3AZJC

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjC00
4J8VB 3X1VA 4XUJA 5B0ZB 4ZBJB 4LD9C 4LD9D 4R8PB 4J8XA 3VH5T 3B0BA 4JJNA 1P3FA 3KUYA 4H9OA 3LZ0A 3REJB 1TAFA 5AV8A 4XZQD 5GT3A 5B31A 3W97A 4JJNB 1P3FB 3MGQD 4WU9A 1JFIA 5B40A 1P3AA 3REKB 3V9RB 5BS7A 1EQZB 3RELC 2AROA 5B32B 4H9OB 4J8UC 4J8UD 3MNNB 4QLCA 3TU4C 3TU4D 5B31B 3AZMA 1WWSA 3AV1A 5CPKC 5CPKD 4WU8B 1HQ3A 3NQJA 4M6BA 2HIOC 2HIOD 4J8WB 3B6FC 5DNNB 5GXQB 5B2JD 5B2JC 5KDMA 1N1JA 3MGSC 3MGSD 3AZMB 3A6NB 3AFAD 2YFWA 5JRGD 5JRGC 3AZEC 3AZED 2CV5A 3WKJC 1ULYA 5B31G 3NQUB 3WKJD 3UTBA 5B1LC 5B1LD 1AOIA 3W98A 4E44A 4H9PB 3VH6W 5GT0B 4H9NB 4NE5A 1N1JB 5GSUB 4H9QA 5G49A 1P3IC 1P3GC 3AZLA 1BH8A 1P34C 1P34D 5AY8B 3LELA 5CPJD 3LZ1B 5CPJC 2F8NH 4YS3C 4YS3D 4KGCC 2HUEC 4KGCD 1M19C 1P3KD 4X23A 1P3LB 1P3KC 5G49B 3AZGC 3AZGD 5FUGB 3AZNC 3AZND 3O62B 1S32C 3AZID 3MGRA 3AZIC 3AV2A 3C1BB 5AV9C 5AV9D 3C1CC 3C1CD 4AWLC 5DNMC 5DNMD 3RELA 1P3BD 1P3BC 2PYOA 2NQBB 1P3MB 1ZLAB 2BYKB 4ZUXB 3UTAC 4J8VD 4J8VC 3AYWA 3AV2B 1M1AA 2L5AA 5B0ZD 5B0ZC 2IO5B 2HIOA 5F99A 3B6FA 3AN2D 3AN2C 3B0CW 5JA4B 2F8NK 4CSRB 1KX4B 3AZEA 5E5AB 5CP6A 4Z66B 4CAYB 5B1LA 3KXBA 3REJD 5BO0B 1M18B 3LJAA 1ID3A 1KX5C 5B1MD 5B1MC 5B33B 3REKD 4YM6A 1EQZC 4H9SA 1F66B 1EQZD 3VH5W 5B32D 5B32C 1P3IA 1BH9A 3KXBB 3AZFA 5B2IC 3MVDB 1P3GA 1TZYD 1TZYC 1P3PA 1P3OC 3WAAA 4Z5TB 5AV6C 5AV6D 5B24B 1M19A 3X1SC 4WU8D 4WU8C 4E45A 5CHLB 3W96B 4J8WD 4J8WC 4UUZB 5DNNC 5GXQD 5GXQC 5DNND 1S32A 3REIB 5B0YB 3AZHA 3WAAB 3A6NC 3A6ND 3WA9A 1P3BA 3REHB 3X1TB 1B6WA 3B6GA 3UTAA 2YFVA 5AVCB 5C3IB 5GT0C 5GT0D 5BNXB 1KX3A 3W99A 5GSUD 5GSUC 3X1VB 3UT9A 4XUJB 3WA9B 2NZDA 1Q9CA 4XZQC 2YFVB 4J8XB 3WTPA 5AY8C 5AY8D 3LZ1C 3LZ1D 3MGQC 3KUYB 1U35A 1P3LC 1P3LD 2CWEA 3LZ0B 1TAFB 5AV8B 3VH6A 3O62C 3O62D 5GT3B 3AZKC 3AZKD 3X1UC 3X1UD 1KX5A 2FJ7A 3W97B 3C1BD 4WU9B 5AVBC 5AVBD 5B40B 1P3AB 1JFIB 2NQBD 1P3MC 1P3MD 2AROB 5B2IA 5CPIA 1ZLAC 1ZLAD 4G91C 4ZUXD 4QLCB 1P3OA 1A7WA 5AV6A 2FJ7B 3X1SA 3AFAC 3AV1B 2F8ND 2IO5C 1HQ3B 3WTPE 3NQJB 2BYMA 3MGPA 5KDMB 3KWQC 3KWQD 1KX4D 2YFWB 4KUDD 4KUDC 2CV5B 4LD9A 4HGAB 4Z66D 3UTBB 1AOIB 3MGPB 3W98B 5AV5D 5AV5C 1M18D 1M18C 4DRBA 1KU5A 5B33D 5B33C 4KHAA 4H9QB 4XZQA 3MVDD 3MVDC 3AZJC 3AZJD 3AZLB 1BH8B 3LELB 3MGQA 4Z5TC 4Z5TD 5B24C 5B24D 4KHAB 4X23B 1R4VA 4J8UA 3W96C 3W96D 3TU4A 5CPKA 3MGRB 5B0YC 5B0YD 3REHD 3RELB 1BFMA 2PYOB 3W98C 4ZBJC 3VH5A 4R8PC 4R8PD 5B2JA 5C3IC 5AVCC 5AVCD 3MGSA 3AFAA 5CPKB 3AYWB 5JRGA 4XUJD 4XUJC 3WKJA 1M1AB 1WWIA 2HIOB 5F99B 3REJC 3B0DB 3B6FB 4DRAA 5BNVA 4JJNC 4JJND 1P3FC 1P3FD 3REKC 3AZEB 5CP6B 5B1LB 3LZ0C 3LZ0D 4H9RA 5AV5A 1P34A 3MNNC 3MNND 4WNNA 5CPJA 5GT3D 5GT3C 5B31C 5B31D 3LJAB 3W97C 4YS3A 1ID3B 3W97D 4KGCA 4WU9D 5B40D 1P3AD 1P3KA 4YM6B 2AROD 2AROC 3AZGA 3AZJA 1P3IB 1BH9B 3AZNA 3AZFB 4H9RB 1P3GB 1P34B 4EO5B 3AZIA 4QLCC 4QLCD 1P3PB 1B67A 3AZMC 3AZMD 5AV9A 3C1CA 3AV1C 3AV1D 5DNMA 1M19B 4G92B 3R45A 1HQ3C 1HQ3D 4WZSB 3AZNB 1S32B 4J8VA 3AZHB 5B0ZA 1P3BB 4HGAC 4R8PA 3R45B 3UTBD 1AOID 3B6GB 3AN2A 3UTAB 3W98D 1KX3B 3W99B 3UT9B 3KSYA 3REJA 2NZDB 1H3OA 3AN2B 3AZLC 3AZLD 3WTPB 3LELC 3LELD 5B1MA 3C1BC 3REKA 3V9RA 1EQZA 2NQBC 1U35B 5B32A 4X23C 4X23D 1TZYA 3MNNA 1H3OB 4ZUXC 1KX5B 3MGRD 3MGRC 5B1MB 3AV2C 4WU8A 3AV2D 3RELD 2PYOC 2PYOD 4J8WA 5B2IB 5CPIB 5DNNA 1TZYB 5GXQA 1P3OB 1F1EA 3A6NA 2JSSA 5AV6B 1KX4C 3X1SB 3AYWC 4NFTA 2RVQD 2RVQC 3AYWD 5E5AC 5E5AD 3NQUA 1M1AD 1M1AC 4Z66C 5F99D 2LY8A 5F99C 2BYMB 3B0DC 4H9PA 5GT0A 3B6FD 4H9NA 5BT1D 5BT1C 5GSUA 5B32G 4WV4B 5CP6C 5CP6D 1F66D 1F66C 4LD9B 3KXBC 3KXBD 5AY8A 3LZ1A 3LJAD 3LJAC 1ID3C 1ID3D 1HTAA 1P3LA 4YM6C 4YM6D 4H9SC 4NE3A 1P3ID 5FUGA 4XZQB 3AZFC 3O62A 3AZFD 1P3GD 4EO5C 3AZKA 3X1UA 1P3PC 1P3PD 3MGQB 3C1BA 5AVBA 3REIC 3REID 3WAAC 3WAAD 2NQBA 1M19D 3REHC 4G92C 3X1TD 3X1TC 1P3MA 1ZLAA 2BYKA 4J8UB 4ZUXA 3TU4B 3AZKB 1S32D 3X1UB 4Z2MH 3VH6T 5AVBB 3X1VC 3AZHC 3AZHD 3X1VD 2F8NA 3WA9C 3WA9D 4NE6A 4G91B 3B6GD 3B6GC 5JA4A 3UTAD 5B2JB 4J8XC 4J8XD 3MGSB 3KWQA 1KX3C 4CSRA 3AFAB 3W99D 3W99C 3KUYD 3KUYC 1KX3D 5E5AA 1KX4A 2F8NB 5JRGB 4KUDA 3UT9C 3UT9D 3WKJB 4Z66A 4CAYA 2NZDC 2NZDD 5BO0A 5AV8C 5AV8D 1M18A 5BNVB 3WTPD 3WTPC 3KWQB 5B33A 4WU9C 4KUDB 5B40C 1P3AC 5BS7C 1F66A 1U35C 1U35D 3MVDA 2F8NG 5AV5B 4WNNB 5CPJB 4Z5TA 1KX5D 5B24A 4YS3B 2FJ7C 2FJ7D 2HUEB 4KGCB 1P3KB 3W96A 4Z2MG 5B2ID 3AZGB 4UUZA 5CPIC 3AZJB 5CPID 3AZIB 1P3OD 3REIA 5B0YA 5AV9B 3B0CT 3X1SD 3C1CB 4AWLB 5DNMB 3REHA 3X1TA 2CV5C 2CV5D 3UTBC 1AOIC 5AVCA 3MGPC 3MGPD 5BNXA
