5AV6A

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6A00
1KX5A 1TAFB 3X1UD 1BH8A 3WKJA 3MVDA 1TZYC 3TU4D 3AZGA 5AV6B 1R4VA 5B1LA 5CPIA 3AN2A 4Z5TC 5AVBC 3B6FA 3X1UC 5B40C 3AZED 4WU9D 3R45B 4H9NA 1M1AA 4YS3D 3A6NB 4XZQB 3UTBB 3O62D 3AZKD 3W98B 4LD9A 2FJ7C 5B0ZA 5B32C 3AFAC 3REJC 2F8NA 5CPKA 3LELA 4QLCA 3O62C 4JJNA 3AZKC 4HGAC 3AV2C 4H9PB 3REHD 3X1SC 1BH8B 3C1CB 4J8WB 4YM6A 3RELB 3W96D 4J8XD 3LJAD 2HIOA 1H3OB 2AROC 1KX3C 4ZBJC 4J8UA 3B6GD 4WNNB 5DNMA 3LZ0B 1ZLAD 5DNNB 5GSUD 3AZJC 3UTAA 4WU8D 3WTPD 1JFIA 1P3LC 1P3MD 2NZDA 3REIA 5CPJB 5B31B 4XUJD 1S32A 5F99B 3WKJD 3MVDD 3MGRB 3AZGD 1N1JA 4H9SC 3WTPC 3MNNA 4X23D 3X1TA 1ID3A 5BO0A 5B1LD 5AVCA 5CPID 1P3MC 3WAAC 3VH6A 5AV8A 4XUJC 1P3PA 3KWQB 3AZHA 1M18A 1M1AD 5C3IC 4X23C 1A7WA 5BNXB 3NQJB 1P3OB 1P3FD 4LD9D 5B0ZD 3W97A 3C1BB 3MGQA 5GT3C 5CPKD 3LELD 3AZIB 4QLCD 1EQZA 5B2IC 4JJND 1AOIB 3MGSC 4ZUXA 5AV9C 1ULYA 5GXQA 1F66B 1B67A 1P3FC 4NE5A 1P34A 5AV5C 4R8PC 5CP6A 5JRGC 1P3BB 2PYOC 2NQBB 3W99A 2LY8A 4KHAA 1KX4A 3KUYC 4KUDA 5B33A 1P3AA 1TZYA 4UUZB 4J8UD 1HQ3C 1HTAA 5DNMD 1P3IA 2IO5B 4CSRA 4Z5TA 3UTAD 1TAFA 5B2JD 2NZDD 4AWLC 5E5AB 3REID 3UT9D 3LZ1C 3X1VD 4J8VB 3MGQB 5AV6A 1M19C 3B0CT 4Z66C 2CV5C 3X1TD 4ZUXB 1ID3D 5B2JC 5AVCD 3MGPB 3AYWB 3R45A 1P3PD 5AY8D 4G92B 3AZLC 1P3KC 1M18D 2YFWB 3VH5A 5JA4B 2L5AA 1BH9B 4XZQA 5GT0B 3UTBA 2F8NG 3AZMC 3REKC 3W98A 3AV1B 1U35B 1KX4B 2BYMB 5B0YC 5B24D 1TZYB 3W97D 1P3GD 4H9PA 4Z5TB 1EQZD 5AVBB 5GXQD 5B40B 3C1CA 4KGCC 1KX3A 4J8WA 1P34D 3AZFC 3RELA 1P3GC 5BNVB 5BT1D 1H3OA 3TU4C 2FJ7B 3AFAB 5B32B 3REJB 4WNNA 2BYKA 3LZ0A 1P3AD 5DNNA 3O62B 1P3ID 3AZKB 4H9SA 4HGAB 3AZEC 3AV2B 4WU9C 1U35C 1KU5A 5CPJA 5B31A 4YS3C 5F99A 3X1SB 3MGRA 4NFTA 4H9RA 5AV6D 5BS7A 3NQUB 5CHLB 1B6WA 3KWQA 2AROB 1KX3B 3A6ND 4ZBJB 3REHC 3UTBD 1Q9CA 3AZJB 5BNXA 3VH6W 3NQJA 3MGSA 1P3LB 1P3OA 3A6NC 3C1BA 3W96C 2BYKB 3AZIA 4J8XC 3WTPB 1AOIA 1F66A 2PYOA 3LJAC 1P3MB 4NE3A 3WAAB 4XUJB 1KX5D 3B6GC 1ZLAC 1F1EA 5GSUC 4H9RB 5C3IB 4WU8C 3RELD 1P3BA 2NQBA 3AN2D 3WA9A 1KX5C 3B6FD 3WKJC 3MVDC 2RVQD 5G49B 3AZGC 3AZNA 4UUZA 5GT3B 5B1LC 5CPIC 3AN2C 4H9QB 5DNND 3B6FC 5B2IB 3KXBA 2F8NK 3MGSB 5AV9B 3V9RB 5E5AA 1P3FB 5CPJD 1M1AC 5B31D 4J8VA 5F99D 2F8ND 3MGRD 5AV5B 4R8PB 5JRGB 2PYOB 3MGPA 3AYWA 3AZMA 4LD9C 5B0ZC 5CPKC 3KUYB 2YFWA 5JA4A 4QLCC 3LELC 1BH9A 5B1MA 4JJNC 3KSYA 5GT0A 4YM6D 1HQ3B 3WA9B 3AV1A 1U35A 2BYMA 2HIOD 4AWLB 1P3OD 3AZNB 3VH5W 3LZ1B 4YM6C 4Z2MG 2HUEC 1M19B 3AZID 4Z66B 3KXBB 2CV5B 5AVBA 1F66D 2HIOC 5B2JB 3X1UA 5B40A 1S32D 4J8UC 3AZLB 1P3KB 5DNMC 3UTAC 3MNND 1P3BD 2NZDC 2NQBD 5BNVA 3AZEA 5AV8D 3REIC 3X1VC 3REKB 3UT9C 3AZMB 1S32C 2FJ7A 3AFAA 5B32A 5B0YB 3REJA 3AZHD 5B1MB 3MNNC 3X1TC 5B31G 3O62A 1ID3C 5AVCC 3AZKA 5AV8C 3AV2A 1P3PC 5AY8C 1M18C 3AZHC 3X1SA 5E5AD 4KGCB 4J8VD 3MGQD 3AZFB 5KDMB 3NQUA 1P3GB 4G91C 4ZUXD 3X1UB 3MGPD 5B24C 3TU4B 3W97C 2AROA 4E45A 5CP6D 1EQZC 4J8XA 4ZUXC 5GXQC 3AZJA 3AZEB 3W99D 1P3LA 4WU9B 4E44A 1U35D 4YS3B 1P34C 1KX4D 4KUDD 5CP6C 5B33D 1TZYD 5GSUA 3WTPA 3W99C 5BT1C 1P3MA 4Z5TD 3WAAA 2CWEA 5AVBD 5FUGB 4XUJA 1KX4C 4KUDC 5B40D 3B0DC 5B33C 1P3AC 1P3IC 4X23A 4EO5C 3REHB 3VH6T 4DRAA 5G49A 5AV6C 2FJ7D 3AFAD 5B32D 3REJD 3W96B 5GT3A 2YFVB 4H9QA 1WWIA 4XZQD 4J8XB 5B2IA 4WZSB 5AV9A 4H9OB 3LJAB 3AV2D 3V9RA 3W98D 4CAYB 1P3FA 3X1SD 3B6GB 1ZLAB 4XZQC 5AV5A 3UTBC 4R8PA 5GSUB 4WU8B 5JRGA 3W98C 1KX5B 3C1CD 3WKJB 3MVDB 3KUYA 3AZGB 2AROD 1KX3D 4J8WD 4X23B 1HQ3A 5B1LB 5CPIB 3AN2B 3AZJD 3B6FB 3C1CC 1P3LD 4H9NB 1M1AB 3LZ1A 4J8WC 3RELC 3LZ0D 1M19A 4Z66A 2CV5A 5B2JA 2RVQC 3WAAD 4LD9B 3UT9A 3X1VA 5B0ZB 3AZLA 1P3KA 4M6BA 2F8NB 5CPKB 3LZ0C 3LELB 4QLCB 5DNNC 4JJNB 5B32G 3WTPE 5CPJC 3REKA 5B31C 5AY8A 5F99C 3KWQD 1WWSA 5B0YA 3MGRC 3VH5T 5BS7C 4YM6B 5GT3D 2JSSA 2HUEB 5B2ID 3MGSD 5AV9D 3KWQC 2HIOB 4KGCA 5B24A 3C1BD 4J8UB 4WV4B 5DNMB 3AZFA 5KDMA 5AV5D 1P3GA 4R8PD 3UTAB 1AOID 5JRGD 1JFIB 2PYOD 2NZDB 1P3OC 3REIB 1S32B 3UT9B 3X1VB 1BFMA 3C1BC 3TU4A 3KUYD 3AZIC 1N1JB 3MNNB 3X1TB 1AOIC 1F66C 1ID3B 1HQ3D 5BO0B 5AVCB 5AV8B 3WA9D 4WU9A 1P3PB 5AY8B 4YS3A 1M18B 3AZHB 3AZND 3LZ1D 1P3BC 2NQBC 4Z2MH 1M19D 3WA9C 4Z66D 3KXBD 2CV5D 5FUGA 4G91B 3AZNC 5B24B 3W97B 3AZLD 1P3KD 2IO5C 1EQZB 3KXBC 3REHA 3B0BA 5GXQB 5E5AC 3AZMD 3REKD 3AYWD 4J8VC 3MGQC 3A6NA 1P34B 5B0YD 3W96A 3B0CW 2YFVA 5CP6B 5B1MD 5GT0D 3MGPC 4H9OA 3LJAA 3AYWC 3W99B 3AV1D 4CAYA 2F8NH 4G92C 4KHAB 4KUDB 3B6GA 3B0DB 4KGCD 1ZLAA 5B33B 5B1MC 4DRBA 5GT0C 1P3AB 1P3IB 4WU8A 3AZFD 4CSRB 4NE6A 3AV1C 4EO5B
