZYD 5AVCA 3LZ1A 3AZNA 3AZIB 1P3AD 4R8PC 3X1VB 5CPID 2CV5C 1U35B 3X1TD 4X23B 3LZ0D 4LD9A 5CPJD 1KX3A 2FJ7A 4YM6A 1HTAA 3AZKB 1H3OA 4DRAA 3AV2D 1P34D 3B0CW 5AV9D 3MGPC 3AV1B 1S32A 4Z2MG 5CP6B 1M19A 3B6FB 3AYWB 2F8NH 3AZMD 1P3GC 1P3OD 5DNNA 3W98A 5BT1D 1P3IC 4R8PB 4H9OB 3W96A 2CV5B 1HQ3D 3MVDC 3MGQD 5E5AC 5B1MA 5GSUA 5GT3C 5F99C 3X1SB 4WU8C 2NQBD 5B33D 1N1JA 3WKJA 3KWQC 3MGPB 3W99D 1BH8B 3MGRD 1P3PA 1P3GB 4J8XC 5AV5D 1KX4D 3W97C 3V9RA 1P3IB 5B2IC 4H9QB 4Z5TD 5B31C 3R45B 3MVDB 4UUZB 3KUYA 3REHA 1TZYA 5E5AB 5B40C 5F99B 5GT3B 4ZUXD 5AY8A 3A6NA 4WU8B 2L5AA 1KU5A 2F8ND 3X1UA 5CPIA 3KWQB 3VH5T 2HIOC 3WA9C 1ID3C 5AV8D 5B0ZC 5AV6A 5CPKC 5CPJA 3LELA 5BO0B 4QLCC 4J8XB 5B2JC 5BNXA 1P34A 4ZBJC 3AV2A 3UT9C 5AV9A 3MGSD 3B6GA 3RELC 2NZDC 3AZJC 5B2IB 5B31B 4J8UC 1JFIA 5B40B 3B0BA 2PYOC 4KHAA 1P3BB 5AVBC 3AZLC 4WNNB 3NQJA 3KXBA 3REIC 2YFVA 2AROD 1HQ3A 5GXQD 3C1BB 1ZLAD 2HIOB 3MGQA 3WA9B 4KGCD 3WTPB 3LZ1D 4JJNC 1ID3B 4XZQC 1BH9A 5B32A 5B0ZB 4H9SC 5B1LD 5B33A 2CWEA 5CPKB 1M18D 2NQBA 3REKC 5CHLB 5B2JB 2YFWB 3UTAD 3UT9B 3X1VA 1P3LC 3W99A 3RELB 3O62C 3MGRA 1KX3D 4J8UB 3VH6T 4KUDC 5AV5A 1KX4A 1P3MC 5GT0C 1EQZC 2PYOB 3AZLB 1S32D 3AFAC 3REIB 2RVQD 3REJD 1A7WA 4NE5A 3AYWA 3W98D 5DNMB 4JJNB 4XZQB 2F8NA 3W96D 3REKB 3LJAB 4H9OA 5C3IC 2CV5A 5AV8A 3O62B 3WKJD 4YS3C 3X1SA 3AZMC 3MGSA 4KUDB 1P3MB 1EQZB 3AFAB 1P3PD 3TU4D 1BH8A 5JRGC 2AROA 4G92C 2JSSA 1ZLAA 3AZHC 3REHD 3B0CT 1P3IA 3C1CD 5C3IB 5AY8D 3R45A 3A6ND 4UUZA 5B1LA 1M18A 4YS3B 3X1UD 5JA4B 4J8WC 4Z66C 3UTAA 3AZFB 5G49B 1M1AD 5AV6D 3LELD 2IO5C 3WAAC 1P3FD 3UTBD 5JRGB 5BS7C 1F66C 3B6GD 4AWLC 4WU9C 3AZEC 4G92B 3REJA 4J8VD 3AZHB 1P3KD 1WWIA 3KXBD 5B24C 5B40A 4J8WB 4Z66B 1P3BA 3AN2C 4WNNA 4XUJD 5BNVA 5B32D 3C1BA 3WA9A 4CAYB 3WTPA 3WAAB 4NE6A 3AZID 5B0ZA 3X1VD 4H9NB 1F66B 1U35D 4AWLB 4X23D 4WU9B 1KX5C 3AZEB 2YFWA 5B0YC 3UT9A 3AZFD 3TU4A 4H9RB 5GXQC 4KGCC 3AZKD 5AVCC 5B24B 3AZNC 3AV1D 3AN2B 5CP6D 3REIA 3B6FD 3AYWD 3C1CA 4H9PB 4LD9C 5DNMA 4R8PD 1M1AA 2FJ7C 4YM6C 2CV5D 1KX5B 5B0YB 4E44A 3LJAA 1S32C 1M19C 1AOIC 3X1SD 1P3FA 4G91C 3UTBA 3W97B 5DNNC 3W98C 5AVCB 3AZNB 3MGPD 4J8VA 3AFAA 1P3KA 3W96C 3MNNC 1P3GD 2F8NG 5B1MC 4LD9B 5GSUC 1P3ID 4XUJA 2FJ7B 4YM6B 3MVDD 1H3OB 4EO5C 1B6WA 5E5AD 4QLCB 5F99D 5GT3D 1M19B 4ZBJB 3AZIA 1AOIB 4WU8D 1P3PC 5JA4A 5DNNB 3KWQD 1U35A 4DRBA 4X23A 3AZGC 5G49A 3AZFA 3AZJB 2NZDB 3MNNB 3KUYC 5AVBB 4J8XD 3REHC 1TZYC 5KDMB 3AZKA 5B1MB 3NQUB 5GSUB 5JRGA 3AV1A 1BFMA 5CP6A 1P3AC 3B6FA 5CPIC 4NFTA 3X1TC 5B2ID 5B31D 3LZ0C 4EO5B 5B40D 1P3BD 5AV6C 5CPJC 4R8PA 1P3LB 1P34C 3AV2C 3C1BD 2HIOD 5AV9C 3AZGB 3WA9D 3WTPD 1ID3D 5B0ZD 5CPKD 1P3OC 5GT0B 3KUYB 5B2JD 1TZYB 3UT9D 3MGPA 4H9NA 5BT1C 3KXBC 1P3AB 3RELD 4CSRB 1HQ3C 1P3GA 3X1TB
chains in the Genus database with same CATH superfamily
3MGQC 4J8UD 3LZ0B 2PYOD 3AZLD 2NQBC 5B33C 3REID 5CPJB 1ULYA 4H9QA 5BNXB 3MVDA 3AV2B 1P34B 2BYMB 4UPKA 3W99C 2Y2GA 5E5AA 5DNMD 5F99A 5GT3A 4JJND 4XZQD 3MGRC 4WU8A 3AZMB 1P3OB 3KWQA 3REKD 5AV5C 1KX4C 4KHAB 1P3LD 3LJAD 3NQJB 2YFVB 1KX5A 3O62D 1HQ3B 4Z5TC 5BO0A 4J8XA 3IP4C 3MGQB 3AYWC 3A1KA 4KUDD 4ZUXC 3W97A 5GT0D 1P3MD 1EQZD 2NQBB 3AFAD 2F8NK 3WTPE 5B2IA 5B31A 4WV4B 3W99B 2HUEC 5AV8C 3MGRB 4E45A 3X1SC 2HIOA 5AV5B 3MGSC 1KX4B 2IO5B 1ID3A 2DQNC 5CPKA 4YS3D 4Z5TB 4QLCA 5B2JA 1AOIA 4ZUXB 3RELA 2F8NB 1T3UA 2AROC 3AZJA 2NZDA 1ZLAC 4J8UA 3LZ1C 2PYOA 2HUEB 5JRGD 3MNNA 5AV8B 5AVBA 5B1LC 3AZLA 1M18C 5KDMA 5FUGB 5B32G 3NQUA 3UTAC 3VH5A 3AZHD 3MGSB 2JE5A 3B0DC 4JJNA 2BYKB 4XZQA 4H9SA 1KX3C 3REKA 4J8WD 4Z66D 2LY8A 1P3LA 2ZY5A 3O62A 2AROB 5GXQB 2RVQC 3REJC 3AZGA 1TAFB 1ZLAB 3WAAD 4KGCB 3KSYA 1Q9CA 3EPHA 3LZ1B 4KUDA 2Y2KA 1P3MA 5GT0A 1EQZA 1F66D 5B1LB 4WU9D 1M18B 3AZED 1P3BC 3UTAB 1P3AA 4CSRA 3B0DB 3X1TA 3C1BC 3WKJC 3LZ0A 5B24D 3WTPC 1KX3B 3AN2D 4WJ3C 1S32B 2BYMA 4HGAC 4G91B 3TU4C 4YS3A 3REJB 3W98B 2Y2JA 3VH6A 3AZMA 4M6BA 1P3OA 3VH5W 1KX5D 3W96B 5B0YD 5BNVB 3C1CC 5AY8C 3W97D 3A6NC 2DF4C 1N1JB 3WKJB 5AVCD 3X1UC 3AZND 5DNMC 3AZHA 1M1AC 2BG1A 3LELC 1P3PB 4HGAB 3TU4B 3LJAC 4LD9D 4J8WA 4Z66A 1P3FC 1B67A 3UTBC 2FJ7D 4Z2MH 3B6GC 3V9RB 4YM6D 4WZSB 4CAYA 4J8VC 3WAAA 4QLCD 3REHB 1M19D 1P3KC 1AOID 3C1CB 4Z5TA 5BS7A 5AY8B 