chains in the Genus database with same CATH superfamily
4J8VB 2DQNC 3X1VA 4XUJA 5B0ZB 4ZBJB 4LD9C 4LD9D 4R8PB 4J8XA 2Y2HA 3VH5T 3B0BA 4JJNA 1P3FA 3KUYA 4H9OA 3LZ0A 3REJB 1TAFA 5AV8A 4XZQD 5GT3A 5B31A 3W97A 4JJNB 1P3FB 3MGQD 4WU9A 1JFIA 5B40A 2Y2NA 1P3AA 3REKB 3V9RB 5BS7A 1EQZB 3RELC 2AROA 5B32B 4H9OB 4J8UC 4J8UD 3MNNB 3IP4C 4QLCA 3TU4C 3TU4D 5B31B 3AZMA 1WWSA 3AV1A 5CPKC 5CPKD 4WU8B 2Y2KA 1HQ3A 3NQJA 4M6BA 2HIOC 2HIOD 4J8WB 3B6FC 5DNNB 5GXQB 5B2JD 5B2JC 5KDMA 1N1JA 3MGSC 3MGSD 3AZMB 3A6NB 3A1IA 3AFAD 2YFWA 5JRGD 5JRGC 3AZEC 3AZED 2CV5A 3WKJC 1ULYA 5B31G 3NQUB 3WKJD 3UTBA 5B1LC 5B1LD 1AOIA 3W98A 4E44A 2Y2QA 4H9PB 3VH6W 5GT0B 4H9NB 4NE5A 1N1JB 5GSUB 4H9QA 5G49A 1P3IC 1P3GC 3AZLA 1BH8A 1P34C 1P34D 5AY8B 3LELA 3H0LC 5CPJD 3LZ1B 5CPJC 2F8NH 4YS3C 2VQRA 4YS3D 2HUEC 4KGCC 4KGCD 1M19C 1P3KD 4X23A 1P3LB 1P3KC 5G49B 3AZGC 3AZGD 2G5IC 5FUGB 3AZNC 3O62B 3AZND 1S32C 3AZID 3MGRA 3AZIC 3AV2A 3C1BB 5AV9C 5AV9D 3FDDA 3C1CC 3C1CD 5DNMC 5DNMD 4AWLC 3RELA 1P3BD 1P3BC 2PYOA 1P3MB 2NQBB 1ZLAB 2BYKB 4ZUXB 3UTAC 4J8VD 4J8VC 3AYWA 3AV2B 1M1AA 2L5AA 2XD1A 5B0ZD 5B0ZC 2IO5B 3F6TA 2HIOA 2J8PA 5F99A 3B6FA 3AN2D 3AN2C 3B0CW 5JA4B 2F8NK 4CSRB 1KX4B 3AZEA 5E5AB 5CP6A 4Z66B 4CAYB 5B1LA 3KXBA 3REJD 5BO0B 1M18B 3LJAA 1ID3A 1KX5C 3AL0C 3EPKA 5B1MD 5B1MC 5B33B 3REKD 4YM6A 1EQZC 4H9SA 1F66B 1EQZD 3VH5W 5B32D 5B32C 1P3IA 1BH9A 3KXBB 3AZFA 5B2IC 3MVDB 1P3GA 1TZYD 1TZYC 1P3PA 1P3OC 3WAAA 2Y2GA 4Z5TB 5AV6C 5AV6D 5B24B 1M19A 3X1SC 4WU8D 4WU8C 4E45A 5CHLB 3W96B 4J8WD 4J8WC 4UUZB 5DNNC 5GXQD 5GXQC 5DNND 1S32A 4DQYB 3REIB 5B0YB 3AZHA 3WAAB 3A6NC 3A6ND 3WA9A 1P3BA 3REHB 3X1TB 1B6WA 3B6GA 3UTAA 2YFVA 5AVCB 5C3IB 5GT0C 5GT0D 5BNXB 1KX3A 3W99A 5GSUD 5GSUC 3X1VB 3UT9A 4XUJB 3WA9B 2NZDA 1Q9CA 1T3UA 4XZQC 2YFVB 4J8XB 5AY8C 5AY8D 3WTPA 3LZ1C 3LZ1D 3MGQC 3KUYB 2F2AC 1U35A 1P3LC 1P3LD 2CWEA 3LZ0B 1TAFB 5AV8B 3P5JB 3VH6A 3O62C 3O62D 5GT3B 3AZKC 3AZKD 3X1UC 3X1UD 1KX5A 2FJ7A 3W97B 3C1BD 4WU9B 5AVBC 5AVBD 5B40B 1P3AB 1JFIB 2NQBD 1P3MC 1P3MD 2AROB 5B2IA 5CPIA 1ZLAC 1ZLAD 4G91C 4ZUXD 2JCHA 4QLCB 1P3OA 1A7WA 1PZRA 5AV6A 2FJ7B 3X1SA 3AFAC 3AV1B 2F8ND 2IO5C 2ZY3A 1HQ3B 3WTPE 3NQJB 2BYMA 3MGPA 1Z2CB 5KDMB 2Y2PA 3KWQC 3KWQD 1KX4D 2YFWB 4KUDD 4KUDC 2CV5B 4LD9A 4HGAB 4Z66D 3UTBB 1AOIB 3MGPB 3W98B 5AV5D 5AV5C 1M18D 1M18C 4DRBA 1KU5A 1W2EA 5B33D 5B33C 4KHAA 4H9QB 4XZQA 3MVDD 3MVDC 3AZJC 3AZJD 3AZLB 1BH8B 3LELB 3MGQA 4Z5TC 4Z5TD 5B24C 2G5HC 5B24D 4KHAB 4X23B 1R4VA 4J8UA 2Y2MA 3W96C 3W96D 3TU4A 5CPKA 3MGRB 5B0YC 5B0YD 3REHD 3RELB 1BFMA 2PYOB 3W98C 4ZBJC 3VH5A 4R8PC 4R8PD 2ZY2A 3H0RC 5B2JA 5C3IC 5AVCC 5AVCD 3MGSA 3AFAA 5CPKB 3AYWB 5JRGA 4XUJD 4XUJC 3WKJA 1M1AB 1WWIA 2FFFB 2HIOB 5F99B 3REJC 3B0DB 3B6FB 4DRAA 5BNVA 4JJNC 4JJND 1P3FC 1P3FD 3REKC 3AZEB 5CP6B 5B1LB 3A1KA 2Y2OA 3LZ0C 3LZ0D 4H9RA 5AV5A 1P34A 3MNNC 3MNND 4WNNA 5CPJA 5GT3D 5GT3C 5B31C 5B31D 3LJAB 3W97C 4YS3A 1ID3B 3W97D 4KGCA 4WU9D 3EPLA 5B40D 1P3AD 1P3KA 4YM6B 2AROD 2AROC 3AZGA 3AZJA 1P3IB 1BH9B 3AZNA 3AZFB 4H9RB 1P3GB 1P34B 4EO5B 3AZIA 4QLCC 4QLCD 1P3PB 1B67A 3AZMC 3AZMD 5AV9A 3C1CA 3AV1C 3AV1D 5DNMA 1M19B 3EG5B 4G92B 3R45A 1HQ3C 1HQ3D 4WZSB 3AZNB 1S32B 4J8VA 3AZHB 5B0ZA 2RIQA 1P3BB 4HGAC 4R8PA 3R45B 3UTBD 1AOID 2DF4C 3B6GB 3AN2A 3UTAB 3W98D 1KX3B 3W99B 3UT9B 3KSYA 3REJA 2NZDB 2XD5A 1H3OA 3EPHA 3AN2B 3AZLC 3AZLD 3WTPB 3LELC 2JE5A 3LELD 5B1MA 3C1BC 3REKA 3V9RA 2W8SA 1EQZA 2NQBC 1U35B 5B32A 4X23C 4X23D 1TZYA 3MNNA 3H0MC 1H3OB 4ZUXC 2ZY4A 1KX5B 3MGRD 3MGRC 5B1MB 3AV2C 4WU8A 3AV2D 3RELD 2PYOC 2PYOD 4J8WA 5B2IB 5CPIB 5DNNA 1TZYB 5GXQA 2UWXA 1F1EA 1P3OB 3A6NA 2JSSA 5AV6B 1KX4C 3X1SB 3AYWC 4NFTA 2RVQD 2RVQC 3EPJA 5E5AC 5E5AD 3AYWD 3NQUA 1M1AD 1M1AC 4Z66C 5F99D 2LY8A 5F99C 2BYMB 3B0DC 4H9PA 5GT0A 3B6FD 4H9NA 5BT1D 5BT1C 5GSUA 5B32G 2Y2LA 4WV4B 5CP6C 5CP6D 1F66D 1F66C 4LD9B 3KXBC 3KXBD 2ZY5A 5AY8A 3LZ1A 3LJAD 3LJAC 1ID3C 1ID3D 1HTAA 1P3LA 4YM6C 4YM6D 4H9SC 4NE3A 1P3ID 5FUGA 4XZQB 3AZFC 3O62A 3AZFD 1P3GD 4EO5C 3AZKA 3X1UA 2Y2IA 1P3PC 1P3PD 3MGQB 3C1BA 5AVBA 3REIC 3REID 3WAAC 3WAAD 2NQBA 1M19D 3REHC 4G92C 3X1TD 3X1TC 1P3MA 1ZLAA 2BYKA 2ZM5A 4J8UB 4ZUXA 3TU4B 3AZKB 1S32D 3X1UB 4Z2MH 3VH6T 5AVBB 3X1VC 3AZHC 3AZHD 3X1VD 2F8NA 3WA9C 3WA9D 4NE6A 4G91B 3B6GD 3B6GC 5JA4A 3UTAD 5B2JB 4J8XC 4J8XD 3MGSB 2Y2JA 3KWQA 1KX3C 4CSRA 3AFAB 3W99D 3W99C 3KUYD 3KUYC 1KX3D 5E5AA 1KX4A 2F8NB 5JRGB 4KUDA 3UT9C 3UT9D 3WKJB 4Z66A 4CAYA 2NZDC 2NZDD 5BO0A 5AV8C 5AV8D 1M18A 5BNVB 3WTPD 3WTPC 3KWQB 4UPKA 5B33A 4WU9C 4KUDB 5B40C 1P3AC 5BS7C 1F66A 1U35C 1U35D 3MVDA 2F8NG 5AV5B 4WNNB 5CPJB 4Z5TA 1KX5D 5B24A 4YS3B 2FJ7C 2FJ7D 2HUEB 4KGCB 1P3KB 3W96A 4Z2MG 5B2ID 3AZGB 4UUZA 5CPIC 3AZJB 5CPID 3AZIB 1P3OD 3REIA 5B0YA 5AV9B 3B0CT 3X1SD 3C1CB 4AWLB 5DNMB 3REHA 3X1TA 4WJ3C 2CV5C 2CV5D 2BG1A 3UTBC 1AOIC 5AVCA 3MGPC 3MGPD 5BNXA 3KFUG