chains in the Genus database with same CATH superfamily
1KX5A 1TAFB 3X1UD 1BH8A 3WKJA 3MVDA 1TZYC 3TU4D 3AZGA 5AV6B 1R4VA 5B1LA 5CPIA 3AN2A 4Z5TC 5AVBC 3B6FA 3X1UC 5B40C 3AZED 4WU9D 3R45B 4H9NA 1M1AA 4YS3D 3A6NB 4XZQB 3UTBB 3O62D 3AZKD 3W98B 4LD9A 2FJ7C 5B0ZA 5B32C 3AFAC 3REJC 2F8NA 5CPKA 3LELA 4QLCA 3O62C 4JJNA 3AZKC 4HGAC 3AV2C 4H9PB 3REHD 3X1SC 1BH8B 3H0LC 3C1CB 4J8WB 4YM6A 3RELB 3W96D 4J8XD 3LJAD 2HIOA 1H3OB 2AROC 1KX3C 4ZBJC 4J8UA 3B6GD 4WNNB 5DNMA 3LZ0B 1ZLAD 5DNNB 5GSUD 3AZJC 3UTAA 4WU8D 3WTPD 1JFIA 1P3LC 1P3MD 2NZDA 3REIA 5CPJB 5B31B 4XUJD 1S32A 5F99B 2ZY2A 3WKJD 3MVDD 3MGRB 3AZGD 1N1JA 4H9SC 3WTPC 3MNNA 4X23D 3X1TA 1ID3A 5BO0A 5B1LD 5AVCA 5CPID 1P3MC 3WAAC 3VH6A 5AV8A 4XUJC 1P3PA 3KWQB 3AZHA 1M18A 2Y2PA 1M1AD 5C3IC 4X23C 1A7WA 5BNXB 3NQJB 2JE5A 1P3OB 1P3FD 4LD9D 5B0ZD 3W97A 3C1BB 3MGQA 5GT3C 5CPKD 3LELD 3AZIB 4QLCD 1EQZA 5B2IC 4JJND 1AOIB 3MGSC 4ZUXA 5AV9C 1ULYA 5GXQA 1F66B 1B67A 1P3FC 4NE5A 1P34A 5AV5C 4R8PC 5CP6A 5JRGC 1P3BB 2PYOC 2NQBB 2ZM5A 3W99A 2LY8A 4KHAA 2Y2MA 1KX4A 3KUYC 4KUDA 5B33A 1P3AA 1TZYA 4UUZB 4J8UD 2Y2GA 1HQ3C 1HTAA 5DNMD 1P3IA 2IO5B 4CSRA 4Z5TA 3UTAD 1TAFA 5B2JD 3EPKA 4AWLC 2NZDD 5E5AB 3EPJA 3REID 3UT9D 3LZ1C 3X1VD 4J8VB 3MGQB 5AV6A 1M19C 3B0CT 4Z66C 2CV5C 3X1TD 4ZUXB 1ID3D 5B2JC 5AVCD 3MGPB 3AYWB 3R45A 1P3PD 5AY8D 4G92B 3AZLC 1P3KC 1M18D 2YFWB 3VH5A 2FFFB 2L5AA 1BH9B 5JA4B 4XZQA 5GT0B 3UTBA 2F8NG 3AZMC 3REKC 3W98A 2JCHA 3AV1B 1U35B 1KX4B 2BYMB 5B0YC 5B24D 2G5IC 1TZYB 3W97D 3IP4C 1P3GD 4H9PA 4Z5TB 1EQZD 5AVBB 5GXQD 5B40B 3C1CA 4KGCC 1KX3A 4J8WA 1P34D 3AZFC 3RELA 1P3GC 5BNVB 5BT1D 1H3OA 3TU4C 2FJ7B 1T3UA 3AFAB 5B32B 3REJB 4WNNA 2BYKA 3LZ0A 1P3AD 5DNNA 3O62B 1P3ID 3AZKB 4H9SA 4HGAB 3AZEC 3AV2B 4WU9C 1U35C 1KU5A 5CPJA 5B31A 4YS3C 5F99A 3X1SB 2ZY3A 3MGRA 4NFTA 4H9RA 5AV6D 5BS7A 3NQUB 5CHLB 1B6WA 3KWQA 2G5HC 2AROB 1KX3B 3A6ND 3F6TA 4ZBJB 3REHC 3UTBD 1Q9CA 3AZJB 5BNXA 3VH6W 3NQJA 3MGSA 1P3LB 1P3OA 3A1IA 3A6NC 3C1BA 3W96C 2BYKB 3AZIA 4J8XC 3WTPB 1AOIA 1F66A 2PYOA 3LJAC 1P3MB 4NE3A 3WAAB 2ZY5A 4XUJB 1KX5D 3B6GC 1ZLAC 1F1EA 2BG1A 5GSUC 4H9RB 5C3IB 4WU8C 3RELD 1P3BA 2NQBA 3AN2D 3WA9A 1KX5C 3B6FD 3WKJC 3MVDC 2RVQD 5G49B 3AZGC 3AZNA 4UUZA 4DQYB 5GT3B 5B1LC 5CPIC 3AN2C 4H9QB 5DNND 1W2EA 3B6FC 5B2IB 3KXBA 2F8NK 3MGSB 5AV9B 3V9RB 2UWXA 5E5AA 1P3FB 5CPJD 1M1AC 5B31D 4J8VA 2Y2IA 5F99D 2F8ND 3MGRD 5AV5B 4R8PB 3KFUG 4WJ3C 5JRGB 2PYOB 2F2AC 3MGPA 3AYWA 3AZMA 4LD9C 5B0ZC 5CPKC 3KUYB 2YFWA 5JA4A 4QLCC 3LELC 1BH9A 5B1MA 4JJNC 3KSYA 5GT0A 4YM6D 1HQ3B 2Y2LA 3WA9B 3AV1A 1U35A 2BYMA 2HIOD 4AWLB 1P3OD 3AZNB 3VH5W 3LZ1B 4YM6C 4Z2MG 2HUEC 1M19B 3AZID 4Z66B 3KXBB 2CV5B 5AVBA 1F66D 2HIOC 5B2JB 3X1UA 5B40A 1S32D 4J8UC 3AZLB 1P3KB 5DNMC 2ZY4A 3UTAC 3MNND 1P3BD 2NZDC 2NQBD 5BNVA 3AZEA 5AV8D 3REIC 3X1VC 3REKB 3UT9C 3AZMB 1S32C 2FJ7A 2XD1A 3AFAA 5B32A 5B0YB 3REJA 3AZHD 5B1MB 3MNNC 3X1TC 5B31G 3O62A 1ID3C 5AVCC 3AZKA 5AV8C 3AV2A 3P5JB 5AY8C 1P3PC 1M18C 3AZHC 3X1SA 5E5AD 4KGCB 4J8VD 3A1KA 3MGQD 3AZFB 5KDMB 3NQUA 1P3GB 4G91C 4ZUXD 3X1UB 3MGPD 5B24C 3TU4B 3W97C 2Y2KA 2AROA 4E45A 5CP6D 1EQZC 4J8XA 4ZUXC 5GXQC 3AZJA 3AZEB 3W99D 1P3LA 4WU9B 4E44A 1U35D 4YS3B 1P34C 1KX4D 4KUDD 5CP6C 5B33D 1TZYD 5GSUA 3WTPA 3W99C 5BT1C 1P3MA 2VQRA 4Z5TD 3WAAA 2CWEA 1PZRA 5FUGB 4XUJA 5AVBD 1KX4C 4KUDC 3H0RC 3B0DC 5B40D 5B33C 1P3AC 1P3IC 4X23A 4EO5C 3REHB 3VH6T 4DRAA 5G49A 5AV6C 2FJ7D 3AFAD 5B32D 3REJD 3W96B 2Y2HA 5GT3A 2YFVB 4H9QA 1WWIA 4XZQD 4J8XB 5B2IA 4WZSB 5AV9A 4H9OB 3LJAB 3AV2D 3V9RA 3W98D 4CAYB 1P3FA 3X1SD 3B6GB 1ZLAB 4XZQC 5AV5A 3UTBC 4R8PA 5GSUB 4WU8B 2DQNC 5JRGA 2W8SA 3W98C 1KX5B 3C1CD 3WKJB 3MVDB 3KUYA 3AZGB 2AROD 1KX3D 4UPKA 2J8PA 4J8WD 3EPHA 4X23B 1HQ3A 5B1LB 5CPIB 3AN2B 2DF4C 3AZJD 1Z2CB 3B6FB 3C1CC 1P3LD 4H9NB 2Y2JA 1M1AB 3LZ1A 4J8WC 3RELC 3LZ0D 1M19A 4Z66A 2CV5A 5B2JA 2RVQC 3WAAD 4LD9B 3UT9A 3X1VA 5B0ZB 3AZLA 1P3KA 4M6BA 2F8NB 5CPKB 3LZ0C 3LELB 4QLCB 5DNNC 4JJNB 2RIQA 5B32G 3WTPE 5CPJC 3REKA 5B31C 3EPLA 5AY8A 5F99C 3KWQD 1WWSA 5B0YA 3MGRC 3VH5T 5BS7C 4YM6B 5GT3D 2JSSA 2HUEB 5B2ID 3MGSD 5AV9D 3KWQC 2HIOB 4KGCA 5B24A 3C1BD 4J8UB 4WV4B 5DNMB 3AL0C 3AZFA 5KDMA 5AV5D 1P3GA 4R8PD 3UTAB 1AOID 5JRGD 1JFIB 2PYOD 2NZDB 1P3OC 2Y2QA 3REIB 1S32B 2XD5A 3UT9B 3X1VB 1BFMA 3C1BC 3TU4A 3KUYD 3AZIC 3H0MC 1N1JB 3MNNB 3X1TB 1AOIC 1F66C 1ID3B 1HQ3D 5BO0B 5AVCB 5AV8B 3WA9D 4WU9A 1P3PB 5AY8B 4YS3A 1M18B 3EG5B 3AZHB 3AZND 3LZ1D 1P3BC 2NQBC 4Z2MH 1M19D 3WA9C 4Z66D 3KXBD 2CV5D 5FUGA 4G91B 3AZNC 5B24B 3W97B 3AZLD 1P3KD 2Y2OA 2IO5C 2Y2NA 3KXBC 3REHA 1EQZB 3B0BA 5GXQB 5E5AC 3AZMD 3REKD 3AYWD 4J8VC 3MGQC 3A6NA 1P34B 5B0YD 3W96A 3B0CW 2YFVA 5CP6B 5B1MD 5GT0D 3MGPC 4H9OA 3LJAA 3AYWC 3W99B 3AV1D 4CAYA 2F8NH 4G92C 4KHAB 4KUDB 3B6GA 3B0DB 4KGCD 1ZLAA 5B33B 5B1MC 4DRBA 5GT0C 1P3AB 1P3IB 4WU8A 3AZFD 4CSRB 4NE6A 3AV1C 3FDDA 4EO5B
