3AZJC

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjC00
1M1AB 4EO5B 1KX3B 5GT3B 5G49B 3MGPD 1P3MC 2F8NA 4H9OA 4WU8B 3W96A 4KUDC 3AZMC 5B31A 1HQ3B 3AV2A 5BO0B 3WKJB 4H9RB 3X1UB 2NQBC 3X1TA 3A6NA 3WA9A 4E44A 5AV5A 3O62A 4XUJC 1P3IB 4JJNB 3AZED 3R45A 5AV6B 3KUYB 3NQJB 1EQZB 1KX5C 2PYOC 3AZKB 5B24C 3MVDB 5B40B 5JRGB 1ZLAD 1P3BD 3REJD 3LELC 1ID3B 5DNMD 4WU9A 3C1CD 1TZYB 4J8UD 4J8XB 1M19B 2HIOC 5AVCD 3LJAB 3AZID 4NE5A 3AZNA 1P34D 3AZEC 3AFAA 5CHLB 4CSRB 2PYOA 3LZ1D 3RELB 3KSYA 4ZUXA 3VH5W 1JFIA 2F8NK 5KDMA 3VH6W 4J8WA 5GT0D 4NFTA 5C3IC 1ZLAC 1P3BC 5B1MB 3REJC 3LELA 3B6FB 5DNMC 3C1CC 3TU4B 3WAAD 5B33A 4J8UC 4H9NB 2HIOA 1KU5A 5E5AB 5AVCC 3AZFB 3AZIC 1P3LA 4XZQD 3UTAA 4DRBA 5CPIB 2BYMA 3MGRD 3REIA 3AZEA 1P34C 5B0ZA 4X23D 1B6WA 4Z5TD 5B2IA 3WTPE 3KXBB 4G91B 3W98D 3LZ1C 4HGAB 1KX4B 1P3KB 4KGCB 4WZSB 5AV8A 5GT0C 1M18D 5B32A 1P3BA 2FJ7A 4Z66A 3REHD 5FUGB 3LZ0D 1WWIA 4J8UA 3WTPA 3V9RB 5AVCA 3AZIA 2RVQD 2BYKA 2F8ND 4G92C 3W96D 4XZQC 4QLCA 5B31D 5AV9A 3AV2D 3AN2A 3AV1B 3MGRC 3AYWA 3KWQA 4X23C 2LY8A 5F99B 4Z5TC 5B1LA 3AZLB 3X1SB 3X1TD 3W98C 3LZ1A 4YM6A 1N1JB 5DNND 2YFVB 4H9PA 5AV5D 1S32D 4NE6A 1KX3A 5GT3A 1M18C 2YFWA 1U35B 5BNVA 2L5AA 1HQ3A 3AZGB 5BO0A 3WKJA 3MGPB 3LZ0C 4H9SC 2RVQC 3B0BA 3VH5T 3VH6T 3W96C 4Z2MG 5B31C 5B0YB 4R8PB 1P3IA 4WU9D 5AV6A 3KUYA 3UT9B 3NQJA 3X1TC 5DNNC 3AZKA 3AZJA 1S32C 1M18A 5CPJB 3AZND 1H3OA 4CAYB 3AFAD 1P3OD 1P3GA 3B6GB 3LZ0A 1ID3A 5GSUC 4M6BA 3MGSB 3MGQB 3REJB 3W99B 4ZUXD 1F66B 4J8WD 3LJAA 4ZBJB 5GXQB 3LELD 1BH8B 4WU9C 5B33D 2HIOD 4YS3B 4LD9B 4CSRA 5DNNA 3X1VB 1P3LD 1S32A 2HUEB 3UTAD 3RELA 1F1EA 3AZNC 3REID 3AFAC 1P3OC 5B0ZD 5B1MA 5BNXA 5B2ID 5GSUA 3B6FA 3MNND 4ZUXC 4J8WC 5AV8D 3AZFA 5B32D 5CP6D 3WAAB 2FJ7D 4Z66D 5CPIA 5BS7C 5CPKB 3C1BD 5B33C 3WTPD 2NZDB 3KXBA 3REKB 1P3LC 4X23B 4QLCD 5AV9D 1ULYA 3UTAC 3AN2D 1KX4A 1P3KA 1P3AD 3REIC 3AYWD 1P3OA 3KWQD 5B0ZC 5JA4B 3AZHB 5B1LD 5B2IC 4YM6D 1AOIB 3MNNC 3REHB 2CWEA 3NQUA 3V9RA 5AV8C 5GT3D 5AY8B 1KX3D 5B32C 2AROB 5CP6C 4WU8D 2FJ7C 1HQ3D 4Z66C 3UTBA 5BS7A 3AV1A 3WKJD 1WWSA 3C1BC 4H9OB 4J8VA 3X1UD 4AWLC 5B31B 3AV2B 3WTPC 3AZLA 4QLCC 1N1JA 5AV9C 5B2JB 3AN2C 1P3PA 1P3FB 2CV5B 1P3AC 3AYWC 3A6NB 1P3ID 3KWQC 4JJND 3WA9B 5AV6D 5AV5B 3O62B 3KUYD 4WNNA 5B1LC 3AZGA 1EQZD 4YM6C 3AZKD 3MNNA 3W97B 3AZJD 3MVDD 5B40D 4EO5C 1KX3C 5GT3C 5CP6A 5AVBB 4WU8C 1HQ3C 5B0YA 1P3MB 3WKJC 4R8PA 1P3GD 3C1BA 4KUDB 1ID3D 3X1UC 3AZMB 3UT9A 1TAFB 4H9QB 3LJAD 3B0DC 1P3AA 2NQBB 3B0CT 1P3IC 5CPJA 4JJNC 5AV6C 3KUYC 4XUJB 1EQZC 3AZKC 3MGSA 3MGQA 3AZJC 1M1AA 3MVDC 3RELD 5B40C 5G49A 1KX5B 2PYOB 3W99A 4WU8A 5B24B 5GXQA 5B1MD 1P3GC 4H9RA 5KDMB 5GSUD 3X1UA 1ID3C 3B6FD 3TU4D 3LELB 1A7WA 1M19C 4YS3A 5E5AD 3LJAC 3AZFD 3X1VA 2HIOB 5CPID 4JJNA 1P3LB 1EQZA 3KXBD 5BT1D 3AZEB 3MVDA 5B40A 3RELC 1KX4D 1P3KD 4KGCD 5JRGA 4Z2MH 5B1MC 3B6FC 5C3IB 1TZYA 3TU4C 1ZLAB 1P3BB 5DNMB 4J8XA 1M19A 2F8NG 3C1CB 2NZDA 5E5AC 3REKA 3AZFC 5B31G 4J8UB 1HTAA 3UTBD 5AVCB 3AZIB 5CPIC 3AV1D 4J8VD 5AV9B 5F99D 3KXBC 1P34B 5BT1C 3AZLD 3X1SD 4G91C 4NE3A 1AOIA 4HGAC 1KX4C 1P3KC 1P3PD 4KGCC 4KHAB 3LZ1B 5AY8A 3AZGD 5GT0B 3TU4A 2YFWB 1BH9B 5BNVB 4H9NA 5E5AA 2IO5C 3B0CW 5B2JA 3UTBC 5B0YD 3AV1C 4R8PD 1P3FA 2CV5A 4G92B 4J8VC 4XZQB 5F99C 4UUZB 3B0DB 3UT9D 3MGRB 3AZLC 3X1SC 3W97A 4Z5TB 1Q9CA 4KGCA 1P3PC 3W98B 5CPJD 1U35C 5AVBA 3AZJB 3AZGC 1P3MA 1M18B 3MGPC 3B6GD 5FUGA 3VH5A 4KUDA 3VH6A 1H3OB 3AZMA 3MGSD 3MGQD 1M1AD 3W99D 1P3GB 3LZ0B 1TAFA 1F66D 4H9QA 5GXQD 5B0YC 4R8PC 2NQBA 2F8NB 3W96B 5F99A 3UT9C 4XUJA 3X1SA 4YS3D 4LD9D 3X1VD 4DRAA 2YFVA 3X1TB 1KX5A 5DNNB 1U35A 5CPJC 4E45A 5B24A 1S32B 3MGPA 3B6GC 1BFMA 3R45B 3MGSC 3MGQC 1M1AC 5BNXB 3W99C 5GSUB 1F66C 5JRGD 5B32G 4ZBJC 5GXQC 5CPKD 1TZYD 4J8XD 1M19D 4WU9B 4YS3C 2NZDD 4LD9C 3REKD 3X1VC 2HUEC 4CAYA 3AZHD 3B6GA 3AZNB 2JSSA 3AFAB 1P3OB 1ZLAA 3REJA 1AOID 4H9PB 1F66A 5DNMA 5JRGC 3C1CA 5AY8D 2AROD 3WAAC 4ZUXB 1JFIB 3NQUB 4J8WB 1BH8A 5CPKC 1TZYC 2IO5B 4WV4B 3UTBB 4J8XC 2NZDC 4LD9A 1P34A 3REKC 4J8VB 5B33B 5B2JD 1P3FD 2CV5D 4KHAA 3A6ND 1B67A 3UTAB 3WA9D 3AZHC 3O62D 1P3PB 2BYMB 3REIB 5GT0A 5B0ZB 1R4VA 1BH9A 1AOIC 3W97D 5B2IB 4WNNB 3REHC 5AY8C 3MNNB 5AVBD 2AROC 3WAAA 5AV8B 5CPKA 1P3MD 5B32B 5CP6B 4KUDD 2FJ7B 4XZQA 3AZMD 4Z66B 3AV2C 4UUZA 3MGRA 3C1BB 4AWLB 4X23A 3WTPB 4Z5TA 5B2JC 2BYKB 2NQBD 1P3FC 2CV5C 3W98A 4QLCB 3A6NC 5JA4A 3AN2B 3WA9C 3AZHA 5AV5C 3O62C 1P3AB 4XUJD 3AYWB 3KWQB 3W97C 5B1LB 3REHA 4YM6B 1KX5D 2PYOD 1U35D 2F8NH 2AROA 5AVBC 5B24D 4H9SA
