3AZJC

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 100
sequence length 100
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjC00
3R45B 3C1CB 5F99C 1M19D 3KWQA 3AZED 3X1VA 3AYWC 5GXQD 1BH9B 3O62A 1KX3B 2F8NK 3MGSC 1S32C 1P3MC 5GT3A 3NQUB 2RVQC 1P3PC 3W98C 4J8UB 4WU9B 1P3OA 4XZQD 1TZYB 5B1LB 5E5AA 4J8WA 5CPJC 2F8NG 3WKJC 2FJ7B 4WNNA 5G49B 3W99C 4WZSB 5DNNC 5BO0B 4J8XD 3WTPD 1EQZA 4HGAB 5B2IC 3AZKA 3VH6W 4J8VD 2CWEA 4X23B 4H9OA 5CHLB 4KGCA 4H9QA 1HQ3A 5AY8B 3B6FD 5CPKB 3W96B 3AV1A 3B6GA 3AV2A 3AFAD 1U35D 3VH5W 4H9NA 4R8PD 3C1CC 3REHD 3REKB 3KXBA 3RELA 4JJNA 3B0DB 4E44A 5B2JD 5B0ZA 3X1TD 1HQ3B 3LZ1A 1P3KB 5C3IB 1KX3C 1AOIC 3UT9D 5B40B 3VH5T 1B67A 2HUEB 3AV2B 4J8UC 4ZUXA 4WU9C 1TZYC 5B1LC 5AVCA 2FJ7C 2YFWA 1N1JA 2PYOB 3KWQC 5B24D 3X1UA 3AZLB 3KXBB 3RELB 3TU4D 3AN2B 4HGAC 5AV5D 1P3AB 5BS7A 3O62C 3MVDB 5CPIB 2AROA 5JA4A 5B0ZB 3X1SD 3LZ1B 1M1AB 3MGRA 4X23C 3UTAB 1ID3A 3WAAD 3NQJA 5B31A 4YS3A 1P3OC 4J8WC 5E5AC 5CPKC 1P3BA 3W96C 2YFWB 5GSUA 3AYWA 1N1JB 3MGSA 3REJB 1S32A 3AZGB 3AZFB 1P3PA 3W98A 3LZ0D 2AROB 5JA4B 1P34D 1BH8A 5B1MD 3MGRB 5CPJA 1JFIA 3KUYD 2HIOD 3REIA 3MGPD 3AZHD 1HQ3C 5B31B 3AZND 5C3IC 5DNNA 5AV8A 4YM6D 1P3GD 5B40C 1P3BB 3AV1C 2HUEC 3AV2C 5F99D 5GSUB 1P3IB 5DNMB 3A6NA 5AVBD 2PYOC 4WV4B 2CV5A 3AZLC 3KXBC 3RELC 3AN2C 4DRBA 1P3FD 1P3MD 1BH8B 4Z5TD 1P3AC 1JFIB 3KSYA 3MVDC 3REIB 3WKJD 5B0ZC 3LZ1C 1M1AC 5AV8B 3AZJA 3R45A 3C1CA 2NZDD 5B0YB 5B2ID 3A6NB 4Z2MG 1BH9A 4G92B 1KX3A 3LJAD 3LELD 3NQUA 3MNNA 5BS7C 4J8UA 2AROC 4WU9A 3MGRC 2FJ7A 3AZJB 5G49A 3AZMB 5B31C 5CP6B 4YS3C 5BO0A 1P3BC 5GSUC 1P3IC 5GXQA 5DNMC 4X23A 1HTAA 3MGQA 4QLCD 1M18B 5B32D 3WA9B 5AY8A 2LY8A 3MNNB 1AOID 5CPKA 4Z66D 3W96A 1TAFB 3REIC 3AZID 4NE5A 1TZYD 5B1LD 3W97D 1M19B 3C1BA 5AV8C 4J8XA 3AZEB 3KWQD 5GXQB 3REKA 3X1VD 1KX4A 4J8VA 5B33A 3A6NC 3MGQB 3O62D 4G92C 1WWIA 2CV5C 1P3KA 4XZQB 5GT3D 5B40A 4H9SA 4KHAB 1P3OD 1KX5A 4J8WD 5E5AD 3C1BB 5KDMA 4J8XB 5AV6A 3WTPB 3AZJC 3AZMC 2PYOA 4G91B 5CP6C 5FUGB 3AZLA 1KX4B 3AN2A 4J8VB 1EQZD 5B33B 1P3AA 4CAYB 5AV9D 3MVDA 3AZKD 5CPIA 3B6FB 1M1AA 3UTAA 4KGCD 3WA9C 4WU8A 3AFAB 1HQ3D 3MNNC 3UTBD 1KX5B 5KDMB 4NE3A 3AV1D 3B6GD 5AV6B 4H9RA 4R8PB 3REHB 1M19C 5B24A 3AZEC 5B32G 3REJA 3AZGA 3AZFA 5GXQC 3KXBD 3RELD 3X1TB 4JJND 1H3OA 3MGQC 5BNXB 4WU8B 5B0ZD 3LZ1D 5AY8C 4XZQC 1ZLAA 4CSRB 4H9RB 4ZUXD 1P3IA 5AVCD 5DNMA 5JRGD 5B24B 3C1BC 1P3LD 4J8XC 3TU4B 5GT0A 5AV5B 4KUDA 3B0BA 4G91C 3X1UD 3REKC 1KX4C 3X1SB 4J8VC 5B33C 2L5AA 1H3OB 3B0DC 3AZHA 1ID3D 2AROD 3WAAB 3MGRD 1P3KC 3V9RA 1ZLAB 4H9SC 3AFAC 2F8NA 4Z2MH 4YS3D 1KX5C 5B0YA 1P3BD 1F1EA 5AV6C 5AVBA 5GSUD 4R8PC 5GT0B 3REHC 3AYWD 4KUDB 3LZ0B 1P3FA 3MGSD 1P34B 1S32D 4M6BA 2RVQD 4XUJA 1P3PD 3KUYB 2HIOB 3W98D 3AZHB 5CPIC 3X1TC 3AZNB 5CPJD 3UTAC 4YM6B 1P3GB 1BFMA 3V9RB 4WU8C 3AZMA 3W99D 2F8NB 2NZDA 4LD9A 5DNND 5CP6A 5AV8D 1F66A 5AVBB 1ULYA 5B24C 2NQBA 3A6ND 1P3FB 3REJC 5AV5C 4Z5TB 1M18A 3AZGC 4XUJB 3AZFC 2CV5D 3WA9A 3WKJB 3X1SC 1TAFA 4UUZA 2BYMB 2NZDB 1M19A 4LD9B 3AZJD 3AZEA 1ZLAC 1F66B 1KU5A 5B2IB 3C1CD 2NQBB 3LJAB 5GT0C 3LELB 4KUDC 5BT1C 3LZ0C 1KX3D 4NE6A 4H9PB 4XZQA 5B31G 4Z66A 3KUYC 4ZBJB 3MNND 4UUZB 4J8UD 3AZHC 4KHAA 4WU9D 3AZNC 2FJ7D 3WTPA 5FUGA 5B0YC 1B6WA 5AVBC 4CAYA 4QLCB 5B32B 3B6FA 1P3FC 1AOIB 4X23D 3MGQD 4Z5TC 4Z66B 4XUJC 3AFAA 5AY8D 1U35A 3AZIB 3W97B 5CPKD 3W96D 4R8PA 3REHA 2NZDC 3KWQB 3C1BD 4LD9C 3X1VB 1F66C 3REKD 3O62B 5AV9A 1KX4D 5B2JA 2NQBC 3X1TA 3LJAC 5B33D 5GT3B 3LELC 3UT9A 3WTPE 5BNXA 1M18C 1U35B 1P3KD 3UTBA 1P3OB 4J8WB 5E5AB 5B40D 4CSRA 4WNNB 4ZBJC 3AV2D 1KX5D 4EO5B 5AV6D 3VH6T 3TU4A 1EQZB 5AV5A 2PYOD 3AZLD 5AV9B 3AZKB 3AN2D 5B2JB 3X1SA 2BYKA 1P3AD 4QLCC 4H9OB 2IO5B 3UT9B 5B32C 4KGCB 3MVDD 4H9QB 5CPID 3WAAA 1M1AD 3UTAD 3UTBB 4Z66C 3AV1B 4WU8D 3B6GB 3AZIC 3W97C 5JRGA 1P3LA 5BNVA 3WTPC 1A7WA 4H9NB 3LZ0A 3X1VC 3REJD 1P34A 2BYKB 5B1MA 4JJNB 3AZGD 1WWSA 3AZFD 3KUYA 2HIOA 3MGPA 3AZNA 3B6FC 4NFTA 5GT3C 4YM6A 1P3GA 5F99A 5B31D 4ZUXB 1U35C 5AVCB 1ZLAD 5JRGB 1P3LB 2YFVA 5BNVB 1P3ID 5DNMD 4EO5C 3X1UB 5GT0D 1P3MA 1EQZC 4KUDD 5B1MB 4Z5TA 5BT1D 5AV9C 3B0CW 3AZKC 3MGPB 5B2JC 1ID3B 3WKJA 4DRAA 4AWLB 2IO5C 3UT9C 4KGCC 2BYMA 3VH6A 3REID 3W99A 1Q9CA 3NQJB 5F99B 3UTBC 4YS3B 3B6GC 2YFVB 5B2IA 2F8ND 3AYWB 2JSSA 5B0YD 3B0CT 3LJAA 3MGSB 3TU4C 1S32B 1P3MB 3LELA 1P3PB 3W98B 3VH5A 4H9PA 5CPJB 4JJNC 4XUJD 3WAAC 3W99B 5DNNB 3AZMD 4ZUXC 4LD9D 5CP6D 5AVCC 5JRGC 1P3LC 1F66D 4E45A 4QLCA 1R4VA 5B32A 3X1UC 2CV5B 2NQBD 1AOIA 2F8NH 1P34C 5B1MC 1M18D 3WA9D 2HIOC 1ID3C 3AZIA 3MGPC 1TZYA 3W97A 5B1LA 4AWLC 4YM6C 1P3GC