chains in the Genus database with same CATH topology
1KX5A 1TAFB 3X1UD 1BH8A 3WKJA 3MVDA 1TZYC 3TU4D 3AZGA 5AV6B 1R4VA 5B1LA 5CPIA 3AN2A 4Z5TC 5AVBC 3B6FA 3X1UC 5B40C 3AZED 4WU9D 3R45B 4H9NA 1M1AA 4YS3D 3A6NB 4XZQB 3UTBB 3O62D 3AZKD 3W98B 4LD9A 2FJ7C 5B0ZA 5B32C 3AFAC 3REJC 2F8NA 5CPKA 3LELA 4QLCA 3O62C 4JJNA 3AZKC 4HGAC 3AV2C 4H9PB 3REHD 3X1SC 1BH8B 3H0LC 3C1CB 4J8WB 4YM6A 3RELB 3W96D 4J8XD 3LJAD 2HIOA 1H3OB 2AROC 1KX3C 4ZBJC 4J8UA 3B6GD 4WNNB 5DNMA 3LZ0B 1ZLAD 5DNNB 5GSUD 3AZJC 3UTAA 4WU8D 3WTPD 1JFIA 1P3LC 1P3MD 2NZDA 3REIA 5CPJB 5B31B 4XUJD 1S32A 5F99B 2ZY2A 3WKJD 3MVDD 3MGRB 3AZGD 1N1JA 4H9SC 3WTPC 3MNNA 4X23D 3X1TA 1ID3A 5BO0A 5B1LD 5AVCA 5CPID 1P3MC 3WAAC 3VH6A 5AV8A 4XUJC 1P3PA 3KWQB 3AZHA 1M18A 2Y2PA 1M1AD 5C3IC 4X23C 1A7WA 5BNXB 3NQJB 2JE5A 1P3OB 1P3FD 4LD9D 5B0ZD 3W97A 3C1BB 3MGQA 5GT3C 5CPKD 3LELD 3AZIB 4QLCD 1EQZA 5B2IC 4JJND 1AOIB 3MGSC 4ZUXA 5AV9C 1ULYA 5GXQA 1F66B 1B67A 1P3FC 4NE5A 1P34A 5AV5C 4R8PC 5CP6A 5JRGC 1P3BB 2PYOC 2NQBB 2ZM5A 3W99A 2LY8A 4KHAA 2Y2MA 1KX4A 3KUYC 4KUDA 5B33A 1P3AA 1TZYA 4UUZB 4J8UD 2Y2GA 1HQ3C 1HTAA 5DNMD 1P3IA 2IO5B 4CSRA 4Z5TA 3UTAD 1TAFA 5B2JD 3EPKA 4AWLC 2NZDD 5E5AB 3EPJA 3REID 3UT9D 3LZ1C 3X1VD 4J8VB 3MGQB 5AV6A 1M19C 3B0CT 4Z66C 2CV5C 3X1TD 4ZUXB 1ID3D 5B2JC 5AVCD 3MGPB 3AYWB 3R45A 1P3PD 5AY8D 4G92B 3AZLC 1P3KC 1M18D 2YFWB 3VH5A 2FFFB 2L5AA 1BH9B 5JA4B 4XZQA 5GT0B 3UTBA 2F8NG 3AZMC 3REKC 3W98A 2JCHA 3AV1B 1U35B 1KX4B 2BYMB 5B0YC 5B24D 2G5IC 1TZYB 3W97D 3IP4C 1P3GD 4H9PA 4Z5TB 1EQZD 5AVBB 5GXQD 5B40B 3C1CA 4KGCC 1KX3A 4J8WA 1P34D 3AZFC 3RELA 1P3GC 5BNVB 5BT1D 1H3OA 3TU4C 2FJ7B 1T3UA 3AFAB 5B32B 3REJB 4WNNA 2BYKA 3LZ0A 1P3AD 5DNNA 3O62B 1P3ID 3AZKB 4H9SA 4HGAB 3AZEC 3AV2B 4WU9C 1U35C 1KU5A 5CPJA 5B31A 4YS3C 5F99A 3X1SB 2ZY3A 3MGRA 4NFTA 4H9RA 5AV6D 5BS7A 3NQUB 5CHLB 1B6WA 3KWQA 2G5HC 2AROB 1KX3B 3A6ND 3F6TA 4ZBJB 3REHC 3UTBD 1Q9CA 3AZJB 5BNXA 3VH6W 3NQJA 3MGSA 1P3LB 1P3OA 3A1IA 3A6NC 3C1BA 3W96C 2BYKB 3AZIA 4J8XC 3WTPB 1AOIA 1F66A 2PYOA 3LJAC 1P3MB 4NE3A 3WAAB 2ZY5A 4XUJB 1KX5D 3B6GC 1ZLAC 1F1EA 2BG1A 5GSUC 4H9RB 5C3IB 4WU8C 3RELD 1P3BA 2NQBA 3AN2D 3WA9A 1KX5C 3B6FD 3WKJC 3MVDC 2RVQD 5G49B 3AZGC 3AZNA 4UUZA 4DQYB 5GT3B 5B1LC 5CPIC 3AN2C 4H9QB 5DNND 1W2EA 3B6FC 5B2IB 3KXBA 2F8NK 3MGSB 5AV9B 3V9RB 2UWXA 5E5AA 1P3FB 5CPJD 1M1AC 5B31D 4J8VA 2Y2IA 5F99D 2F8ND 3MGRD 5AV5B 4R8PB 3KFUG 4WJ3C 5JRGB 2PYOB 2F2AC 3MGPA 3AYWA 3AZMA 4LD9C 5B0ZC 5CPKC 3KUYB 2YFWA 5JA4A 4QLCC 3LELC 1BH9A 5B1MA 4JJNC 3KSYA 5GT0A 4YM6D 1HQ3B 2Y2LA 3WA9B 3AV1A 1U35A 2BYMA 2HIOD 4AWLB 1P3OD 3AZNB 3VH5W 3LZ1B 4YM6C 4Z2MG 2HUEC 1M19B 3AZID 4Z66B 3KXBB 2CV5B 5AVBA 1F66D 2HIOC 5B2JB 3X1UA 5B40A 1S32D 4J8UC 3AZLB 1P3KB 5DNMC 2ZY4A 3UTAC 3MNND 1P3BD 2NZDC 2NQBD 5BNVA 3AZEA 5AV8D 3REIC 3X1VC 3REKB 3UT9C 3AZMB 1S32C 2FJ7A 2XD1A 3AFAA 5B32A 5B0YB 3REJA 3AZHD 5B1MB 3MNNC 3X1TC 5B31G 3O62A 1ID3C 5AVCC 3AZKA 5AV8C 3AV2A 3P5JB 5AY8C 1P3PC 1M18C 3AZHC 3X1SA 5E5AD 4KGCB 4J8VD 3A1KA 3MGQD 3AZFB 5KDMB 3NQUA 1P3GB 4G91C 4ZUXD 3X1UB 3MGPD 5B24C 3TU4B 3W97C 2Y2KA 2AROA 4E45A 5CP6D 1EQZC 4J8XA 4ZUXC 5GXQC 3AZJA 3AZEB 3W99D 1P3LA 4WU9B 4E44A 1U35D 4YS3B 1P34C 1KX4D 4KUDD 5CP6C 5B33D 1TZYD 5GSUA 3WTPA 3W99C 5BT1C 1P3MA 2VQRA 4Z5TD 3WAAA 2CWEA 1PZRA 5FUGB 4XUJA 5AVBD 1KX4C 4KUDC 3H0RC 3B0DC 5B40D 5B33C 1P3AC 1P3IC 4X23A 4EO5C 3REHB 3VH6T 4DRAA 5G49A 5AV6C 2FJ7D 3AFAD 5B32D 3REJD 3W96B 2Y2HA 5GT3A 2YFVB 4H9QA 1WWIA 4XZQD 4J8XB 5B2IA 4WZSB 5AV9A 4H9OB 3LJAB 3AV2D 3V9RA 3W98D 4CAYB 1P3FA 3X1SD 3B6GB 1ZLAB 4XZQC 5AV5A 3UTBC 4R8PA 5GSUB 4WU8B 2DQNC 5JRGA 2W8SA 3W98C 1KX5B 3C1CD 3WKJB 3MVDB 3KUYA 3AZGB 2AROD 1KX3D 4UPKA 2J8PA 4J8WD 3EPHA 4X23B 1HQ3A 5B1LB 5CPIB 3AN2B 2DF4C 3AZJD 1Z2CB 3B6FB 3C1CC 1P3LD 4H9NB 2Y2JA 1M1AB 3LZ1A 4J8WC 3RELC 3LZ0D 1M19A 4Z66A 2CV5A 5B2JA 2RVQC 3WAAD 4LD9B 3UT9A 3X1VA 5B0ZB 3AZLA 1P3KA 4M6BA 2F8NB 5CPKB 3LZ0C 3LELB 4QLCB 5DNNC 