3A6NB 5DNND 1F66A 4WU9A 5B31G 3AZEA 3X1UB 2NZDD 3AZJD 4ZUXA 4XUJC 4H9RA 1M1AB 2J8PA 2Y2NA 4NE3A 3MNND 5B32C 5AVBD 1R4VA 3VH6W 5AV6B 5CPIB 3LELB 5B24A 5B1MD 5GSUD 3AZIC 3AN2A 1P3FB 3X1VC 5AV9B 3UTBB 5FUGA 1U35C 3B6GB 4X23C 3AZFC 1WWSA 1Z2CB 4H9PA 1JFIB 2UWXA 4J8VB 4DQYB 2BYKA 1P3KB 1F1EA 3KXBB 3AZKC 5B0YA 3AZGD 3AV1C 5CP6C 3B6FC 4XUJB 5GXQA 1BH9B 3KUYD 1TAFA 5B32B 5B33B 4KGCA 1TZYD 5AVCA 3LZ1A 3AZNA 3AZIB 1P3AD 4R8PC 3X1VB 2G5IC 5CPID 2CV5C 1U35B 3X1TD 4X23B 3H0RC 3LZ0D 4LD9A 5CPJD 1KX3A 2FJ7A 4YM6A 1HTAA 3AZKB 1H3OA 4DRAA 3AV2D 1P34D 3B0CW 5AV9D 3MGPC 3AV1B 1S32A 4Z2MG 5CP6B 1M19A 3B6FB 3AYWB 2F8NH 3AZMD 1P3GC 1P3OD 5DNNA 3W98A 3F6TA 5BT1D 1P3IC 4R8PB 4H9OB 3W96A 2CV5B 1HQ3D 3MVDC 3MGQD 5E5AC 5B1MA 3H0LC 5GSUA 5GT3C 5F99C 3X1SB 4WU8C 2NQBD 5B33D 1N1JA 3WKJA 3KWQC 3MGPB 3W99D 1BH8B 3MGRD 1P3PA 1P3GB 4J8XC 5AV5D 1KX4D 3W97C 3V9RA 1P3IB 5B2IC 4H9QB 4Z5TD 5B31C 3R45B 3MVDB 4UUZB 3KUYA 3REHA 1TZYA 5E5AB 5B40C 5F99B 5GT3B 4ZUXD 5AY8A 3A6NA 4WU8B 2L5AA 1KU5A 2F8ND 3X1UA 5CPIA 3KWQB 3VH5T 2HIOC 3WA9C 1ID3C 5AV8D 5B0ZC 5AV6A 5CPKC 5CPJA 3LELA 5BO0B 4QLCC 4J8XB 5B2JC 5BNXA 2XD1A 1P34A 4ZBJC 3AV2A 3UT9C 5AV9A 3MGSD 3B6GA 3RELC 2FFFB 2NZDC 3AZJC 5B2IB 5B31B 4J8UC 1JFIA 5B40B 3B0BA 2PYOC 4KHAA 1P3BB 3AL0C 5AVBC 3AZLC 4WNNB 3NQJA 3KXBA 3REIC 2YFVA 3EPLA 2AROD 1HQ3A 5GXQD 3C1BB 1ZLAD 2HIOB 3MGQA 3WA9B 4KGCD 2G5HC 3WTPB 3LZ1D 4JJNC 1ID3B 4XZQC 1BH9A 2ZM5A 5B32A 5B0ZB 4H9SC 5B1LD 5B33A 2CWEA 5CPKB 1M18D 2NQBA 3REKC 5CHLB 5B2JB 2YFWB 3UTAD 3UT9B 3X1VA 1P3LC 3W99A 3RELB 3O62C 3MGRA 2ZY3A 1KX3D 4J8UB 3VH6T 1W2EA 4KUDC 5AV5A 1KX4A 1P3MC 5GT0C 1EQZC 2PYOB 3AZLB 1S32D 2Y2IA 3AFAC 3REIB 2RVQD 3REJD 1A7WA 4NE5A 3AYWA 3W98D 5DNMB 4JJNB 2Y2HA 4XZQB 2VQRA 2RIQA 2F8NA 3W96D 3REKB 3LJAB 4H9OA 5C3IC 2CV5A 5AV8A 3O62B 3WKJD 4YS3C 3X1SA 2ZY4A 2Y2OA 3AZMC 3MGSA 4KUDB 1P3MB 1EQZB 2JCHA 3AFAB 1P3PD 3TU4D 1BH8A 5JRGC 2AROA 4G92C 2JSSA 1ZLAA 3AZHC 3REHD 3B0CT 1P3IA 3KFUG 3P5JB 3C1CD 5C3IB 5AY8D 3R45A 3A6ND 4UUZA 5B1LA 1M18A 4YS3B 3X1UD 5JA4B 4J8WC 4Z66C 3UTAA 3AZFB 5G49B 1M1AD 5AV6D 3LELD 2IO5C 3WAAC 2ZY2A 1P3FD 3UTBD 5JRGB 5BS7C 1F66C 3B6GD 4AWLC 4WU9C 3AZEC 4G92B 3REJA 4J8VD 3AZHB 1P3KD 1WWIA 3KXBD 5B24C 5B40A 4J8WB 4Z66B 2Y2QA 3AN2C 1P3BA 4WNNA 4XUJD 5BNVA 5B32D 3C1BA 3WA9A 4CAYB 3H0MC 3WTPA 3WAAB 4NE6A 3AZID 5B0ZA 3X1VD 4H9NB 1F66B 1U35D 4AWLB 4X23D 4WU9B 1KX5C 3AZEB 2YFWA 5B0YC 3UT9A 3AZFD 3TU4A 2W8SA 4H9RB 5GXQC 4KGCC 3AZKD 5AVCC 5B24B 3AZNC 3AV1D 3AN2B 5CP6D 3REIA 3B6FD 3AYWD 3C1CA 4H9PB 4LD9C 2Y2PA 5DNMA 3A1IA 2Y2MA 4R8PD 1M1AA 2FJ7C 4YM6C 2CV5D 1KX5B 5B0YB 4E44A 3LJAA 1S32C 1M19C 1AOIC 3X1SD 1P3FA 4G91C 3UTBA 3W97B 5DNNC 3W98C 5AVCB 3AZNB 3MGPD 4J8VA 3AFAA 1P3KA 3W96C 2Y2LA 3MNNC 1P3GD 2F8NG 5B1MC 4LD9B 5GSUC 1P3ID 4XUJA 2FJ7B 4YM6B 3MVDD 1H3OB 4EO5C 1B6WA 5E5AD 4QLCB 5F99D 5GT3D 1M19B 4ZBJB 3AZIA 1AOIB 4WU8D 1P3PC 5JA4A 5DNNB 3KWQD 1U35A 4DRBA 4X23A 3AZGC 5G49A 3AZFA 3AZJB 2NZDB 3MNNB 3KUYC 5AVBB 4J8XD 3REHC 1TZYC 5KDMB 3AZKA 5B1MB 3NQUB 5GSUB 5JRGA 3AV1A 1BFMA 5CP6A 1P3AC 3B6FA 5CPIC 4NFTA 3X1TC 5B2ID 5B31D 3LZ0C 4EO5B 5B40D 1P3BD 1PZRA 5AV6C 5CPJC 4R8PA 1P3LB 1P34C 3AV2C 3C1BD 3FDDA 2HIOD 5AV9C 3AZGB 3WA9D 3WTPD 1ID3D 3EPJA 2XD5A 5B0ZD 5CPKD 1P3OC 2F2AC 5GT0B 3KUYB 3EPKA 5B2JD 1TZYB 3UT9D 3MGPA 4H9NA 5BT1C 3KXBC 1P3AB 3RELD 4CSRB 3EG5B 1HQ3C 1P3GA 3X1TB
chains in the Genus database with same CATH topology
3MGQC 4J8UD 3LZ0B 2PYOD 3AZLD 2NQBC 5B33C 3REID 5CPJB 1ULYA 4H9QA 5BNXB 3MVDA 3AV2B 1P34B 2BYMB 4UPKA 3W99C 2Y2GA 5E5AA 5DNMD 5F99A 5GT3A 4JJND 4XZQD 3MGRC 4WU8A 3AZMB 1P3OB 3KWQA 3REKD 5AV5C 1KX4C 4KHAB 1P3LD 3LJAD 3NQJB 2YFVB 1KX5A 3O62D 1HQ3B 4Z5TC 5BO0A 4J8XA 3IP4C 3MGQB 3AYWC 3A1KA 4KUDD 4ZUXC 3W97A 5GT0D 1P3MD 1EQZD 2NQBB 3AFAD 2F8NK 3WTPE 5B2IA 5B31A 4WV4B 3W99B 2HUEC 5AV8C 3MGRB 4E45A 3X1SC 2HIOA 5AV5B 3MGSC 1KX4B 2IO5B 1ID3A 2DQNC 5CPKA 4YS3D 4Z5TB 4QLCA 5B2JA 1AOIA 4ZUXB 3RELA 2F8NB 1T3UA 2AROC 3AZJA 2NZDA 1ZLAC 4J8UA 3LZ1C 2PYOA 2HUEB 5JRGD 3MNNA 5AV8B 5AVBA 5B1LC 3AZLA 1M18C 5KDMA 5FUGB 5B32G 3NQUA 3UTAC 3VH5A 3AZHD 3MGSB 2JE5A 3B0DC 4JJNA 2BYKB 4XZQA 4H9SA 1KX3C 3REKA 4J8WD 4Z66D 2LY8A 1P3LA 