chains in the Genus database with same CATH topology
4J8VB 2DQNC 3X1VA 4XUJA 5B0ZB 4ZBJB 4LD9C 4LD9D 4R8PB 4J8XA 2Y2HA 3VH5T 3B0BA 4JJNA 1P3FA 3KUYA 4H9OA 3LZ0A 3REJB 1TAFA 5AV8A 4XZQD 5GT3A 5B31A 3W97A 4JJNB 1P3FB 3MGQD 4WU9A 1JFIA 5B40A 2Y2NA 1P3AA 3REKB 3V9RB 5BS7A 1EQZB 3RELC 2AROA 5B32B 4H9OB 4J8UC 4J8UD 3MNNB 3IP4C 4QLCA 3TU4C 3TU4D 5B31B 3AZMA 1WWSA 3AV1A 5CPKC 5CPKD 4WU8B 2Y2KA 1HQ3A 3NQJA 4M6BA 2HIOC 2HIOD 4J8WB 3B6FC 5DNNB 5GXQB 5B2JD 5B2JC 5KDMA 1N1JA 3MGSC 3MGSD 3AZMB 3A6NB 3A1IA 3AFAD 2YFWA 5JRGD 5JRGC 3AZEC 3AZED 2CV5A 3WKJC 1ULYA 5B31G 3NQUB 3WKJD 3UTBA 5B1LC 5B1LD 1AOIA 3W98A 4E44A 2Y2QA 4H9PB 3VH6W 5GT0B 4H9NB 4NE5A 1N1JB 5GSUB 4H9QA 5G49A 1P3IC 1P3GC 3AZLA 1BH8A 1P34C 1P34D 5AY8B 3LELA 3H0LC 5CPJD 3LZ1B 5CPJC 2F8NH 4YS3C 2VQRA 4YS3D 2HUEC 4KGCC 4KGCD 1M19C 1P3KD 4X23A 1P3LB 1P3KC 5G49B 3AZGC 3AZGD 2G5IC 5FUGB 3AZNC 3O62B 3AZND 1S32C 3AZID 3MGRA 3AZIC 3AV2A 3C1BB 5AV9C 5AV9D 3FDDA 3C1CC 3C1CD 5DNMC 5DNMD 4AWLC 3RELA 1P3BD 1P3BC 2PYOA 1P3MB 2NQBB 1ZLAB 2BYKB 4ZUXB 3UTAC 4J8VD 4J8VC 3AYWA 3AV2B 1M1AA 2L5AA 2XD1A 5B0ZD 5B0ZC 2IO5B 3F6TA 2HIOA 2J8PA 5F99A 3B6FA 3AN2D 3AN2C 3B0CW 5JA4B 2F8NK 4CSRB 1KX4B 3AZEA 5E5AB 5CP6A 4Z66B 4CAYB 5B1LA 3KXBA 3REJD 5BO0B 1M18B 3LJAA 1ID3A 1KX5C 3AL0C 3EPKA 5B1MD 5B1MC 5B33B 3REKD 4YM6A 1EQZC 4H9SA 1F66B 1EQZD 3VH5W 5B32D 5B32C 1P3IA 1BH9A 3KXBB 3AZFA 5B2IC 3MVDB 1P3GA 1TZYD 1TZYC 1P3PA 1P3OC 3WAAA 2Y2GA 4Z5TB 5AV6C 5AV6D 5B24B 1M19A 3X1SC 4WU8D 4WU8C 4E45A 5CHLB 3W96B 4J8WD 4J8WC 4UUZB 5DNNC 5GXQD 5GXQC 5DNND 1S32A 4DQYB 3REIB 5B0YB 3AZHA 3WAAB 3A6NC 3A6ND 3WA9A 1P3BA 3REHB 3X1TB 1B6WA 3B6GA 3UTAA 2YFVA 5AVCB 5C3IB 5GT0C 5GT0D 5BNXB 1KX3A 3W99A 5GSUD 5GSUC 3X1VB 3UT9A 4XUJB 3WA9B 2NZDA 1Q9CA 1T3UA 4XZQC 2YFVB 4J8XB 5AY8C 5AY8D 3WTPA 3LZ1C 3LZ1D 3MGQC 3KUYB 2F2AC 1U35A 1P3LC 1P3LD 2CWEA 3LZ0B 1TAFB 5AV8B 3P5JB 3VH6A 3O62C 3O62D 5GT3B 3AZKC 3AZKD 3X1UC 3X1UD 1KX5A 2FJ7A 3W97B 3C1BD 4WU9B 5AVBC 5AVBD 5B40B 1P3AB 1JFIB 2NQBD 1P3MC 1P3MD 2AROB 5B2IA 5CPIA 1ZLAC 1ZLAD 4G91C 4ZUXD 2JCHA 4QLCB 1P3OA 1A7WA 1PZRA 5AV6A 2FJ7B 3X1SA 3AFAC 3AV1B 2F8ND 2IO5C 2ZY3A 1HQ3B 3WTPE 3NQJB 2BYMA 3MGPA 1Z2CB 5KDMB 2Y2PA 3KWQC 3KWQD 1KX4D 2YFWB 4KUDD 4KUDC 2CV5B 4LD9A 4HGAB 4Z66D 3UTBB 1AOIB 3MGPB 3W98B 5AV5D 5AV5C 1M18D 1M18C 4DRBA 1KU5A 1W2EA 5B33D 5B33C 4KHAA 4H9QB 4XZQA 3MVDD 3MVDC 3AZJC 3AZJD 3AZLB 1BH8B 3LELB 3MGQA 4Z5TC 4Z5TD 5B24C 2G5HC 5B24D 4KHAB 4X23B 1R4VA 4J8UA 2Y2MA 3W96C 3W96D 3TU4A 5CPKA 3MGRB 5B0YC 5B0YD 3REHD 3RELB 1BFMA 2PYOB 3W98C 4ZBJC 3VH5A 4R8PC 4R8PD 2ZY2A 3H0RC 5B2JA 5C3IC 5AVCC 5AVCD 3MGSA 3AFAA 5CPKB 3AYWB 5JRGA 4XUJD 4XUJC 3WKJA 1M1AB 1WWIA 2FFFB 2HIOB 5F99B 3REJC 3B0DB 3B6FB 4DRAA 5BNVA 4JJNC 4JJND 1P3FC 1P3FD 3REKC 3AZEB 5CP6B 5B1LB 3A1KA 2Y2OA 3LZ0C 3LZ0D 4H9RA 5AV5A 1P34A 3MNNC 3MNND 4WNNA 5CPJA 5GT3D 5GT3C 5B31C 5B31D 3LJAB 3W97C 4YS3A 1ID3B 3W97D 4KGCA 4WU9D 3EPLA 5B40D 1P3AD 1P3KA 4YM6B 2AROD 2AROC 3AZGA 3AZJA 1P3IB 1BH9B 3AZNA 3AZFB 4H9RB 1P3GB 1P34B 4EO5B 3AZIA 4QLCC 4QLCD 1P3PB 1B67A 3AZMC 3AZMD 5AV9A 3C1CA 3AV1C 3AV1D 5DNMA 1M19B 3EG5B 4G92B 3R45A 1HQ3C 1HQ3D 4WZSB 3AZNB 1S32B 4J8VA 3AZHB 5B0ZA 2RIQA 1P3BB 4HGAC 4R8PA 3R45B 3UTBD 1AOID 2DF4C 3B6GB 3AN2A 3UTAB 3W98D 1KX3B 3W99B 3UT9B 3KSYA 3REJA 2NZDB 2XD5A 1H3OA 3EPHA 3AN2B 3AZLC 3AZLD 3WTPB 3LELC 2JE5A 3LELD 5B1MA 3C1BC 3REKA 3V9RA 2W8SA 1EQZA 2NQBC 1U35B 5B32A 4X23C 4X23D 1TZYA 3MNNA 3H0MC 1H3OB 4ZUXC 2ZY4A 1KX5B 3MGRD 3MGRC 5B1MB 3AV2C 4WU8A 3AV2D 3RELD 2PYOC 2PYOD 4J8WA 5B2IB 5CPIB 5DNNA 1TZYB 5GXQA 2UWXA 1F1EA 1P3OB 3A6NA 2JSSA 5AV6B 1KX4C 3X1SB 3AYWC 4NFTA 2RVQD 2RVQC 3EPJA 5E5AC 5E5AD 3AYWD 3NQUA 1M1AD 1M1AC 4Z66C 5F99D 2LY8A 5F99C 2BYMB 3B0DC 4H9PA 5GT0A 3B6FD 4H9NA 5BT1D 5BT1C 5GSUA 5B32G 2Y2LA 4WV4B 5CP6C 5CP6D 1F66D 1F66C 4LD9B 3KXBC 3KXBD 2ZY5A 5AY8A 3LZ1A 3LJAD 3LJAC 1ID3C 1ID3D 1HTAA 1P3LA 4YM6C 4YM6D 