5AV6A

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6A00
4CAYA 3TU4B 3B0DC 1P3OD 4EO5B 5AV9C 5AY8C 4YM6C 4YM6D 5DNNA 1P34A 3W96A 2IO5B 5B1LB 4Z66B 2HIOB 1TZYB 3X1UD 4HGAB 3KXBC 5AVCA 5B32G 3KXBD 1U35B 1P3KB 3LELA 5AV8A 1M19B 3O62A 4H9NA 3W97B 3LZ1A 5DNNC 1P34C 1P3OB 1B6WA 5DNND 3B0DB 5JA4A 3W96D 2YFVA 3X1VC 4YM6B 5AVCC 5B24A 3AZFD 5AVCD 3WA9D 3X1UB 3LELC 3KXBB 4J8UC 5AV8D 5FUGA 3O62D 3LZ1C 4CAYB 1P3FA 5B2JA 1TAFA 3AZMA 4R8PA 5DNNB 1P34B 3W96B 5B24D 5B32A 1P3LA 5AVCB 1KX3A 4G91B 1P3FC 1HTAA 3VH6A 3LELB 1P3FD 5AV8B 5B2JD 3O62B 4H9NB 3AZND 3AV1A 4YS3A 5AV5A 3AZMD 5BS7A 1EQZC 3B0CT 3LZ1B 4R8PD 3AYWC 4ZBJC 3KWQA 5JA4B 2YFVB 1P3IA 5B32D 5B24B 1P3LD 3AZLD 1P3BA 3AZEA 1KX3D 4KGCA 3B6FC 2F8NK 3AV1C 5FUGB 5BS7C 4YS3D 5AV5D 1P3FB 1F1EA 5B2JB 4Z2MG 1TAFB 3VH6T 5B1MA 3KWQC 2HUEC 3AZMB 4JJNA 5CPJC 4R8PB 1P3ID 2NQBC 3RELC 5B33A 5CPKC 3KSYA 4ZBJB 2AROC 1P3BC 4WNNA 3REJA 1P3BD 4AWLC 3AZED 4KGCD 5B32B 1P3LB 1KX5C 4XZQA 1HQ3A 1KX3B 5CHLB 3AZHD 5AVBC 4WU8A 4UUZB 5B1MC 3B6FB 3AV1B 3LJAC 4YS3B 5B0ZA 5AV5B 4DRAA 2RVQD 3MVDD 4JJND 4G92B 2FJ7A 3KWQB 5B33D 2HUEB 3REJD 3MGPC 1P3IB 4E45A 5BNVA 3W99A 4E44A 4XZQD 1P3BB 1HQ3D 3AZEB 4AWLB 4KGCB 4WU8D 1AOIA 5C3IB 5B0ZD 5JRGA 5AV9A 5AY8A 4Z66D 5B1MB 2FJ7D 3UT9C 4JJNB 1ZLAC 5B31C 3MNNC 3W99D 5B33B 4WNNB 3REJB 5B0YC 1KU5A 2PYOA 3AZIC 2F8NG 1AOID 4XZQB 2CV5A 1HQ3B 2NZDC 3MGQC 3WKJA 4WU8B 5JRGC 5JRGD 5AV9D 5AY8D 5KDMA 3AN2C 5B0ZB 3KUYA 3MGRC 3X1VA 2FJ7B 2YFWA 5GXQC 2PYOC 1H3OB 5BNVB 3W99B 2CV5C 2PYOD 3MNNB 3WKJC 2CV5D 4NFTA 4J8UA 1AOIB 3AZIB 3C1CC 1P34D 4DRBA 3KUYC 4KHAA 5JRGB 5AV9B 3REKC 3KUYD 5AY8B 3X1VD 4J8VC 3A6NA 5DNMC 3W98A 3LELD 2F8NA 4J8UD 2PYOB 4NE5A 2CV5B 4X23C 3LZ1D 3WKJB 