4JJNB 2RIQA 5B32G 3WTPE 5CPJC 3REKA 5B31C 3EPLA 5AY8A 5F99C 3KWQD 1WWSA 5B0YA 3MGRC 3VH5T 5BS7C 4YM6B 5GT3D 2JSSA 2HUEB 5B2ID 3MGSD 5AV9D 3KWQC 2HIOB 4KGCA 5B24A 3C1BD 4J8UB 4WV4B 5DNMB 3AL0C 3AZFA 5KDMA 5AV5D 1P3GA 4R8PD 3UTAB 1AOID 5JRGD 1JFIB 2PYOD 2NZDB 1P3OC 2Y2QA 3REIB 1S32B 2XD5A 3UT9B 3X1VB 1BFMA 3C1BC 3TU4A 3KUYD 3AZIC 3H0MC 1N1JB 3MNNB 3X1TB 1AOIC 1F66C 1ID3B 1HQ3D 5BO0B 5AVCB 5AV8B 3WA9D 4WU9A 1P3PB 5AY8B 4YS3A 1M18B 3EG5B 3AZHB 3AZND 3LZ1D 1P3BC 2NQBC 4Z2MH 1M19D 3WA9C 4Z66D 3KXBD 2CV5D 5FUGA 4G91B 3AZNC 5B24B 3W97B 3AZLD 1P3KD 2Y2OA 2IO5C 2Y2NA 3KXBC 3REHA 1EQZB 3B0BA 5GXQB 5E5AC 3AZMD 3REKD 3AYWD 4J8VC 3MGQC 3A6NA 1P34B 5B0YD 3W96A 3B0CW 2YFVA 5CP6B 5B1MD 5GT0D 3MGPC 4H9OA 3LJAA 3AYWC 3W99B 3AV1D 4CAYA 2F8NH 4G92C 4KHAB 4KUDB 3B6GA 3B0DB 4KGCD 1ZLAA 5B33B 5B1MC 4DRBA 5GT0C 1P3AB 1P3IB 4WU8A 3AZFD 4CSRB 4NE6A 3AV1C 3FDDA 4EO5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX5 A;  1TAF B;  3X1U D;  1BH8 A;  3WKJ A;  3MVD A;  1TZY C;  3TU4 D;  3AZG A;  5AV6 B;  1R4V A;  5B1L A;  5CPI A;  3AN2 A;  4Z5T C;  5AVB C;  3B6F A;  3X1U C;  5B40 C;  3AZE D;  4WU9 D;  3R45 B;  4H9N A;  1M1A A;  4YS3 D;  3A6N B;  4XZQ B;  3UTB B;  3O62 D;  3AZK D;  3W98 B;  4LD9 A;  2FJ7 C;  5B0Z A;  5B32 C;  3AFA C;  3REJ C;  2F8N A;  5CPK A;  3LEL A;  4QLC A;  3O62 C;  4JJN A;  3AZK C;  4HGA C;  3AV2 C;  4H9P B;  3REH D;  3X1S C;  1BH8 B;  3C1C B;  4J8W B;  4YM6 A;  3REL B;  3W96 D;  4J8X D;  3LJA D;  2HIO A;  1H3O B;  2ARO C;  1KX3 C;  4ZBJ C;  4J8U A;  3B6G D;  4WNN B;  5DNM A;  3LZ0 B;  1ZLA D;  5DNN B;  5GSU D;  3AZJ C;  3UTA A;  4WU8 D;  3WTP D;  1JFI A;  1P3L C;  1P3M D;  2NZD A;  3REI A;  5CPJ B;  5B31 B;  4XUJ D;  1S32 A;  5F99 B;  3WKJ D;  3MVD D;  3MGR B;  3AZG D;  1N1J A;  4H9S C;  3WTP C;  3MNN A;  4X23 D;  3X1T A;  1ID3 A;  5BO0 A;  5B1L D;  5AVC A;  5CPI D;  1P3M C;  3WAA C;  3VH6 A;  5AV8 A;  4XUJ C;  1P3P A;  3KWQ B;  3AZH A;  1M18 A;  1M1A D;  5C3I C;  4X23 C;  1A7W A;  5BNX B;  3NQJ B;  1P3O B;  1P3F D;  4LD9 D;  5B0Z D;  3W97 A;  3C1B B;  3MGQ A;  5GT3 C;  5CPK D;  3LEL D;  3AZI B;  4QLC D;  1EQZ A;  5B2I C;  4JJN D;  1AOI B;  3MGS C;  4ZUX A;  5AV9 C;  1ULY A;  5GXQ A;  1F66 B;  1B67 A;  1P3F C;  4NE5 A;  1P34 A;  5AV5 C;  4R8P C;  5CP6 A;  5JRG C;  1P3B B;  2PYO C;  2NQB B;  3W99 A;  2LY8 A;  4KHA A;  1KX4 A;  3KUY C;  4KUD A;  5B33 A;  1P3A A;  1TZY A;  4UUZ B;  4J8U D;  1HQ3 C;  1HTA A;  5DNM D;  1P3I A;  2IO5 B;  4CSR A;  4Z5T A;  3UTA D;  1TAF A;  5B2J D;  2NZD D;  4AWL C;  5E5A B;  3REI D;  3UT9 D;  3LZ1 C;  3X1V D;  4J8V B;  3MGQ B;  5AV6 A;  1M19 C;  3B0C T;  4Z66 C;  2CV5 C;  3X1T D;  4ZUX B;  1ID3 D;  5B2J C;  5AVC D;  3MGP B;  3AYW B;  3R45 A;  1P3P D;  5AY8 D;  4G92 B;  3AZL C;  1P3K C;  1M18 D;  2YFW B;  3VH5 A;  5JA4 B;  2L5A A;  1BH9 B;  4XZQ A;  5GT0 B;  3UTB A;  2F8N G;  3AZM C;  3REK C;  3W98 A;  3AV1 B;  1U35 B;  1KX4 B;  2BYM B;  5B0Y C;  5B24 D;  1TZY B;  3W97 D;  1P3G D;  4H9P A;  4Z5T B;  1EQZ D;  5AVB B;  5GXQ D;  5B40 B;  3C1C A;  4KGC C;  1KX3 A;  4J8W A;  1P34 D;  3AZF C;  3REL A;  1P3G C;  5BNV B;  5BT1 D;  1H3O A;  3TU4 C;  2FJ7 B;  3AFA B;  5B32 B;  3REJ B;  4WNN A;  2BYK A;  3LZ0 A;  1P3A D;  5DNN A;  3O62 B;  1P3I D;  3AZK B;  4H9S A;  4HGA B;  3AZE C;  3AV2 B;  4WU9 C;  1U35 C;  1KU5 A;  5CPJ A;  5B31 A;  4YS3 C;  5F99 A;  3X1S B;  3MGR A;  4NFT A;  4H9R A;  5AV6 D;  5BS7 A;  3NQU B;  5CHL B;  1B6W A;  3KWQ A;  2ARO B;  1KX3 B;  3A6N D;  4ZBJ B;  3REH C;  3UTB D;  1Q9C A;  3AZJ B;  5BNX A;  3VH6 W;  3NQJ A;  3MGS A;  1P3L B;  1P3O A;  3A6N C;  3C1B A;  3W96 C;  2BYK B;  3AZI A;  4J8X C;  3WTP B;  1AOI A;  1F66 A;  2PYO A;  3LJA C;  1P3M B;  4NE3 A;  3WAA B;  4XUJ B;  1KX5 D;  3B6G C;  1ZLA C;  1F1E A;  5GSU C;  4H9R B;  5C3I B;  4WU8 C;  3REL D;  1P3B A;  2NQB A;  3AN2 D;  3WA9 A;  1KX5 C;  3B6F D;  3WKJ C;  3MVD C;  2RVQ D;  5G49 B;  3AZG C;  3AZN A;  4UUZ A;  5GT3 B;  5B1L C;  5CPI C;  3AN2 C;  4H9Q B;  5DNN D;  3B6F C;  5B2I B;  3KXB A;  2F8N K;  3MGS B;  5AV9 B;  3V9R B;  5E5A A;  1P3F B;  5CPJ D;  1M1A C;  5B31 D;  4J8V A;  5F99 D;  2F8N D;  3MGR D;  5AV5 B;  4R8P B;  5JRG B;  2PYO B;  3MGP A;  3AYW A;  3AZM A;  4LD9 C;  5B0Z C;  5CPK C;  3KUY B;  2YFW A;  5JA4 A;  4QLC C;  3LEL C;  1BH9 A;  5B1M A;  4JJN C;  3KSY A;  5GT0 A;  4YM6 D;  1HQ3 