4H9SC 4NE3A 1P3ID 5FUGA 4XZQB 3AZFC 3O62A 3AZFD 1P3GD 4EO5C 3AZKA 3X1UA 2Y2IA 1P3PC 1P3PD 3MGQB 3C1BA 5AVBA 3REIC 3REID 3WAAC 3WAAD 2NQBA 1M19D 3REHC 4G92C 3X1TD 3X1TC 1P3MA 1ZLAA 2BYKA 2ZM5A 4J8UB 4ZUXA 3TU4B 3AZKB 1S32D 3X1UB 4Z2MH 3VH6T 5AVBB 3X1VC 3AZHC 3AZHD 3X1VD 2F8NA 3WA9C 3WA9D 4NE6A 4G91B 3B6GD 3B6GC 5JA4A 3UTAD 5B2JB 4J8XC 4J8XD 3MGSB 2Y2JA 3KWQA 1KX3C 4CSRA 3AFAB 3W99D 3W99C 3KUYD 3KUYC 1KX3D 5E5AA 1KX4A 2F8NB 5JRGB 4KUDA 3UT9C 3UT9D 3WKJB 4Z66A 4CAYA 2NZDC 2NZDD 5BO0A 5AV8C 5AV8D 1M18A 5BNVB 3WTPD 3WTPC 3KWQB 4UPKA 5B33A 4WU9C 4KUDB 5B40C 1P3AC 5BS7C 1F66A 1U35C 1U35D 3MVDA 2F8NG 5AV5B 4WNNB 5CPJB 4Z5TA 1KX5D 5B24A 4YS3B 2FJ7C 2FJ7D 2HUEB 4KGCB 1P3KB 3W96A 4Z2MG 5B2ID 3AZGB 4UUZA 5CPIC 3AZJB 5CPID 3AZIB 1P3OD 3REIA 5B0YA 5AV9B 3B0CT 3X1SD 3C1CB 4AWLB 5DNMB 3REHA 3X1TA 4WJ3C 2CV5C 2CV5D 2BG1A 3UTBC 1AOIC 5AVCA 3MGPC 3MGPD 5BNXA 3KFUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  3X1V A;  4XUJ A;  5B0Z B;  4ZBJ B;  4LD9 C;  4LD9 D;  4R8P B;  4J8X A;  3VH5 T;  3B0B A;  4JJN A;  1P3F A;  3KUY A;  4H9O A;  3LZ0 A;  3REJ B;  1TAF A;  5AV8 A;  4XZQ D;  5GT3 A;  5B31 A;  3W97 A;  4JJN B;  1P3F B;  3MGQ D;  4WU9 A;  1JFI A;  5B40 A;  1P3A A;  3REK B;  3V9R B;  5BS7 A;  1EQZ B;  3REL C;  2ARO A;  5B32 B;  4H9O B;  4J8U C;  4J8U D;  3MNN B;  4QLC A;  3TU4 C;  3TU4 D;  5B31 B;  3AZM A;  1WWS A;  3AV1 A;  5CPK C;  5CPK D;  4WU8 B;  1HQ3 A;  3NQJ A;  4M6B A;  2HIO C;  2HIO D;  4J8W B;  3B6F C;  5DNN B;  5GXQ B;  5B2J D;  5B2J C;  5KDM A;  1N1J A;  3MGS C;  3MGS D;  3AZM B;  3A6N B;  3AFA D;  2YFW A;  5JRG D;  5JRG C;  3AZE C;  3AZE D;  2CV5 A;  3WKJ C;  1ULY A;  5B31 G;  3NQU B;  3WKJ D;  3UTB A;  5B1L C;  5B1L D;  1AOI A;  3W98 A;  4E44 A;  4H9P B;  3VH6 W;  5GT0 B;  4H9N B;  4NE5 A;  1N1J B;  5GSU B;  4H9Q A;  5G49 A;  1P3I C;  1P3G C;  3AZL A;  1BH8 A;  1P34 C;  1P34 D;  5AY8 B;  3LEL A;  5CPJ D;  3LZ1 B;  5CPJ C;  2F8N H;  4YS3 C;  4YS3 D;  4KGC C;  2HUE C;  4KGC D;  1M19 C;  1P3K D;  4X23 A;  1P3L B;  1P3K C;  5G49 B;  3AZG C;  3AZG D;  5FUG B;  3AZN C;  3AZN D;  3O62 B;  1S32 C;  3AZI D;  3MGR A;  3AZI C;  3AV2 A;  3C1B B;  5AV9 C;  5AV9 D;  3C1C C;  3C1C D;  4AWL C;  5DNM C;  5DNM D;  3REL A;  1P3B D;  1P3B C;  2PYO A;  2NQB B;  1P3M B;  1ZLA B;  2BYK B;  4ZUX B;  3UTA C;  4J8V D;  4J8V C;  3AYW A;  3AV2 B;  1M1A A;  2L5A A;  5B0Z D;  5B0Z C;  2IO5 B;  2HIO A;  5F99 A;  3B6F A;  3AN2 D;  3AN2 C;  3B0C W;  5JA4 B;  2F8N K;  4CSR B;  1KX4 B;  3AZE A;  5E5A B;  5CP6 A;  4Z66 B;  4CAY B;  5B1L A;  3KXB A;  3REJ D;  5BO0 B;  1M18 B;  3LJA A;  1ID3 A;  1KX5 C;  5B1M D;  5B1M C;  5B33 B;  3REK D;  4YM6 A;  1EQZ C;  4H9S A;  1F66 B;  1EQZ D;  3VH5 W;  5B32 D;  5B32 C;  1P3I A;  1BH9 A;  3KXB B;  3AZF A;  5B2I C;  3MVD B;  1P3G A;  1TZY D;  1TZY C;  1P3P A;  1P3O C;  3WAA A;  4Z5T B;  5AV6 C;  5AV6 D;  5B24 B;  1M19 A;  3X1S C;  4WU8 D;  4WU8 C;  4E45 A;  5CHL B;  3W96 B;  4J8W D;  4J8W C;  4UUZ B;  5DNN C;  5GXQ D;  5GXQ C;  5DNN D;  1S32 A;  3REI B;  5B0Y B;  3AZH A;  3WAA B;  3A6N C;  3A6N D;  3WA9 A;  1P3B A;  3REH B;  3X1T B;  1B6W A;  3B6G A;  3UTA A;  2YFV A;  5AVC B;  5C3I B;  5GT0 C;  5GT0 D;  5BNX B;  1KX3 A;  3W99 A;  5GSU D;  5GSU C;  3X1V B;  3UT9 A;  4XUJ B;  3WA9 B;  2NZD A;  1Q9C A;  4XZQ C;  2YFV B;  4J8X B;  3WTP A;  5AY8 C;  5AY8 D;  3LZ1 C;  3LZ1 D;  3MGQ C;  3KUY B;  1U35 A;  1P3L C;  1P3L D;  2CWE A;  3LZ0 B;  1TAF B;  5AV8 B;  3VH6 A;  3O62 C;  3O62 D;  5GT3 B;  3AZK C;  3AZK D;  3X1U C;  3X1U D;  1KX5 A;  2FJ7 A;  3W97 B;  3C1B D;  4WU9 B;  5AVB C;  5AVB D;  5B40 B;  1P3A B;  1JFI B;  2NQB D;  1P3M C;  1P3M D;  2ARO B;  5B2I A;  5CPI A;  1ZLA C;  1ZLA D;  4G91 C;  4ZUX D;  4QLC B;  1P3O A;  1A7W A;  5AV6 A;  2FJ7 B;  3X1S A;  3AFA C;  3AV1 B;  2F8N D;  2IO5 C;  1HQ3 B;  3WTP E;  3NQJ B;  2BYM A;  3MGP A;  5KDM B;  3KWQ C;  3KWQ D;  1KX4 D;  2YFW B;  4KUD D;  4KUD C;  2CV5 B;  4LD9 A;  4HGA B;  4Z66 D;  3UTB B;  1AOI B;  3MGP B;  3W98 B;  5AV5 D;  5AV5 C;  1M18 D;  1M18 C;  4DRB A;  1KU5 A;  5B33 D;  5B33 C;  4KHA A;  4H9Q B;  4XZQ A;  3MVD D;  3MVD C;  3AZJ C;  3AZJ D;  3AZL B;  1BH8 B;  3LEL B;  3MGQ A;  4Z5T C;  4Z5T D;  5B24 C;  5B24 D;  4KHA B;  4X23 B;  1R4V A;  4J8U A;  3W96 C;  3W96 D;  3TU4 A;  5CPK A;  3MGR B;  5B0Y C;  5B0Y D;  3REH D;  3REL B;  1BFM