2ZY5A 3O62A 2AROB 5GXQB 2RVQC 3REJC 3AZGA 1TAFB 1ZLAB 3WAAD 4KGCB 3KSYA 1Q9CA 3EPHA 3LZ1B 4KUDA 2Y2KA 1P3MA 5GT0A 1EQZA 1F66D 5B1LB 4WU9D 1M18B 3AZED 1P3BC 3UTAB 1P3AA 4CSRA 3B0DB 3X1TA 3C1BC 3WKJC 3LZ0A 5B24D 3WTPC 1KX3B 3AN2D 4WJ3C 1S32B 2BYMA 4HGAC 4G91B 3TU4C 4YS3A 3REJB 3W98B 2Y2JA 3VH6A 3AZMA 4M6BA 1P3OA 3VH5W 1KX5D 3W96B 5B0YD 5BNVB 3C1CC 5AY8C 3W97D 3A6NC 2DF4C 1N1JB 3WKJB 5AVCD 3X1UC 3AZND 5DNMC 3AZHA 1M1AC 2BG1A 3LELC 1P3PB 4HGAB 3TU4B 3LJAC 4LD9D 4J8WA 4Z66A 1P3FC 1B67A 3UTBC 2FJ7D 4Z2MH 3B6GC 3V9RB 4YM6D 4WZSB 4CAYA 4J8VC 3WAAA 4QLCD 3REHB 1M19D 1P3KC 1AOID 3C1CB 4Z5TA 5BS7A 5AY8B 3A6NB 5DNND 1F66A 4WU9A 5B31G 3AZEA 3X1UB 2NZDD 3AZJD 4ZUXA 4XUJC 4H9RA 1M1AB 2J8PA 2Y2NA 4NE3A 3MNND 5B32C 5AVBD 1R4VA 3VH6W 5AV6B 5CPIB 3LELB 5B24A 5B1MD 5GSUD 3AZIC 3AN2A 1P3FB 3X1VC 5AV9B 3UTBB 5FUGA 1U35C 3B6GB 4X23C 3AZFC 1WWSA 1Z2CB 4H9PA 1JFIB 2UWXA 4J8VB 4DQYB 2BYKA 1P3KB 1F1EA 3KXBB 3AZKC 5B0YA 3AZGD 3AV1C 5CP6C 3B6FC 4XUJB 5GXQA 1BH9B 3KUYD 1TAFA 5B32B 5B33B 4KGCA 1TZYD 5AVCA 3LZ1A 3AZNA 3AZIB 1P3AD 4R8PC 3X1VB 2G5IC 5CPID 2CV5C 1U35B 3X1TD 4X23B 3H0RC 3LZ0D 4LD9A 5CPJD 1KX3A 2FJ7A 4YM6A 1HTAA 3AZKB 1H3OA 4DRAA 3AV2D 1P34D 3B0CW 5AV9D 3MGPC 3AV1B 1S32A 4Z2MG 5CP6B 1M19A 3B6FB 3AYWB 2F8NH 3AZMD 1P3GC 1P3OD 5DNNA 3W98A 3F6TA 5BT1D 1P3IC 4R8PB 4H9OB 3W96A 2CV5B 1HQ3D 3MVDC 3MGQD 5E5AC 5B1MA 3H0LC 5GSUA 5GT3C 5F99C 3X1SB 4WU8C 2NQBD 5B33D 1N1JA 3WKJA 3KWQC 3MGPB 3W99D 1BH8B 3MGRD 1P3PA 1P3GB 4J8XC 5AV5D 1KX4D 3W97C 3V9RA 1P3IB 5B2IC 4H9QB 4Z5TD 5B31C 3R45B 3MVDB 4UUZB 3KUYA 3REHA 1TZYA 5E5AB 5B40C 5F99B 5GT3B 4ZUXD 5AY8A 3A6NA 4WU8B 2L5AA 1KU5A 2F8ND 3X1UA 5CPIA 3KWQB 3VH5T 2HIOC 3WA9C 1ID3C 5AV8D 5B0ZC 5AV6A 5CPKC 5CPJA 3LELA 5BO0B 4QLCC 4J8XB 5B2JC 5BNXA 2XD1A 1P34A 4ZBJC 3AV2A 3UT9C 5AV9A 3MGSD 3B6GA 3RELC 2FFFB 2NZDC 3AZJC 5B2IB 5B31B 4J8UC 1JFIA 5B40B 3B0BA 2PYOC 4KHAA 1P3BB 3AL0C 5AVBC 3AZLC 4WNNB 3NQJA 3KXBA 3REIC 2YFVA 3EPLA 2AROD 1HQ3A 5GXQD 3C1BB 1ZLAD 2HIOB 3MGQA 3WA9B 4KGCD 2G5HC 3WTPB 3LZ1D 4JJNC 1ID3B 4XZQC 1BH9A 2ZM5A 5B32A 5B0ZB 4H9SC 5B1LD 5B33A 2CWEA 5CPKB 1M18D 2NQBA 3REKC 5CHLB 5B2JB 2YFWB 3UTAD 3UT9B 3X1VA 1P3LC 3W99A 3RELB 3O62C 3MGRA 2ZY3A 1KX3D 4J8UB 3VH6T 1W2EA 4KUDC 5AV5A 1KX4A 1P3MC 5GT0C 1EQZC 2PYOB 3AZLB 1S32D 2Y2IA 3AFAC 3REIB 2RVQD 3REJD 1A7WA 4NE5A 3AYWA 3W98D 5DNMB 4JJNB 2Y2HA 4XZQB 2VQRA 2RIQA 2F8NA 3W96D 3REKB 3LJAB 4H9OA 5C3IC 2CV5A 5AV8A 3O62B 3WKJD 4YS3C 3X1SA 2ZY4A 2Y2OA 3AZMC 3MGSA 4KUDB 1P3MB 1EQZB 2JCHA 3AFAB 1P3PD 3TU4D 1BH8A 5JRGC 2AROA 4G92C 2JSSA 1ZLAA 3AZHC 3REHD 3B0CT 1P3IA 3KFUG 3P5JB 3C1CD 5C3IB 5AY8D 3R45A 3A6ND 4UUZA 5B1LA 1M18A 4YS3B 3X1UD 5JA4B 4J8WC 4Z66C 3UTAA 3AZFB 5G49B 1M1AD 5AV6D 3LELD 2IO5C 3WAAC 2ZY2A 1P3FD 3UTBD 5JRGB 5BS7C 1F66C 3B6GD 4AWLC 4WU9C 3AZEC 4G92B 3REJA 4J8VD 3AZHB 1P3KD 1WWIA 3KXBD 5B24C 5B40A 4J8WB 4Z66B 2Y2QA 3AN2C 1P3BA 4WNNA 4XUJD 5BNVA 5B32D 3C1BA 3WA9A 4CAYB 3H0MC 3WTPA 3WAAB 4NE6A 3AZID 5B0ZA 3X1VD 4H9NB 1F66B 1U35D 4AWLB 4X23D 4WU9B 1KX5C 3AZEB 2YFWA 5B0YC 3UT9A 3AZFD 3TU4A 2W8SA 4H9RB 5GXQC 4KGCC 3AZKD 5AVCC 5B24B 3AZNC 3AV1D 3AN2B 5CP6D 3REIA 3B6FD 3AYWD 3C1CA 4H9PB 4LD9C 2Y2PA 5DNMA 3A1IA 2Y2MA 4R8PD 1M1AA 2FJ7C 4YM6C 2CV5D 1KX5B 5B0YB 4E44A 3LJAA 1S32C 1M19C 1AOIC 3X1SD 1P3FA 4G91C 3UTBA 3W97B 5DNNC 3W98C 5AVCB 3AZNB 3MGPD 4J8VA 3AFAA 1P3KA 3W96C 2Y2LA 3MNNC 1P3GD 2F8NG 5B1MC 4LD9B 5GSUC 1P3ID 4XUJA 2FJ7B 4YM6B 3MVDD 1H3OB 4EO5C 1B6WA 5E5AD 4QLCB 5F99D 5GT3D 1M19B 4ZBJB 3AZIA 1AOIB 4WU8D 1P3PC 5JA4A 5DNNB 3KWQD 1U35A 4DRBA 4X23A 3AZGC 5G49A 3AZFA 3AZJB 2NZDB 3MNNB 3KUYC 5AVBB 4J8XD 3REHC 1TZYC 5KDMB 3AZKA 5B1MB 3NQUB 5GSUB 5JRGA 3AV1A 1BFMA 5CP6A 1P3AC 3B6FA 5CPIC 4NFTA 3X1TC 5B2ID 5B31D 3LZ0C 4EO5B 5B40D 1P3BD 1PZRA 5AV6C 5CPJC 4R8PA 1P3LB 1P34C 3AV2C 3C1BD 3FDDA 2HIOD 5AV9C 3AZGB 3WA9D 3WTPD 1ID3D 3EPJA 2XD5A 5B0ZD 5CPKD 1P3OC 2F2AC 5GT0B 3KUYB 3EPKA 5B2JD 1TZYB 3UT9D 3MGPA 4H9NA 5BT1C 3KXBC 1P3AB 3RELD 4CSRB 3EG5B 1HQ3C 1P3GA 3X1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ C;  4J8U D;  3LZ0 B;  2PYO D;  3AZL D;  2NQB C;  5B33 C;  3REI D;  5CPJ B;  1ULY A;  4H9Q A;  5BNX B;  3MVD A;  3AV2 B;  