B;  3WA9 B;  3AV1 A;  1U35 A;  2BYM A;  2HIO D;  4AWL B;  1P3O D;  3AZN B;  3VH5 W;  3LZ1 B;  4YM6 C;  4Z2M G;  2HUE C;  1M19 B;  3AZI D;  4Z66 B;  3KXB B;  2CV5 B;  5AVB A;  1F66 D;  2HIO C;  5B2J B;  3X1U A;  5B40 A;  1S32 D;  4J8U C;  3AZL B;  1P3K B;  5DNM C;  3UTA C;  3MNN D;  1P3B D;  2NZD C;  2NQB D;  5BNV A;  3AZE A;  5AV8 D;  3REI C;  3X1V C;  3REK B;  3UT9 C;  3AZM B;  1S32 C;  2FJ7 A;  3AFA A;  5B32 A;  5B0Y B;  3REJ A;  3AZH D;  5B1M B;  3MNN C;  3X1T C;  5B31 G;  3O62 A;  1ID3 C;  5AVC C;  3AZK A;  5AV8 C;  3AV2 A;  1P3P C;  5AY8 C;  1M18 C;  3AZH C;  3X1S A;  5E5A D;  4KGC B;  4J8V D;  3MGQ D;  3AZF B;  5KDM B;  3NQU A;  1P3G B;  4G91 C;  4ZUX D;  3X1U B;  3MGP D;  5B24 C;  3TU4 B;  3W97 C;  2ARO A;  4E45 A;  5CP6 D;  1EQZ C;  4J8X A;  4ZUX C;  5GXQ C;  3AZJ A;  3AZE B;  3W99 D;  1P3L A;  4WU9 B;  4E44 A;  1U35 D;  4YS3 B;  1P34 C;  1KX4 D;  4KUD D;  5CP6 C;  5B33 D;  1TZY D;  5GSU A;  3WTP A;  3W99 C;  5BT1 C;  1P3M A;  4Z5T D;  3WAA A;  2CWE A;  5AVB D;  5FUG B;  4XUJ A;  1KX4 C;  4KUD C;  5B40 D;  3B0D C;  5B33 C;  1P3A C;  1P3I C;  4X23 A;  4EO5 C;  3REH B;  3VH6 T;  4DRA A;  5G49 A;  5AV6 C;  2FJ7 D;  3AFA D;  5B32 D;  3REJ D;  3W96 B;  5GT3 A;  2YFV B;  4H9Q A;  1WWI A;  4XZQ D;  4J8X B;  5B2I A;  4WZS B;  5AV9 A;  4H9O B;  3LJA B;  3AV2 D;  3V9R A;  3W98 D;  4CAY B;  1P3F A;  3X1S D;  3B6G B;  1ZLA B;  4XZQ C;  5AV5 A;  3UTB C;  4R8P A;  5GSU B;  4WU8 B;  5JRG A;  3W98 C;  1KX5 B;  3C1C D;  3WKJ B;  3MVD B;  3KUY A;  3AZG B;  2ARO D;  1KX3 D;  4J8W D;  4X23 B;  1HQ3 A;  5B1L B;  5CPI B;  3AN2 B;  3AZJ D;  3B6F B;  3C1C C;  1P3L D;  4H9N B;  1M1A B;  3LZ1 A;  4J8W C;  3REL C;  3LZ0 D;  1M19 A;  4Z66 A;  2CV5 A;  5B2J A;  2RVQ C;  3WAA D;  4LD9 B;  3UT9 A;  3X1V A;  5B0Z B;  3AZL A;  1P3K A;  4M6B A;  2F8N B;  5CPK B;  3LZ0 C;  3LEL B;  4QLC B;  5DNN C;  4JJN B;  5B32 G;  3WTP E;  5CPJ C;  3REK A;  5B31 C;  5AY8 A;  5F99 C;  3KWQ D;  1WWS A;  5B0Y A;  3MGR C;  3VH5 T;  5BS7 C;  4YM6 B;  5GT3 D;  2JSS A;  2HUE B;  5B2I D;  3MGS D;  5AV9 D;  3KWQ C;  2HIO B;  4KGC A;  5B24 A;  3C1B D;  4J8U B;  4WV4 B;  5DNM B;  3AZF A;  5KDM A;  5AV5 D;  1P3G A;  4R8P D;  3UTA B;  1AOI D;  5JRG D;  1JFI B;  2PYO D;  2NZD B;  1P3O C;  3REI B;  1S32 B;  3UT9 B;  3X1V B;  1BFM A;  3C1B C;  3TU4 A;  3KUY D;  3AZI C;  1N1J B;  3MNN B;  3X1T B;  1AOI C;  1F66 C;  1ID3 B;  1HQ3 D;  5BO0 B;  5AVC B;  5AV8 B;  3WA9 D;  4WU9 A;  1P3P B;  5AY8 B;  4YS3 A;  1M18 B;  3AZH B;  3AZN D;  3LZ1 D;  1P3B C;  2NQB C;  4Z2M H;  1M19 D;  3WA9 C;  4Z66 D;  3KXB D;  2CV5 D;  5FUG A;  4G91 B;  3AZN C;  5B24 B;  3W97 B;  3AZL D;  1P3K D;  2IO5 C;  1EQZ B;  3KXB C;  3REH A;  3B0B A;  5GXQ B;  5E5A C;  3AZM D;  3REK D;  3AYW D;  4J8V C;  3MGQ C;  3A6N A;  1P34 B;  5B0Y D;  3W96 A;  3B0C W;  2YFV A;  5CP6 B;  5B1M D;  5GT0 D;  3MGP C;  4H9O A;  3LJA A;  3AYW C;  3W99 B;  3AV1 D;  4CAY A;  2F8N H;  4G92 C;  4KHA B;  4KUD B;  3B6G A;  3B0D B;  4KGC D;  1ZLA A;  5B33 B;  5B1M C;  4DRB A;  5GT0 C;  1P3A B;  1P3I B;  4WU8 A;  3AZF D;  4CSR B;  4NE6 A;  3AV1 C;  4EO5 B; 
#chains in the Genus database with same CATH topology
 1KX5 A;  1TAF B;  3X1U D;  1BH8 A;  3WKJ A;  3MVD A;  1TZY C;  3TU4 D;  3AZG A;  5AV6 B;  1R4V A;  5B1L A;  5CPI A;  3AN2 A;  4Z5T C;  5AVB C;  3B6F A;  3X1U C;  5B40 C;  3AZE D;  4WU9 D;  3R45 B;  4H9N A;  1M1A A;  4YS3 D;  3A6N B;  4XZQ B;  3UTB B;  3O62 D;  3AZK D;  3W98 B;  4LD9 A;  2FJ7 C;  5B0Z A;  5B32 C;  3AFA C;  3REJ C;  2F8N A;  5CPK A;  3LEL A;  4QLC A;  3O62 C;  4JJN A;  3AZK C;  4HGA C;  3AV2 C;  4H9P B;  3REH D;  3X1S C;  1BH8 B;  3H0L C;  3C1C B;  4J8W B;  4YM6 A;  3REL B;  3W96 D;  4J8X D;  3LJA D;  2HIO A;  1H3O B;  2ARO C;  1KX3 C;  4ZBJ C;  4J8U A;  3B6G D;  4WNN B;  5DNM A;  3LZ0 B;  1ZLA D;  5DNN B;  5GSU D;  3AZJ C;  3UTA A;  4WU8 D;  3WTP D;  1JFI A;  1P3L C;  1P3M D;  2NZD A;  3REI A;  5CPJ B;  5B31 B;  4XUJ D;  1S32 A;  5F99 B;  2ZY2 A;  3WKJ D;  3MVD D;  3MGR B;  3AZG D;  1N1J A;  4H9S C;  3WTP C;  3MNN A;  4X23 D;  3X1T A;  1ID3 A;  5BO0 A;  5B1L D;  5AVC A;  5CPI D;  1P3M C;  3WAA C;  3VH6 A;  5AV8 A;  4XUJ C;  1P3P A;  3KWQ B;  3AZH A;  1M18 A;  2Y2P A;  1M1A D;  5C3I C;  4X23 C;  1A7W A;  5BNX B;  3NQJ B;  2JE5 A;  1P3O B;  1P3F D;  4LD9 D;  5B0Z D;  3W97 A;  3C1B B;  