A;  2PYO B;  3W98 C;  4ZBJ C;  3VH5 A;  4R8P C;  4R8P D;  5B2J A;  5C3I C;  5AVC C;  5AVC D;  3MGS A;  3AFA A;  5CPK B;  3AYW B;  5JRG A;  4XUJ D;  4XUJ C;  3WKJ A;  1M1A B;  1WWI A;  2HIO B;  5F99 B;  3REJ C;  3B0D B;  3B6F B;  4DRA A;  5BNV A;  4JJN C;  4JJN D;  1P3F C;  1P3F D;  3REK C;  3AZE B;  5CP6 B;  5B1L B;  3LZ0 C;  3LZ0 D;  4H9R A;  5AV5 A;  1P34 A;  3MNN C;  3MNN D;  4WNN A;  5CPJ A;  5GT3 D;  5GT3 C;  5B31 C;  5B31 D;  3LJA B;  3W97 C;  4YS3 A;  1ID3 B;  3W97 D;  4KGC A;  4WU9 D;  5B40 D;  1P3A D;  1P3K A;  4YM6 B;  2ARO D;  2ARO C;  3AZG A;  3AZJ A;  1P3I B;  1BH9 B;  3AZN A;  3AZF B;  4H9R B;  1P3G B;  1P34 B;  4EO5 B;  3AZI A;  4QLC C;  4QLC D;  1P3P B;  1B67 A;  3AZM C;  3AZM D;  5AV9 A;  3C1C A;  3AV1 C;  3AV1 D;  5DNM A;  1M19 B;  4G92 B;  3R45 A;  1HQ3 C;  1HQ3 D;  4WZS B;  3AZN B;  1S32 B;  4J8V A;  3AZH B;  5B0Z A;  1P3B B;  4HGA C;  4R8P A;  3R45 B;  3UTB D;  1AOI D;  3B6G B;  3AN2 A;  3UTA B;  3W98 D;  1KX3 B;  3W99 B;  3UT9 B;  3KSY A;  3REJ A;  2NZD B;  1H3O A;  3AN2 B;  3AZL C;  3AZL D;  3WTP B;  3LEL C;  3LEL D;  5B1M A;  3C1B C;  3REK A;  3V9R A;  1EQZ A;  2NQB C;  1U35 B;  5B32 A;  4X23 C;  4X23 D;  1TZY A;  3MNN A;  1H3O B;  4ZUX C;  1KX5 B;  3MGR D;  3MGR C;  5B1M B;  3AV2 C;  4WU8 A;  3AV2 D;  3REL D;  2PYO C;  2PYO D;  4J8W A;  5B2I B;  5CPI B;  5DNN A;  1TZY B;  5GXQ A;  1P3O B;  1F1E A;  3A6N A;  2JSS A;  5AV6 B;  1KX4 C;  3X1S B;  3AYW C;  4NFT A;  2RVQ D;  2RVQ C;  3AYW D;  5E5A C;  5E5A D;  3NQU A;  1M1A D;  1M1A C;  4Z66 C;  5F99 D;  2LY8 A;  5F99 C;  2BYM B;  3B0D C;  4H9P A;  5GT0 A;  3B6F D;  4H9N A;  5BT1 D;  5BT1 C;  5GSU A;  5B32 G;  4WV4 B;  5CP6 C;  5CP6 D;  1F66 D;  1F66 C;  4LD9 B;  3KXB C;  3KXB D;  5AY8 A;  3LZ1 A;  3LJA D;  3LJA C;  1ID3 C;  1ID3 D;  1HTA A;  1P3L A;  4YM6 C;  4YM6 D;  4H9S C;  4NE3 A;  1P3I D;  5FUG A;  4XZQ B;  3AZF C;  3O62 A;  3AZF D;  1P3G D;  4EO5 C;  3AZK A;  3X1U A;  1P3P C;  1P3P D;  3MGQ B;  3C1B A;  5AVB A;  3REI C;  3REI D;  3WAA C;  3WAA D;  2NQB A;  1M19 D;  3REH C;  4G92 C;  3X1T D;  3X1T C;  1P3M A;  1ZLA A;  2BYK A;  4J8U B;  4ZUX A;  3TU4 B;  3AZK B;  1S32 D;  3X1U B;  4Z2M H;  3VH6 T;  5AVB B;  3X1V C;  3AZH C;  3AZH D;  3X1V D;  2F8N A;  3WA9 C;  3WA9 D;  4NE6 A;  4G91 B;  3B6G D;  3B6G C;  5JA4 A;  3UTA D;  5B2J B;  4J8X C;  4J8X D;  3MGS B;  3KWQ A;  1KX3 C;  4CSR A;  3AFA B;  3W99 D;  3W99 C;  3KUY D;  3KUY C;  1KX3 D;  5E5A A;  1KX4 A;  2F8N B;  5JRG B;  4KUD A;  3UT9 C;  3UT9 D;  3WKJ B;  4Z66 A;  4CAY A;  2NZD C;  2NZD D;  5BO0 A;  5AV8 C;  5AV8 D;  1M18 A;  5BNV B;  3WTP D;  3WTP C;  3KWQ B;  5B33 A;  4WU9 C;  4KUD B;  5B40 C;  1P3A C;  5BS7 C;  1F66 A;  1U35 C;  1U35 D;  3MVD A;  2F8N G;  5AV5 B;  4WNN B;  5CPJ B;  4Z5T A;  1KX5 D;  5B24 A;  4YS3 B;  2FJ7 C;  2FJ7 D;  2HUE B;  4KGC B;  1P3K B;  3W96 A;  4Z2M G;  5B2I D;  3AZG B;  4UUZ A;  5CPI C;  3AZJ B;  5CPI D;  3AZI B;  1P3O D;  3REI A;  5B0Y A;  5AV9 B;  3B0C T;  3X1S D;  3C1C B;  4AWL B;  5DNM B;  3REH A;  3X1T A;  2CV5 C;  2CV5 D;  3UTB C;  1AOI C;  5AVC A;  3MGP C;  3MGP D;  5BNX A; 
#chains in the Genus database with same CATH topology
 4J8V B;  2DQN C;  3X1V A;  4XUJ A;  5B0Z B;  4ZBJ B;  4LD9 C;  4LD9 D;  4R8P B;  4J8X A;  2Y2H A;  3VH5 T;  3B0B A;  4JJN A;  1P3F A;  3KUY A;  4H9O A;  3LZ0 A;  3REJ B;  1TAF A;  5AV8 A;  4XZQ D;  5GT3 A;  5B31 A;  3W97 A;  4JJN B;  1P3F B;  3MGQ D;  4WU9 A;  1JFI A;  5B40 A;  2Y2N A;  1P3A A;  3REK B;  3V9R B;  5BS7 A;  1EQZ B;  3REL C;  2ARO A;  5B32 B;  4H9O B;  4J8U C;  4J8U D;  3MNN B;  3IP4 C;  4QLC A;  3TU4 C;  3TU4 D;  5B31 B;  3AZM A;  1WWS A;  3AV1 A;  5CPK C;  5CPK D;  4WU8 B;  2Y2K A;  1HQ3 A;  3NQJ A;  4M6B A;  2HIO C;  2HIO D;  4J8W B;  3B6F C;  5DNN B;  5GXQ B;  5B2J D;  5B2J C;  5KDM A;  1N1J A;  3MGS C;  3MGS D;  3AZM B;  3A6N B;  3A1I A;  3AFA D;  2YFW A;  5JRG D;  5JRG C;  3AZE C;  3AZE D;  2CV5 A;  3WKJ C;  1ULY A;  5B31 G;  3NQU B;  3WKJ D;  3UTB A;  5B1L C;  5B1L D;  1AOI A;  3W98 A;  4E44 A;  2Y2Q A;  4H9P B;  3VH6 W;  5GT0 B;  4H9N B;  4NE5 A;  1N1J B;  5GSU B;  4H9Q A;  5G49 A;  1P3I C;  1P3G C;  3AZL A;  1BH8 A;  1P34 C;  1P34 D;  5AY8 B;  3LEL A;  3H0L C;  5CPJ D;  3LZ1 B;  5CPJ C;  2F8N H;  4YS3 C;  2VQR A;  4YS3 D;  2HUE C;  4KGC C;  4KGC D;  1M19 C;  1P3K D;  4X23 A;  