chains in the Genus database with same CATH superfamily
1M1AB 4EO5B 1KX3B 5GT3B 5G49B 3MGPD 1P3MC 2F8NA 4H9OA 4WU8B 3W96A 4KUDC 3AZMC 5B31A 1HQ3B 3AV2A 5BO0B 3WKJB 4H9RB 3X1UB 2Y2MA 2NQBC 3X1TA 3A6NA 3WA9A 4E44A 5AV5A 3O62A 4XUJC 1P3IB 4JJNB 3AZED 3R45A 5AV6B 3KUYB 3NQJB 1EQZB 1KX5C 2PYOC 3AZKB 5B24C 3MVDB 5B40B 5JRGB 1ZLAD 1P3BD 3REJD 3LELC 1ID3B 5DNMD 4WU9A 3C1CD 1TZYB 4J8UD 4J8XB 1M19B 2HIOC 5AVCD 3LJAB 3AZID 4NE5A 3AZNA 1P34D 3AZEC 3AFAA 5CHLB 4CSRB 2PYOA 3LZ1D 3RELB 3KSYA 4ZUXA 3VH5W 1JFIA 2F8NK 5KDMA 3VH6W 4J8WA 5GT0D 4NFTA 5C3IC 1ZLAC 1P3BC 5B1MB 3REJC 3LELA 2Y2JA 3B6FB 5DNMC 3C1CC 3TU4B 3WAAD 5B33A 4J8UC 4H9NB 2Y2IA 2HIOA 1KU5A 5E5AB 5AVCC 3AZFB 3AZIC 2BG1A 1P3LA 4XZQD 3UTAA 4DRBA 5CPIB 2BYMA 3MGRD 3REIA 3AZEA 1P34C 5B0ZA 4X23D 1B6WA 4Z5TD 5B2IA 3WTPE 3KXBB 4G91B 3W98D 3LZ1C 4HGAB 1KX4B 1P3KB 4KGCB 4WZSB 5AV8A 5GT0C 1M18D 5B32A 1P3BA 2FJ7A 4Z66A 3REHD 5FUGB 3LZ0D 1WWIA 4J8UA 3H0MC 3WTPA 3V9RB 5AVCA 3AZIA 2RVQD 2BYKA 2F8ND 4G92C 3W96D 4XZQC 4QLCA 5B31D 5AV9A 3EPJA 3AV2D 3AN2A 3AV1B 3MGRC 3AYWA 3KWQA 4X23C 2LY8A 5F99B 4Z5TC 5B1LA 3AZLB 3X1SB 3X1TD 3W98C 3LZ1A 4YM6A 1N1JB 5DNND 2YFVB 4H9PA 5AV5D 1S32D 4NE6A 1KX3A 5GT3A 1M18C 2YFWA 1U35B 5BNVA 2L5AA 1HQ3A 3AZGB 5BO0A 3WKJA 3MGPB 3LZ0C 4H9SC 2RVQC 3B0BA 3VH5T 3VH6T 3W96C 4Z2MG 5B31C 5B0YB 4R8PB 1P3IA 3KFUG 4WU9D 5AV6A 3KUYA 3UT9B 3NQJA 3X1TC 5DNNC 3AZKA 3AZJA 1S32C 1M18A 5CPJB 3AZND 1H3OA 4CAYB 3AFAD 1P3OD 1P3GA 3B6GB 3LZ0A 1ID3A 5GSUC 4M6BA 3MGSB 3MGQB 3REJB 3W99B 4ZUXD 1F66B 4J8WD 3LJAA 4ZBJB 5GXQB 2DF4C 3LELD 2Y2PA 1BH8B 4WU9C 3FDDA 5B33D 2HIOD 2UWXA 4YS3B 4LD9B 4CSRA 5DNNA 3X1VB 1P3LD 1S32A 2HUEB 3UTAD 3RELA 1F1EA 3AZNC 3REID 3AFAC 1P3OC 5B0ZD 5B1MA 5BNXA 5B2ID 5GSUA 3B6FA 2Y2LA 3MNND 4ZUXC 4J8WC 5AV8D 3AZFA 5B32D 5CP6D 3WAAB 2FJ7D 4Z66D 5CPIA 5BS7C 5CPKB 3C1BD 5B33C 3WTPD 2NZDB 2ZY4A 3KXBA 3REKB 3A1KA 1P3LC 4X23B 4QLCD 5AV9D 1ULYA 3UTAC 3AN2D 1KX4A 1P3KA 1P3AD 3REIC 3AYWD 1P3OA 2VQRA 3KWQD 5B0ZC 5JA4B 3AZHB 5B1LD 2XD1A 5B2IC 2JCHA 2Y2HA 4YM6D 1AOIB 3MNNC 3REHB 2CWEA 3NQUA 3V9RA 5AV8C 5GT3D 5AY8B 1KX3D 3EG5B 5B32C 2AROB 5CP6C 4WU8D 2FJ7C 1HQ3D 2W8SA 4Z66C 3UTBA 5BS7A 3AV1A 3WKJD 1WWSA 3C1BC 4H9OB 4J8VA 3X1UD 4AWLC 5B31B 3AV2B 3WTPC 3AZLA 4QLCC 1N1JA 5AV9C 5B2JB 3AN2C 1P3PA 1P3FB 2CV5B 1P3AC 3AYWC 3A6NB 1P3ID 3KWQC 4JJND 3WA9B 5AV6D 5AV5B 3O62B 3KUYD 4WNNA 5B1LC 3AZGA 1EQZD 4YM6C 3AZKD 3MNNA 3W97B 3AZJD 2Y2NA 3MVDD 5B40D 4EO5C 1KX3C 5GT3C 5CP6A 5AVBB 4WU8C 1HQ3C 5B0YA 1P3MB 3WKJC 4R8PA 1P3GD 3C1BA 4KUDB 1ID3D 3X1UC 3AZMB 3UT9A 1TAFB 4H9QB 3LJAD 1PZRA 3B0DC 1P3AA 2XD5A 3B0CT 2NQBB 1P3IC 5CPJA 4JJNC 5AV6C 3KUYC 4XUJB 1EQZC 3AL0C 3AZKC 3MGSA 3MGQA 3AZJC 1M1AA 3MVDC 3RELD 5B40C 5G49A 1KX5B 2PYOB 3W99A 4WU8A 5B24B 3H0LC 5GXQA 5B1MD 1P3GC 4H9RA 5KDMB 5GSUD 3X1UA 1ID3C 3B6FD 3TU4D 3LELB 1A7WA 1M19C 4YS3A 5E5AD 3LJAC 3AZFD 3X1VA 2ZY2A 2HIOB 5CPID 4JJNA 1P3LB 1EQZA 3KXBD 5BT1D 3AZEB 2J8PA 3MVDA 5B40A 3RELC 1KX4D 1P3KD 3IP4C 5JRGA 4KGCD 4Z2MH 5B1MC 3B6FC 5C3IB 1TZYA 3TU4C 1ZLAB 1P3BB 2G5HC 2G5IC 5DNMB 4J8XA 1M19A 2F8NG 3C1CB 2NZDA 5E5AC 3REKA 3EPKA 5B31G 3AZFC 4J8UB 1HTAA 3UTBD 5AVCB 3AZIB 5CPIC 3AV1D 4J8VD 5AV9B 5F99D 3KXBC 1P34B 5BT1C 3AZLD 3X1SD 4G91C 4NE3A 1AOIA 4HGAC 1KX4C 1P3KC 1P3PD 4KGCC 1T3UA 4KHAB 3LZ1B 5AY8A 3AZGD 5GT0B 3TU4A 2YFWB 1BH9B 5BNVB 4H9NA 5E5AA 4DQYB 2IO5C 3B0CW 5B2JA 3UTBC 5B0YD 3AV1C 4R8PD 1P3FA 2CV5A 4G92B 4J8VC 4XZQB 5F99C 4UUZB 3B0DB 3UT9D 3MGRB 3AZLC 3X1SC 2Y2QA 2Y2KA 3W97A 4Z5TB 1Q9CA 4KGCA 4WJ3C 1P3PC 3W98B 5CPJD 1U35C 5AVBA 3AZJB 3AZGC 3P5JB 1P3MA 1M18B 3MGPC 3B6GD 5FUGA 3VH5A 4KUDA 3VH6A 1H3OB 3AZMA 3MGSD 3MGQD 1M1AD 3W99D 1P3GB 3LZ0B 1TAFA 1F66D 4H9QA 5GXQD 3EPHA 5B0YC 4R8PC 2NQBA 2F8NB 2ZM5A 3H0RC 3W96B 5F99A 3UT9C 4XUJA 3X1SA 4YS3D 4LD9D 3X1VD 4DRAA 2YFVA 3X1TB 1KX5A 5DNNB 1U35A 5CPJC 4E45A 5B24A 1S32B 3MGPA 3B6GC 1BFMA 3R45B 3MGSC 3MGQC 1M1AC 5BNXB 3W99C 3EPLA 5GSUB 1F66C 5JRGD 5B32G 4ZBJC 5GXQC 5CPKD 1TZYD 2F2AC 4J8XD 1M19D 4WU9B 4YS3C 2NZDD 4LD9C 3REKD 3X1VC 2HUEC 2Y2GA 2ZY3A 4CAYA 3AZHD 3B6GA 3AZNB 2JSSA 3AFAB 1P3OB 1ZLAA 3REJA 1AOID 4H9PB 1F66A 5DNMA 5JRGC 2Y2OA 3C1CA 5AY8D 2AROD 3WAAC 4ZUXB 1JFIB 3NQUB 4J8WB 1BH8A 5CPKC 1TZYC 1W2EA 2IO5B 4WV4B 3UTBB 4J8XC 2NZDC 4LD9A 1P34A 3REKC 4J8VB 5B33B 5B2JD 1P3FD 2CV5D 3A1IA 4KHAA 3A6ND 1B67A 3UTAB 3WA9D 3AZHC 3O62D 1P3PB 2BYMB 3REIB 5GT0A 4UPKA 2DQNC 2RIQA 5B0ZB 1R4VA 1BH9A 1AOIC 3W97D 5B2IB 4WNNB 3REHC 2ZY5A 2FFFB 5AY8C 3MNNB 5AVBD 2AROC 3WAAA 5AV8B 5CPKA 1P3MD 5B32B 5CP6B 1Z2CB 2FJ7B 4XZQA 3AZMD 4KUDD 4Z66B 3AV2C 4UUZA 3MGRA 3C1BB 4AWLB 4X23A 3F6TA 3WTPB 4Z5TA 5B2JC 2BYKB 2NQBD 1P3FC 2CV5C 3W98A 4QLCB 3A6NC 5JA4A 3AN2B 3WA9C 3AZHA 5AV5C 3O62C 1P3AB 4XUJD 3AYWB 3KWQB 2JE5A 3W97C 5B1LB 3REHA 4YM6B 1KX5D 2PYOD 1U35D 2F8NH 2AROA 5AVBC 5B24D 4H9SA