chains in the Genus database with same CATH superfamily
3R45B 3C1CB 3EPHA 5F99C 1M19D 3KWQA 3AZED 3X1VA 3AYWC 5GXQD 1BH9B 3O62A 1KX3B 3IP4C 2F8NK 3MGSC 1S32C 1P3MC 5GT3A 3NQUB 2RVQC 1P3PC 3W98C 3H0RC 4J8UB 4WU9B 1P3OA 4XZQD 1TZYB 5B1LB 5E5AA 4J8WA 2BG1A 5CPJC 2F8NG 2FJ7B 4WNNA 5G49B 3W99C 4WZSB 5DNNC 5BO0B 4J8XD 3WTPD 1EQZA 4HGAB 5B2IC 3AZKA 3VH6W 4J8VD 2CWEA 4X23B 4H9OA 5CHLB 4KGCA 4H9QA 1HQ3A 5AY8B 3B6FD 5CPKB 2G5HC 3W96B 3AV1A 3B6GA 3AV2A 3AFAD 1U35D 3VH5W 4H9NA 4R8PD 3C1CC 3REHD 3REKB 3KXBA 3RELA 2Y2PA 4JJNA 3B0DB 4E44A 5B2JD 5B0ZA 3X1TD 1HQ3B 3LZ1A 1P3KB 5C3IB 1KX3C 1AOIC 4DQYB 3UT9D 5B40B 3VH5T 1B67A 2HUEB 3AV2B 4J8UC 4ZUXA 4WU9C 2Y2HA 1TZYC 5B1LC 5AVCA 2FJ7C 2YFWA 1N1JA 2PYOB 3KWQC 5B24D 3X1UA 3AZLB 3KXBB 3RELB 3TU4D 3AN2B 4HGAC 5AV5D 1P3AB 5BS7A 3O62C 3MVDB 5CPIB 2AROA 5JA4A 5B0ZB 3X1SD 3LZ1B 1M1AB 3MGRA 4X23C 3UTAB 1ID3A 3WAAD 3NQJA 5B31A 4YS3A 1P3OC 4J8WC 5E5AC 5CPKC 1P3BA 3W96C 2YFWB 5GSUA 3AYWA 1N1JB 3KFUG 3MGSA 3REJB 1S32A 3AZGB 3AZFB 1P3PA 3W98A 3LZ0D 2AROB 5JA4B 1P34D 1BH8A 5B1MD 3MGRB 5CPJA 1JFIA 3KUYD 2HIOD 3REIA 3MGPD 3AZHD 2XD5A 1HQ3C 5B31B 3AZND 5C3IC 5DNNA 5AV8A 4YM6D 1P3GD 5B40C 1P3BB 3AV1C 2HUEC 3AV2C 5F99D 5GSUB 1P3IB 5DNMB 3A6NA 5AVBD 2PYOC 4WV4B 2ZY4A 2CV5A 3AZLC 3KXBC 3RELC 3AN2C 4DRBA 1P3FD 1P3MD 1BH8B 4Z5TD 1P3AC 3EPLA 1JFIB 3KSYA 3MVDC 3REIB 3WKJD 5B0ZC 3LZ1C 1M1AC 5AV8B 3AZJA 3R45A 3C1CA 2NZDD 1T3UA 5B0YB 5B2ID 3A6NB 4Z2MG 1BH9A 2ZY3A 4G92B 1KX3A 3LJAD 3LELD 3NQUA 3MNNA 5BS7C 4J8UA 2AROC 4WU9A 2Y2NA 3MGRC 2FJ7A 3AZJB 5G49A 3AZMB 2J8PA 5B31C 5CP6B 4YS3C 5BO0A 1P3BC 2JCHA 5GSUC 1P3IC 5GXQA 5DNMC 1W2EA 4X23A 1HTAA 3MGQA 1Z2CB 2Y2GA 4QLCD 1M18B 5B32D 3WA9B 5AY8A 2LY8A 3MNNB 1AOID 2F2AC 5CPKA 4Z66D 3W96A 1TAFB 2UWXA 3REIC 3AZID 4NE5A 1TZYD 5B1LD 3W97D 1M19B 3C1BA 5AV8C 4J8XA 3AZEB 3KWQD 5GXQB 3REKA 3X1VD 2W8SA 1KX4A 4J8VA 5B33A 3A6NC 3EPJA 3MGQB 3O62D 4G92C 1WWIA 2CV5C 1P3KA 4XZQB 5GT3D 5B40A 4H9SA 4KHAB 1P3OD 1KX5A 4J8WD 5E5AD 3C1BB 5KDMA 3AL0C 4J8XB 5AV6A 3WTPB 2G5IC 3AZJC 3P5JB 3AZMC 2PYOA 4G91B 5CP6C 5FUGB 3AZLA 1KX4B 3AN2A 4J8VB 1EQZD 5B33B 1P3AA 4CAYB 3EPKA 5AV9D 3MVDA 3F6TA 3AZKD 5CPIA 3B6FB 3H0MC 1M1AA 3UTAA 2JE5A 4KGCD 3WA9C 4WU8A 3AFAB 1HQ3D 3MNNC 3UTBD 1KX5B 5KDMB 4NE3A 3AV1D 3B6GD 5AV6B 2ZM5A 4H9RA 4R8PB 3REHB 1M19C 5B24A 3AZEC 5B32G 3REJA 2Y2QA 3AZGA 3AZFA 5GXQC 3KXBD 3RELD 2Y2LA 3X1TB 4JJND 1H3OA 3MGQC 5BNXB 4WU8B 5B0ZD 3LZ1D 5AY8C 4XZQC 1ZLAA 4CSRB 4H9RB 4ZUXD 1P3IA 5AVCD 5DNMA 5JRGD 5B24B 3C1BC 1P3LD 4J8XC 3TU4B 5GT0A 5AV5B 4KUDA 3B0BA 1PZRA 4G91C 3X1UD 3REKC 1KX4C 3X1SB 4J8VC 5B33C 2L5AA 1H3OB 3B0DC 3AZHA 1ID3D 2AROD 3WAAB 3MGRD 1P3KC 3V9RA 1ZLAB 4H9SC 3AFAC 2F8NA 4Z2MH 2Y2IA 4YS3D 1KX5C 5B0YA 1P3BD 5AV6C 1F1EA 5AVBA 5GSUD 4R8PC 5GT0B 3REHC 3AYWD 4KUDB 3LZ0B 1P3FA 3MGSD 1P34B 1S32D 4M6BA 2RVQD 4XUJA 1P3PD 3KUYB 2HIOB 3W98D 3AZHB 5CPIC 3X1TC 3AZNB 5CPJD 3UTAC 4YM6B 1P3GB 1BFMA 3V9RB 4WU8C 3AZMA 3W99D 2F8NB 2NZDA 4LD9A 5DNND 5CP6A 5AV8D 3EG5B 1F66A 5AVBB 1ULYA 5B24C 2NQBA 3A6ND 1P3FB 3REJC 5AV5C 4Z5TB 1M18A 3AZGC 4XUJB 3AZFC 2CV5D 3WA9A 3WKJB 3X1SC 2VQRA 2DQNC 1TAFA 4UUZA 2BYMB 3H0LC 2NZDB 1M19A 4LD9B 3AZJD 3AZEA 1ZLAC 1F66B 1KU5A 5B2IB 3C1CD 2NQBB 3LJAB 3WKJC 5GT0C 3LELB 4KUDC 5BT1C 3LZ0C 1KX3D 4NE6A 4H9PB 4XZQA 5B31G 4Z66A 3A1IA 3KUYC 4ZBJB 3MNND 4UUZB 4J8UD 3AZHC 4KHAA 4WU9D 3AZNC 2FJ7D 3WTPA 5FUGA 5B0YC 1B6WA 5AVBC 4CAYA 4QLCB 5B32B 3B6FA 1P3FC 1AOIB 4X23D 3MGQD 4Z5TC 4Z66B 4UPKA 4XUJC 2Y2KA 3AFAA 5AY8D 1U35A 3AZIB 3W97B 5CPKD 3W96D 4R8PA 3REHA 2NZDC 3KWQB 3C1BD 4LD9C 3X1VB 1F66C 2ZY5A 3REKD 3O62B 5AV9A 3A1KA 1KX4D 5B2JA 2NQBC 3X1TA 3LJAC 5B33D 5GT3B 3LELC 3UT9A 3WTPE 2FFFB 5BNXA 1M18C 1U35B 1P3KD 3UTBA 1P3OB 4J8WB 5E5AB 5B40D 4CSRA 4WNNB 4ZBJC 3AV2D 1KX5D 2Y2OA 4EO5B 5AV6D 3VH6T 3TU4A 1EQZB 5AV5A 2PYOD 3AZLD 5AV9B 3AZKB 3AN2D 5B2JB 2DF4C 3X1SA 2BYKA 1P3AD 4QLCC 4H9OB 2IO5B 3UT9B 5B32C 4KGCB 3MVDD 4H9QB 2Y2JA 5CPID 3WAAA 1M1AD 3UTAD 3UTBB 4Z66C 3AV1B 4WU8D 3B6GB 3AZIC 3W97C 5JRGA 1P3LA 5BNVA 3WTPC 1A7WA 4H9NB 3LZ0A 3X1VC 3FDDA 3REJD 1P34A 2BYKB 5B1MA 4JJNB 3AZGD 1WWSA 3AZFD 3KUYA 2HIOA 4WJ3C 3MGPA 3AZNA 3B6FC 2Y2MA 4NFTA 5GT3C 4YM6A 1P3GA 2ZY2A 5F99A 5B31D 4ZUXB 1U35C 5AVCB 1ZLAD 5JRGB 1P3LB 2YFVA 5BNVB 1P3ID 5DNMD 4EO5C 3X1UB 5GT0D 1P3MA 1EQZC 4KUDD 5B1MB 4Z5TA 5BT1D 5AV9C 3B0CW 3AZKC 3MGPB 5B2JC 1ID3B 3WKJA 4DRAA 4AWLB 2IO5C 3UT9C 4KGCC 2BYMA 3VH6A 3REID 3W99A 1Q9CA 3NQJB 5F99B 3UTBC 4YS3B 3B6GC 2YFVB 5B2IA 2F8ND 3AYWB 2JSSA 5B0YD 3B0CT 3LJAA 3MGSB 3TU4C 1S32B 1P3MB 3LELA 2RIQA 1P3PB 3W98B 3VH5A 4H9PA 5CPJB 4JJNC 4XUJD 3WAAC 3W99B 5DNNB 3AZMD 4ZUXC 4LD9D 5CP6D 5AVCC 5JRGC 1P3LC 1F66D 4E45A 4QLCA 1R4VA 5B32A 3X1UC 2CV5B 2NQBD 1AOIA 2F8NH 2XD1A 1P34C 5B1MC 1M18D 3WA9D 2HIOC 1ID3C 3AZIA 3MGPC 1TZYA 3W97A 5B1LA 4AWLC 4YM6C 1P3GC