3MGQ A;  5GT3 C;  5CPK D;  3LEL D;  3AZI B;  4QLC D;  1EQZ A;  5B2I C;  4JJN D;  1AOI B;  3MGS C;  4ZUX A;  5AV9 C;  1ULY A;  5GXQ A;  1F66 B;  1B67 A;  1P3F C;  4NE5 A;  1P34 A;  5AV5 C;  4R8P C;  5CP6 A;  5JRG C;  1P3B B;  2PYO C;  2NQB B;  2ZM5 A;  3W99 A;  2LY8 A;  4KHA A;  2Y2M A;  1KX4 A;  3KUY C;  4KUD A;  5B33 A;  1P3A A;  1TZY A;  4UUZ B;  4J8U D;  2Y2G A;  1HQ3 C;  1HTA A;  5DNM D;  1P3I A;  2IO5 B;  4CSR A;  4Z5T A;  3UTA D;  1TAF A;  5B2J D;  3EPK A;  4AWL C;  2NZD D;  5E5A B;  3EPJ A;  3REI D;  3UT9 D;  3LZ1 C;  3X1V D;  4J8V B;  3MGQ B;  5AV6 A;  1M19 C;  3B0C T;  4Z66 C;  2CV5 C;  3X1T D;  4ZUX B;  1ID3 D;  5B2J C;  5AVC D;  3MGP B;  3AYW B;  3R45 A;  1P3P D;  5AY8 D;  4G92 B;  3AZL C;  1P3K C;  1M18 D;  2YFW B;  3VH5 A;  2FFF B;  2L5A A;  1BH9 B;  5JA4 B;  4XZQ A;  5GT0 B;  3UTB A;  2F8N G;  3AZM C;  3REK C;  3W98 A;  2JCH A;  3AV1 B;  1U35 B;  1KX4 B;  2BYM B;  5B0Y C;  5B24 D;  2G5I C;  1TZY B;  3W97 D;  3IP4 C;  1P3G D;  4H9P A;  4Z5T B;  1EQZ D;  5AVB B;  5GXQ D;  5B40 B;  3C1C A;  4KGC C;  1KX3 A;  4J8W A;  1P34 D;  3AZF C;  3REL A;  1P3G C;  5BNV B;  5BT1 D;  1H3O A;  3TU4 C;  2FJ7 B;  1T3U A;  3AFA B;  5B32 B;  3REJ B;  4WNN A;  2BYK A;  3LZ0 A;  1P3A D;  5DNN A;  3O62 B;  1P3I D;  3AZK B;  4H9S A;  4HGA B;  3AZE C;  3AV2 B;  4WU9 C;  1U35 C;  1KU5 A;  5CPJ A;  5B31 A;  4YS3 C;  5F99 A;  3X1S B;  2ZY3 A;  3MGR A;  4NFT A;  4H9R A;  5AV6 D;  5BS7 A;  3NQU B;  5CHL B;  1B6W A;  3KWQ A;  2G5H C;  2ARO B;  1KX3 B;  3A6N D;  3F6T A;  4ZBJ B;  3REH C;  3UTB D;  1Q9C A;  3AZJ B;  5BNX A;  3VH6 W;  3NQJ A;  3MGS A;  1P3L B;  1P3O A;  3A1I A;  3A6N C;  3C1B A;  3W96 C;  2BYK B;  3AZI A;  4J8X C;  3WTP B;  1AOI A;  1F66 A;  2PYO A;  3LJA C;  1P3M B;  4NE3 A;  3WAA B;  2ZY5 A;  4XUJ B;  1KX5 D;  3B6G C;  1ZLA C;  1F1E A;  2BG1 A;  5GSU C;  4H9R B;  5C3I B;  4WU8 C;  3REL D;  1P3B A;  2NQB A;  3AN2 D;  3WA9 A;  1KX5 C;  3B6F D;  3WKJ C;  3MVD C;  2RVQ D;  5G49 B;  3AZG C;  3AZN A;  4UUZ A;  4DQY B;  5GT3 B;  5B1L C;  5CPI C;  3AN2 C;  4H9Q B;  5DNN D;  1W2E A;  3B6F C;  5B2I B;  3KXB A;  2F8N K;  3MGS B;  5AV9 B;  3V9R B;  2UWX A;  5E5A A;  1P3F B;  5CPJ D;  1M1A C;  5B31 D;  4J8V A;  2Y2I A;  5F99 D;  2F8N D;  3MGR D;  5AV5 B;  4R8P B;  3KFU G;  4WJ3 C;  5JRG B;  2PYO B;  2F2A C;  3MGP A;  3AYW A;  3AZM A;  4LD9 C;  5B0Z C;  5CPK C;  3KUY B;  2YFW A;  5JA4 A;  4QLC C;  3LEL C;  1BH9 A;  5B1M A;  4JJN C;  3KSY A;  5GT0 A;  4YM6 D;  1HQ3 B;  2Y2L A;  3WA9 B;  3AV1 A;  1U35 A;  2BYM A;  2HIO D;  4AWL B;  1P3O D;  3AZN B;  3VH5 W;  3LZ1 B;  4YM6 C;  4Z2M G;  2HUE C;  1M19 B;  3AZI D;  4Z66 B;  3KXB B;  2CV5 B;  5AVB A;  1F66 D;  2HIO C;  5B2J B;  3X1U A;  5B40 A;  1S32 D;  4J8U C;  3AZL B;  1P3K B;  5DNM C;  2ZY4 A;  3UTA C;  3MNN D;  1P3B D;  2NZD C;  2NQB D;  5BNV A;  3AZE A;  5AV8 D;  3REI C;  3X1V C;  3REK B;  3UT9 C;  3AZM B;  1S32 C;  2FJ7 A;  2XD1 A;  3AFA A;  5B32 A;  5B0Y B;  3REJ A;  3AZH D;  5B1M B;  3MNN C;  3X1T C;  5B31 G;  3O62 A;  1ID3 C;  5AVC C;  3AZK A;  5AV8 C;  3AV2 A;  3P5J B;  5AY8 C;  1P3P C;  1M18 C;  3AZH C;  3X1S A;  5E5A D;  4KGC B;  4J8V D;  3A1K A;  3MGQ D;  3AZF B;  5KDM B;  3NQU A;  1P3G B;  4G91 C;  4ZUX D;  3X1U B;  3MGP D;  5B24 C;  3TU4 B;  3W97 C;  2Y2K A;  2ARO A;  4E45 A;  5CP6 D;  1EQZ C;  4J8X A;  4ZUX C;  5GXQ C;  3AZJ A;  3AZE B;  3W99 D;  1P3L A;  4WU9 B;  4E44 A;  1U35 D;  4YS3 B;  1P34 C;  1KX4 D;  4KUD D;  5CP6 C;  5B33 D;  1TZY D;  5GSU A;  3WTP A;  3W99 C;  5BT1 C;  1P3M A;  2VQR A;  4Z5T D;  3WAA A;  2CWE A;  1PZR A;  5FUG B;  4XUJ A;  5AVB D;  1KX4 C;  4KUD C;  3H0R C;  3B0D C;  5B40 D;  5B33 C;  1P3A C;  1P3I C;  4X23 A;  4EO5 C;  3REH B;  3VH6 T;  4DRA A;  5G49 A;  5AV6 C;  2FJ7 D;  3AFA D;  5B32 D;  3REJ D;  3W96 B;  2Y2H A;  5GT3 A;  2YFV B;  4H9Q A;  1WWI A;  4XZQ D;  4J8X B;  5B2I A;  4WZS B;  5AV9 A;  4H9O B;  3LJA B;  3AV2 D;  3V9R A;  3W98 D;  4CAY B;  1P3F A;  3X1S D;  3B6G B;  1ZLA B;  4XZQ C;  5AV5 A;  3UTB C;  4R8P A;  5GSU B;  4WU8 B;  2DQN C;  5JRG A;  2W8S A;  3W98 C;  1KX5 B;  3C1C D;  3WKJ B;  3MVD B;  3KUY A;  3AZG B;  2ARO D;  1KX3 D;  4UPK A;  2J8P A;  4J8W D;  3EPH A;  4X23 B;  1HQ3 A;  5B1L B;  5CPI B;  3AN2 B;  2DF4 C;  3AZJ D;  1Z2C B;  3B6F B;  3C1C C;  1P3L D;  4H9N B;  2Y2J A;  1M1A B;  3LZ1 A;  4J8W