2BYKA 4H9OA 5KDMB 1EQZA 3A6NC 3AYWA 3A6ND 3KUYB 3X1VB 1P3GA 3W98C 4M6BA 2YFWB 5F99A 2F8ND 4UUZA 5G49A 4Z2MH 3B6FA 4J8UB 4WZSB 5GSUC 5GT0A 4J8XC 4QLCC 4X23B 1EQZD 3AYWD 1R4VA 1WWIA 4WU9A 4KHAB 3NQUA 5CPJA 1P3GC 4WV4B 4Z5TA 2NQBA 3RELA 5B31G 5F99C 3A6NB 3B0BA 5CPKA 1M1AA 2AROA 5F99D 3X1SC 3W98B 1KX5A 3B6FD 2F8NB 5GT0C 3AV1D 5AVBA 5E5AC 2BYKB 4H9OB 1P3PA 3MGSA 4WU9C 4NE6A 3KWQD 3LJAA 4WU9D 4H9SA 4J8XB 4QLCB 5CPJD 4Z5TC 1EQZB 3AYWB 4Z5TD 2NQBD 1F66A 3RELD 1M1AC 5AV6C 5CPKD 5BT1C 1M1AD 2AROD 3MGPA 1P3GB 3REIC 5F99B 1KX5D 3VH5W 2JSSA 3AV2C 5AVBD 3B6GA 5G49B 3VH5A 1P3PC 3MGSC 5B1MD 3AZKC 3MGSD 4H9SC 1JFIA 5GT0B 3LJAD 3C1BC 4J8WC 1F66C 1S32C 4WU9B 1F66D 1ULYA 3UT9A 3NQUB 4NE3A 5CPJB 1P3AC 1ZLAA 1H3OA 3MGPD 4Z5TB 5B31A 2NQBB 3RELB 3MNNA 5CPKB 1M1AB 2AROB 3AFAC 5B0YA 1BH8B 3B6GC 3AZGA 3AZIA 1KX4A 4ZUXC 3B6GD 1KX5B 2NZDA 3MGQA 5AVBB 3AV2B 3X1TC 4H9RA 5B2IA 5CP6C 1P3PB 3MGSB 3AN2A 3NQJA 3LJAB 2L5AA 3UT9D 1ZLAD 3MGRA 2LY8A 5B31D 3UTAC 1F66B 3MNND 4XUJA 5GXQA 5B40C 3MGPB 1M18A 5B0YD 3TU4C 3AZGC 1KX4C 3AZGD 3AZID 1KX4D 4EO5C 2NZDD 3MGQD 3B6GB 5B2IC 1P3MA 1JFIB 2IO5C 5B1LC 3C1CA 3AN2D 2HIOC 1TZYC 4HGAC 3REKA 3MGRD 4XUJC 4J8VA 3UT9B 1M18C 4XUJD 5GXQD 1ZLAB 1WWSA 1M18D 5B31B 3WTPA 5DNMA 4KUDC 4H9QA 1M19C 3W97C 3WKJD 5B0YB 3UTBA 1P3MC 3AZGB 1P3OC 5GT3A 1KX4B 1P3MD 4X23A 2NZDB 3MGQB 1BFMA 3C1CD 4H9RB 5B2IB 3REKD 4CSRB 3AN2B 3NQJB 3REHA 4J8VD 3X1UC 3MGRB 3WTPC 3AZFA 3WTPD 5DNMD 4XUJB 5GXQB 3WA9A 3UTBC 1M18B 5GT3C 3UTBD 4H9PA 3WAAA 5GT3D 4KUDB 3AZJA 4X23D 1P3MB 5GSUA 3LZ0A 4J8XA 4QLCA 3V9RA 3W96C 3WTPE 3REHC 3C1CB 3REHD 3REKB 3AZFC 1N1JB 3W98D 4G91C 3WA9C 4J8VB 1ID3A 3WAAC 3WTPB 3B0CW 3X1SA 5AV8C 5DNMB 3WAAD 4H9QB 3O62C 3AZJC 