1P34 B;  2BYM B;  3W99 C;  5E5A A;  5DNM D;  5F99 A;  5GT3 A;  4JJN D;  4XZQ D;  3MGR C;  4WU8 A;  3AZM B;  1P3O B;  3KWQ A;  3REK D;  5AV5 C;  1KX4 C;  4KHA B;  1P3L D;  3LJA D;  3NQJ B;  2YFV B;  1KX5 A;  3O62 D;  1HQ3 B;  4Z5T C;  5BO0 A;  4J8X A;  3MGQ B;  3AYW C;  4KUD D;  4ZUX C;  3W97 A;  5GT0 D;  1P3M D;  1EQZ D;  2NQB B;  3AFA D;  2F8N K;  3WTP E;  5B2I A;  5B31 A;  4WV4 B;  3W99 B;  2HUE C;  5AV8 C;  3MGR B;  4E45 A;  3X1S C;  2HIO A;  5AV5 B;  3MGS C;  1KX4 B;  2IO5 B;  1ID3 A;  5CPK A;  4YS3 D;  4Z5T B;  4QLC A;  5B2J A;  1AOI A;  4ZUX B;  3REL A;  2F8N B;  2ARO C;  3AZJ A;  2NZD A;  1ZLA C;  4J8U A;  3LZ1 C;  2PYO A;  2HUE B;  5JRG D;  3MNN A;  5AV8 B;  5AVB A;  5B1L C;  3AZL A;  1M18 C;  5KDM A;  5FUG B;  5B32 G;  3NQU A;  3UTA C;  3VH5 A;  3AZH D;  3MGS B;  3B0D C;  4JJN A;  2BYK B;  4XZQ A;  4H9S A;  1KX3 C;  3REK A;  4J8W D;  4Z66 D;  2LY8 A;  1P3L A;  3O62 A;  2ARO B;  5GXQ B;  2RVQ C;  3REJ C;  3AZG A;  1TAF B;  1ZLA B;  3WAA D;  4KGC B;  3KSY A;  1Q9C A;  3LZ1 B;  4KUD A;  1P3M A;  5GT0 A;  1EQZ A;  1F66 D;  5B1L B;  4WU9 D;  1M18 B;  3AZE D;  1P3B C;  3UTA B;  1P3A A;  4CSR A;  3B0D B;  3X1T A;  3C1B C;  3WKJ C;  3LZ0 A;  5B24 D;  3WTP C;  1KX3 B;  3AN2 D;  1S32 B;  2BYM A;  4HGA C;  4G91 B;  3TU4 C;  4YS3 A;  3REJ B;  3W98 B;  3VH6 A;  3AZM A;  4M6B A;  1P3O A;  3VH5 W;  1KX5 D;  3W96 B;  5B0Y D;  5BNV B;  3C1C C;  5AY8 C;  3W97 D;  3A6N C;  3WKJ B;  1N1J B;  5AVC D;  3X1U C;  3AZN D;  5DNM C;  3AZH A;  1M1A C;  3LEL C;  1P3P B;  4HGA B;  3TU4 B;  3LJA C;  4LD9 D;  4J8W A;  4Z66 A;  1P3F C;  1B67 A;  3UTB C;  2FJ7 D;  4Z2M H;  3B6G C;  3V9R B;  4YM6 D;  4WZS B;  4CAY A;  4J8V C;  3WAA A;  4QLC D;  3REH B;  1M19 D;  1P3K C;  1AOI D;  3C1C B;  4Z5T A;  5BS7 A;  5AY8 B;  3A6N B;  5DNN D;  1F66 A;  4WU9 A;  5B31 G;  3AZE A;  3X1U B;  2NZD D;  3AZJ D;  4ZUX A;  4XUJ C;  4H9R A;  1M1A B;  4NE3 A;  3MNN D;  5B32 C;  5AVB D;  1R4V A;  3VH6 W;  5AV6 B;  5CPI B;  3LEL B;  5B24 A;  5B1M D;  5GSU D;  3AZI C;  3AN2 A;  1P3F B;  3X1V C;  5AV9 B;  3UTB B;  5FUG A;  1U35 C;  3B6G B;  4X23 C;  3AZF C;  1WWS A;  4H9P A;  1JFI B;  4J8V B;  2BYK A;  1P3K B;  1F1E A;  3KXB B;  3AZK C;  5B0Y A;  3AZG D;  3AV1 C;  5CP6 C;  3B6F C;  4XUJ B;  5GXQ A;  1BH9 B;  3KUY D;  1TAF A;  5B32 B;  5B33 B;  4KGC A;  1TZY D;  5AVC A;  3LZ1 A;  3AZN A;  3AZI B;  1P3A D;  4R8P C;  3X1V B;  5CPI D;  2CV5 C;  1U35 B;  3X1T D;  4X23 B;  3LZ0 D;  4LD9 A;  5CPJ D;  1KX3 A;  2FJ7 A;  4YM6 A;  1HTA A;  3AZK B;  1H3O A;  4DRA A;  3AV2 D;  1P34 D;  3B0C W;  5AV9 D;  3MGP C;  3AV1 B;  1S32 A;  4Z2M G;  5CP6 B;  1M19 A;  3B6F B;  3AYW B;  2F8N H;  3AZM D;  1P3G C;  1P3O D;  5DNN A;  3W98 A;  5BT1 D;  1P3I C;  4R8P B;  4H9O B;  3W96 A;  2CV5 B;  1HQ3 D;  3MVD C;  3MGQ D;  5E5A C;  5B1M A;  5GSU A;  5GT3 C;  5F99 C;  3X1S B;  4WU8 C;  2NQB D;  5B33 D;  1N1J A;  3WKJ A;  3KWQ C;  3MGP B;  3W99 D;  1BH8 B;  3MGR D;  1P3P A;  1P3G B;  4J8X C;  5AV5 D;  1KX4 D;  3W97 C;  3V9R A;  1P3I B;  5B2I C;  4H9Q B;  4Z5T D;  5B31 C;  3R45 B;  3MVD B;  4UUZ B;  3KUY A;  3REH A;  1TZY A;  5E5A B;  5B40 C;  5F99 B;  5GT3 B;  4ZUX D;  5AY8 A;  3A6N A;  4WU8 B;  2L5A A;  1KU5 A;  2F8N D;  3X1U A;  5CPI A;  3KWQ B;  3VH5 T;  2HIO C;  3WA9 C;  1ID3 C;  5AV8 D;  5B0Z C;  5AV6 A;  5CPK C;  5CPJ A;  3LEL A;  5BO0 B;  4QLC C;  4J8X B;  5B2J C;  5BNX A;  1P34 A;  4ZBJ C;  3AV2 A;  3UT9 C;  5AV9 A;  3MGS D;  3B6G A;  3REL C;  2NZD C;  3AZJ C;  5B2I B;  5B31 B;  4J8U C;  1JFI A;  5B40 B;  3B0B A;  2PYO C;  4KHA A;  1P3B B;  5AVB C;  3AZL C;  4WNN B;  3NQJ A;  3KXB A;  3REI C;  2YFV A;  2ARO D;  1HQ3 A;  5GXQ D;  3C1B B;  1ZLA D;  2HIO B;  3MGQ A;  3WA9 B;  4KGC D;  3WTP B;  3LZ1 D;  4JJN C;  1ID3 B;  4XZQ C;  1BH9 A;  5B32 A;  5B0Z B;  4H9S C;  5B1L D;  5B33 A;  2CWE A;  5CPK B;  1M18 D;  2NQB A;  3REK C;  5CHL B;  5B2J B;  2YFW B;  3UTA D;  3UT9 B;  3X1V A;  1P3L C;  3W99 A;  3REL B;  3O62 C;  3MGR A;  1KX3 D;  4J8U B;  3VH6 T;  4KUD C;  5AV5 A;  1KX4 A;  1P3M C;  5GT0 C;  1EQZ C;  2PYO B;  3AZL B;  1S32 D;  3AFA C;  3REI B;  2RVQ D;  3REJ D;  