chains in the Genus database with same CATH topology
3R45B 3C1CB 3EPHA 5F99C 1M19D 3KWQA 3AZED 3X1VA 3AYWC 5GXQD 1BH9B 3O62A 1KX3B 3IP4C 2F8NK 3MGSC 1S32C 1P3MC 5GT3A 3NQUB 2RVQC 1P3PC 3W98C 3H0RC 4J8UB 4WU9B 1P3OA 4XZQD 1TZYB 5B1LB 5E5AA 4J8WA 2BG1A 5CPJC 2F8NG 2FJ7B 4WNNA 5G49B 3W99C 4WZSB 5DNNC 5BO0B 4J8XD 3WTPD 1EQZA 4HGAB 5B2IC 3AZKA 3VH6W 4J8VD 2CWEA 4X23B 4H9OA 5CHLB 4KGCA 4H9QA 1HQ3A 5AY8B 3B6FD 5CPKB 2G5HC 3W96B 3AV1A 3B6GA 3AV2A 3AFAD 1U35D 3VH5W 4H9NA 4R8PD 3C1CC 3REHD 3REKB 3KXBA 3RELA 2Y2PA 4JJNA 3B0DB 4E44A 5B2JD 5B0ZA 3X1TD 1HQ3B 3LZ1A 1P3KB 5C3IB 1KX3C 1AOIC 4DQYB 3UT9D 5B40B 3VH5T 1B67A 2HUEB 3AV2B 4J8UC 4ZUXA 4WU9C 2Y2HA 1TZYC 5B1LC 5AVCA 2FJ7C 2YFWA 1N1JA 2PYOB 3KWQC 5B24D 3X1UA 3AZLB 3KXBB 3RELB 3TU4D 3AN2B 4HGAC 5AV5D 1P3AB 5BS7A 3O62C 3MVDB 5CPIB 2AROA 5JA4A 5B0ZB 3X1SD 3LZ1B 1M1AB 3MGRA 4X23C 3UTAB 1ID3A 3WAAD 3NQJA 5B31A 4YS3A 1P3OC 4J8WC 5E5AC 5CPKC 1P3BA 3W96C 2YFWB 5GSUA 3AYWA 1N1JB 3KFUG 3MGSA 3REJB 1S32A 3AZGB 3AZFB 1P3PA 3W98A 3LZ0D 2AROB 5JA4B 1P34D 1BH8A 5B1MD 3MGRB 5CPJA 1JFIA 3KUYD 2HIOD 3REIA 3MGPD 3AZHD 2XD5A 1HQ3C 5B31B 3AZND 5C3IC 5DNNA 5AV8A 4YM6D 1P3GD 5B40C 1P3BB 3AV1C 2HUEC 3AV2C 5F99D 5GSUB 1P3IB 5DNMB 3A6NA 5AVBD 2PYOC 4WV4B 2ZY4A 2CV5A 3AZLC 3KXBC 3RELC 3AN2C 4DRBA 1P3FD 1P3MD 1BH8B 4Z5TD 1P3AC 3EPLA 1JFIB 3KSYA 3MVDC 3REIB 3WKJD 5B0ZC 3LZ1C 1M1AC 5AV8B 3AZJA 3R45A 3C1CA 2NZDD 1T3UA 5B0YB 5B2ID 3A6NB 4Z2MG 1BH9A 2ZY3A 4G92B 1KX3A 3LJAD 3LELD 3NQUA 3MNNA 5BS7C 4J8UA 2AROC 4WU9A 2Y2NA 3MGRC 2FJ7A 3AZJB 5G49A 3AZMB 2J8PA 5B31C 5CP6B 4YS3C 5BO0A 1P3BC 2JCHA 5GSUC 1P3IC 5GXQA 5DNMC 1W2EA 4X23A 1HTAA 3MGQA 1Z2CB 2Y2GA 4QLCD 1M18B 5B32D 3WA9B 5AY8A 2LY8A 3MNNB 1AOID 2F2AC 5CPKA 4Z66D 3W96A 1TAFB 2UWXA 3REIC 3AZID 4NE5A 1TZYD 5B1LD 3W97D 1M19B 3C1BA 5AV8C 4J8XA 3AZEB 3KWQD 5GXQB 3REKA 3X1VD 2W8SA 1KX4A 4J8VA 5B33A 3A6NC 3EPJA 3MGQB 3O62D 4G92C 1WWIA 2CV5C 1P3KA 4XZQB 5GT3D 5B40A 4H9SA 4KHAB 1P3OD 1KX5A 4J8WD 5E5AD 3C1BB 5KDMA 3AL0C 4J8XB 5AV6A 3WTPB 2G5IC 3AZJC 3P5JB 3AZMC 2PYOA 4G91B 5CP6C 5FUGB 3AZLA 1KX4B 3AN2A 4J8VB 1EQZD 5B33B 1P3AA 4CAYB 3EPKA 5AV9D 3MVDA 3F6TA 3AZKD 5CPIA 3B6FB 3H0MC 1M1AA 3UTAA 2JE5A 4KGCD 3WA9C 4WU8A 3AFAB 1HQ3D 3MNNC 3UTBD 1KX5B 5KDMB 4NE3A 3AV1D 3B6GD 5AV6B 2ZM5A 4H9RA 4R8PB 3REHB 1M19C 5B24A 3AZEC 5B32G 3REJA 2Y2QA 3AZGA 3AZFA 5GXQC 3KXBD 3RELD 2Y2LA 3X1TB 4JJND 1H3OA 3MGQC 5BNXB 4WU8B 5B0ZD 3LZ1D 5AY8C 4XZQC 1ZLAA 4CSRB 4H9RB 4ZUXD 1P3IA 5AVCD 5DNMA 5JRGD 5B24B 3C1BC 1P3LD 4J8XC 3TU4B 5GT0A 5AV5B 4KUDA 3B0BA 1PZRA 4G91C 3X1UD 3REKC 1KX4C 3X1SB 4J8VC 5B33C 2L5AA 1H3OB 3B0DC 3AZHA 1ID3D 2AROD 3WAAB 3MGRD 1P3KC 3V9RA 1ZLAB 4H9SC 3AFAC 2F8NA 4Z2MH 2Y2IA 4YS3D 1KX5C 5B0YA 1P3BD 5AV6C 1F1EA 5AVBA 5GSUD 4R8PC 5GT0B 3REHC 3AYWD 4KUDB 3LZ0B 1P3FA 3MGSD 1P34B 1S32D 4M6BA 2RVQD 4XUJA 1P3PD 3KUYB 2HIOB 3W98D 3AZHB 5CPIC 3X1TC 3AZNB 5CPJD 3UTAC 4YM6B 1P3GB 1BFMA 3V9RB 4WU8C 3AZMA 3W99D 2F8NB 2NZDA 4LD9A 5DNND 5CP6A 5AV8D 3EG5B 1F66A 5AVBB 1ULYA 5B24C 2NQBA 3A6ND 1P3FB 3REJC 5AV5C 4Z5TB 1M18A 3AZGC 4XUJB 3AZFC 2CV5D 3WA9A 3WKJB 3X1SC 2VQRA 2DQNC 1TAFA 4UUZA 2BYMB 3H0LC 2NZDB 1M19A 4LD9B 3AZJD 3AZEA 1ZLAC 1F66B 1KU5A 5B2IB 3C1CD 2NQBB 3LJAB 3WKJC 5GT0C 3LELB 4KUDC 5BT1C 3LZ0C 1KX3D 4NE6A 4H9PB 4XZQA 5B31G 4Z66A 3A1IA 3KUYC 4ZBJB 3MNND 4UUZB 4J8UD 3AZHC 4KHAA 4WU9D 3AZNC 2FJ7D 3WTPA 5FUGA 5B0YC 1B6WA 5AVBC 4CAYA 4QLCB 5B32B 3B6FA 1P3FC 1AOIB 4X23D 3MGQD 4Z5TC 4Z66B 4UPKA 4XUJC 2Y2KA 3AFAA 5AY8D 1U35A 3AZIB 3W97B 5CPKD 3W96D 4R8PA 3REHA 2NZDC 3KWQB 3C1BD 4LD9C 3X1VB 1F66C 2ZY5A 3REKD 3O62B 5AV9A 3A1KA 1KX4D 5B2JA 2NQBC 3X1TA 3LJAC 5B33D 5GT3B 3LELC 3UT9A 3WTPE 2FFFB 5BNXA 1M18C 1U35B 1P3KD 3UTBA 1P3OB 4J8WB 5E5AB 5B40D 4CSRA 4WNNB 4ZBJC 3AV2D 1KX5D 2Y2OA 4EO5B 5AV6D 3VH6T 3TU4A 1EQZB 5AV5A 2PYOD 3AZLD 5AV9B 3AZKB 3AN2D 5B2JB 2DF4C 