chains in the Genus database with same CATH topology
1M1AB 4EO5B 1KX3B 5GT3B 5G49B 3MGPD 1P3MC 2F8NA 4H9OA 4WU8B 3W96A 4KUDC 3AZMC 5B31A 1HQ3B 3AV2A 5BO0B 3WKJB 4H9RB 3X1UB 2Y2MA 2NQBC 3X1TA 3A6NA 3WA9A 4E44A 5AV5A 3O62A 4XUJC 1P3IB 4JJNB 3AZED 3R45A 5AV6B 3KUYB 3NQJB 1EQZB 1KX5C 2PYOC 3AZKB 5B24C 3MVDB 5B40B 5JRGB 1ZLAD 1P3BD 3REJD 3LELC 1ID3B 5DNMD 4WU9A 3C1CD 1TZYB 4J8UD 4J8XB 1M19B 2HIOC 5AVCD 3LJAB 3AZID 4NE5A 3AZNA 1P34D 3AZEC 3AFAA 5CHLB 4CSRB 2PYOA 3LZ1D 3RELB 3KSYA 4ZUXA 3VH5W 1JFIA 2F8NK 5KDMA 3VH6W 4J8WA 5GT0D 4NFTA 5C3IC 1ZLAC 1P3BC 5B1MB 3REJC 3LELA 2Y2JA 3B6FB 5DNMC 3C1CC 3TU4B 3WAAD 5B33A 4J8UC 4H9NB 2Y2IA 2HIOA 1KU5A 5E5AB 5AVCC 3AZFB 3AZIC 2BG1A 1P3LA 4XZQD 3UTAA 4DRBA 5CPIB 2BYMA 3MGRD 3REIA 3AZEA 1P34C 5B0ZA 4X23D 1B6WA 4Z5TD 5B2IA 3WTPE 3KXBB 4G91B 3W98D 3LZ1C 4HGAB 1KX4B 1P3KB 4KGCB 4WZSB 5AV8A 5GT0C 1M18D 5B32A 1P3BA 2FJ7A 4Z66A 3REHD 5FUGB 3LZ0D 1WWIA 4J8UA 3H0MC 3WTPA 3V9RB 5AVCA 3AZIA 2RVQD 2BYKA 2F8ND 4G92C 3W96D 4XZQC 4QLCA 5B31D 5AV9A 3EPJA 3AV2D 3AN2A 3AV1B 3MGRC 3AYWA 3KWQA 4X23C 2LY8A 5F99B 4Z5TC 5B1LA 3AZLB 3X1SB 3X1TD 3W98C 3LZ1A 4YM6A 1N1JB 5DNND 2YFVB 4H9PA 5AV5D 1S32D 4NE6A 1KX3A 5GT3A 1M18C 2YFWA 1U35B 5BNVA 2L5AA 1HQ3A 3AZGB 5BO0A 3WKJA 3MGPB 3LZ0C 4H9SC 2RVQC 3B0BA 3VH5T 3VH6T 3W96C 4Z2MG 5B31C 5B0YB 4R8PB 1P3IA 3KFUG 4WU9D 5AV6A 3KUYA 3UT9B 3NQJA 3X1TC 5DNNC 3AZKA 3AZJA 1S32C 1M18A 5CPJB 3AZND 1H3OA 4CAYB 3AFAD 1P3OD 1P3GA 3B6GB 3LZ0A 1ID3A 5GSUC 4M6BA 3MGSB 3MGQB 3REJB 3W99B 4ZUXD 1F66B 4J8WD 3LJAA 4ZBJB 5GXQB 2DF4C 3LELD 2Y2PA 1BH8B 4WU9C 3FDDA 5B33D 2HIOD 2UWXA 4YS3B 4LD9B 4CSRA 5DNNA 3X1VB 1P3LD 1S32A 2HUEB 3UTAD 3RELA 1F1EA 3AZNC 3REID 3AFAC 1P3OC 5B0ZD 5B1MA 5BNXA 5B2ID 5GSUA 3B6FA 2Y2LA 3MNND 4ZUXC 4J8WC 5AV8D 3AZFA 5B32D 5CP6D 3WAAB 2FJ7D 4Z66D 5CPIA 5BS7C 5CPKB 3C1BD 5B33C 3WTPD 2NZDB 2ZY4A 3KXBA 3REKB 3A1KA 1P3LC 4X23B 4QLCD 5AV9D 1ULYA 3UTAC 3AN2D 1KX4A 1P3KA 1P3AD 3REIC 3AYWD 1P3OA 2VQRA 3KWQD 5B0ZC 5JA4B 3AZHB 5B1LD 2XD1A 5B2IC 2JCHA 2Y2HA 4YM6D 1AOIB 3MNNC 3REHB 2CWEA 3NQUA 3V9RA 5AV8C 5GT3D 5AY8B 1KX3D 3EG5B 5B32C 2AROB 5CP6C 4WU8D 2FJ7C 1HQ3D 2W8SA 4Z66C 3UTBA 5BS7A 3AV1A 3WKJD 1WWSA 3C1BC 4H9OB 4J8VA 3X1UD 4AWLC 5B31B 3AV2B 3WTPC 3AZLA 4QLCC 1N1JA 5AV9C 5B2JB 3AN2C 1P3PA 1P3FB 2CV5B 1P3AC 3AYWC 3A6NB 1P3ID 3KWQC 4JJND 3WA9B 5AV6D 5AV5B 3O62B 3KUYD 4WNNA 5B1LC 3AZGA 1EQZD 4YM6C 3AZKD 3MNNA 3W97B 3AZJD 2Y2NA 3MVDD 5B40D 4EO5C 1KX3C 5GT3C 5CP6A 5AVBB 4WU8C 1HQ3C 5B0YA 1P3MB 3WKJC 4R8PA 1P3GD 3C1BA 4KUDB 1ID3D 3X1UC 3AZMB 3UT9A 1TAFB 4H9QB 3LJAD 1PZRA 3B0DC 1P3AA 2XD5A 3B0CT 2NQBB 1P3IC 5CPJA 4JJNC 5AV6C 3KUYC 4XUJB 1EQZC 3AL0C 3AZKC 3MGSA 3MGQA 3AZJC 1M1AA 3MVDC 3RELD 5B40C 5G49A 1KX5B 2PYOB 3W99A 4WU8A 5B24B 3H0LC 5GXQA 5B1MD 1P3GC 4H9RA 5KDMB 5GSUD 3X1UA 1ID3C 3B6FD 3TU4D 3LELB 1A7WA 1M19C 4YS3A 5E5AD 3LJAC 3AZFD 3X1VA 2ZY2A 2HIOB 5CPID 4JJNA 1P3LB 1EQZA 3KXBD 5BT1D 3AZEB 2J8PA 3MVDA 5B40A 3RELC 1KX4D 1P3KD 3IP4C 5JRGA 4KGCD 4Z2MH 5B1MC 3B6FC 5C3IB 1TZYA 3TU4C 1ZLAB 1P3BB 2G5HC 2G5IC 5DNMB 4J8XA 1M19A 2F8NG 3C1CB 2NZDA 5E5AC 3REKA 3EPKA 5B31G 3AZFC 4J8UB 1HTAA 3UTBD 5AVCB 3AZIB 5CPIC 3AV1D 4J8VD 5AV9B 5F99D 3KXBC 1P34B 5BT1C 3AZLD 3X1SD 4G91C 4NE3A 1AOIA 4HGAC 1KX4C 1P3KC 1P3PD 4KGCC 1T3UA 4KHAB 3LZ1B 5AY8A 3AZGD 5GT0B 3TU4A 2YFWB 1BH9B 5BNVB 4H9NA 5E5AA 4DQYB 2IO5C 3B0CW 5B2JA 3UTBC 5B0YD 3AV1C 4R8PD 1P3FA 2CV5A 4G92B 4J8VC 4XZQB 5F99C 4UUZB 3B0DB 3UT9D 3MGRB 3AZLC 3X1SC 2Y2QA 2Y2KA 3W97A 4Z5TB 1Q9CA 4KGCA 4WJ3C 1P3PC 3W98B 5CPJD 1U35C 5AVBA 3AZJB 3AZGC 3P5JB 1P3MA 1M18B 3MGPC 3B6GD 5FUGA 3VH5A 4KUDA 3VH6A 1H3OB 3AZMA 3MGSD 3MGQD 1M1AD 3W99D 1P3GB 3LZ0B 1TAFA 1F66D 4H9QA 5GXQD 3EPHA 5B0YC 4R8PC 2NQBA 2F8NB 2ZM5A 3H0RC 3W96B 5F99A 3UT9C 4XUJA 3X1SA 4YS3D 4LD9D 3X1VD 4DRAA 2YFVA 3X1TB 1KX5A 5DNNB 1U35A 5CPJC 4E45A 5B24A 1S32B 3MGPA 3B6GC 1BFMA 3R45B 3MGSC 3MGQC 1M1AC 5BNXB 3W99C 