1P3L B;  1P3K C;  5G49 B;  3AZG C;  3AZG D;  2G5I C;  5FUG B;  3AZN C;  3O62 B;  3AZN D;  1S32 C;  3AZI D;  3MGR A;  3AZI C;  3AV2 A;  3C1B B;  5AV9 C;  5AV9 D;  3FDD A;  3C1C C;  3C1C D;  5DNM C;  5DNM D;  4AWL C;  3REL A;  1P3B D;  1P3B C;  2PYO A;  1P3M B;  2NQB B;  1ZLA B;  2BYK B;  4ZUX B;  3UTA C;  4J8V D;  4J8V C;  3AYW A;  3AV2 B;  1M1A A;  2L5A A;  2XD1 A;  5B0Z D;  5B0Z C;  2IO5 B;  3F6T A;  2HIO A;  2J8P A;  5F99 A;  3B6F A;  3AN2 D;  3AN2 C;  3B0C W;  5JA4 B;  2F8N K;  4CSR B;  1KX4 B;  3AZE A;  5E5A B;  5CP6 A;  4Z66 B;  4CAY B;  5B1L A;  3KXB A;  3REJ D;  5BO0 B;  1M18 B;  3LJA A;  1ID3 A;  1KX5 C;  3AL0 C;  3EPK A;  5B1M D;  5B1M C;  5B33 B;  3REK D;  4YM6 A;  1EQZ C;  4H9S A;  1F66 B;  1EQZ D;  3VH5 W;  5B32 D;  5B32 C;  1P3I A;  1BH9 A;  3KXB B;  3AZF A;  5B2I C;  3MVD B;  1P3G A;  1TZY D;  1TZY C;  1P3P A;  1P3O C;  3WAA A;  2Y2G A;  4Z5T B;  5AV6 C;  5AV6 D;  5B24 B;  1M19 A;  3X1S C;  4WU8 D;  4WU8 C;  4E45 A;  5CHL B;  3W96 B;  4J8W D;  4J8W C;  4UUZ B;  5DNN C;  5GXQ D;  5GXQ C;  5DNN D;  1S32 A;  4DQY B;  3REI B;  5B0Y B;  3AZH A;  3WAA B;  3A6N C;  3A6N D;  3WA9 A;  1P3B A;  3REH B;  3X1T B;  1B6W A;  3B6G A;  3UTA A;  2YFV A;  5AVC B;  5C3I B;  5GT0 C;  5GT0 D;  5BNX B;  1KX3 A;  3W99 A;  5GSU D;  5GSU C;  3X1V B;  3UT9 A;  4XUJ B;  3WA9 B;  2NZD A;  1Q9C A;  1T3U A;  4XZQ C;  2YFV B;  4J8X B;  5AY8 C;  5AY8 D;  3WTP A;  3LZ1 C;  3LZ1 D;  3MGQ C;  3KUY B;  2F2A C;  1U35 A;  1P3L C;  1P3L D;  2CWE A;  3LZ0 B;  1TAF B;  5AV8 B;  3P5J B;  3VH6 A;  3O62 C;  3O62 D;  5GT3 B;  3AZK C;  3AZK D;  3X1U C;  3X1U D;  1KX5 A;  2FJ7 A;  3W97 B;  3C1B D;  4WU9 B;  5AVB C;  5AVB D;  5B40 B;  1P3A B;  1JFI B;  2NQB D;  1P3M C;  1P3M D;  2ARO B;  5B2I A;  5CPI A;  1ZLA C;  1ZLA D;  4G91 C;  4ZUX D;  2JCH A;  4QLC B;  1P3O A;  1A7W A;  1PZR A;  5AV6 A;  2FJ7 B;  3X1S A;  3AFA C;  3AV1 B;  2F8N D;  2IO5 C;  2ZY3 A;  1HQ3 B;  3WTP E;  3NQJ B;  2BYM A;  3MGP A;  1Z2C B;  5KDM B;  2Y2P A;  3KWQ C;  3KWQ D;  1KX4 D;  2YFW B;  4KUD D;  4KUD C;  2CV5 B;  4LD9 A;  4HGA B;  4Z66 D;  3UTB B;  1AOI B;  3MGP B;  3W98 B;  5AV5 D;  5AV5 C;  1M18 D;  1M18 C;  4DRB A;  1KU5 A;  1W2E A;  5B33 D;  5B33 C;  4KHA A;  4H9Q B;  4XZQ A;  3MVD D;  3MVD C;  3AZJ C;  3AZJ D;  3AZL B;  1BH8 B;  3LEL B;  3MGQ A;  4Z5T C;  4Z5T D;  5B24 C;  2G5H C;  5B24 D;  4KHA B;  4X23 B;  1R4V A;  4J8U A;  2Y2M A;  3W96 C;  3W96 D;  3TU4 A;  5CPK A;  3MGR B;  5B0Y C;  5B0Y D;  3REH D;  3REL B;  1BFM A;  2PYO B;  3W98 C;  4ZBJ C;  3VH5 A;  4R8P C;  4R8P D;  2ZY2 A;  3H0R C;  5B2J A;  5C3I C;  5AVC C;  5AVC D;  3MGS A;  3AFA A;  5CPK B;  3AYW B;  5JRG A;  4XUJ D;  4XUJ C;  3WKJ A;  1M1A B;  1WWI A;  2FFF B;  2HIO B;  5F99 B;  3REJ C;  3B0D B;  3B6F B;  4DRA A;  5BNV A;  4JJN C;  4JJN D;  1P3F C;  1P3F D;  3REK C;  3AZE B;  5CP6 B;  5B1L B;  3A1K A;  2Y2O A;  3LZ0 C;  3LZ0 D;  4H9R A;  5AV5 A;  1P34 A;  3MNN C;  3MNN D;  4WNN A;  5CPJ A;  5GT3 D;  5GT3 C;  5B31 C;  5B31 D;  3LJA B;  3W97 C;  4YS3 A;  1ID3 B;  3W97 D;  4KGC A;  4WU9 D;  3EPL A;  5B40 D;  1P3A D;  1P3K A;  4YM6 B;  2ARO D;  2ARO C;  3AZG A;  3AZJ A;  1P3I B;  1BH9 B;  3AZN A;  3AZF B;  4H9R B;  1P3G B;  1P34 B;  4EO5 B;  3AZI A;  4QLC C;  4QLC D;  1P3P B;  1B67 A;  3AZM C;  3AZM D;  5AV9 A;  3C1C A;  3AV1 C;  3AV1 D;  5DNM A;  1M19 B;  3EG5 B;  4G92 B;  3R45 A;  1HQ3 C;  1HQ3 D;  4WZS B;  3AZN B;  1S32 B;  4J8V A;  3AZH B;  5B0Z A;  2RIQ A;  1P3B B;  4HGA C;  4R8P A;  3R45 B;  3UTB D;  1AOI D;  2DF4 C;  3B6G B;  3AN2 A;  3UTA B;  3W98 D;  1KX3 B;  3W99 B;  3UT9 B;  3KSY A;  3REJ A;  2NZD B;  2XD5 A;  1H3O A;  3EPH A;  3AN2 B;  3AZL C;  3AZL D;  3WTP B;  3LEL C;  2JE5 A;  3LEL D;  5B1M A;  3C1B C;  3REK A;  3V9R A;  2W8S A;  1EQZ A;  2NQB C;  1U35 B;  5B32 A;  4X23 C;  4X23 D;  1TZY A;  3MNN A;  3H0M C;  1H3O B;  4ZUX C;  2ZY4 A;  1KX5 B;  3MGR D;  3MGR C;  5B1M B;  3AV2 C;  4WU8 A;  3AV2 D;  3REL D;  2PYO C;  2PYO D;  4J8W A;  5B2I B;  5CPI B;  5DNN A;  1TZY B;  5GXQ A;  2UWX A;  1F1E A;  1P3O B;  3A6N A;  2JSS A;  5AV6 B;  1KX4 C;  3X1S B;  3AYW C;  4NFT A;  2RVQ D;  2RVQ C;  3EPJ A;  5E5A C;  5E5A D;  3AYW D;  3NQU A;  1M1A D;  1M1A C;  4Z66 C;  5F99 D;  2LY8 A;  5F99 C;  2BYM B;  3B0D C;  4H9P A;  5GT0 A;  3B6F D;  4H9N A;  5BT1 D;  5BT1 C;  5GSU A;  5B32 