3X1SA 2BYKA 1P3AD 4QLCC 4H9OB 2IO5B 3UT9B 5B32C 4KGCB 3MVDD 4H9QB 2Y2JA 5CPID 3WAAA 1M1AD 3UTAD 3UTBB 4Z66C 3AV1B 4WU8D 3B6GB 3AZIC 3W97C 5JRGA 1P3LA 5BNVA 3WTPC 1A7WA 4H9NB 3LZ0A 3X1VC 3FDDA 3REJD 1P34A 2BYKB 5B1MA 4JJNB 3AZGD 1WWSA 3AZFD 3KUYA 2HIOA 4WJ3C 3MGPA 3AZNA 3B6FC 2Y2MA 4NFTA 5GT3C 4YM6A 1P3GA 2ZY2A 5F99A 5B31D 4ZUXB 1U35C 5AVCB 1ZLAD 5JRGB 1P3LB 2YFVA 5BNVB 1P3ID 5DNMD 4EO5C 3X1UB 5GT0D 1P3MA 1EQZC 4KUDD 5B1MB 4Z5TA 5BT1D 5AV9C 3B0CW 3AZKC 3MGPB 5B2JC 1ID3B 3WKJA 4DRAA 4AWLB 2IO5C 3UT9C 4KGCC 2BYMA 3VH6A 3REID 3W99A 1Q9CA 3NQJB 5F99B 3UTBC 4YS3B 3B6GC 2YFVB 5B2IA 2F8ND 3AYWB 2JSSA 5B0YD 3B0CT 3LJAA 3MGSB 3TU4C 1S32B 1P3MB 3LELA 2RIQA 1P3PB 3W98B 3VH5A 4H9PA 5CPJB 4JJNC 4XUJD 3WAAC 3W99B 5DNNB 3AZMD 4ZUXC 4LD9D 5CP6D 5AVCC 5JRGC 1P3LC 1F66D 4E45A 4QLCA 1R4VA 5B32A 3X1UC 2CV5B 2NQBD 1AOIA 2F8NH 2XD1A 1P34C 5B1MC 1M18D 3WA9D 2HIOC 1ID3C 3AZIA 3MGPC 1TZYA 3W97A 5B1LA 4AWLC 4YM6C 1P3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 B;  3C1C B;  5F99 C;  1M19 D;  3KWQ A;  3AZE D;  3X1V A;  3AYW C;  5GXQ D;  1BH9 B;  3O62 A;  1KX3 B;  2F8N K;  3MGS C;  1S32 C;  1P3M C;  5GT3 A;  3NQU B;  2RVQ C;  1P3P C;  3W98 C;  4J8U B;  4WU9 B;  1P3O A;  4XZQ D;  1TZY B;  5B1L B;  5E5A A;  4J8W A;  5CPJ C;  2F8N G;  3WKJ C;  2FJ7 B;  4WNN A;  5G49 B;  3W99 C;  4WZS B;  5DNN C;  5BO0 B;  4J8X D;  3WTP D;  1EQZ A;  4HGA B;  5B2I C;  3AZK A;  3VH6 W;  4J8V D;  2CWE A;  4X23 B;  4H9O A;  5CHL B;  4KGC A;  4H9Q A;  1HQ3 A;  5AY8 B;  3B6F D;  5CPK B;  3W96 B;  3AV1 A;  3B6G A;  3AV2 A;  3AFA D;  1U35 D;  3VH5 W;  4H9N A;  4R8P D;  3C1C C;  3REH D;  3REK B;  3KXB A;  3REL A;  4JJN A;  3B0D B;  4E44 A;  5B2J D;  5B0Z A;  3X1T D;  1HQ3 B;  3LZ1 A;  1P3K B;  5C3I B;  1KX3 C;  1AOI C;  3UT9 D;  5B40 B;  3VH5 T;  1B67 A;  2HUE B;  3AV2 B;  4J8U C;  4ZUX A;  4WU9 C;  1TZY C;  5B1L C;  5AVC A;  2FJ7 C;  2YFW A;  1N1J A;  2PYO B;  3KWQ C;  5B24 D;  3X1U A;  3AZL B;  3KXB B;  3REL B;  3TU4 D;  3AN2 B;  4HGA C;  5AV5 D;  1P3A B;  5BS7 A;  3O62 C;  3MVD B;  5CPI B;  2ARO A;  5JA4 A;  5B0Z B;  3X1S D;  3LZ1 B;  1M1A B;  3MGR A;  4X23 C;  3UTA B;  1ID3 A;  3WAA D;  3NQJ A;  5B31 A;  4YS3 A;  1P3O C;  4J8W C;  5E5A C;  5CPK C;  1P3B A;  3W96 C;  2YFW B;  5GSU A;  3AYW A;  1N1J B;  3MGS A;  3REJ B;  1S32 A;  3AZG B;  3AZF B;  1P3P A;  3W98 A;  3LZ0 D;  2ARO B;  5JA4 B;  1P34 D;  1BH8 A;  5B1M D;  3MGR B;  5CPJ A;  1JFI A;  3KUY D;  2HIO D;  3REI A;  3MGP D;  3AZH D;  1HQ3 C;  5B31 B;  3AZN D;  5C3I C;  5DNN A;  5AV8 A;  4YM6 D;  1P3G D;  5B40 C;  1P3B B;  3AV1 C;  2HUE C;  3AV2 C;  5F99 D;  5GSU B;  1P3I B;  5DNM B;  3A6N A;  5AVB D;  2PYO C;  4WV4 B;  2CV5 A;  3AZL C;  3KXB C;  3REL C;  3AN2 C;  4DRB A;  1P3F D;  1P3M D;  1BH8 B;  4Z5T D;  1P3A C;  1JFI B;  3KSY A;  3MVD C;  3REI B;  3WKJ D;  5B0Z C;  3LZ1 C;  1M1A C;  5AV8 B;  3AZJ A;  3R45 A;  3C1C A;  2NZD D;  5B0Y B;  5B2I D;  3A6N B;  4Z2M G;  1BH9 A;  4G92 B;  1KX3 A;  3LJA D;  3LEL D;  3NQU A;  3MNN A;  5BS7 C;  4J8U A;  2ARO C;  4WU9 A;  3MGR C;  2FJ7 A;  3AZJ B;  5G49 A;  3AZM B;  5B31 C;  5CP6 B;  4YS3 C;  5BO0 A;  1P3B C;  5GSU C;  1P3I C;  5GXQ A;  5DNM C;  4X23 A;  1HTA A;  3MGQ A;  4QLC D;  1M18 B;  5B32 D;  3WA9 B;  5AY8 A;  2LY8 A;  3MNN B;  1AOI D;  5CPK A;  4Z66 D;  3W96 A;  1TAF B;  3REI C;  3AZI D;  4NE5 A;  1TZY D;  5B1L D;  3W97 D;  1M19 B;  3C1B A;  5AV8 C;  4J8X A;  3AZE B;  3KWQ D;  5GXQ B;  3REK A;  3X1V D;  1KX4 A;  4J8V A;  5B33 A;  3A6N C;  3MGQ B;  3O62 D;  4G92 C;  1WWI A;  2CV5 C;  1P3K A;  4XZQ B;  5GT3 D;  5B40 A;  4H9S A;  4KHA B;  1P3O D;  1KX5 A;  4J8W D;  5E5A D;  3C1B B;  5KDM A;  4J8X B;  5AV6 A;  3WTP B;  3AZJ C;  3AZM C;  2PYO A;  4G91 B;  5CP6 C;  5FUG B;  3AZL A;  1KX4 B;  3AN2 A;  4J8V B;  1EQZ D;  5B33 B;  1P3A A;  4CAY B;  5AV9 D;  3MVD A;  3AZK D;  5CPI A;  3B6F B;  1M1A A;  3UTA A;  4KGC D;  3WA9 C;  4WU8 A;  3AFA B;  1HQ3 D;  3MNN C;  3UTB D;  1KX5 B;  5KDM B;  4NE3 A;  3AV1 D;  3B6G D;  5AV6 B;  4H9R A;  4R8P B;  3REH B;  1M19 C;  5B24 A;  3AZE C;  5B32 G;  3REJ A;  3AZG A;  3AZF A;  5GXQ C;  3KXB D;  3REL D;  3X1T B;  4JJN D;  1H3O A;  3MGQ C;  5BNX B;  4WU8 B;  5B0Z D;  3LZ1 D;  5AY8 C;  4XZQ C;  1ZLA A;  4CSR B;  4H9R B;  4ZUX D;  1P3I A;  5AVC D;  5DNM A;  5JRG D;  5B24 B;  3C1B C;  1P3L D;  4J8X C;  3TU4 B;  5GT0 A;  