3EPLA 5GSUB 1F66C 5JRGD 5B32G 4ZBJC 5GXQC 5CPKD 1TZYD 2F2AC 4J8XD 1M19D 4WU9B 4YS3C 2NZDD 4LD9C 3REKD 3X1VC 2HUEC 2Y2GA 2ZY3A 4CAYA 3AZHD 3B6GA 3AZNB 2JSSA 3AFAB 1P3OB 1ZLAA 3REJA 1AOID 4H9PB 1F66A 5DNMA 5JRGC 2Y2OA 3C1CA 5AY8D 2AROD 3WAAC 4ZUXB 1JFIB 3NQUB 4J8WB 1BH8A 5CPKC 1TZYC 1W2EA 2IO5B 4WV4B 3UTBB 4J8XC 2NZDC 4LD9A 1P34A 3REKC 4J8VB 5B33B 5B2JD 1P3FD 2CV5D 3A1IA 4KHAA 3A6ND 1B67A 3UTAB 3WA9D 3AZHC 3O62D 1P3PB 2BYMB 3REIB 5GT0A 4UPKA 2DQNC 2RIQA 5B0ZB 1R4VA 1BH9A 1AOIC 3W97D 5B2IB 4WNNB 3REHC 2ZY5A 2FFFB 5AY8C 3MNNB 5AVBD 2AROC 3WAAA 5AV8B 5CPKA 1P3MD 5B32B 5CP6B 1Z2CB 2FJ7B 4XZQA 3AZMD 4KUDD 4Z66B 3AV2C 4UUZA 3MGRA 3C1BB 4AWLB 4X23A 3F6TA 3WTPB 4Z5TA 5B2JC 2BYKB 2NQBD 1P3FC 2CV5C 3W98A 4QLCB 3A6NC 5JA4A 3AN2B 3WA9C 3AZHA 5AV5C 3O62C 1P3AB 4XUJD 3AYWB 3KWQB 2JE5A 3W97C 5B1LB 3REHA 4YM6B 1KX5D 2PYOD 1U35D 2F8NH 2AROA 5AVBC 5B24D 4H9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A B;  4EO5 B;  1KX3 B;  5GT3 B;  5G49 B;  3MGP D;  1P3M C;  2F8N A;  4H9O A;  4WU8 B;  3W96 A;  4KUD C;  3AZM C;  5B31 A;  1HQ3 B;  3AV2 A;  5BO0 B;  3WKJ B;  4H9R B;  3X1U B;  2NQB C;  3X1T A;  3A6N A;  3WA9 A;  4E44 A;  5AV5 A;  3O62 A;  4XUJ C;  1P3I B;  4JJN B;  3AZE D;  3R45 A;  5AV6 B;  3KUY B;  3NQJ B;  1EQZ B;  1KX5 C;  2PYO C;  3AZK B;  5B24 C;  3MVD B;  5B40 B;  5JRG B;  1ZLA D;  1P3B D;  3REJ D;  3LEL C;  1ID3 B;  5DNM D;  4WU9 A;  3C1C D;  1TZY B;  4J8U D;  4J8X B;  1M19 B;  2HIO C;  5AVC D;  3LJA B;  3AZI D;  4NE5 A;  3AZN A;  1P34 D;  3AZE C;  3AFA A;  5CHL B;  4CSR B;  2PYO A;  3LZ1 D;  3REL B;  3KSY A;  4ZUX A;  3VH5 W;  1JFI A;  2F8N K;  5KDM A;  3VH6 W;  4J8W A;  5GT0 D;  4NFT A;  5C3I C;  1ZLA C;  1P3B C;  5B1M B;  3REJ C;  3LEL A;  3B6F B;  5DNM C;  3C1C C;  3TU4 B;  3WAA D;  5B33 A;  4J8U C;  4H9N B;  2HIO A;  1KU5 A;  5E5A B;  5AVC C;  3AZF B;  3AZI C;  1P3L A;  4XZQ D;  3UTA A;  4DRB A;  5CPI B;  2BYM A;  3MGR D;  3REI A;  3AZE A;  1P34 C;  5B0Z A;  4X23 D;  1B6W A;  4Z5T D;  5B2I A;  3WTP E;  3KXB B;  4G91 B;  3W98 D;  3LZ1 C;  4HGA B;  1KX4 B;  1P3K B;  4KGC B;  4WZS B;  5AV8 A;  5GT0 C;  1M18 D;  5B32 A;  1P3B A;  2FJ7 A;  4Z66 A;  3REH D;  5FUG B;  3LZ0 D;  1WWI A;  4J8U A;  3WTP A;  3V9R B;  5AVC A;  3AZI A;  2RVQ D;  2BYK A;  2F8N D;  4G92 C;  3W96 D;  4XZQ C;  4QLC A;  5B31 D;  5AV9 A;  3AV2 D;  3AN2 A;  3AV1 B;  3MGR C;  3AYW A;  3KWQ A;  4X23 C;  2LY8 A;  5F99 B;  4Z5T C;  5B1L A;  3AZL B;  3X1S B;  3X1T D;  3W98 C;  3LZ1 A;  4YM6 A;  1N1J B;  5DNN D;  2YFV B;  4H9P A;  5AV5 D;  1S32 D;  4NE6 A;  1KX3 A;  5GT3 A;  1M18 C;  2YFW A;  1U35 B;  5BNV A;  2L5A A;  1HQ3 A;  3AZG B;  5BO0 A;  3WKJ A;  3MGP B;  3LZ0 C;  4H9S C;  2RVQ C;  3B0B A;  3VH5 T;  3VH6 T;  3W96 C;  4Z2M G;  5B31 C;  5B0Y B;  4R8P B;  1P3I A;  4WU9 D;  5AV6 A;  3KUY A;  3UT9 B;  3NQJ A;  3X1T C;  5DNN C;  3AZK A;  3AZJ A;  1S32 C;  1M18 A;  5CPJ B;  3AZN D;  1H3O A;  4CAY B;  3AFA D;  1P3O D;  1P3G A;  3B6G B;  3LZ0 A;  1ID3 A;  5GSU C;  4M6B A;  3MGS B;  3MGQ B;  3REJ B;  3W99 B;  4ZUX D;  1F66 B;  4J8W D;  3LJA A;  4ZBJ B;  5GXQ B;  3LEL D;  1BH8 B;  4WU9 C;  5B33 D;  2HIO D;  4YS3 B;  4LD9 B;  4CSR A;  5DNN A;  3X1V B;  1P3L D;  1S32 A;  2HUE B;  3UTA D;  3REL A;  1F1E A;  3AZN C;  3REI D;  3AFA C;  1P3O C;  5B0Z D;  5B1M A;  5BNX A;  5B2I D;  5GSU A;  3B6F A;  3MNN D;  4ZUX C;  4J8W C;  5AV8 D;  3AZF A;  5B32 D;  5CP6 D;  3WAA B;  2FJ7 D;  4Z66 D;  5CPI A;  5BS7 C;  5CPK B;  3C1B D;  5B33 C;  3WTP D;  2NZD B;  3KXB A;  3REK B;  1P3L C;  4X23 B;  4QLC D;  5AV9 D;  1ULY A;  3UTA C;  3AN2 D;  1KX4 A;  1P3K A;  1P3A D;  3REI C;  3AYW D;  1P3O A;  3KWQ D;  5B0Z C;  5JA4 B;  3AZH B;  5B1L D;  5B2I C;  4YM6 D;  1AOI B;  3MNN C;  3REH B;  2CWE A;  3NQU A;  3V9R A;  5AV8 C;  5GT3 D;  5AY8 B;  1KX3 D;  5B32 C;  2ARO B;  5CP6 C;  4WU8 D;  2FJ7 C;  1HQ3 D;  4Z66 C;  3UTB A;  5BS7 A;  3AV1 A;  3WKJ D;  1WWS A;  3C1B C;  4H9O B;  4J8V A;  3X1U D;  4AWL C;  5B31 B;  3AV2 B;  3WTP C;  3AZL A;  4QLC C;  1N1J A;  5AV9 C;  5B2J B;  3AN2 C;  1P3P A;  1P3F B;  2CV5 B;  1P3A C;  3AYW C;  3A6N B;  1P3I D;  3KWQ C;  4JJN D;  3WA9 B;  5AV6 D;  5AV5 B;  3O62 B;  3KUY D;  4WNN A;  5B1L C;  3AZG A;  1EQZ D;  4YM6 C;  3AZK D;  3MNN A;  3W97 B;  3AZJ D;  3MVD D;  5B40 D;  4EO5 C;  1KX3 C;  5GT3 C;  5CP6 A;  5AVB B;  4WU8 C;  1HQ3 