3AZJD 3UTBB 3LZ0C 5GT3B 5GSUD 5E5AA 3LZ0D 4J8XD 4QLCD 3AZNA 2BYMA 1BH9A 5B24C 1P3GD 1ID3C 3REHB 5AV6A 1ID3D 3R45A 1BH8A 3AZFB 3AZLA 3X1SD 3VH6W 3REIA 3WA9B 5B2JC 4H9PB 5GT0D 3AV2A 3WAAB 3AZNC 5E5AD 3AZMC 3AZJB 5CPIA 4R8PC 3AZKA 4LD9A 5GSUB 3LZ0B 1A7WA 3V9RB 3C1BA 4J8WA 1S32A 5AV6D 5B32C 1P3LC 5BT1D 3AZLC 1P3AA 1KX3C 1ID3B 3REID 3AFAA 1Q9CA 3X1SB 3AV2D 5CPIC 3AZHA 4YS3C 4ZUXA 5AV5C 5CPID 4LD9C 1P3PD 4G92C 3AZKD 4LD9D 5BO0A 5E5AB 3X1TA 1B67A 3C1BD 3AZNB 2BYMB 5BNXA 5CP6A 4J8WD 1P3IC 3MVDA 1BH9B 1S32D 1P3AD 2F8NH 3AZEC 3UTAA 4KGCC 5AV6B 3R45B 2CWEA 3AFAD 5B40A 3AZLB 5C3IC 3AZHC 3TU4A 3REIB 4ZUXD 3X1TD 5CPIB 2RVQC 3VH5T 3MVDC 4CSRA 4JJNC 3AZKB 5CP6D 4LD9B 5B1LA 4Z66A 2HIOA 3C1BB 5B33C 1TZYA 4J8WB 3REJC 1S32B 3UTAD 1U35A 1P3AB 4XZQC 1P3KA 1HQ3C 5B40D 3TU4D 4WU8C 4KUDA 1M19A 3AFAB 3W97A 3AZHB 1P3OA 5B2ID 4ZUXB 5B0ZC 4Z66C 5BO0B 5B1LD 3X1TB 2FJ7C 4YM6A 2HIOD 1N1JA 1TZYD 5BNXB 5CP6B 1U35C 3MVDB 1U35D 1P3KC 3W99C 3X1UA 1P3KD 3KXBA 3UTAB 1AOIC 4KUDD 1M19D 3W97D 5B40B
chains in the Genus database with same CATH superfamily
4CAYA 3TU4B 3EPKA 3B0DC 1P3OD 4EO5B 5AV9C 5AY8C 4YM6C 4YM6D 5DNNA 1P34A 3W96A 3EPJA 2IO5B 1Z2CB 5B1LB 4Z66B 2HIOB 1TZYB 3X1UD 4HGAB 3KXBC 5AVCA 5B32G 3KXBD 1U35B 1P3KB 3LELA 5AV8A 1M19B 3O62A 4H9NA 3W97B 3LZ1A 5DNNC 2JE5A 1P34C 1P3OB 1B6WA 5DNND 3B0DB 5JA4A 3W96D 2YFVA 3X1VC 2XD1A 4YM6B 3A1IA 5AVCC 5B24A 3AZFD 5AVCD 3WA9D 3X1UB 3LELC 3KXBB 4J8UC 5AV8D 5FUGA 3O62D 3LZ1C 4CAYB 1P3FA 5B2JA 1TAFA 2W8SA 3AZMA 4R8PA 5DNNB 1P34B 3W96B 5B24D 2F2AC 3EPHA 5B32A 1P3LA 5AVCB 1KX3A 4G91B 1P3FC 1HTAA 3VH6A 3LELB 2RIQA 1P3FD 5AV8B 5B2JD 3O62B 4H9NB 3AZND 3AV1A 4YS3A 5AV5A 3AZMD 5BS7A 1EQZC 3B0CT 3LZ1B 4R8PD 3AYWC 