5AV5 B;  4KUD A;  3B0B A;  4G91 C;  3X1U D;  3REK C;  1KX4 C;  3X1S B;  4J8V C;  5B33 C;  2L5A A;  1H3O B;  3B0D C;  3AZH A;  1ID3 D;  2ARO D;  3WAA B;  3MGR D;  1P3K C;  3V9R A;  1ZLA B;  4H9S C;  3AFA C;  2F8N A;  4Z2M H;  4YS3 D;  1KX5 C;  5B0Y A;  1P3B D;  1F1E A;  5AV6 C;  5AVB A;  5GSU D;  4R8P C;  5GT0 B;  3REH C;  3AYW D;  4KUD B;  3LZ0 B;  1P3F A;  3MGS D;  1P34 B;  1S32 D;  4M6B A;  2RVQ D;  4XUJ A;  1P3P D;  3KUY B;  2HIO B;  3W98 D;  3AZH B;  5CPI C;  3X1T C;  3AZN B;  5CPJ D;  3UTA C;  4YM6 B;  1P3G B;  1BFM A;  3V9R B;  4WU8 C;  3AZM A;  3W99 D;  2F8N B;  2NZD A;  4LD9 A;  5DNN D;  5CP6 A;  5AV8 D;  1F66 A;  5AVB B;  1ULY A;  5B24 C;  2NQB A;  3A6N D;  1P3F B;  3REJ C;  5AV5 C;  4Z5T B;  1M18 A;  3AZG C;  4XUJ B;  3AZF C;  2CV5 D;  3WA9 A;  3WKJ B;  3X1S C;  1TAF A;  4UUZ A;  2BYM B;  2NZD B;  1M19 A;  4LD9 B;  3AZJ D;  3AZE A;  1ZLA C;  1F66 B;  1KU5 A;  5B2I B;  3C1C D;  2NQB B;  3LJA B;  5GT0 C;  3LEL B;  4KUD C;  5BT1 C;  3LZ0 C;  1KX3 D;  4NE6 A;  4H9P B;  4XZQ A;  5B31 G;  4Z66 A;  3KUY C;  4ZBJ B;  3MNN D;  4UUZ B;  4J8U D;  3AZH C;  4KHA A;  4WU9 D;  3AZN C;  2FJ7 D;  3WTP A;  5FUG A;  5B0Y C;  1B6W A;  5AVB C;  4CAY A;  4QLC B;  5B32 B;  3B6F A;  1P3F C;  1AOI B;  4X23 D;  3MGQ D;  4Z5T C;  4Z66 B;  4XUJ C;  3AFA A;  5AY8 D;  1U35 A;  3AZI B;  3W97 B;  5CPK D;  3W96 D;  4R8P A;  3REH A;  2NZD C;  3KWQ B;  3C1B D;  4LD9 C;  3X1V B;  1F66 C;  3REK D;  3O62 B;  5AV9 A;  1KX4 D;  5B2J A;  2NQB C;  3X1T A;  3LJA C;  5B33 D;  5GT3 B;  3LEL C;  3UT9 A;  3WTP E;  5BNX A;  1M18 C;  1U35 B;  1P3K D;  3UTB A;  1P3O B;  4J8W B;  5E5A B;  5B40 D;  4CSR A;  4WNN B;  4ZBJ C;  3AV2 D;  1KX5 D;  4EO5 B;  5AV6 D;  3VH6 T;  3TU4 A;  1EQZ B;  5AV5 A;  2PYO D;  3AZL D;  5AV9 B;  3AZK B;  3AN2 D;  5B2J B;  3X1S A;  2BYK A;  1P3A D;  4QLC C;  4H9O B;  2IO5 B;  3UT9 B;  5B32 C;  4KGC B;  3MVD D;  4H9Q B;  5CPI D;  3WAA A;  1M1A D;  3UTA D;  3UTB B;  4Z66 C;  3AV1 B;  4WU8 D;  3B6G B;  3AZI C;  3W97 C;  5JRG A;  1P3L A;  5BNV A;  3WTP C;  1A7W A;  4H9N B;  3LZ0 A;  3X1V C;  3REJ D;  1P34 A;  2BYK B;  5B1M A;  4JJN B;  3AZG D;  1WWS A;  3AZF D;  3KUY A;  2HIO A;  3MGP A;  3AZN A;  3B6F C;  4NFT A;  5GT3 C;  4YM6 A;  1P3G A;  5F99 A;  5B31 D;  4ZUX B;  1U35 C;  5AVC B;  1ZLA D;  5JRG B;  1P3L B;  2YFV A;  5BNV B;  1P3I D;  5DNM D;  4EO5 C;  3X1U B;  5GT0 D;  1P3M A;  1EQZ C;  4KUD D;  5B1M B;  4Z5T A;  5BT1 D;  5AV9 C;  3B0C W;  3AZK C;  3MGP B;  5B2J C;  1ID3 B;  3WKJ A;  4DRA A;  4AWL B;  2IO5 C;  3UT9 C;  4KGC C;  2BYM A;  3VH6 A;  3REI D;  3W99 A;  1Q9C A;  3NQJ B;  5F99 B;  3UTB C;  4YS3 B;  3B6G C;  2YFV B;  5B2I A;  2F8N D;  3AYW B;  2JSS A;  5B0Y D;  3B0C T;  3LJA A;  3MGS B;  3TU4 C;  1S32 B;  1P3M B;  3LEL A;  1P3P B;  3W98 B;  3VH5 A;  4H9P A;  5CPJ B;  4JJN C;  4XUJ D;  3WAA C;  3W99 B;  5DNN B;  3AZM D;  4ZUX C;  4LD9 D;  5CP6 D;  5AVC C;  5JRG C;  1P3L C;  1F66 D;  4E45 A;  4QLC A;  1R4V A;  5B32 A;  3X1U C;  2CV5 B;  2NQB D;  1AOI A;  2F8N H;  1P34 C;  5B1M C;  1M18 D;  3WA9 D;  2HIO C;  1ID3 C;  3AZI A;  3MGP C;  1TZY A;  3W97 A;  5B1L A;  4AWL C;  4YM6 C;  1P3G C; 
#chains in the Genus database with same CATH topology
 3R45 B;  3C1C B;  3EPH A;  5F99 C;  1M19 D;  3KWQ A;  3AZE D;  3X1V A;  3AYW C;  5GXQ D;  1BH9 B;  3O62 A;  1KX3 B;  3IP4 C;  2F8N K;  3MGS C;  1S32 C;  1P3M C;  5GT3 A;  3NQU B;  2RVQ C;  1P3P C;  3W98 C;  3H0R C;  4J8U B;  4WU9 B;  1P3O A;  4XZQ D;  1TZY B;  5B1L B;  5E5A A;  4J8W A;  2BG1 A;  5CPJ C;  2F8N G;  2FJ7 B;  4WNN A;  5G49 B;  3W99 C;  4WZS B;  5DNN C;  5BO0 B;  4J8X D;  3WTP D;  1EQZ A;  4HGA B;  5B2I C;  3AZK A;  3VH6 W;  4J8V D;  2CWE A;  4X23 B;  4H9O A;  5CHL B;  4KGC A;  4H9Q A;  1HQ3 A;  5AY8 B;  3B6F D;  5CPK B;  2G5H C;  3W96 B;  3AV1 A;  3B6G A;  3AV2 A;  3AFA D;  1U35 D;  3VH5 W;  4H9N A;  4R8P D;  3C1C C;  3REH D;  3REK B;  3KXB A;  3REL A;  2Y2P A;  4JJN A;  3B0D B;  4E44 A;  5B2J D;  5B0Z A;  3X1T D;  1HQ3 B;  3LZ1 A;  1P3K B;  5C3I B;  1KX3 C;  1AOI C;  4DQY B;  3UT9 D;  5B40 B;  3VH5 T;  1B67 A;  2HUE B;  3AV2 B;  4J8U C;  4ZUX A;  4WU9 C;  2Y2H A;  1TZY C;  5B1L C;  5AVC A;  2FJ7 C;  2YFW A;  1N1J A;  2PYO B;  3KWQ C;  5B24 D;  3X1U A;  3AZL B;  3KXB B;  3REL B;  3TU4 D;  3AN2 B;  4HGA C;  5AV5 D;  1P3A B;  5BS7 A;  3O62 C;  3MVD B;  5CPI