C;  5B0Y A;  1P3M B;  3WKJ C;  4R8P A;  1P3G D;  3C1B A;  4KUD B;  1ID3 D;  3X1U C;  3AZM B;  3UT9 A;  1TAF B;  4H9Q B;  3LJA D;  3B0D C;  1P3A A;  2NQB B;  3B0C T;  1P3I C;  5CPJ A;  4JJN C;  5AV6 C;  3KUY C;  4XUJ B;  1EQZ C;  3AZK C;  3MGS A;  3MGQ A;  3AZJ C;  1M1A A;  3MVD C;  3REL D;  5B40 C;  5G49 A;  1KX5 B;  2PYO B;  3W99 A;  4WU8 A;  5B24 B;  5GXQ A;  5B1M D;  1P3G C;  4H9R A;  5KDM B;  5GSU D;  3X1U A;  1ID3 C;  3B6F D;  3TU4 D;  3LEL B;  1A7W A;  1M19 C;  4YS3 A;  5E5A D;  3LJA C;  3AZF D;  3X1V A;  2HIO B;  5CPI D;  4JJN A;  1P3L B;  1EQZ A;  3KXB D;  5BT1 D;  3AZE B;  3MVD A;  5B40 A;  3REL C;  1KX4 D;  1P3K D;  4KGC D;  5JRG A;  4Z2M H;  5B1M C;  3B6F C;  5C3I B;  1TZY A;  3TU4 C;  1ZLA B;  1P3B B;  5DNM B;  4J8X A;  1M19 A;  2F8N G;  3C1C B;  2NZD A;  5E5A C;  3REK A;  3AZF C;  5B31 G;  4J8U B;  1HTA A;  3UTB D;  5AVC B;  3AZI B;  5CPI C;  3AV1 D;  4J8V D;  5AV9 B;  5F99 D;  3KXB C;  1P34 B;  5BT1 C;  3AZL D;  3X1S D;  4G91 C;  4NE3 A;  1AOI A;  4HGA C;  1KX4 C;  1P3K C;  1P3P D;  4KGC C;  4KHA B;  3LZ1 B;  5AY8 A;  3AZG D;  5GT0 B;  3TU4 A;  2YFW B;  1BH9 B;  5BNV B;  4H9N A;  5E5A A;  2IO5 C;  3B0C W;  5B2J A;  3UTB C;  5B0Y D;  3AV1 C;  4R8P D;  1P3F A;  2CV5 A;  4G92 B;  4J8V C;  4XZQ B;  5F99 C;  4UUZ B;  3B0D B;  3UT9 D;  3MGR B;  3AZL C;  3X1S C;  3W97 A;  4Z5T B;  1Q9C A;  4KGC A;  1P3P C;  3W98 B;  5CPJ D;  1U35 C;  5AVB A;  3AZJ B;  3AZG C;  1P3M A;  1M18 B;  3MGP C;  3B6G D;  5FUG A;  3VH5 A;  4KUD A;  3VH6 A;  1H3O B;  3AZM A;  3MGS D;  3MGQ D;  1M1A D;  3W99 D;  1P3G B;  3LZ0 B;  1TAF A;  1F66 D;  4H9Q A;  5GXQ D;  5B0Y C;  4R8P C;  2NQB A;  2F8N B;  3W96 B;  5F99 A;  3UT9 C;  4XUJ A;  3X1S A;  4YS3 D;  4LD9 D;  3X1V D;  4DRA A;  2YFV A;  3X1T B;  1KX5 A;  5DNN B;  1U35 A;  5CPJ C;  4E45 A;  5B24 A;  1S32 B;  3MGP A;  3B6G C;  1BFM A;  3R45 B;  3MGS C;  3MGQ C;  1M1A C;  5BNX B;  3W99 C;  5GSU B;  1F66 C;  5JRG D;  5B32 G;  4ZBJ C;  5GXQ C;  5CPK D;  1TZY D;  4J8X D;  1M19 D;  4WU9 B;  4YS3 C;  2NZD D;  4LD9 C;  3REK D;  3X1V C;  2HUE C;  4CAY A;  3AZH D;  3B6G A;  3AZN B;  2JSS A;  3AFA B;  1P3O B;  1ZLA A;  3REJ A;  1AOI D;  4H9P B;  1F66 A;  5DNM A;  5JRG C;  3C1C A;  5AY8 D;  2ARO D;  3WAA C;  4ZUX B;  1JFI B;  3NQU B;  4J8W B;  1BH8 A;  5CPK C;  1TZY C;  2IO5 B;  4WV4 B;  3UTB B;  4J8X C;  2NZD C;  4LD9 A;  1P34 A;  3REK C;  4J8V B;  5B33 B;  5B2J D;  1P3F D;  2CV5 D;  4KHA A;  3A6N D;  1B67 A;  3UTA B;  3WA9 D;  3AZH C;  3O62 D;  1P3P B;  2BYM B;  3REI B;  5GT0 A;  5B0Z B;  1R4V A;  1BH9 A;  1AOI C;  3W97 D;  5B2I B;  4WNN B;  3REH C;  5AY8 C;  3MNN B;  5AVB D;  2ARO C;  3WAA A;  5AV8 B;  5CPK A;  1P3M D;  5B32 B;  5CP6 B;  4KUD D;  2FJ7 B;  4XZQ A;  3AZM D;  4Z66 B;  3AV2 C;  4UUZ A;  3MGR A;  3C1B B;  4AWL B;  4X23 A;  3WTP B;  4Z5T A;  5B2J C;  2BYK B;  2NQB D;  1P3F C;  2CV5 C;  3W98 A;  4QLC B;  3A6N C;  5JA4 A;  3AN2 B;  3WA9 C;  3AZH A;  5AV5 C;  3O62 C;  1P3A B;  4XUJ D;  3AYW B;  3KWQ B;  3W97 C;  5B1L B;  3REH A;  4YM6 B;  1KX5 D;  2PYO D;  1U35 D;  2F8N H;  2ARO A;  5AVB C;  5B24 D;  4H9S A; 
#chains in the Genus database with same CATH topology
 1M1A B;  4EO5 B;  1KX3 B;  5GT3 B;  5G49 B;  3MGP D;  1P3M C;  2F8N A;  4H9O A;  4WU8 B;  3W96 A;  4KUD C;  3AZM C;  5B31 A;  1HQ3 B;  3AV2 A;  5BO0 B;  3WKJ B;  4H9R B;  3X1U B;  2Y2M A;  2NQB C;  3X1T A;  3A6N A;  3WA9 A;  4E44 A;  5AV5 A;  3O62 A;  4XUJ C;  1P3I B;  4JJN B;  3AZE D;  3R45 A;  5AV6 B;  3KUY B;  3NQJ B;  1EQZ B;  1KX5 C;  2PYO C;  3AZK B;  5B24 C;  3MVD B;  5B40 B;  5JRG B;  1ZLA D;  1P3B D;  3REJ D;  3LEL C;  1ID3 B;  5DNM D;  4WU9 A;  3C1C D;  1TZY B;  4J8U D;  4J8X B;  1M19 B;  2HIO C;  5AVC D;  3LJA B;  3AZI D;  4NE5 A;  3AZN A;  1P34 D;  3AZE C;  3AFA A;  5CHL B;  4CSR B;  2PYO A;  3LZ1 D;  3REL B;  3KSY A;  4ZUX A;  3VH5 W;  1JFI A;  2F8N K;  5KDM A;  3VH6 W;  4J8W A;  5GT0 D;  4NFT A;  5C3I C;  1ZLA C;  1P3B C;  5B1M B;  3REJ C;  3LEL A;  2Y2J A;  3B6F B;  5DNM C;  3C1C C;  3TU4 B;  3WAA D;  5B33 A;  4J8U C;  4H9N B;  2Y2I A;  2HIO A;  1KU5 A;  5E5A B;  5AVC C;  3AZF B;  3AZI C;  2BG1 A;  1P3L A;  4XZQ D;  3UTA A;  4DRB A;  5CPI B;  2BYM A;  3MGR D;  3REI A;  3AZE A;  1P34 C;  5B0Z A;  4X23 D;  1B6W A;  4Z5T D;  5B2I A;  3WTP E;  3KXB B;  4G91 B;  3W98 D;  3LZ1 C;  4HGA B;  