1A7W A;  4NE5 A;  3AYW A;  3W98 D;  5DNM B;  4JJN B;  4XZQ B;  2F8N A;  3W96 D;  3REK B;  3LJA B;  4H9O A;  5C3I C;  2CV5 A;  5AV8 A;  3O62 B;  3WKJ D;  4YS3 C;  3X1S A;  3AZM C;  3MGS A;  4KUD B;  1P3M B;  1EQZ B;  3AFA B;  1P3P D;  3TU4 D;  1BH8 A;  5JRG C;  2ARO A;  4G92 C;  2JSS A;  1ZLA A;  3AZH C;  3REH D;  3B0C T;  1P3I A;  3C1C D;  5C3I B;  5AY8 D;  3R45 A;  3A6N D;  4UUZ A;  5B1L A;  1M18 A;  4YS3 B;  3X1U D;  5JA4 B;  4J8W C;  4Z66 C;  3UTA A;  3AZF B;  5G49 B;  1M1A D;  5AV6 D;  3LEL D;  2IO5 C;  3WAA C;  1P3F D;  3UTB D;  5JRG B;  5BS7 C;  1F66 C;  3B6G D;  4AWL C;  4WU9 C;  3AZE C;  4G92 B;  3REJ A;  4J8V D;  3AZH B;  1P3K D;  1WWI A;  3KXB D;  5B24 C;  5B40 A;  4J8W B;  4Z66 B;  1P3B A;  3AN2 C;  4WNN A;  4XUJ D;  5BNV A;  5B32 D;  3C1B A;  3WA9 A;  4CAY B;  3WTP A;  3WAA B;  4NE6 A;  3AZI D;  5B0Z A;  3X1V D;  4H9N B;  1F66 B;  1U35 D;  4AWL B;  4X23 D;  4WU9 B;  1KX5 C;  3AZE B;  2YFW A;  5B0Y C;  3UT9 A;  3AZF D;  3TU4 A;  4H9R B;  5GXQ C;  4KGC C;  3AZK D;  5AVC C;  5B24 B;  3AZN C;  3AV1 D;  3AN2 B;  5CP6 D;  3REI A;  3B6F D;  3AYW D;  3C1C A;  4H9P B;  4LD9 C;  5DNM A;  4R8P D;  1M1A A;  2FJ7 C;  4YM6 C;  2CV5 D;  1KX5 B;  5B0Y B;  4E44 A;  3LJA A;  1S32 C;  1M19 C;  1AOI C;  3X1S D;  1P3F A;  4G91 C;  3UTB A;  3W97 B;  5DNN C;  3W98 C;  5AVC B;  3AZN B;  3MGP D;  4J8V A;  3AFA A;  1P3K A;  3W96 C;  3MNN C;  1P3G D;  2F8N G;  5B1M C;  4LD9 B;  5GSU C;  1P3I D;  4XUJ A;  2FJ7 B;  4YM6 B;  3MVD D;  1H3O B;  4EO5 C;  1B6W A;  5E5A D;  4QLC B;  5F99 D;  5GT3 D;  1M19 B;  4ZBJ B;  3AZI A;  1AOI B;  4WU8 D;  1P3P C;  5JA4 A;  5DNN B;  3KWQ D;  1U35 A;  4DRB A;  4X23 A;  3AZG C;  5G49 A;  3AZF A;  3AZJ B;  2NZD B;  3MNN B;  3KUY C;  5AVB B;  4J8X D;  3REH C;  1TZY C;  5KDM B;  3AZK A;  5B1M B;  3NQU B;  5GSU B;  5JRG A;  3AV1 A;  1BFM A;  5CP6 A;  1P3A C;  3B6F A;  5CPI C;  4NFT A;  3X1T C;  5B2I D;  5B31 D;  3LZ0 C;  4EO5 B;  5B40 D;  1P3B D;  5AV6 C;  5CPJ C;  4R8P A;  1P3L B;  1P34 C;  3AV2 C;  3C1B D;  2HIO D;  5AV9 C;  3AZG B;  3WA9 D;  3WTP D;  1ID3 D;  5B0Z D;  5CPK D;  1P3O C;  5GT0 B;  3KUY B;  5B2J D;  1TZY B;  3UT9 D;  3MGP A;  4H9N A;  5BT1 C;  3KXB C;  1P3A B;  3REL D;  4CSR B;  1HQ3 C;  1P3G A;  3X1T B; 
#chains in the Genus database with same CATH topology
 3MGQ C;  4J8U D;  3LZ0 B;  2PYO D;  3AZL D;  2NQB C;  5B33 C;  3REI D;  5CPJ B;  1ULY A;  4H9Q A;  5BNX B;  3MVD A;  3AV2 B;  1P34 B;  2BYM B;  4UPK A;  3W99 C;  2Y2G A;  5E5A A;  5DNM D;  5F99 A;  5GT3 A;  4JJN D;  4XZQ D;  3MGR C;  4WU8 A;  3AZM B;  1P3O B;  3KWQ A;  3REK D;  5AV5 C;  1KX4 C;  4KHA B;  1P3L D;  3LJA D;  3NQJ B;  2YFV B;  1KX5 A;  3O62 D;  1HQ3 B;  4Z5T C;  5BO0 A;  4J8X A;  3IP4 C;  3MGQ B;  3AYW C;  3A1K A;  4KUD D;  4ZUX C;  3W97 A;  5GT0 D;  1P3M D;  1EQZ D;  2NQB B;  3AFA D;  2F8N K;  3WTP E;  5B2I A;  5B31 A;  4WV4 B;  3W99 B;  2HUE C;  5AV8 C;  3MGR B;  4E45 A;  3X1S C;  2HIO A;  5AV5 B;  3MGS C;  1KX4 B;  2IO5 B;  1ID3 A;  2DQN C;  5CPK A;  4YS3 D;  4Z5T B;  4QLC A;  5B2J A;  1AOI A;  4ZUX B;  3REL A;  2F8N B;  1T3U A;  2ARO C;  3AZJ A;  2NZD A;  1ZLA C;  4J8U A;  3LZ1 C;  2PYO A;  2HUE B;  5JRG D;  3MNN A;  5AV8 B;  5AVB A;  5B1L C;  3AZL A;  1M18 C;  5KDM A;  5FUG B;  5B32 G;  3NQU A;  3UTA C;  3VH5 A;  3AZH D;  3MGS B;  2JE5 A;  3B0D C;  4JJN A;  2BYK B;  4XZQ A;  4H9S A;  1KX3 C;  3REK A;  4J8W D;  4Z66 D;  2LY8 A;  1P3L A;  2ZY5 A;  3O62 A;  2ARO B;  5GXQ B;  2RVQ C;  3REJ C;  3AZG A;  1TAF B;  1ZLA B;  3WAA D;  4KGC B;  3KSY A;  1Q9C A;  3EPH A;  3LZ1 B;  4KUD A;  2Y2K A;  1P3M A;  5GT0 A;  1EQZ A;  1F66 D;  5B1L B;  4WU9 D;  1M18 B;  3AZE D;  1P3B C;  3UTA B;  1P3A A;  4CSR A;  3B0D B;  3X1T A;  3C1B C;  3WKJ C;  3LZ0 A;  5B24 D;  3WTP C;  1KX3 B;  3AN2 D;  4WJ3 C;  1S32 B;  2BYM A;  4HGA C;  4G91 B;  3TU4 C;  4YS3 A;  3REJ B;  3W98 B;  2Y2J A;  3VH6 A;  3AZM A;  4M6B A;  1P3O A;  3VH5 W;  1KX5 D;  3W96 B;  5B0Y D;  5BNV B;  3C1C C;  5AY8 C;  3W97 D;  3A6N C;  2DF4 C;  1N1J B;  3WKJ B;  5AVC D;  3X1U C;  3AZN D;  5DNM C;  3AZH A;  1M1A C;  2BG1 A;  3LEL C;  1P3P B;  4HGA