2Y2IA 4ZBJC 2Y2JA 3KWQA 5JA4B 2YFVB 1P3IA 2Y2KA 5B32D 5B24B 1P3LD 3AZLD 1P3BA 3AZEA 1KX3D 4KGCA 2Y2HA 3B6FC 3EG5B 4UPKA 2F8NK 3AV1C 5FUGB 5BS7C 4YS3D 5AV5D 2ZM5A 1P3FB 1F1EA 5B2JB 4Z2MG 1TAFB 3VH6T 5B1MA 3KWQC 2HUEC 3AZMB 4JJNA 5CPJC 4R8PB 1P3ID 2NQBC 3RELC 5B33A 5CPKC 3KSYA 4ZBJB 2AROC 1P3BC 4WNNA 3REJA 1P3BD 4AWLC 3AZED 2Y2PA 4KGCD 5B32B 1P3LB 1KX5C 4XZQA 1HQ3A 1KX3B 5CHLB 3AZHD 5AVBC 4WU8A 4UUZB 5B1MC 3B6FB 3AV1B 3LJAC 4YS3B 5B0ZA 5AV5B 4DRAA 2DQNC 2RVQD 3MVDD 4JJND 4G92B 2FJ7A 3KWQB 5B33D 2HUEB 3REJD 3MGPC 1P3IB 4E45A 5BNVA 3W99A 4E44A 4XZQD 1P3BB 1HQ3D 1W2EA 3AZEB 4AWLB 4KGCB 4WU8D 1AOIA 3P5JB 5C3IB 5B0ZD 5JRGA 5AV9A 5AY8A 4Z66D 5B1MB 2FJ7D 3UT9C 4JJNB 1ZLAC 5B31C 3MNNC 3W99D 5B33B 4WNNB 3REJB 5B0YC 1KU5A 2PYOA 3AZIC 2F8NG 1AOID 4XZQB 2CV5A 1HQ3B 2NZDC 3MGQC 3WKJA 4WU8B 5JRGC 5JRGD 5AV9D 5AY8D 5KDMA 3AN2C 5B0ZB 2DF4C 3MGRC 3KUYA 3X1VA 2FJ7B 2Y2GA 2YFWA 5GXQC 2PYOC 1H3OB 5BNVB 3W99B 2CV5C 2PYOD 3MNNB 3WKJC 2CV5D 4DQYB 4NFTA 4J8UA 1AOIB 3AZIB 3C1CC 1P34D 4DRBA 3KUYC 4KHAA 5JRGB 5AV9B 3REKC 3KUYD 5AY8B 3X1VD 4J8VC 3A6NA 5DNMC 3W98A 3LELD 2F8NA 4J8UD 2PYOB 4NE5A 2CV5B 4X23C 3LZ1D 3WKJB 2BYKA 3EPLA 4H9OA 5KDMB 1EQZA 3A6NC 3AYWA 3A6ND 3KUYB 2Y2NA 3X1VB 1P3GA 3W98C 4M6BA 2YFWB 5F99A 3H0RC 2F8ND 4UUZA 5G49A 4Z2MH 3B6FA 4J8UB 4WZSB 5GSUC 5GT0A 4J8XC 4QLCC 4X23B 1EQZD 3AYWD 1R4VA 1WWIA 4WU9A 4KHAB 3NQUA 5CPJA 1P3GC 4WV4B 2Y2QA 4Z5TA 2NQBA 3RELA 5B31G 5F99C 3A6NB 3B0BA 5CPKA 1M1AA 2AROA 5F99D 3X1SC 3W98B 1KX5A 3B6FD 2ZY2A 2F8NB 5GT0C 3AV1D 5AVBA 5E5AC 2BYKB 4H9OB 1P3PA 3MGSA 4WU9C 4NE6A 3KWQD 3LJAA 4WU9D 4H9SA 4J8XB 4QLCB 5CPJD 4Z5TC 1EQZB 3AYWB 4Z5TD 2NQBD 1F66A 3RELD 1M1AC 5AV6C 1T3UA 5CPKD 5BT1C 1M1AD 