1KX4 B;  1P3K B;  4KGC B;  4WZS B;  5AV8 A;  5GT0 C;  1M18 D;  5B32 A;  1P3B A;  2FJ7 A;  4Z66 A;  3REH D;  5FUG B;  3LZ0 D;  1WWI A;  4J8U A;  3H0M C;  3WTP A;  3V9R B;  5AVC A;  3AZI A;  2RVQ D;  2BYK A;  2F8N D;  4G92 C;  3W96 D;  4XZQ C;  4QLC A;  5B31 D;  5AV9 A;  3EPJ A;  3AV2 D;  3AN2 A;  3AV1 B;  3MGR C;  3AYW A;  3KWQ A;  4X23 C;  2LY8 A;  5F99 B;  4Z5T C;  5B1L A;  3AZL B;  3X1S B;  3X1T D;  3W98 C;  3LZ1 A;  4YM6 A;  1N1J B;  5DNN D;  2YFV B;  4H9P A;  5AV5 D;  1S32 D;  4NE6 A;  1KX3 A;  5GT3 A;  1M18 C;  2YFW A;  1U35 B;  5BNV A;  2L5A A;  1HQ3 A;  3AZG B;  5BO0 A;  3WKJ A;  3MGP B;  3LZ0 C;  4H9S C;  2RVQ C;  3B0B A;  3VH5 T;  3VH6 T;  3W96 C;  4Z2M G;  5B31 C;  5B0Y B;  4R8P B;  1P3I A;  3KFU G;  4WU9 D;  5AV6 A;  3KUY A;  3UT9 B;  3NQJ A;  3X1T C;  5DNN C;  3AZK A;  3AZJ A;  1S32 C;  1M18 A;  5CPJ B;  3AZN D;  1H3O A;  4CAY B;  3AFA D;  1P3O D;  1P3G A;  3B6G B;  3LZ0 A;  1ID3 A;  5GSU C;  4M6B A;  3MGS B;  3MGQ B;  3REJ B;  3W99 B;  4ZUX D;  1F66 B;  4J8W D;  3LJA A;  4ZBJ B;  5GXQ B;  2DF4 C;  3LEL D;  2Y2P A;  1BH8 B;  4WU9 C;  3FDD A;  5B33 D;  2HIO D;  2UWX A;  4YS3 B;  4LD9 B;  4CSR A;  5DNN A;  3X1V B;  1P3L D;  1S32 A;  2HUE B;  3UTA D;  3REL A;  1F1E A;  3AZN C;  3REI D;  3AFA C;  1P3O C;  5B0Z D;  5B1M A;  5BNX A;  5B2I D;  5GSU A;  3B6F A;  2Y2L A;  3MNN D;  4ZUX C;  4J8W C;  5AV8 D;  3AZF A;  5B32 D;  5CP6 D;  3WAA B;  2FJ7 D;  4Z66 D;  5CPI A;  5BS7 C;  5CPK B;  3C1B D;  5B33 C;  3WTP D;  2NZD B;  2ZY4 A;  3KXB A;  3REK B;  3A1K A;  1P3L C;  4X23 B;  4QLC D;  5AV9 D;  1ULY A;  3UTA C;  3AN2 D;  1KX4 A;  1P3K A;  1P3A D;  3REI C;  3AYW D;  1P3O A;  2VQR A;  3KWQ D;  5B0Z C;  5JA4 B;  3AZH B;  5B1L D;  2XD1 A;  5B2I C;  2JCH A;  2Y2H A;  4YM6 D;  1AOI B;  3MNN C;  3REH B;  2CWE A;  3NQU A;  3V9R A;  5AV8 C;  5GT3 D;  5AY8 B;  1KX3 D;  3EG5 B;  5B32 C;  2ARO B;  5CP6 C;  4WU8 D;  2FJ7 C;  1HQ3 D;  2W8S A;  4Z66 C;  3UTB A;  5BS7 A;  3AV1 A;  3WKJ D;  1WWS A;  3C1B C;  4H9O B;  4J8V A;  3X1U D;  4AWL C;  5B31 B;  3AV2 B;  3WTP C;  3AZL A;  4QLC C;  1N1J A;  5AV9 C;  5B2J B;  3AN2 C;  1P3P A;  1P3F B;  2CV5 B;  1P3A C;  3AYW C;  3A6N B;  1P3I D;  3KWQ C;  4JJN D;  3WA9 B;  5AV6 D;  5AV5 B;  3O62 B;  3KUY D;  4WNN A;  5B1L C;  3AZG A;  1EQZ D;  4YM6 C;  3AZK D;  3MNN A;  3W97 B;  3AZJ D;  2Y2N A;  3MVD D;  5B40 D;  4EO5 C;  1KX3 C;  5GT3 C;  5CP6 A;  5AVB B;  4WU8 C;  1HQ3 C;  5B0Y A;  1P3M B;  3WKJ C;  4R8P A;  1P3G D;  3C1B A;  4KUD B;  1ID3 D;  3X1U C;  3AZM B;  3UT9 A;  1TAF B;  4H9Q B;  3LJA D;  1PZR A;  3B0D C;  1P3A A;  2XD5 A;  3B0C T;  2NQB B;  1P3I C;  5CPJ A;  4JJN C;  5AV6 C;  3KUY C;  4XUJ B;  1EQZ C;  3AL0 C;  3AZK C;  3MGS A;  3MGQ A;  3AZJ C;  1M1A A;  3MVD C;  3REL D;  5B40 C;  5G49 A;  1KX5 B;  2PYO B;  3W99 A;  4WU8 A;  5B24 B;  3H0L C;  5GXQ A;  5B1M D;  1P3G C;  4H9R A;  5KDM B;  5GSU D;  3X1U A;  1ID3 C;  3B6F D;  3TU4 D;  3LEL B;  1A7W A;  1M19 C;  4YS3 A;  5E5A D;  3LJA C;  3AZF D;  3X1V A;  2ZY2 A;  2HIO B;  5CPI D;  4JJN A;  1P3L B;  1EQZ A;  3KXB D;  5BT1 D;  3AZE B;  2J8P A;  3MVD A;  5B40 A;  3REL C;  1KX4 D;  1P3K D;  3IP4 C;  5JRG A;  4KGC D;  4Z2M H;  5B1M C;  3B6F C;  5C3I B;  1TZY A;  3TU4 C;  1ZLA B;  1P3B B;  2G5H C;  2G5I C;  5DNM B;  4J8X A;  1M19 A;  2F8N G;  3C1C B;  2NZD A;  5E5A C;  3REK A;  3EPK A;  5B31 G;  3AZF C;  4J8U B;  1HTA A;  3UTB D;  5AVC B;  3AZI B;  5CPI C;  3AV1 D;  4J8V D;  5AV9 B;  5F99 D;  3KXB C;  1P34 B;  5BT1 C;  3AZL D;  3X1S D;  4G91 C;  4NE3 A;  1AOI A;  4HGA C;  1KX4 C;  1P3K C;  1P3P D;  4KGC C;  1T3U A;  4KHA B;  3LZ1 B;  5AY8 A;  3AZG D;  5GT0 B;  3TU4 A;  2YFW B;  1BH9 B;  5BNV B;  4H9N A;  5E5A A;  4DQY B;  2IO5 C;  3B0C W;  5B2J A;  3UTB C;  5B0Y D;  3AV1 C;  4R8P D;  1P3F A;  2CV5 A;  4G92 B;  4J8V C;  4XZQ B;  5F99 C;  4UUZ B;  3B0D B;  3UT9 D;  3MGR B;  3AZL C;  3X1S C;  2Y2Q A;  2Y2K A;  3W97 A;  4Z5T B;  1Q9C A;  4KGC A;  4WJ3 C;  1P3P C;  3W98 B;  5CPJ D;  1U35 C;  5AVB A;  3AZJ B;  3AZG C;  3P5J B;  1P3M A;  1M18 B;  3MGP C;  3B6G D;  5FUG A;  3VH5 A;  4KUD A;  3VH6 A;  1H3O B;  3AZM A;  3MGS D;  3MGQ D;  1M1A D;  3W99 D;  1P3G B;  3LZ0 B;  1TAF A;  1F66 D;  4H9Q A;  5GXQ D;  3EPH A;  5B0Y C;  4R8P C;  2NQB A;  2F8N B;  2ZM5 A;  3H0R C;  3W96 B;  5F99 A;  3UT9 C;  4XUJ A;  3X1S A;  4YS3 