G;  2Y2L A;  4WV4 B;  5CP6 C;  5CP6 D;  1F66 D;  1F66 C;  4LD9 B;  3KXB C;  3KXB D;  2ZY5 A;  5AY8 A;  3LZ1 A;  3LJA D;  3LJA C;  1ID3 C;  1ID3 D;  1HTA A;  1P3L A;  4YM6 C;  4YM6 D;  4H9S C;  4NE3 A;  1P3I D;  5FUG A;  4XZQ B;  3AZF C;  3O62 A;  3AZF D;  1P3G D;  4EO5 C;  3AZK A;  3X1U A;  2Y2I A;  1P3P C;  1P3P D;  3MGQ B;  3C1B A;  5AVB A;  3REI C;  3REI D;  3WAA C;  3WAA D;  2NQB A;  1M19 D;  3REH C;  4G92 C;  3X1T D;  3X1T C;  1P3M A;  1ZLA A;  2BYK A;  2ZM5 A;  4J8U B;  4ZUX A;  3TU4 B;  3AZK B;  1S32 D;  3X1U B;  4Z2M H;  3VH6 T;  5AVB B;  3X1V C;  3AZH C;  3AZH D;  3X1V D;  2F8N A;  3WA9 C;  3WA9 D;  4NE6 A;  4G91 B;  3B6G D;  3B6G C;  5JA4 A;  3UTA D;  5B2J B;  4J8X C;  4J8X D;  3MGS B;  2Y2J A;  3KWQ A;  1KX3 C;  4CSR A;  3AFA B;  3W99 D;  3W99 C;  3KUY D;  3KUY C;  1KX3 D;  5E5A A;  1KX4 A;  2F8N B;  5JRG B;  4KUD A;  3UT9 C;  3UT9 D;  3WKJ B;  4Z66 A;  4CAY A;  2NZD C;  2NZD D;  5BO0 A;  5AV8 C;  5AV8 D;  1M18 A;  5BNV B;  3WTP D;  3WTP C;  3KWQ B;  4UPK A;  5B33 A;  4WU9 C;  4KUD B;  5B40 C;  1P3A C;  5BS7 C;  1F66 A;  1U35 C;  1U35 D;  3MVD A;  2F8N G;  5AV5 B;  4WNN B;  5CPJ B;  4Z5T A;  1KX5 D;  5B24 A;  4YS3 B;  2FJ7 C;  2FJ7 D;  2HUE B;  4KGC B;  1P3K B;  3W96 A;  4Z2M G;  5B2I D;  3AZG B;  4UUZ A;  5CPI C;  3AZJ B;  5CPI D;  3AZI B;  1P3O D;  3REI A;  5B0Y A;  5AV9 B;  3B0C T;  3X1S D;  3C1C B;  4AWL B;  5DNM B;  3REH A;  3X1T A;  4WJ3 C;  2CV5 C;  2CV5 D;  2BG1 A;  3UTB C;  1AOI C;  5AVC A;  3MGP C;  3MGP D;  5BNX A;  3KFU G; 
#chains in the Genus database with same CATH homology
 4J8V B;  2DQN C;  3X1V A;  4XUJ A;  5B0Z B;  4ZBJ B;  4LD9 C;  4LD9 D;  4R8P B;  4J8X A;  2Y2H A;  3VH5 T;  3B0B A;  4JJN A;  1P3F A;  3KUY A;  4H9O A;  3LZ0 A;  3REJ B;  1TAF A;  5AV8 A;  4XZQ D;  5GT3 A;  5B31 A;  3W97 A;  4JJN B;  1P3F B;  3MGQ D;  4WU9 A;  1JFI A;  5B40 A;  2Y2N A;  1P3A A;  3REK B;  3V9R B;  5BS7 A;  1EQZ B;  3REL C;  2ARO A;  5B32 B;  4H9O B;  4J8U C;  4J8U D;  3MNN B;  3IP4 C;  4QLC A;  3TU4 C;  3TU4 D;  5B31 B;  3AZM A;  1WWS A;  3AV1 A;  5CPK C;  5CPK D;  4WU8 B;  2Y2K A;  1HQ3 A;  3NQJ A;  4M6B A;  2HIO C;  2HIO D;  4J8W B;  3B6F C;  5DNN B;  5GXQ B;  5B2J D;  5B2J C;  5KDM A;  1N1J A;  3MGS C;  3MGS D;  3AZM B;  3A6N B;  3A1I A;  3AFA D;  2YFW A;  5JRG D;  5JRG C;  3AZE C;  3AZE D;  2CV5 A;  3WKJ C;  1ULY A;  5B31 G;  3NQU B;  3WKJ D;  3UTB A;  5B1L C;  5B1L D;  1AOI A;  3W98 A;  4E44 A;  2Y2Q A;  4H9P B;  3VH6 W;  5GT0 B;  4H9N B;  4NE5 A;  1N1J B;  5GSU B;  4H9Q A;  5G49 A;  1P3I C;  1P3G C;  3AZL A;  1BH8 A;  1P34 C;  1P34 D;  5AY8 B;  3LEL A;  3H0L C;  5CPJ D;  3LZ1 B;  5CPJ C;  2F8N H;  4YS3 C;  2VQR A;  4YS3 D;  2HUE C;  4KGC C;  4KGC D;  1M19 C;  1P3K D;  4X23 A;  1P3L B;  1P3K C;  5G49 B;  3AZG C;  3AZG D;  2G5I C;  5FUG B;  3AZN C;  3O62 B;  3AZN D;  1S32 C;  3AZI D;  3MGR A;  3AZI C;  3AV2 A;  3C1B B;  5AV9 C;  5AV9 D;  3FDD A;  3C1C C;  3C1C D;  5DNM C;  5DNM D;  4AWL C;  3REL A;  1P3B D;  1P3B C;  2PYO A;  1P3M B;  2NQB B;  1ZLA B;  2BYK B;  4ZUX B;  3UTA C;  4J8V D;  4J8V C;  3AYW A;  3AV2 B;  1M1A A;  2L5A A;  2XD1 A;  5B0Z D;  5B0Z C;  2IO5 B;  3F6T A;  2HIO A;  2J8P A;  5F99 A;  3B6F A;  3AN2 D;  3AN2 C;  3B0C W;  5JA4 B;  2F8N K;  4CSR B;  1KX4 B;  3AZE A;  5E5A B;  5CP6 A;  4Z66 B;  4CAY B;  5B1L A;  3KXB A;  3REJ D;  5BO0 B;  1M18 B;  3LJA A;  1ID3 A;  1KX5 C;  3AL0 C;  3EPK A;  5B1M D;  5B1M C;  5B33 B;  3REK D;  4YM6 A;  1EQZ C;  4H9S A;  1F66 B;  1EQZ D;  3VH5 W;  5B32 D;  5B32 C;  1P3I A;  1BH9 A;  3KXB B;  3AZF A;  5B2I C;  3MVD B;  1P3G A;  1TZY D;  1TZY C;  1P3P A;  1P3O C;  3WAA A;  2Y2G A;  4Z5T B;  5AV6 C;  5AV6 D;  5B24 B;  1M19 A;  3X1S C;  4WU8 D;  4WU8 C;  4E45 A;  5CHL B;  3W96 B;  4J8W D;  4J8W C;  4UUZ B;  5DNN C;  5GXQ D;  5GXQ C;  5DNN D;  1S32 A;  4DQY B;  3REI B;  5B0Y B;  3AZH A;  3WAA B;  3A6N C;  3A6N D;  3WA9 A;  1P3B A;  3REH B;  3X1T B;  1B6W A;  3B6G A;  3UTA A;  2YFV A;  5AVC B;  5C3I B;  5GT0 C;  5GT0 D;  5BNX B;  1KX3 A;  3W99 A;  5GSU D;  5GSU C;  3X1V B;  3UT9 A;  4XUJ B;  3WA9 B;  2NZD A;  1Q9C A;  1T3U A;  4XZQ C;  2YFV B;  4J8X B;  5AY8 C;  5AY8 D;  3WTP A;  3LZ1 C;  3LZ1 D;  3MGQ C;  3KUY B;  2F2A C;  1U35 A;  1P3L C;  1P3L D;  2CWE A;  3LZ0 B;  1TAF B;  5AV8 B;  3P5J B;  3VH6 A;  3O62 C;  3O62 D;  5GT3 B;  