B;  2ARO A;  5JA4 A;  5B0Z B;  3X1S D;  3LZ1 B;  1M1A B;  3MGR A;  4X23 C;  3UTA B;  1ID3 A;  3WAA D;  3NQJ A;  5B31 A;  4YS3 A;  1P3O C;  4J8W C;  5E5A C;  5CPK C;  1P3B A;  3W96 C;  2YFW B;  5GSU A;  3AYW A;  1N1J B;  3KFU G;  3MGS A;  3REJ B;  1S32 A;  3AZG B;  3AZF B;  1P3P A;  3W98 A;  3LZ0 D;  2ARO B;  5JA4 B;  1P34 D;  1BH8 A;  5B1M D;  3MGR B;  5CPJ A;  1JFI A;  3KUY D;  2HIO D;  3REI A;  3MGP D;  3AZH D;  2XD5 A;  1HQ3 C;  5B31 B;  3AZN D;  5C3I C;  5DNN A;  5AV8 A;  4YM6 D;  1P3G D;  5B40 C;  1P3B B;  3AV1 C;  2HUE C;  3AV2 C;  5F99 D;  5GSU B;  1P3I B;  5DNM B;  3A6N A;  5AVB D;  2PYO C;  4WV4 B;  2ZY4 A;  2CV5 A;  3AZL C;  3KXB C;  3REL C;  3AN2 C;  4DRB A;  1P3F D;  1P3M D;  1BH8 B;  4Z5T D;  1P3A C;  3EPL A;  1JFI B;  3KSY A;  3MVD C;  3REI B;  3WKJ D;  5B0Z C;  3LZ1 C;  1M1A C;  5AV8 B;  3AZJ A;  3R45 A;  3C1C A;  2NZD D;  1T3U A;  5B0Y B;  5B2I D;  3A6N B;  4Z2M G;  1BH9 A;  2ZY3 A;  4G92 B;  1KX3 A;  3LJA D;  3LEL D;  3NQU A;  3MNN A;  5BS7 C;  4J8U A;  2ARO C;  4WU9 A;  2Y2N A;  3MGR C;  2FJ7 A;  3AZJ B;  5G49 A;  3AZM B;  2J8P A;  5B31 C;  5CP6 B;  4YS3 C;  5BO0 A;  1P3B C;  2JCH A;  5GSU C;  1P3I C;  5GXQ A;  5DNM C;  1W2E A;  4X23 A;  1HTA A;  3MGQ A;  1Z2C B;  2Y2G A;  4QLC D;  1M18 B;  5B32 D;  3WA9 B;  5AY8 A;  2LY8 A;  3MNN B;  1AOI D;  2F2A C;  5CPK A;  4Z66 D;  3W96 A;  1TAF B;  2UWX A;  3REI C;  3AZI D;  4NE5 A;  1TZY D;  5B1L D;  3W97 D;  1M19 B;  3C1B A;  5AV8 C;  4J8X A;  3AZE B;  3KWQ D;  5GXQ B;  3REK A;  3X1V D;  2W8S A;  1KX4 A;  4J8V A;  5B33 A;  3A6N C;  3EPJ A;  3MGQ B;  3O62 D;  4G92 C;  1WWI A;  2CV5 C;  1P3K A;  4XZQ B;  5GT3 D;  5B40 A;  4H9S A;  4KHA B;  1P3O D;  1KX5 A;  4J8W D;  5E5A D;  3C1B B;  5KDM A;  3AL0 C;  4J8X B;  5AV6 A;  3WTP B;  2G5I C;  3AZJ C;  3P5J B;  3AZM C;  2PYO A;  4G91 B;  5CP6 C;  5FUG B;  3AZL A;  1KX4 B;  3AN2 A;  4J8V B;  1EQZ D;  5B33 B;  1P3A A;  4CAY B;  3EPK A;  5AV9 D;  3MVD A;  3F6T A;  3AZK D;  5CPI A;  3B6F B;  3H0M C;  1M1A A;  3UTA A;  2JE5 A;  4KGC D;  3WA9 C;  4WU8 A;  3AFA B;  1HQ3 D;  3MNN C;  3UTB D;  1KX5 B;  5KDM B;  4NE3 A;  3AV1 D;  3B6G D;  5AV6 B;  2ZM5 A;  4H9R A;  4R8P B;  3REH B;  1M19 C;  5B24 A;  3AZE C;  5B32 G;  3REJ A;  2Y2Q A;  3AZG A;  3AZF A;  5GXQ C;  3KXB D;  3REL D;  2Y2L A;  3X1T B;  4JJN D;  1H3O A;  3MGQ C;  5BNX B;  4WU8 B;  5B0Z D;  3LZ1 D;  5AY8 C;  4XZQ C;  1ZLA A;  4CSR B;  4H9R B;  4ZUX D;  1P3I A;  5AVC D;  5DNM A;  5JRG D;  5B24 B;  3C1B C;  1P3L D;  4J8X C;  3TU4 B;  5GT0 A;  5AV5 B;  4KUD A;  3B0B A;  1PZR A;  4G91 C;  3X1U D;  3REK C;  1KX4 C;  3X1S B;  4J8V C;  5B33 C;  2L5A A;  1H3O B;  3B0D C;  3AZH A;  1ID3 D;  2ARO D;  3WAA B;  3MGR D;  1P3K C;  3V9R A;  1ZLA B;  4H9S C;  3AFA C;  2F8N A;  4Z2M H;  2Y2I A;  4YS3 D;  1KX5 C;  5B0Y A;  1P3B D;  5AV6 C;  1F1E A;  5AVB A;  5GSU D;  4R8P C;  5GT0 B;  3REH C;  3AYW D;  4KUD B;  3LZ0 B;  1P3F A;  3MGS D;  1P34 B;  1S32 D;  4M6B A;  2RVQ D;  4XUJ A;  1P3P D;  3KUY B;  2HIO B;  3W98 D;  3AZH B;  5CPI C;  3X1T C;  3AZN B;  5CPJ D;  3UTA C;  4YM6 B;  1P3G B;  1BFM A;  3V9R B;  4WU8 C;  3AZM A;  3W99 D;  2F8N B;  2NZD A;  4LD9 A;  5DNN D;  5CP6 A;  5AV8 D;  3EG5 B;  1F66 A;  5AVB B;  1ULY A;  5B24 C;  2NQB A;  3A6N D;  1P3F B;  3REJ C;  5AV5 C;  4Z5T B;  1M18 A;  3AZG C;  4XUJ B;  3AZF C;  2CV5 D;  3WA9 A;  3WKJ B;  3X1S C;  2VQR A;  2DQN C;  1TAF A;  4UUZ A;  2BYM B;  3H0L C;  2NZD B;  1M19 A;  4LD9 B;  3AZJ D;  3AZE A;  1ZLA C;  1F66 B;  1KU5 A;  5B2I B;  3C1C D;  2NQB B;  3LJA B;  3WKJ C;  5GT0 C;  3LEL B;  4KUD C;  5BT1 C;  3LZ0 C;  1KX3 D;  4NE6 A;  4H9P B;  4XZQ A;  5B31 G;  4Z66 A;  3A1I A;  3KUY C;  4ZBJ B;  3MNN D;  4UUZ B;  4J8U D;  3AZH C;  4KHA A;  4WU9 D;  3AZN C;  2FJ7 D;  3WTP A;  5FUG A;  5B0Y C;  1B6W A;  5AVB C;  4CAY A;  4QLC B;  5B32 B;  3B6F A;  1P3F C;  1AOI B;  4X23 D;  3MGQ D;  4Z5T C;  4Z66 B;  4UPK A;  4XUJ C;  2Y2K A;  3AFA A;  5AY8 D;  1U35 A;  3AZI B;  3W97 B;  5CPK D;  3W96 D;  4R8P A;  3REH A;  2NZD C;  3KWQ B;  3C1B D;  4LD9 C;  3X1V B;  1F66 C;  2ZY5 A;  3REK D;  3O62 B;  5AV9 A;  3A1K A;  1KX4 D;  5B2J A;  2NQB C;  3X1T A;  3LJA C;  5B33 D;  5GT3 B;  3LEL C;  3UT9 A;  3WTP E;  2FFF B;  5BNX A;  1M18 C;  1U35 B;  1P3K D;  3UTB A;  1P3O B;  4J8W B;  5E5A B;  5B40 D;  4CSR A;  4WNN B;  4ZBJ C;  3AV2 D;  1KX5 