D;  4LD9 D;  3X1V D;  4DRA A;  2YFV A;  3X1T B;  1KX5 A;  5DNN B;  1U35 A;  5CPJ C;  4E45 A;  5B24 A;  1S32 B;  3MGP A;  3B6G C;  1BFM A;  3R45 B;  3MGS C;  3MGQ C;  1M1A C;  5BNX B;  3W99 C;  3EPL A;  5GSU B;  1F66 C;  5JRG D;  5B32 G;  4ZBJ C;  5GXQ C;  5CPK D;  1TZY D;  2F2A C;  4J8X D;  1M19 D;  4WU9 B;  4YS3 C;  2NZD D;  4LD9 C;  3REK D;  3X1V C;  2HUE C;  2Y2G A;  2ZY3 A;  4CAY A;  3AZH D;  3B6G A;  3AZN B;  2JSS A;  3AFA B;  1P3O B;  1ZLA A;  3REJ A;  1AOI D;  4H9P B;  1F66 A;  5DNM A;  5JRG C;  2Y2O A;  3C1C A;  5AY8 D;  2ARO D;  3WAA C;  4ZUX B;  1JFI B;  3NQU B;  4J8W B;  1BH8 A;  5CPK C;  1TZY C;  1W2E A;  2IO5 B;  4WV4 B;  3UTB B;  4J8X C;  2NZD C;  4LD9 A;  1P34 A;  3REK C;  4J8V B;  5B33 B;  5B2J D;  1P3F D;  2CV5 D;  3A1I A;  4KHA A;  3A6N D;  1B67 A;  3UTA B;  3WA9 D;  3AZH C;  3O62 D;  1P3P B;  2BYM B;  3REI B;  5GT0 A;  4UPK A;  2DQN C;  2RIQ A;  5B0Z B;  1R4V A;  1BH9 A;  1AOI C;  3W97 D;  5B2I B;  4WNN B;  3REH C;  2ZY5 A;  2FFF B;  5AY8 C;  3MNN B;  5AVB D;  2ARO C;  3WAA A;  5AV8 B;  5CPK A;  1P3M D;  5B32 B;  5CP6 B;  1Z2C B;  2FJ7 B;  4XZQ A;  3AZM D;  4KUD D;  4Z66 B;  3AV2 C;  4UUZ A;  3MGR A;  3C1B B;  4AWL B;  4X23 A;  3F6T A;  3WTP B;  4Z5T A;  5B2J C;  2BYK B;  2NQB D;  1P3F C;  2CV5 C;  3W98 A;  4QLC B;  3A6N C;  5JA4 A;  3AN2 B;  3WA9 C;  3AZH A;  5AV5 C;  3O62 C;  1P3A B;  4XUJ D;  3AYW B;  3KWQ B;  2JE5 A;  3W97 C;  5B1L B;  3REH A;  4YM6 B;  1KX5 D;  2PYO D;  1U35 D;  2F8N H;  2ARO A;  5AVB C;  5B24 D;  4H9S A; 
#chains in the Genus database with same CATH homology
 1M1A B;  4EO5 B;  1KX3 B;  5GT3 B;  5G49 B;  3MGP D;  1P3M C;  2F8N A;  4H9O A;  4WU8 B;  3W96 A;  4KUD C;  3AZM C;  5B31 A;  1HQ3 B;  3AV2 A;  5BO0 B;  3WKJ B;  4H9R B;  3X1U B;  2Y2M A;  2NQB C;  3X1T A;  3A6N A;  3WA9 A;  4E44 A;  5AV5 A;  3O62 A;  4XUJ C;  1P3I B;  4JJN B;  3AZE D;  3R45 A;  5AV6 B;  3KUY B;  3NQJ B;  1EQZ B;  1KX5 C;  2PYO C;  3AZK B;  5B24 C;  3MVD B;  5B40 B;  5JRG B;  1ZLA D;  1P3B D;  3REJ D;  3LEL C;  1ID3 B;  5DNM D;  4WU9 A;  3C1C D;  1TZY B;  4J8U D;  4J8X B;  1M19 B;  2HIO C;  5AVC D;  3LJA B;  3AZI D;  4NE5 A;  3AZN A;  1P34 D;  3AZE C;  3AFA A;  5CHL B;  4CSR B;  2PYO A;  3LZ1 D;  3REL B;  3KSY A;  4ZUX A;  3VH5 W;  1JFI A;  2F8N K;  5KDM A;  3VH6 W;  4J8W A;  5GT0 D;  4NFT A;  5C3I C;  1ZLA C;  1P3B C;  5B1M B;  3REJ C;  3LEL A;  2Y2J A;  3B6F B;  5DNM C;  3C1C C;  3TU4 B;  3WAA D;  5B33 A;  4J8U C;  4H9N B;  2Y2I A;  2HIO A;  1KU5 A;  5E5A B;  5AVC C;  3AZF B;  3AZI C;  2BG1 A;  1P3L A;  4XZQ D;  3UTA A;  4DRB A;  5CPI B;  2BYM A;  3MGR D;  3REI A;  3AZE A;  1P34 C;  5B0Z A;  4X23 D;  1B6W A;  4Z5T D;  5B2I A;  3WTP E;  3KXB B;  4G91 B;  3W98 D;  3LZ1 C;  4HGA B;  1KX4 B;  1P3K B;  4KGC B;  4WZS B;  5AV8 A;  5GT0 C;  1M18 D;  5B32 A;  1P3B A;  2FJ7 A;  4Z66 A;  3REH D;  5FUG B;  3LZ0 D;  1WWI A;  4J8U A;  3H0M C;  3WTP A;  3V9R B;  5AVC A;  3AZI A;  2RVQ D;  2BYK A;  2F8N D;  4G92 C;  3W96 D;  4XZQ C;  4QLC A;  5B31 D;  5AV9 A;  3EPJ A;  3AV2 D;  3AN2 A;  3AV1 B;  3MGR C;  3AYW A;  3KWQ A;  4X23 C;  2LY8 A;  5F99 B;  4Z5T C;  5B1L A;  3AZL B;  3X1S B;  3X1T D;  3W98 C;  3LZ1 A;  4YM6 A;  1N1J B;  5DNN D;  2YFV B;  4H9P A;  5AV5 D;  1S32 D;  4NE6 A;  1KX3 A;  5GT3 A;  1M18 C;  2YFW A;  1U35 B;  5BNV A;  2L5A A;  1HQ3 A;  3AZG B;  5BO0 A;  3WKJ A;  3MGP B;  3LZ0 C;  4H9S C;  2RVQ C;  3B0B A;  3VH5 T;  3VH6 T;  3W96 C;  4Z2M G;  5B31 C;  5B0Y B;  4R8P B;  1P3I A;  3KFU G;  4WU9 D;  5AV6 A;  3KUY A;  3UT9 B;  3NQJ A;  3X1T C;  5DNN C;  3AZK A;  3AZJ A;  1S32 C;  1M18 A;  5CPJ B;  3AZN D;  1H3O A;  4CAY B;  3AFA D;  1P3O D;  1P3G A;  3B6G B;  3LZ0 A;  1ID3 A;  5GSU C;  4M6B A;  3MGS B;  3MGQ B;  3REJ B;  3W99 B;  4ZUX D;  1F66 B;  4J8W D;  3LJA A;  4ZBJ B;  5GXQ B;  2DF4 C;  3LEL D;  2Y2P A;  1BH8 B;  4WU9 C;  3FDD A;  5B33 D;  2HIO D;  2UWX A;  4YS3 B;  4LD9 B;  4CSR A;  5DNN A;  3X1V B;  1P3L D;  1S32 A;  2HUE B;  3UTA D;  3REL A;  1F1E A;  3AZN C;  3REI D;  3AFA C;  1P3O C;  5B0Z D;  5B1M A;  5BNX A;  5B2I D;  5GSU A;  3B6F A;  2Y2L A;  3MNN D;  4ZUX C;  4J8W C;  5AV8 D;  3AZF A;  5B32 D;  5CP6 D;  3WAA B;  2FJ7 D;  4Z66 D;  5CPI A;  5BS7 C;  5CPK B;  3C1B D;  5B33 C;  3WTP D;  2NZD B;  2ZY4 A;  3KXB A;  3REK B;  3A1K A;  1P3L C;  4X23 B;  4QLC D;  5AV9 D;  