B;  3TU4 B;  3LJA C;  4LD9 D;  4J8W A;  4Z66 A;  1P3F C;  1B67 A;  3UTB C;  2FJ7 D;  4Z2M H;  3B6G C;  3V9R B;  4YM6 D;  4WZS B;  4CAY A;  4J8V C;  3WAA A;  4QLC D;  3REH B;  1M19 D;  1P3K C;  1AOI D;  3C1C B;  4Z5T A;  5BS7 A;  5AY8 B;  3A6N B;  5DNN D;  1F66 A;  4WU9 A;  5B31 G;  3AZE A;  3X1U B;  2NZD D;  3AZJ D;  4ZUX A;  4XUJ C;  4H9R A;  1M1A B;  2J8P A;  2Y2N A;  4NE3 A;  3MNN D;  5B32 C;  5AVB D;  1R4V A;  3VH6 W;  5AV6 B;  5CPI B;  3LEL B;  5B24 A;  5B1M D;  5GSU D;  3AZI C;  3AN2 A;  1P3F B;  3X1V C;  5AV9 B;  3UTB B;  5FUG A;  1U35 C;  3B6G B;  4X23 C;  3AZF C;  1WWS A;  1Z2C B;  4H9P A;  1JFI B;  2UWX A;  4J8V B;  4DQY B;  2BYK A;  1P3K B;  1F1E A;  3KXB B;  3AZK C;  5B0Y A;  3AZG D;  3AV1 C;  5CP6 C;  3B6F C;  4XUJ B;  5GXQ A;  1BH9 B;  3KUY D;  1TAF A;  5B32 B;  5B33 B;  4KGC A;  1TZY D;  5AVC A;  3LZ1 A;  3AZN A;  3AZI B;  1P3A D;  4R8P C;  3X1V B;  2G5I C;  5CPI D;  2CV5 C;  1U35 B;  3X1T D;  4X23 B;  3H0R C;  3LZ0 D;  4LD9 A;  5CPJ D;  1KX3 A;  2FJ7 A;  4YM6 A;  1HTA A;  3AZK B;  1H3O A;  4DRA A;  3AV2 D;  1P34 D;  3B0C W;  5AV9 D;  3MGP C;  3AV1 B;  1S32 A;  4Z2M G;  5CP6 B;  1M19 A;  3B6F B;  3AYW B;  2F8N H;  3AZM D;  1P3G C;  1P3O D;  5DNN A;  3W98 A;  3F6T A;  5BT1 D;  1P3I C;  4R8P B;  4H9O B;  3W96 A;  2CV5 B;  1HQ3 D;  3MVD C;  3MGQ D;  5E5A C;  5B1M A;  3H0L C;  5GSU A;  5GT3 C;  5F99 C;  3X1S B;  4WU8 C;  2NQB D;  5B33 D;  1N1J A;  3WKJ A;  3KWQ C;  3MGP B;  3W99 D;  1BH8 B;  3MGR D;  1P3P A;  1P3G B;  4J8X C;  5AV5 D;  1KX4 D;  3W97 C;  3V9R A;  1P3I B;  5B2I C;  4H9Q B;  4Z5T D;  5B31 C;  3R45 B;  3MVD B;  4UUZ B;  3KUY A;  3REH A;  1TZY A;  5E5A B;  5B40 C;  5F99 B;  5GT3 B;  4ZUX D;  5AY8 A;  3A6N A;  4WU8 B;  2L5A A;  1KU5 A;  2F8N D;  3X1U A;  5CPI A;  3KWQ B;  3VH5 T;  2HIO C;  3WA9 C;  1ID3 C;  5AV8 D;  5B0Z C;  5AV6 A;  5CPK C;  5CPJ A;  3LEL A;  5BO0 B;  4QLC C;  4J8X B;  5B2J C;  5BNX A;  2XD1 A;  1P34 A;  4ZBJ C;  3AV2 A;  3UT9 C;  5AV9 A;  3MGS D;  3B6G A;  3REL C;  2FFF B;  2NZD C;  3AZJ C;  5B2I B;  5B31 B;  4J8U C;  1JFI A;  5B40 B;  3B0B A;  2PYO C;  4KHA A;  1P3B B;  3AL0 C;  5AVB C;  3AZL C;  4WNN B;  3NQJ A;  3KXB A;  3REI C;  2YFV A;  3EPL A;  2ARO D;  1HQ3 A;  5GXQ D;  3C1B B;  1ZLA D;  2HIO B;  3MGQ A;  3WA9 B;  4KGC D;  2G5H C;  3WTP B;  3LZ1 D;  4JJN C;  1ID3 B;  4XZQ C;  1BH9 A;  2ZM5 A;  5B32 A;  5B0Z B;  4H9S C;  5B1L D;  5B33 A;  2CWE A;  5CPK B;  1M18 D;  2NQB A;  3REK C;  5CHL B;  5B2J B;  2YFW B;  3UTA D;  3UT9 B;  3X1V A;  1P3L C;  3W99 A;  3REL B;  3O62 C;  3MGR A;  2ZY3 A;  1KX3 D;  4J8U B;  3VH6 T;  1W2E A;  4KUD C;  5AV5 A;  1KX4 A;  1P3M C;  5GT0 C;  1EQZ C;  2PYO B;  3AZL B;  1S32 D;  2Y2I A;  3AFA C;  3REI B;  2RVQ D;  3REJ D;  1A7W A;  4NE5 A;  3AYW A;  3W98 D;  5DNM B;  4JJN B;  2Y2H A;  4XZQ B;  2VQR A;  2RIQ A;  2F8N A;  3W96 D;  3REK B;  3LJA B;  4H9O A;  5C3I C;  2CV5 A;  5AV8 A;  3O62 B;  3WKJ D;  4YS3 C;  3X1S A;  2ZY4 A;  2Y2O A;  3AZM C;  3MGS A;  4KUD B;  1P3M B;  1EQZ B;  2JCH A;  3AFA B;  1P3P D;  3TU4 D;  1BH8 A;  5JRG C;  2ARO A;  4G92 C;  2JSS A;  1ZLA A;  3AZH C;  3REH D;  3B0C T;  1P3I A;  3KFU G;  3P5J B;  3C1C D;  5C3I B;  5AY8 D;  3R45 A;  3A6N D;  4UUZ A;  5B1L A;  1M18 A;  4YS3 B;  3X1U D;  5JA4 B;  4J8W C;  4Z66 C;  3UTA A;  3AZF B;  5G49 B;  1M1A D;  5AV6 D;  3LEL D;  2IO5 C;  3WAA C;  2ZY2 A;  1P3F D;  3UTB D;  5JRG B;  5BS7 C;  1F66 C;  3B6G D;  4AWL C;  4WU9 C;  3AZE C;  4G92 B;  3REJ A;  4J8V D;  3AZH B;  1P3K D;  1WWI A;  3KXB D;  5B24 C;  5B40 A;  4J8W B;  4Z66 B;  2Y2Q A;  3AN2 C;  1P3B A;  4WNN A;  4XUJ D;  5BNV A;  5B32 D;  3C1B A;  3WA9 A;  4CAY B;  3H0M C;  3WTP A;  3WAA B;  4NE6 A;  3AZI D;  5B0Z A;  3X1V D;  4H9N B;  1F66 B;  1U35 D;  4AWL B;  4X23 D;  4WU9 B;  1KX5 C;  3AZE B;  2YFW A;  5B0Y C;  3UT9 A;  3AZF D;  3TU4 A;  2W8S A;  4H9R B;  5GXQ C;  4KGC C;  3AZK D;  5AVC C;  5B24 B;  3AZN C;  3AV1 D;  3AN2 B;  5CP6 D;  3REI A;  3B6F D;  3AYW D;  3C1C A;  4H9P B;  4LD9 C;  2Y2P A;  5DNM A;  3A1I A;  2Y2M A;  4R8P D;  1M1A A;  2FJ7 C;  4YM6 C;  2CV5 D;  1KX5 B;  5B0Y B;  4E44 A;  