3AZK C;  3AZK D;  3X1U C;  3X1U D;  1KX5 A;  2FJ7 A;  3W97 B;  3C1B D;  4WU9 B;  5AVB C;  5AVB D;  5B40 B;  1P3A B;  1JFI B;  2NQB D;  1P3M C;  1P3M D;  2ARO B;  5B2I A;  5CPI A;  1ZLA C;  1ZLA D;  4G91 C;  4ZUX D;  2JCH A;  4QLC B;  1P3O A;  1A7W A;  1PZR A;  5AV6 A;  2FJ7 B;  3X1S A;  3AFA C;  3AV1 B;  2F8N D;  2IO5 C;  2ZY3 A;  1HQ3 B;  3WTP E;  3NQJ B;  2BYM A;  3MGP A;  1Z2C B;  5KDM B;  2Y2P A;  3KWQ C;  3KWQ D;  1KX4 D;  2YFW B;  4KUD D;  4KUD C;  2CV5 B;  4LD9 A;  4HGA B;  4Z66 D;  3UTB B;  1AOI B;  3MGP B;  3W98 B;  5AV5 D;  5AV5 C;  1M18 D;  1M18 C;  4DRB A;  1KU5 A;  1W2E A;  5B33 D;  5B33 C;  4KHA A;  4H9Q B;  4XZQ A;  3MVD D;  3MVD C;  3AZJ C;  3AZJ D;  3AZL B;  1BH8 B;  3LEL B;  3MGQ A;  4Z5T C;  4Z5T D;  5B24 C;  2G5H C;  5B24 D;  4KHA B;  4X23 B;  1R4V A;  4J8U A;  2Y2M A;  3W96 C;  3W96 D;  3TU4 A;  5CPK A;  3MGR B;  5B0Y C;  5B0Y D;  3REH D;  3REL B;  1BFM A;  2PYO B;  3W98 C;  4ZBJ C;  3VH5 A;  4R8P C;  4R8P D;  2ZY2 A;  3H0R C;  5B2J A;  5C3I C;  5AVC C;  5AVC D;  3MGS A;  3AFA A;  5CPK B;  3AYW B;  5JRG A;  4XUJ D;  4XUJ C;  3WKJ A;  1M1A B;  1WWI A;  2FFF B;  2HIO B;  5F99 B;  3REJ C;  3B0D B;  3B6F B;  4DRA A;  5BNV A;  4JJN C;  4JJN D;  1P3F C;  1P3F D;  3REK C;  3AZE B;  5CP6 B;  5B1L B;  3A1K A;  2Y2O A;  3LZ0 C;  3LZ0 D;  4H9R A;  5AV5 A;  1P34 A;  3MNN C;  3MNN D;  4WNN A;  5CPJ A;  5GT3 D;  5GT3 C;  5B31 C;  5B31 D;  3LJA B;  3W97 C;  4YS3 A;  1ID3 B;  3W97 D;  4KGC A;  4WU9 D;  3EPL A;  5B40 D;  1P3A D;  1P3K A;  4YM6 B;  2ARO D;  2ARO C;  3AZG A;  3AZJ A;  1P3I B;  1BH9 B;  3AZN A;  3AZF B;  4H9R B;  1P3G B;  1P34 B;  4EO5 B;  3AZI A;  4QLC C;  4QLC D;  1P3P B;  1B67 A;  3AZM C;  3AZM D;  5AV9 A;  3C1C A;  3AV1 C;  3AV1 D;  5DNM A;  1M19 B;  3EG5 B;  4G92 B;  3R45 A;  1HQ3 C;  1HQ3 D;  4WZS B;  3AZN B;  1S32 B;  4J8V A;  3AZH B;  5B0Z A;  2RIQ A;  1P3B B;  4HGA C;  4R8P A;  3R45 B;  3UTB D;  1AOI D;  2DF4 C;  3B6G B;  3AN2 A;  3UTA B;  3W98 D;  1KX3 B;  3W99 B;  3UT9 B;  3KSY A;  3REJ A;  2NZD B;  2XD5 A;  1H3O A;  3EPH A;  3AN2 B;  3AZL C;  3AZL D;  3WTP B;  3LEL C;  2JE5 A;  3LEL D;  5B1M A;  3C1B C;  3REK A;  3V9R A;  2W8S A;  1EQZ A;  2NQB C;  1U35 B;  5B32 A;  4X23 C;  4X23 D;  1TZY A;  3MNN A;  3H0M C;  1H3O B;  4ZUX C;  2ZY4 A;  1KX5 B;  3MGR D;  3MGR C;  5B1M B;  3AV2 C;  4WU8 A;  3AV2 D;  3REL D;  2PYO C;  2PYO D;  4J8W A;  5B2I B;  5CPI B;  5DNN A;  1TZY B;  5GXQ A;  2UWX A;  1F1E A;  1P3O B;  3A6N A;  2JSS A;  5AV6 B;  1KX4 C;  3X1S B;  3AYW C;  4NFT A;  2RVQ D;  2RVQ C;  3EPJ A;  5E5A C;  5E5A D;  3AYW D;  3NQU A;  1M1A D;  1M1A C;  4Z66 C;  5F99 D;  2LY8 A;  5F99 C;  2BYM B;  3B0D C;  4H9P A;  5GT0 A;  3B6F D;  4H9N A;  5BT1 D;  5BT1 C;  5GSU A;  5B32 G;  2Y2L A;  4WV4 B;  5CP6 C;  5CP6 D;  1F66 D;  1F66 C;  4LD9 B;  3KXB C;  3KXB D;  2ZY5 A;  5AY8 A;  3LZ1 A;  3LJA D;  3LJA C;  1ID3 C;  1ID3 D;  1HTA A;  1P3L A;  4YM6 C;  4YM6 D;  4H9S C;  4NE3 A;  1P3I D;  5FUG A;  4XZQ B;  3AZF C;  3O62 A;  3AZF D;  1P3G D;  4EO5 C;  3AZK A;  3X1U A;  2Y2I A;  1P3P C;  1P3P D;  3MGQ B;  3C1B A;  5AVB A;  3REI C;  3REI D;  3WAA C;  3WAA D;  2NQB A;  1M19 D;  3REH C;  4G92 C;  3X1T D;  3X1T C;  1P3M A;  1ZLA A;  2BYK A;  2ZM5 A;  4J8U B;  4ZUX A;  3TU4 B;  3AZK B;  1S32 D;  3X1U B;  4Z2M H;  3VH6 T;  5AVB B;  3X1V C;  3AZH C;  3AZH D;  3X1V D;  2F8N A;  3WA9 C;  3WA9 D;  4NE6 A;  4G91 B;  3B6G D;  3B6G C;  5JA4 A;  3UTA D;  5B2J B;  4J8X C;  4J8X D;  3MGS B;  2Y2J A;  3KWQ A;  1KX3 C;  4CSR A;  3AFA B;  3W99 D;  3W99 C;  3KUY D;  3KUY C;  1KX3 D;  5E5A A;  1KX4 A;  2F8N B;  5JRG B;  4KUD A;  3UT9 C;  3UT9 D;  3WKJ B;  4Z66 A;  4CAY A;  2NZD C;  2NZD D;  5BO0 A;  5AV8 C;  5AV8 D;  1M18 A;  5BNV B;  3WTP D;  3WTP C;  3KWQ B;  4UPK A;  5B33 A;  4WU9 C;  4KUD B;  5B40 C;  1P3A C;  5BS7 C;  1F66 A;  1U35 C;  1U35 D;  3MVD A;  2F8N G;  5AV5 B;  4WNN B;  5CPJ B;  4Z5T A;  1KX5 D;  5B24 A;  4YS3 B;  2FJ7 C;  2FJ7 D;  2HUE B;  4KGC B;  1P3K B;  3W96 A;  4Z2M G;  5B2I D;  3AZG B;  4UUZ A;  5CPI C;  3AZJ B;  5CPI D;  3AZI B;  1P3O D;  3REI A;  5B0Y A;  5AV9 B;  3B0C T;  3X1S D;  3C1C B;  4AWL B;  5DNM B;  3REH A;  3X1T A;  4WJ3 C;  2CV5 C;  2CV5 D;  2BG1 A;  3UTB C;  1AOI C;  5AVC A;  3MGP C;  3MGP D;  5BNX A;  3KFU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...