1ULY A;  3UTA C;  3AN2 D;  1KX4 A;  1P3K A;  1P3A D;  3REI C;  3AYW D;  1P3O A;  2VQR A;  3KWQ D;  5B0Z C;  5JA4 B;  3AZH B;  5B1L D;  2XD1 A;  5B2I C;  2JCH A;  2Y2H A;  4YM6 D;  1AOI B;  3MNN C;  3REH B;  2CWE A;  3NQU A;  3V9R A;  5AV8 C;  5GT3 D;  5AY8 B;  1KX3 D;  3EG5 B;  5B32 C;  2ARO B;  5CP6 C;  4WU8 D;  2FJ7 C;  1HQ3 D;  2W8S A;  4Z66 C;  3UTB A;  5BS7 A;  3AV1 A;  3WKJ D;  1WWS A;  3C1B C;  4H9O B;  4J8V A;  3X1U D;  4AWL C;  5B31 B;  3AV2 B;  3WTP C;  3AZL A;  4QLC C;  1N1J A;  5AV9 C;  5B2J B;  3AN2 C;  1P3P A;  1P3F B;  2CV5 B;  1P3A C;  3AYW C;  3A6N B;  1P3I D;  3KWQ C;  4JJN D;  3WA9 B;  5AV6 D;  5AV5 B;  3O62 B;  3KUY D;  4WNN A;  5B1L C;  3AZG A;  1EQZ D;  4YM6 C;  3AZK D;  3MNN A;  3W97 B;  3AZJ D;  2Y2N A;  3MVD D;  5B40 D;  4EO5 C;  1KX3 C;  5GT3 C;  5CP6 A;  5AVB B;  4WU8 C;  1HQ3 C;  5B0Y A;  1P3M B;  3WKJ C;  4R8P A;  1P3G D;  3C1B A;  4KUD B;  1ID3 D;  3X1U C;  3AZM B;  3UT9 A;  1TAF B;  4H9Q B;  3LJA D;  1PZR A;  3B0D C;  1P3A A;  2XD5 A;  3B0C T;  2NQB B;  1P3I C;  5CPJ A;  4JJN C;  5AV6 C;  3KUY C;  4XUJ B;  1EQZ C;  3AL0 C;  3AZK C;  3MGS A;  3MGQ A;  3AZJ C;  1M1A A;  3MVD C;  3REL D;  5B40 C;  5G49 A;  1KX5 B;  2PYO B;  3W99 A;  4WU8 A;  5B24 B;  3H0L C;  5GXQ A;  5B1M D;  1P3G C;  4H9R A;  5KDM B;  5GSU D;  3X1U A;  1ID3 C;  3B6F D;  3TU4 D;  3LEL B;  1A7W A;  1M19 C;  4YS3 A;  5E5A D;  3LJA C;  3AZF D;  3X1V A;  2ZY2 A;  2HIO B;  5CPI D;  4JJN A;  1P3L B;  1EQZ A;  3KXB D;  5BT1 D;  3AZE B;  2J8P A;  3MVD A;  5B40 A;  3REL C;  1KX4 D;  1P3K D;  3IP4 C;  5JRG A;  4KGC D;  4Z2M H;  5B1M C;  3B6F C;  5C3I B;  1TZY A;  3TU4 C;  1ZLA B;  1P3B B;  2G5H C;  2G5I C;  5DNM B;  4J8X A;  1M19 A;  2F8N G;  3C1C B;  2NZD A;  5E5A C;  3REK A;  3EPK A;  5B31 G;  3AZF C;  4J8U B;  1HTA A;  3UTB D;  5AVC B;  3AZI B;  5CPI C;  3AV1 D;  4J8V D;  5AV9 B;  5F99 D;  3KXB C;  1P34 B;  5BT1 C;  3AZL D;  3X1S D;  4G91 C;  4NE3 A;  1AOI A;  4HGA C;  1KX4 C;  1P3K C;  1P3P D;  4KGC C;  1T3U A;  4KHA B;  3LZ1 B;  5AY8 A;  3AZG D;  5GT0 B;  3TU4 A;  2YFW B;  1BH9 B;  5BNV B;  4H9N A;  5E5A A;  4DQY B;  2IO5 C;  3B0C W;  5B2J A;  3UTB C;  5B0Y D;  3AV1 C;  4R8P D;  1P3F A;  2CV5 A;  4G92 B;  4J8V C;  4XZQ B;  5F99 C;  4UUZ B;  3B0D B;  3UT9 D;  3MGR B;  3AZL C;  3X1S C;  2Y2Q A;  2Y2K A;  3W97 A;  4Z5T B;  1Q9C A;  4KGC A;  4WJ3 C;  1P3P C;  3W98 B;  5CPJ D;  1U35 C;  5AVB A;  3AZJ B;  3AZG C;  3P5J B;  1P3M A;  1M18 B;  3MGP C;  3B6G D;  5FUG A;  3VH5 A;  4KUD A;  3VH6 A;  1H3O B;  3AZM A;  3MGS D;  3MGQ D;  1M1A D;  3W99 D;  1P3G B;  3LZ0 B;  1TAF A;  1F66 D;  4H9Q A;  5GXQ D;  3EPH A;  5B0Y C;  4R8P C;  2NQB A;  2F8N B;  2ZM5 A;  3H0R C;  3W96 B;  5F99 A;  3UT9 C;  4XUJ A;  3X1S A;  4YS3 D;  4LD9 D;  3X1V D;  4DRA A;  2YFV A;  3X1T B;  1KX5 A;  5DNN B;  1U35 A;  5CPJ C;  4E45 A;  5B24 A;  1S32 B;  3MGP A;  3B6G C;  1BFM A;  3R45 B;  3MGS C;  3MGQ C;  1M1A C;  5BNX B;  3W99 C;  3EPL A;  5GSU B;  1F66 C;  5JRG D;  5B32 G;  4ZBJ C;  5GXQ C;  5CPK D;  1TZY D;  2F2A C;  4J8X D;  1M19 D;  4WU9 B;  4YS3 C;  2NZD D;  4LD9 C;  3REK D;  3X1V C;  2HUE C;  2Y2G A;  2ZY3 A;  4CAY A;  3AZH D;  3B6G A;  3AZN B;  2JSS A;  3AFA B;  1P3O B;  1ZLA A;  3REJ A;  1AOI D;  4H9P B;  1F66 A;  5DNM A;  5JRG C;  2Y2O A;  3C1C A;  5AY8 D;  2ARO D;  3WAA C;  4ZUX B;  1JFI B;  3NQU B;  4J8W B;  1BH8 A;  5CPK C;  1TZY C;  1W2E A;  2IO5 B;  4WV4 B;  3UTB B;  4J8X C;  2NZD C;  4LD9 A;  1P34 A;  3REK C;  4J8V B;  5B33 B;  5B2J D;  1P3F D;  2CV5 D;  3A1I A;  4KHA A;  3A6N D;  1B67 A;  3UTA B;  3WA9 D;  3AZH C;  3O62 D;  1P3P B;  2BYM B;  3REI B;  5GT0 A;  4UPK A;  2DQN C;  2RIQ A;  5B0Z B;  1R4V A;  1BH9 A;  1AOI C;  3W97 D;  5B2I B;  4WNN B;  3REH C;  2ZY5 A;  2FFF B;  5AY8 C;  3MNN B;  5AVB D;  2ARO C;  3WAA A;  5AV8 B;  5CPK A;  1P3M D;  5B32 B;  5CP6 B;  1Z2C B;  2FJ7 B;  4XZQ A;  3AZM D;  4KUD D;  4Z66 B;  3AV2 C;  4UUZ A;  3MGR A;  3C1B B;  4AWL B;  4X23 A;  3F6T A;  3WTP B;  4Z5T A;  5B2J C;  2BYK B;  2NQB D;  1P3F C;  2CV5 C;  3W98 A;  4QLC B;  3A6N C;  5JA4 A;  3AN2 B;  3WA9 C;  3AZH A;  5AV5 C;  3O62 C;  1P3A B;  4XUJ D;  3AYW B;  3KWQ B;  2JE5 A;  3W97 C;  5B1L B;  3REH A;  4YM6 B;  1KX5 D;  2PYO D;  1U35 D;  2F8N H;  2ARO A;  5AVB C;  5B24 D;  4H9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...