3LJA A;  1S32 C;  1M19 C;  1AOI C;  3X1S D;  1P3F A;  4G91 C;  3UTB A;  3W97 B;  5DNN C;  3W98 C;  5AVC B;  3AZN B;  3MGP D;  4J8V A;  3AFA A;  1P3K A;  3W96 C;  2Y2L A;  3MNN C;  1P3G D;  2F8N G;  5B1M C;  4LD9 B;  5GSU C;  1P3I D;  4XUJ A;  2FJ7 B;  4YM6 B;  3MVD D;  1H3O B;  4EO5 C;  1B6W A;  5E5A D;  4QLC B;  5F99 D;  5GT3 D;  1M19 B;  4ZBJ B;  3AZI A;  1AOI B;  4WU8 D;  1P3P C;  5JA4 A;  5DNN B;  3KWQ D;  1U35 A;  4DRB A;  4X23 A;  3AZG C;  5G49 A;  3AZF A;  3AZJ B;  2NZD B;  3MNN B;  3KUY C;  5AVB B;  4J8X D;  3REH C;  1TZY C;  5KDM B;  3AZK A;  5B1M B;  3NQU B;  5GSU B;  5JRG A;  3AV1 A;  1BFM A;  5CP6 A;  1P3A C;  3B6F A;  5CPI C;  4NFT A;  3X1T C;  5B2I D;  5B31 D;  3LZ0 C;  4EO5 B;  5B40 D;  1P3B D;  1PZR A;  5AV6 C;  5CPJ C;  4R8P A;  1P3L B;  1P34 C;  3AV2 C;  3C1B D;  3FDD A;  2HIO D;  5AV9 C;  3AZG B;  3WA9 D;  3WTP D;  1ID3 D;  3EPJ A;  2XD5 A;  5B0Z D;  5CPK D;  1P3O C;  2F2A C;  5GT0 B;  3KUY B;  3EPK A;  5B2J D;  1TZY B;  3UT9 D;  3MGP A;  4H9N A;  5BT1 C;  3KXB C;  1P3A B;  3REL D;  4CSR B;  3EG5 B;  1HQ3 C;  1P3G A;  3X1T B; 
#chains in the Genus database with same CATH homology
 3MGQ C;  4J8U D;  3LZ0 B;  2PYO D;  3AZL D;  2NQB C;  5B33 C;  3REI D;  5CPJ B;  1ULY A;  4H9Q A;  5BNX B;  3MVD A;  3AV2 B;  1P34 B;  2BYM B;  4UPK A;  3W99 C;  2Y2G A;  5E5A A;  5DNM D;  5F99 A;  5GT3 A;  4JJN D;  4XZQ D;  3MGR C;  4WU8 A;  3AZM B;  1P3O B;  3KWQ A;  3REK D;  5AV5 C;  1KX4 C;  4KHA B;  1P3L D;  3LJA D;  3NQJ B;  2YFV B;  1KX5 A;  3O62 D;  1HQ3 B;  4Z5T C;  5BO0 A;  4J8X A;  3IP4 C;  3MGQ B;  3AYW C;  3A1K A;  4KUD D;  4ZUX C;  3W97 A;  5GT0 D;  1P3M D;  1EQZ D;  2NQB B;  3AFA D;  2F8N K;  3WTP E;  5B2I A;  5B31 A;  4WV4 B;  3W99 B;  2HUE C;  5AV8 C;  3MGR B;  4E45 A;  3X1S C;  2HIO A;  5AV5 B;  3MGS C;  1KX4 B;  2IO5 B;  1ID3 A;  2DQN C;  5CPK A;  4YS3 D;  4Z5T B;  4QLC A;  5B2J A;  1AOI A;  4ZUX B;  3REL A;  2F8N B;  1T3U A;  2ARO C;  3AZJ A;  2NZD A;  1ZLA C;  4J8U A;  3LZ1 C;  2PYO A;  2HUE B;  5JRG D;  3MNN A;  5AV8 B;  5AVB A;  5B1L C;  3AZL A;  1M18 C;  5KDM A;  5FUG B;  5B32 G;  3NQU A;  3UTA C;  3VH5 A;  3AZH D;  3MGS B;  2JE5 A;  3B0D C;  4JJN A;  2BYK B;  4XZQ A;  4H9S A;  1KX3 C;  3REK A;  4J8W D;  4Z66 D;  2LY8 A;  1P3L A;  2ZY5 A;  3O62 A;  2ARO B;  5GXQ B;  2RVQ C;  3REJ C;  3AZG A;  1TAF B;  1ZLA B;  3WAA D;  4KGC B;  3KSY A;  1Q9C A;  3EPH A;  3LZ1 B;  4KUD A;  2Y2K A;  1P3M A;  5GT0 A;  1EQZ A;  1F66 D;  5B1L B;  4WU9 D;  1M18 B;  3AZE D;  1P3B C;  3UTA B;  1P3A A;  4CSR A;  3B0D B;  3X1T A;  3C1B C;  3WKJ C;  3LZ0 A;  5B24 D;  3WTP C;  1KX3 B;  3AN2 D;  4WJ3 C;  1S32 B;  2BYM A;  4HGA C;  4G91 B;  3TU4 C;  4YS3 A;  3REJ B;  3W98 B;  2Y2J A;  3VH6 A;  3AZM A;  4M6B A;  1P3O A;  3VH5 W;  1KX5 D;  3W96 B;  5B0Y D;  5BNV B;  3C1C C;  5AY8 C;  3W97 D;  3A6N C;  2DF4 C;  1N1J B;  3WKJ B;  5AVC D;  3X1U C;  3AZN D;  5DNM C;  3AZH A;  1M1A C;  2BG1 A;  3LEL C;  1P3P B;  4HGA B;  3TU4 B;  3LJA C;  4LD9 D;  4J8W A;  4Z66 A;  1P3F C;  1B67 A;  3UTB C;  2FJ7 D;  4Z2M H;  3B6G C;  3V9R B;  4YM6 D;  4WZS B;  4CAY A;  4J8V C;  3WAA A;  4QLC D;  3REH B;  1M19 D;  1P3K C;  1AOI D;  3C1C B;  4Z5T A;  5BS7 A;  5AY8 B;  3A6N B;  5DNN D;  1F66 A;  4WU9 A;  5B31 G;  3AZE A;  3X1U B;  2NZD D;  3AZJ D;  4ZUX A;  4XUJ C;  4H9R A;  1M1A B;  2J8P A;  2Y2N A;  4NE3 A;  3MNN D;  5B32 C;  5AVB D;  1R4V A;  3VH6 W;  5AV6 B;  5CPI B;  3LEL B;  5B24 A;  5B1M D;  5GSU D;  3AZI C;  3AN2 A;  1P3F B;  3X1V C;  5AV9 B;  3UTB B;  5FUG A;  1U35 C;  3B6G B;  4X23 C;  3AZF C;  1WWS A;  1Z2C B;  4H9P A;  1JFI B;  2UWX A;  4J8V B;  4DQY B;  2BYK A;  1P3K B;  1F1E A;  3KXB B;  3AZK C;  5B0Y A;  3AZG D;  3AV1 C;  5CP6 C;  3B6F C;  4XUJ B;  5GXQ A;  1BH9 B;  3KUY D;  1TAF A;  5B32 B;  5B33 B;  4KGC A;  1TZY D;  5AVC A;  3LZ1 A;  3AZN A;  3AZI B;  1P3A D;  4R8P C;  3X1V B;  2G5I C;  5CPI D;  2CV5 C;  1U35 B;  3X1T D;  4X23 B;  3H0R C;  3LZ0 D;  4LD9 A;  5CPJ D;  1KX3 A;  2FJ7 A;  4YM6 A;  1HTA A;  3AZK B;  1H3O A;  4DRA A;  3AV2 D;  1P34 D;  3B0C W;  5AV9 D;  3MGP C;  3AV1 B;  1S32 A;  4Z2M G;  5CP6 B;  