D;  2Y2O A;  4EO5 B;  5AV6 D;  3VH6 T;  3TU4 A;  1EQZ B;  5AV5 A;  2PYO D;  3AZL D;  5AV9 B;  3AZK B;  3AN2 D;  5B2J B;  2DF4 C;  3X1S A;  2BYK A;  1P3A D;  4QLC C;  4H9O B;  2IO5 B;  3UT9 B;  5B32 C;  4KGC B;  3MVD D;  4H9Q B;  2Y2J A;  5CPI D;  3WAA A;  1M1A D;  3UTA D;  3UTB B;  4Z66 C;  3AV1 B;  4WU8 D;  3B6G B;  3AZI C;  3W97 C;  5JRG A;  1P3L A;  5BNV A;  3WTP C;  1A7W A;  4H9N B;  3LZ0 A;  3X1V C;  3FDD A;  3REJ D;  1P34 A;  2BYK B;  5B1M A;  4JJN B;  3AZG D;  1WWS A;  3AZF D;  3KUY A;  2HIO A;  4WJ3 C;  3MGP A;  3AZN A;  3B6F C;  2Y2M A;  4NFT A;  5GT3 C;  4YM6 A;  1P3G A;  2ZY2 A;  5F99 A;  5B31 D;  4ZUX B;  1U35 C;  5AVC B;  1ZLA D;  5JRG B;  1P3L B;  2YFV A;  5BNV B;  1P3I D;  5DNM D;  4EO5 C;  3X1U B;  5GT0 D;  1P3M A;  1EQZ C;  4KUD D;  5B1M B;  4Z5T A;  5BT1 D;  5AV9 C;  3B0C W;  3AZK C;  3MGP B;  5B2J C;  1ID3 B;  3WKJ A;  4DRA A;  4AWL B;  2IO5 C;  3UT9 C;  4KGC C;  2BYM A;  3VH6 A;  3REI D;  3W99 A;  1Q9C A;  3NQJ B;  5F99 B;  3UTB C;  4YS3 B;  3B6G C;  2YFV B;  5B2I A;  2F8N D;  3AYW B;  2JSS A;  5B0Y D;  3B0C T;  3LJA A;  3MGS B;  3TU4 C;  1S32 B;  1P3M B;  3LEL A;  2RIQ A;  1P3P B;  3W98 B;  3VH5 A;  4H9P A;  5CPJ B;  4JJN C;  4XUJ D;  3WAA C;  3W99 B;  5DNN B;  3AZM D;  4ZUX C;  4LD9 D;  5CP6 D;  5AVC C;  5JRG C;  1P3L C;  1F66 D;  4E45 A;  4QLC A;  1R4V A;  5B32 A;  3X1U C;  2CV5 B;  2NQB D;  1AOI A;  2F8N H;  2XD1 A;  1P34 C;  5B1M C;  1M18 D;  3WA9 D;  2HIO C;  1ID3 C;  3AZI A;  3MGP C;  1TZY A;  3W97 A;  5B1L A;  4AWL C;  4YM6 C;  1P3G C; 
#chains in the Genus database with same CATH homology
 3R45 B;  3C1C B;  3EPH A;  5F99 C;  1M19 D;  3KWQ A;  3AZE D;  3X1V A;  3AYW C;  5GXQ D;  1BH9 B;  3O62 A;  1KX3 B;  3IP4 C;  2F8N K;  3MGS C;  1S32 C;  1P3M C;  5GT3 A;  3NQU B;  2RVQ C;  1P3P C;  3W98 C;  3H0R C;  4J8U B;  4WU9 B;  1P3O A;  4XZQ D;  1TZY B;  5B1L B;  5E5A A;  4J8W A;  2BG1 A;  5CPJ C;  2F8N G;  2FJ7 B;  4WNN A;  5G49 B;  3W99 C;  4WZS B;  5DNN C;  5BO0 B;  4J8X D;  3WTP D;  1EQZ A;  4HGA B;  5B2I C;  3AZK A;  3VH6 W;  4J8V D;  2CWE A;  4X23 B;  4H9O A;  5CHL B;  4KGC A;  4H9Q A;  1HQ3 A;  5AY8 B;  3B6F D;  5CPK B;  2G5H C;  3W96 B;  3AV1 A;  3B6G A;  3AV2 A;  3AFA D;  1U35 D;  3VH5 W;  4H9N A;  4R8P D;  3C1C C;  3REH D;  3REK B;  3KXB A;  3REL A;  2Y2P A;  4JJN A;  3B0D B;  4E44 A;  5B2J D;  5B0Z A;  3X1T D;  1HQ3 B;  3LZ1 A;  1P3K B;  5C3I B;  1KX3 C;  1AOI C;  4DQY B;  3UT9 D;  5B40 B;  3VH5 T;  1B67 A;  2HUE B;  3AV2 B;  4J8U C;  4ZUX A;  4WU9 C;  2Y2H A;  1TZY C;  5B1L C;  5AVC A;  2FJ7 C;  2YFW A;  1N1J A;  2PYO B;  3KWQ C;  5B24 D;  3X1U A;  3AZL B;  3KXB B;  3REL B;  3TU4 D;  3AN2 B;  4HGA C;  5AV5 D;  1P3A B;  5BS7 A;  3O62 C;  3MVD B;  5CPI B;  2ARO A;  5JA4 A;  5B0Z B;  3X1S D;  3LZ1 B;  1M1A B;  3MGR A;  4X23 C;  3UTA B;  1ID3 A;  3WAA D;  3NQJ A;  5B31 A;  4YS3 A;  1P3O C;  4J8W C;  5E5A C;  5CPK C;  1P3B A;  3W96 C;  2YFW B;  5GSU A;  3AYW A;  1N1J B;  3KFU G;  3MGS A;  3REJ B;  1S32 A;  3AZG B;  3AZF B;  1P3P A;  3W98 A;  3LZ0 D;  2ARO B;  5JA4 B;  1P34 D;  1BH8 A;  5B1M D;  3MGR B;  5CPJ A;  1JFI A;  3KUY D;  2HIO D;  3REI A;  3MGP D;  3AZH D;  2XD5 A;  1HQ3 C;  5B31 B;  3AZN D;  5C3I C;  5DNN A;  5AV8 A;  4YM6 D;  1P3G D;  5B40 C;  1P3B B;  3AV1 C;  2HUE C;  3AV2 C;  5F99 D;  5GSU B;  1P3I B;  5DNM B;  3A6N A;  5AVB D;  2PYO C;  4WV4 B;  2ZY4 A;  2CV5 A;  3AZL C;  3KXB C;  3REL C;  3AN2 C;  4DRB A;  1P3F D;  1P3M D;  1BH8 B;  4Z5T D;  1P3A C;  3EPL A;  1JFI B;  3KSY A;  3MVD C;  3REI B;  3WKJ D;  5B0Z C;  3LZ1 C;  1M1A C;  5AV8 B;  3AZJ A;  3R45 A;  3C1C A;  2NZD D;  1T3U A;  5B0Y B;  5B2I D;  3A6N B;  4Z2M G;  1BH9 A;  2ZY3 A;  4G92 B;  1KX3 A;  3LJA D;  3LEL D;  3NQU A;  3MNN A;  5BS7 C;  4J8U A;  2ARO C;  4WU9 A;  2Y2N A;  3MGR C;  2FJ7 A;  3AZJ B;  5G49 A;  3AZM B;  2J8P A;  5B31 C;  5CP6 B;  4YS3 C;  5BO0 A;  1P3B C;  2JCH A;  5GSU C;  1P3I C;  5GXQ A;  5DNM C;  1W2E A;  4X23 A;  1HTA A;  3MGQ A;  1Z2C B;  2Y2G A;  4QLC D;  1M18 B;  5B32 D;  3WA9 B;  5AY8 A;  2LY8 A;  3MNN B;  1AOI D;  2F2A C;  5CPK A;  4Z66 D;  3W96 A;  1TAF B;  2UWX A;  3REI C;  3AZI D;  4NE5 A;  1TZY D;  5B1L D;  3W97 D;  1M19 B;  3C1B A;  5AV8 C;  4J8X A;  3AZE B;  3KWQ D;  5GXQ B;  3REK A;  3X1V D;  2W8S A;  1KX4 A;  4J8V A;  5B33 A;  3A6N C;  3EPJ A;  3MGQ B;  3O62 D;  