C;  3REL C;  3LZ0 D;  1M19 A;  4Z66 A;  2CV5 A;  5B2J A;  2RVQ C;  3WAA D;  4LD9 B;  3UT9 A;  3X1V A;  5B0Z B;  3AZL A;  1P3K A;  4M6B A;  2F8N B;  5CPK B;  3LZ0 C;  3LEL B;  4QLC B;  5DNN C;  4JJN B;  2RIQ A;  5B32 G;  3WTP E;  5CPJ C;  3REK A;  5B31 C;  3EPL A;  5AY8 A;  5F99 C;  3KWQ D;  1WWS A;  5B0Y A;  3MGR C;  3VH5 T;  5BS7 C;  4YM6 B;  5GT3 D;  2JSS A;  2HUE B;  5B2I D;  3MGS D;  5AV9 D;  3KWQ C;  2HIO B;  4KGC A;  5B24 A;  3C1B D;  4J8U B;  4WV4 B;  5DNM B;  3AL0 C;  3AZF A;  5KDM A;  5AV5 D;  1P3G A;  4R8P D;  3UTA B;  1AOI D;  5JRG D;  1JFI B;  2PYO D;  2NZD B;  1P3O C;  2Y2Q A;  3REI B;  1S32 B;  2XD5 A;  3UT9 B;  3X1V B;  1BFM A;  3C1B C;  3TU4 A;  3KUY D;  3AZI C;  3H0M C;  1N1J B;  3MNN B;  3X1T B;  1AOI C;  1F66 C;  1ID3 B;  1HQ3 D;  5BO0 B;  5AVC B;  5AV8 B;  3WA9 D;  4WU9 A;  1P3P B;  5AY8 B;  4YS3 A;  1M18 B;  3EG5 B;  3AZH B;  3AZN D;  3LZ1 D;  1P3B C;  2NQB C;  4Z2M H;  1M19 D;  3WA9 C;  4Z66 D;  3KXB D;  2CV5 D;  5FUG A;  4G91 B;  3AZN C;  5B24 B;  3W97 B;  3AZL D;  1P3K D;  2Y2O A;  2IO5 C;  2Y2N A;  3KXB C;  3REH A;  1EQZ B;  3B0B A;  5GXQ B;  5E5A C;  3AZM D;  3REK D;  3AYW D;  4J8V C;  3MGQ C;  3A6N A;  1P34 B;  5B0Y D;  3W96 A;  3B0C W;  2YFV A;  5CP6 B;  5B1M D;  5GT0 D;  3MGP C;  4H9O A;  3LJA A;  3AYW C;  3W99 B;  3AV1 D;  4CAY A;  2F8N H;  4G92 C;  4KHA B;  4KUD B;  3B6G A;  3B0D B;  4KGC D;  1ZLA A;  5B33 B;  5B1M C;  4DRB A;  5GT0 C;  1P3A B;  1P3I B;  4WU8 A;  3AZF D;  4CSR B;  4NE6 A;  3AV1 C;  3FDD A;  4EO5 B; 
#chains in the Genus database with same CATH homology
 1KX5 A;  1TAF B;  3X1U D;  1BH8 A;  3WKJ A;  3MVD A;  1TZY C;  3TU4 D;  3AZG A;  5AV6 B;  1R4V A;  5B1L A;  5CPI A;  3AN2 A;  4Z5T C;  5AVB C;  3B6F A;  3X1U C;  5B40 C;  3AZE D;  4WU9 D;  3R45 B;  4H9N A;  1M1A A;  4YS3 D;  3A6N B;  4XZQ B;  3UTB B;  3O62 D;  3AZK D;  3W98 B;  4LD9 A;  2FJ7 C;  5B0Z A;  5B32 C;  3AFA C;  3REJ C;  2F8N A;  5CPK A;  3LEL A;  4QLC A;  3O62 C;  4JJN A;  3AZK C;  4HGA C;  3AV2 C;  4H9P B;  3REH D;  3X1S C;  1BH8 B;  3H0L C;  3C1C B;  4J8W B;  4YM6 A;  3REL B;  3W96 D;  4J8X D;  3LJA D;  2HIO A;  1H3O B;  2ARO C;  1KX3 C;  4ZBJ C;  4J8U A;  3B6G D;  4WNN B;  5DNM A;  3LZ0 B;  1ZLA D;  5DNN B;  5GSU D;  3AZJ C;  3UTA A;  4WU8 D;  3WTP D;  1JFI A;  1P3L C;  1P3M D;  2NZD A;  3REI A;  5CPJ B;  5B31 B;  4XUJ D;  1S32 A;  5F99 B;  2ZY2 A;  3WKJ D;  3MVD D;  3MGR B;  3AZG D;  1N1J A;  4H9S C;  3WTP C;  3MNN A;  4X23 D;  3X1T A;  1ID3 A;  5BO0 A;  5B1L D;  5AVC A;  5CPI D;  1P3M C;  3WAA C;  3VH6 A;  5AV8 A;  4XUJ C;  1P3P A;  3KWQ B;  3AZH A;  1M18 A;  2Y2P A;  1M1A D;  5C3I C;  4X23 C;  1A7W A;  5BNX B;  3NQJ B;  2JE5 A;  1P3O B;  1P3F D;  4LD9 D;  5B0Z D;  3W97 A;  3C1B B;  3MGQ A;  5GT3 C;  5CPK D;  3LEL D;  3AZI B;  4QLC D;  1EQZ A;  5B2I C;  4JJN D;  1AOI B;  3MGS C;  4ZUX A;  5AV9 C;  1ULY A;  5GXQ A;  1F66 B;  1B67 A;  1P3F C;  4NE5 A;  1P34 A;  5AV5 C;  4R8P C;  5CP6 A;  5JRG C;  1P3B B;  2PYO C;  2NQB B;  2ZM5 A;  3W99 A;  2LY8 A;  4KHA A;  2Y2M A;  1KX4 A;  3KUY C;  4KUD A;  5B33 A;  1P3A A;  1TZY A;  4UUZ B;  4J8U D;  2Y2G A;  1HQ3 C;  1HTA A;  5DNM D;  1P3I A;  2IO5 B;  4CSR A;  4Z5T A;  3UTA D;  1TAF A;  5B2J D;  3EPK A;  4AWL C;  2NZD D;  5E5A B;  3EPJ A;  3REI D;  3UT9 D;  3LZ1 C;  3X1V D;  4J8V B;  3MGQ B;  5AV6 A;  1M19 C;  3B0C T;  4Z66 C;  2CV5 C;  3X1T D;  4ZUX B;  1ID3 D;  5B2J C;  5AVC D;  3MGP B;  3AYW B;  3R45 A;  1P3P D;  5AY8 D;  4G92 B;  3AZL C;  1P3K C;  1M18 D;  2YFW B;  3VH5 A;  2FFF B;  2L5A A;  1BH9 B;  5JA4 B;  4XZQ A;  5GT0 B;  3UTB A;  2F8N G;  3AZM C;  3REK C;  3W98 A;  2JCH A;  3AV1 B;  1U35 B;  1KX4 B;  2BYM B;  5B0Y C;  5B24 D;  2G5I C;  1TZY B;  3W97 D;  3IP4 C;  1P3G D;  4H9P A;  4Z5T B;  1EQZ D;  5AVB B;  5GXQ D;  5B40 B;  3C1C A;  4KGC C;  1KX3 A;  4J8W A;  1P34 D;  3AZF C;  3REL A;  1P3G C;  5BNV B;  5BT1 D;  1H3O A;  3TU4 C;  2FJ7 B;  1T3U A;  3AFA B;  5B32 B;  3REJ B;  4WNN A;  2BYK A;  3LZ0 A;  1P3A D;  5DNN A;  3O62 B;  1P3I D;  3AZK B;  4H9S A;  4HGA B;  3AZE C;  3AV2 B;  4WU9 C;  1U35 C;  1KU5 A;  5CPJ A;  5B31 A;  4YS3 C;  5F99 A;  3X1S B;  2ZY3 A;  3MGR A;  4NFT A;  4H9R A;  5AV6 D;  5BS7 A;  3NQU B;  5CHL B;  1B6W A;  3KWQ A;  2G5H C;  2ARO B;  1KX3 B;  3A6N D;  3F6T A;  4ZBJ B;  3REH C;  3UTB D;  1Q9C A;  3AZJ B;  