1M19 A;  3B6F B;  3AYW B;  2F8N H;  3AZM D;  1P3G C;  1P3O D;  5DNN A;  3W98 A;  3F6T A;  5BT1 D;  1P3I C;  4R8P B;  4H9O B;  3W96 A;  2CV5 B;  1HQ3 D;  3MVD C;  3MGQ D;  5E5A C;  5B1M A;  3H0L C;  5GSU A;  5GT3 C;  5F99 C;  3X1S B;  4WU8 C;  2NQB D;  5B33 D;  1N1J A;  3WKJ A;  3KWQ C;  3MGP B;  3W99 D;  1BH8 B;  3MGR D;  1P3P A;  1P3G B;  4J8X C;  5AV5 D;  1KX4 D;  3W97 C;  3V9R A;  1P3I B;  5B2I C;  4H9Q B;  4Z5T D;  5B31 C;  3R45 B;  3MVD B;  4UUZ B;  3KUY A;  3REH A;  1TZY A;  5E5A B;  5B40 C;  5F99 B;  5GT3 B;  4ZUX D;  5AY8 A;  3A6N A;  4WU8 B;  2L5A A;  1KU5 A;  2F8N D;  3X1U A;  5CPI A;  3KWQ B;  3VH5 T;  2HIO C;  3WA9 C;  1ID3 C;  5AV8 D;  5B0Z C;  5AV6 A;  5CPK C;  5CPJ A;  3LEL A;  5BO0 B;  4QLC C;  4J8X B;  5B2J C;  5BNX A;  2XD1 A;  1P34 A;  4ZBJ C;  3AV2 A;  3UT9 C;  5AV9 A;  3MGS D;  3B6G A;  3REL C;  2FFF B;  2NZD C;  3AZJ C;  5B2I B;  5B31 B;  4J8U C;  1JFI A;  5B40 B;  3B0B A;  2PYO C;  4KHA A;  1P3B B;  3AL0 C;  5AVB C;  3AZL C;  4WNN B;  3NQJ A;  3KXB A;  3REI C;  2YFV A;  3EPL A;  2ARO D;  1HQ3 A;  5GXQ D;  3C1B B;  1ZLA D;  2HIO B;  3MGQ A;  3WA9 B;  4KGC D;  2G5H C;  3WTP B;  3LZ1 D;  4JJN C;  1ID3 B;  4XZQ C;  1BH9 A;  2ZM5 A;  5B32 A;  5B0Z B;  4H9S C;  5B1L D;  5B33 A;  2CWE A;  5CPK B;  1M18 D;  2NQB A;  3REK C;  5CHL B;  5B2J B;  2YFW B;  3UTA D;  3UT9 B;  3X1V A;  1P3L C;  3W99 A;  3REL B;  3O62 C;  3MGR A;  2ZY3 A;  1KX3 D;  4J8U B;  3VH6 T;  1W2E A;  4KUD C;  5AV5 A;  1KX4 A;  1P3M C;  5GT0 C;  1EQZ C;  2PYO B;  3AZL B;  1S32 D;  2Y2I A;  3AFA C;  3REI B;  2RVQ D;  3REJ D;  1A7W A;  4NE5 A;  3AYW A;  3W98 D;  5DNM B;  4JJN B;  2Y2H A;  4XZQ B;  2VQR A;  2RIQ A;  2F8N A;  3W96 D;  3REK B;  3LJA B;  4H9O A;  5C3I C;  2CV5 A;  5AV8 A;  3O62 B;  3WKJ D;  4YS3 C;  3X1S A;  2ZY4 A;  2Y2O A;  3AZM C;  3MGS A;  4KUD B;  1P3M B;  1EQZ B;  2JCH A;  3AFA B;  1P3P D;  3TU4 D;  1BH8 A;  5JRG C;  2ARO A;  4G92 C;  2JSS A;  1ZLA A;  3AZH C;  3REH D;  3B0C T;  1P3I A;  3KFU G;  3P5J B;  3C1C D;  5C3I B;  5AY8 D;  3R45 A;  3A6N D;  4UUZ A;  5B1L A;  1M18 A;  4YS3 B;  3X1U D;  5JA4 B;  4J8W C;  4Z66 C;  3UTA A;  3AZF B;  5G49 B;  1M1A D;  5AV6 D;  3LEL D;  2IO5 C;  3WAA C;  2ZY2 A;  1P3F D;  3UTB D;  5JRG B;  5BS7 C;  1F66 C;  3B6G D;  4AWL C;  4WU9 C;  3AZE C;  4G92 B;  3REJ A;  4J8V D;  3AZH B;  1P3K D;  1WWI A;  3KXB D;  5B24 C;  5B40 A;  4J8W B;  4Z66 B;  2Y2Q A;  3AN2 C;  1P3B A;  4WNN A;  4XUJ D;  5BNV A;  5B32 D;  3C1B A;  3WA9 A;  4CAY B;  3H0M C;  3WTP A;  3WAA B;  4NE6 A;  3AZI D;  5B0Z A;  3X1V D;  4H9N B;  1F66 B;  1U35 D;  4AWL B;  4X23 D;  4WU9 B;  1KX5 C;  3AZE B;  2YFW A;  5B0Y C;  3UT9 A;  3AZF D;  3TU4 A;  2W8S A;  4H9R B;  5GXQ C;  4KGC C;  3AZK D;  5AVC C;  5B24 B;  3AZN C;  3AV1 D;  3AN2 B;  5CP6 D;  3REI A;  3B6F D;  3AYW D;  3C1C A;  4H9P B;  4LD9 C;  2Y2P A;  5DNM A;  3A1I A;  2Y2M A;  4R8P D;  1M1A A;  2FJ7 C;  4YM6 C;  2CV5 D;  1KX5 B;  5B0Y B;  4E44 A;  3LJA A;  1S32 C;  1M19 C;  1AOI C;  3X1S D;  1P3F A;  4G91 C;  3UTB A;  3W97 B;  5DNN C;  3W98 C;  5AVC B;  3AZN B;  3MGP D;  4J8V A;  3AFA A;  1P3K A;  3W96 C;  2Y2L A;  3MNN C;  1P3G D;  2F8N G;  5B1M C;  4LD9 B;  5GSU C;  1P3I D;  4XUJ A;  2FJ7 B;  4YM6 B;  3MVD D;  1H3O B;  4EO5 C;  1B6W A;  5E5A D;  4QLC B;  5F99 D;  5GT3 D;  1M19 B;  4ZBJ B;  3AZI A;  1AOI B;  4WU8 D;  1P3P C;  5JA4 A;  5DNN B;  3KWQ D;  1U35 A;  4DRB A;  4X23 A;  3AZG C;  5G49 A;  3AZF A;  3AZJ B;  2NZD B;  3MNN B;  3KUY C;  5AVB B;  4J8X D;  3REH C;  1TZY C;  5KDM B;  3AZK A;  5B1M B;  3NQU B;  5GSU B;  5JRG A;  3AV1 A;  1BFM A;  5CP6 A;  1P3A C;  3B6F A;  5CPI C;  4NFT A;  3X1T C;  5B2I D;  5B31 D;  3LZ0 C;  4EO5 B;  5B40 D;  1P3B D;  1PZR A;  5AV6 C;  5CPJ C;  4R8P A;  1P3L B;  1P34 C;  3AV2 C;  3C1B D;  3FDD A;  2HIO D;  5AV9 C;  3AZG B;  3WA9 D;  3WTP D;  1ID3 D;  3EPJ A;  2XD5 A;  5B0Z D;  5CPK D;  1P3O C;  2F2A C;  5GT0 B;  3KUY B;  3EPK A;  5B2J D;  1TZY B;  3UT9 D;  3MGP A;  4H9N A;  5BT1 C;  3KXB C;  1P3A B;  3REL D;  4CSR B;  3EG5 B;  1HQ3 C;  1P3G A;  3X1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...