4G92 C;  1WWI A;  2CV5 C;  1P3K A;  4XZQ B;  5GT3 D;  5B40 A;  4H9S A;  4KHA B;  1P3O D;  1KX5 A;  4J8W D;  5E5A D;  3C1B B;  5KDM A;  3AL0 C;  4J8X B;  5AV6 A;  3WTP B;  2G5I C;  3AZJ C;  3P5J B;  3AZM C;  2PYO A;  4G91 B;  5CP6 C;  5FUG B;  3AZL A;  1KX4 B;  3AN2 A;  4J8V B;  1EQZ D;  5B33 B;  1P3A A;  4CAY B;  3EPK A;  5AV9 D;  3MVD A;  3F6T A;  3AZK D;  5CPI A;  3B6F B;  3H0M C;  1M1A A;  3UTA A;  2JE5 A;  4KGC D;  3WA9 C;  4WU8 A;  3AFA B;  1HQ3 D;  3MNN C;  3UTB D;  1KX5 B;  5KDM B;  4NE3 A;  3AV1 D;  3B6G D;  5AV6 B;  2ZM5 A;  4H9R A;  4R8P B;  3REH B;  1M19 C;  5B24 A;  3AZE C;  5B32 G;  3REJ A;  2Y2Q A;  3AZG A;  3AZF A;  5GXQ C;  3KXB D;  3REL D;  2Y2L A;  3X1T B;  4JJN D;  1H3O A;  3MGQ C;  5BNX B;  4WU8 B;  5B0Z D;  3LZ1 D;  5AY8 C;  4XZQ C;  1ZLA A;  4CSR B;  4H9R B;  4ZUX D;  1P3I A;  5AVC D;  5DNM A;  5JRG D;  5B24 B;  3C1B C;  1P3L D;  4J8X C;  3TU4 B;  5GT0 A;  5AV5 B;  4KUD A;  3B0B A;  1PZR A;  4G91 C;  3X1U D;  3REK C;  1KX4 C;  3X1S B;  4J8V C;  5B33 C;  2L5A A;  1H3O B;  3B0D C;  3AZH A;  1ID3 D;  2ARO D;  3WAA B;  3MGR D;  1P3K C;  3V9R A;  1ZLA B;  4H9S C;  3AFA C;  2F8N A;  4Z2M H;  2Y2I A;  4YS3 D;  1KX5 C;  5B0Y A;  1P3B D;  5AV6 C;  1F1E A;  5AVB A;  5GSU D;  4R8P C;  5GT0 B;  3REH C;  3AYW D;  4KUD B;  3LZ0 B;  1P3F A;  3MGS D;  1P34 B;  1S32 D;  4M6B A;  2RVQ D;  4XUJ A;  1P3P D;  3KUY B;  2HIO B;  3W98 D;  3AZH B;  5CPI C;  3X1T C;  3AZN B;  5CPJ D;  3UTA C;  4YM6 B;  1P3G B;  1BFM A;  3V9R B;  4WU8 C;  3AZM A;  3W99 D;  2F8N B;  2NZD A;  4LD9 A;  5DNN D;  5CP6 A;  5AV8 D;  3EG5 B;  1F66 A;  5AVB B;  1ULY A;  5B24 C;  2NQB A;  3A6N D;  1P3F B;  3REJ C;  5AV5 C;  4Z5T B;  1M18 A;  3AZG C;  4XUJ B;  3AZF C;  2CV5 D;  3WA9 A;  3WKJ B;  3X1S C;  2VQR A;  2DQN C;  1TAF A;  4UUZ A;  2BYM B;  3H0L C;  2NZD B;  1M19 A;  4LD9 B;  3AZJ D;  3AZE A;  1ZLA C;  1F66 B;  1KU5 A;  5B2I B;  3C1C D;  2NQB B;  3LJA B;  3WKJ C;  5GT0 C;  3LEL B;  4KUD C;  5BT1 C;  3LZ0 C;  1KX3 D;  4NE6 A;  4H9P B;  4XZQ A;  5B31 G;  4Z66 A;  3A1I A;  3KUY C;  4ZBJ B;  3MNN D;  4UUZ B;  4J8U D;  3AZH C;  4KHA A;  4WU9 D;  3AZN C;  2FJ7 D;  3WTP A;  5FUG A;  5B0Y C;  1B6W A;  5AVB C;  4CAY A;  4QLC B;  5B32 B;  3B6F A;  1P3F C;  1AOI B;  4X23 D;  3MGQ D;  4Z5T C;  4Z66 B;  4UPK A;  4XUJ C;  2Y2K A;  3AFA A;  5AY8 D;  1U35 A;  3AZI B;  3W97 B;  5CPK D;  3W96 D;  4R8P A;  3REH A;  2NZD C;  3KWQ B;  3C1B D;  4LD9 C;  3X1V B;  1F66 C;  2ZY5 A;  3REK D;  3O62 B;  5AV9 A;  3A1K A;  1KX4 D;  5B2J A;  2NQB C;  3X1T A;  3LJA C;  5B33 D;  5GT3 B;  3LEL C;  3UT9 A;  3WTP E;  2FFF B;  5BNX A;  1M18 C;  1U35 B;  1P3K D;  3UTB A;  1P3O B;  4J8W B;  5E5A B;  5B40 D;  4CSR A;  4WNN B;  4ZBJ C;  3AV2 D;  1KX5 D;  2Y2O A;  4EO5 B;  5AV6 D;  3VH6 T;  3TU4 A;  1EQZ B;  5AV5 A;  2PYO D;  3AZL D;  5AV9 B;  3AZK B;  3AN2 D;  5B2J B;  2DF4 C;  3X1S A;  2BYK A;  1P3A D;  4QLC C;  4H9O B;  2IO5 B;  3UT9 B;  5B32 C;  4KGC B;  3MVD D;  4H9Q B;  2Y2J A;  5CPI D;  3WAA A;  1M1A D;  3UTA D;  3UTB B;  4Z66 C;  3AV1 B;  4WU8 D;  3B6G B;  3AZI C;  3W97 C;  5JRG A;  1P3L A;  5BNV A;  3WTP C;  1A7W A;  4H9N B;  3LZ0 A;  3X1V C;  3FDD A;  3REJ D;  1P34 A;  2BYK B;  5B1M A;  4JJN B;  3AZG D;  1WWS A;  3AZF D;  3KUY A;  2HIO A;  4WJ3 C;  3MGP A;  3AZN A;  3B6F C;  2Y2M A;  4NFT A;  5GT3 C;  4YM6 A;  1P3G A;  2ZY2 A;  5F99 A;  5B31 D;  4ZUX B;  1U35 C;  5AVC B;  1ZLA D;  5JRG B;  1P3L B;  2YFV A;  5BNV B;  1P3I D;  5DNM D;  4EO5 C;  3X1U B;  5GT0 D;  1P3M A;  1EQZ C;  4KUD D;  5B1M B;  4Z5T A;  5BT1 D;  5AV9 C;  3B0C W;  3AZK C;  3MGP B;  5B2J C;  1ID3 B;  3WKJ A;  4DRA A;  4AWL B;  2IO5 C;  3UT9 C;  4KGC C;  2BYM A;  3VH6 A;  3REI D;  3W99 A;  1Q9C A;  3NQJ B;  5F99 B;  3UTB C;  4YS3 B;  3B6G C;  2YFV B;  5B2I A;  2F8N D;  3AYW B;  2JSS A;  5B0Y D;  3B0C T;  3LJA A;  3MGS B;  3TU4 C;  1S32 B;  1P3M B;  3LEL A;  2RIQ A;  1P3P B;  3W98 B;  3VH5 A;  4H9P A;  5CPJ B;  4JJN C;  4XUJ D;  3WAA C;  3W99 B;  5DNN B;  3AZM D;  4ZUX C;  4LD9 D;  5CP6 D;  5AVC C;  5JRG C;  1P3L C;  1F66 D;  4E45 A;  4QLC A;  1R4V A;  5B32 A;  3X1U C;  2CV5 B;  2NQB D;  1AOI A;  2F8N H;  2XD1 A;  1P34 C;  5B1M C;  1M18 D;  3WA9 D;  2HIO C;  1ID3 C;  3AZI A;  3MGP C;  1TZY A;  3W97 A;  5B1L A;  4AWL C;  4YM6 C;  1P3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...