5BNX A;  3VH6 W;  3NQJ A;  3MGS A;  1P3L B;  1P3O A;  3A1I A;  3A6N C;  3C1B A;  3W96 C;  2BYK B;  3AZI A;  4J8X C;  3WTP B;  1AOI A;  1F66 A;  2PYO A;  3LJA C;  1P3M B;  4NE3 A;  3WAA B;  2ZY5 A;  4XUJ B;  1KX5 D;  3B6G C;  1ZLA C;  1F1E A;  2BG1 A;  5GSU C;  4H9R B;  5C3I B;  4WU8 C;  3REL D;  1P3B A;  2NQB A;  3AN2 D;  3WA9 A;  1KX5 C;  3B6F D;  3WKJ C;  3MVD C;  2RVQ D;  5G49 B;  3AZG C;  3AZN A;  4UUZ A;  4DQY B;  5GT3 B;  5B1L C;  5CPI C;  3AN2 C;  4H9Q B;  5DNN D;  1W2E A;  3B6F C;  5B2I B;  3KXB A;  2F8N K;  3MGS B;  5AV9 B;  3V9R B;  2UWX A;  5E5A A;  1P3F B;  5CPJ D;  1M1A C;  5B31 D;  4J8V A;  2Y2I A;  5F99 D;  2F8N D;  3MGR D;  5AV5 B;  4R8P B;  3KFU G;  4WJ3 C;  5JRG B;  2PYO B;  2F2A C;  3MGP A;  3AYW A;  3AZM A;  4LD9 C;  5B0Z C;  5CPK C;  3KUY B;  2YFW A;  5JA4 A;  4QLC C;  3LEL C;  1BH9 A;  5B1M A;  4JJN C;  3KSY A;  5GT0 A;  4YM6 D;  1HQ3 B;  2Y2L A;  3WA9 B;  3AV1 A;  1U35 A;  2BYM A;  2HIO D;  4AWL B;  1P3O D;  3AZN B;  3VH5 W;  3LZ1 B;  4YM6 C;  4Z2M G;  2HUE C;  1M19 B;  3AZI D;  4Z66 B;  3KXB B;  2CV5 B;  5AVB A;  1F66 D;  2HIO C;  5B2J B;  3X1U A;  5B40 A;  1S32 D;  4J8U C;  3AZL B;  1P3K B;  5DNM C;  2ZY4 A;  3UTA C;  3MNN D;  1P3B D;  2NZD C;  2NQB D;  5BNV A;  3AZE A;  5AV8 D;  3REI C;  3X1V C;  3REK B;  3UT9 C;  3AZM B;  1S32 C;  2FJ7 A;  2XD1 A;  3AFA A;  5B32 A;  5B0Y B;  3REJ A;  3AZH D;  5B1M B;  3MNN C;  3X1T C;  5B31 G;  3O62 A;  1ID3 C;  5AVC C;  3AZK A;  5AV8 C;  3AV2 A;  3P5J B;  5AY8 C;  1P3P C;  1M18 C;  3AZH C;  3X1S A;  5E5A D;  4KGC B;  4J8V D;  3A1K A;  3MGQ D;  3AZF B;  5KDM B;  3NQU A;  1P3G B;  4G91 C;  4ZUX D;  3X1U B;  3MGP D;  5B24 C;  3TU4 B;  3W97 C;  2Y2K A;  2ARO A;  4E45 A;  5CP6 D;  1EQZ C;  4J8X A;  4ZUX C;  5GXQ C;  3AZJ A;  3AZE B;  3W99 D;  1P3L A;  4WU9 B;  4E44 A;  1U35 D;  4YS3 B;  1P34 C;  1KX4 D;  4KUD D;  5CP6 C;  5B33 D;  1TZY D;  5GSU A;  3WTP A;  3W99 C;  5BT1 C;  1P3M A;  2VQR A;  4Z5T D;  3WAA A;  2CWE A;  1PZR A;  5FUG B;  4XUJ A;  5AVB D;  1KX4 C;  4KUD C;  3H0R C;  3B0D C;  5B40 D;  5B33 C;  1P3A C;  1P3I C;  4X23 A;  4EO5 C;  3REH B;  3VH6 T;  4DRA A;  5G49 A;  5AV6 C;  2FJ7 D;  3AFA D;  5B32 D;  3REJ D;  3W96 B;  2Y2H A;  5GT3 A;  2YFV B;  4H9Q A;  1WWI A;  4XZQ D;  4J8X B;  5B2I A;  4WZS B;  5AV9 A;  4H9O B;  3LJA B;  3AV2 D;  3V9R A;  3W98 D;  4CAY B;  1P3F A;  3X1S D;  3B6G B;  1ZLA B;  4XZQ C;  5AV5 A;  3UTB C;  4R8P A;  5GSU B;  4WU8 B;  2DQN C;  5JRG A;  2W8S A;  3W98 C;  1KX5 B;  3C1C D;  3WKJ B;  3MVD B;  3KUY A;  3AZG B;  2ARO D;  1KX3 D;  4UPK A;  2J8P A;  4J8W D;  3EPH A;  4X23 B;  1HQ3 A;  5B1L B;  5CPI B;  3AN2 B;  2DF4 C;  3AZJ D;  1Z2C B;  3B6F B;  3C1C C;  1P3L D;  4H9N B;  2Y2J A;  1M1A B;  3LZ1 A;  4J8W C;  3REL C;  3LZ0 D;  1M19 A;  4Z66 A;  2CV5 A;  5B2J A;  2RVQ C;  3WAA D;  4LD9 B;  3UT9 A;  3X1V A;  5B0Z B;  3AZL A;  1P3K A;  4M6B A;  2F8N B;  5CPK B;  3LZ0 C;  3LEL B;  4QLC B;  5DNN C;  4JJN B;  2RIQ A;  5B32 G;  3WTP E;  5CPJ C;  3REK A;  5B31 C;  3EPL A;  5AY8 A;  5F99 C;  3KWQ D;  1WWS A;  5B0Y A;  3MGR C;  3VH5 T;  5BS7 C;  4YM6 B;  5GT3 D;  2JSS A;  2HUE B;  5B2I D;  3MGS D;  5AV9 D;  3KWQ C;  2HIO B;  4KGC A;  5B24 A;  3C1B D;  4J8U B;  4WV4 B;  5DNM B;  3AL0 C;  3AZF A;  5KDM A;  5AV5 D;  1P3G A;  4R8P D;  3UTA B;  1AOI D;  5JRG D;  1JFI B;  2PYO D;  2NZD B;  1P3O C;  2Y2Q A;  3REI B;  1S32 B;  2XD5 A;  3UT9 B;  3X1V B;  1BFM A;  3C1B C;  3TU4 A;  3KUY D;  3AZI C;  3H0M C;  1N1J B;  3MNN B;  3X1T B;  1AOI C;  1F66 C;  1ID3 B;  1HQ3 D;  5BO0 B;  5AVC B;  5AV8 B;  3WA9 D;  4WU9 A;  1P3P B;  5AY8 B;  4YS3 A;  1M18 B;  3EG5 B;  3AZH B;  3AZN D;  3LZ1 D;  1P3B C;  2NQB C;  4Z2M H;  1M19 D;  3WA9 C;  4Z66 D;  3KXB D;  2CV5 D;  5FUG A;  4G91 B;  3AZN C;  5B24 B;  3W97 B;  3AZL D;  1P3K D;  2Y2O A;  2IO5 C;  2Y2N A;  3KXB C;  3REH A;  1EQZ B;  3B0B A;  5GXQ B;  5E5A C;  3AZM D;  3REK D;  3AYW D;  4J8V C;  3MGQ C;  3A6N A;  1P34 B;  5B0Y D;  3W96 A;  3B0C W;  2YFV A;  5CP6 B;  5B1M D;  5GT0 D;  3MGP C;  4H9O A;  3LJA A;  3AYW C;  3W99 B;  3AV1 D;  4CAY A;  2F8N H;  4G92 C;  4KHA B;  4KUD B;  3B6G A;  3B0D B;  4KGC D;  1ZLA A;  5B33 B;  5B1M C;  4DRB A;  5GT0 C;  1P3A B;  1P3I B;  4WU8 A;  3AZF D;  4CSR B;  4NE6 A;  3AV1 C;  3FDD A;  4EO5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...