2AROD 3MGPA 1P3GB 3REIC 5F99B 1KX5D 3VH5W 2JSSA 3AV2C 2XD5A 5AVBD 3B6GA 5G49B 3VH5A 1P3PC 3MGSC 5B1MD 3AZKC 3MGSD 4H9SC 1JFIA 5GT0B 3LJAD 3C1BC 4J8WC 1F66C 2G5IC 1S32C 4WU9B 1F66D 1ULYA 3UT9A 3NQUB 4NE3A 5CPJB 1P3AC 1ZLAA 1H3OA 3MGPD 4Z5TB 5B31A 2NQBB 3RELB 3MNNA 5CPKB 1M1AB 2AROB 3AFAC 5B0YA 1BH8B 3B6GC 3AZGA 3AZIA 1KX4A 4ZUXC 3B6GD 1KX5B 2NZDA 3MGQA 5AVBB 3AV2B 3X1TC 4H9RA 5B2IA 5CP6C 1P3PB 3MGSB 3AN2A 3NQJA 3LJAB 2L5AA 3UT9D 1ZLAD 3MGRA 2LY8A 5B31D 3UTAC 1F66B 2Y2LA 3MNND 4XUJA 5GXQA 5B40C 3MGPB 1M18A 5B0YD 3TU4C 3AZGC 1KX4C 3AZGD 3AZID 1KX4D 4EO5C 2NZDD 3MGQD 3B6GB 5B2IC 1P3MA 1JFIB 2IO5C 5B1LC 3C1CA 3AN2D 2HIOC 1TZYC 4HGAC 3REKA 3MGRD 2ZY5A 4XUJC 4J8VA 3UT9B 1M18C 4XUJD 5GXQD 1ZLAB 1WWSA 1M18D 5B31B 3WTPA 5DNMA 4KUDC 4H9QA 1M19C 3W97C 3WKJD 5B0YB 3UTBA 1P3MC 3AZGB 1P3OC 5GT3A 1KX4B 1P3MD 4X23A 2NZDB 3MGQB 1BFMA 3C1CD 4H9RB 5B2IB 3REKD 4CSRB 3AN2B 2FFFB 3NQJB 3REHA 4J8VD 3X1UC 3MGRB 3WTPC 3AZFA 3WTPD 5DNMD 4XUJB 5GXQB 3WA9A 3UTBC 1M18B 5GT3C 3UTBD 4H9PA 3WAAA 5GT3D 2VQRA 4KUDB 3AZJA 4X23D 1P3MB 5GSUA 3LZ0A 4J8XA 4QLCA 3V9RA 3W96C 3WTPE 3REHC 3C1CB 3REHD 1PZRA 3REKB 3AZFC 1N1JB 3W98D 4G91C 3WA9C 4J8VB 1ID3A 3WAAC 3WTPB 3B0CW 3X1SA 5AV8C 5DNMB 3WAAD 4H9QB 3O62C 3AZJC 2Y2OA 3AZJD 3UTBB 3LZ0C 5GT3B 5GSUD 5E5AA 3LZ0D 4J8XD 4QLCD 3AZNA 2BYMA 1BH9A 5B24C 1P3GD 1ID3C 3REHB 5AV6A 1ID3D 2ZY4A 3R45A 1BH8A 3AZFB 3AZLA 3X1SD 3VH6W 3REIA 3WA9B 5B2JC 4H9PB 5GT0D 3AV2A 3WAAB 3AZNC 5E5AD 3AZMC 3AZJB 5CPIA 4R8PC 3AZKA 4LD9A 5GSUB 3LZ0B 1A7WA 3V9RB 3C1BA 4J8WA 1S32A 5AV6D 5B32C 2JCHA 1P3LC 5BT1D 3AZLC 1P3AA 1KX3C 1ID3B 3REID 3AFAA 1Q9CA 3X1SB 3AV2D 5CPIC 3AZHA 4YS3C 4ZUXA 5AV5C 3IP4C 5CPID 4LD9C 1P3PD 4G92C 3AZKD 4LD9D 5BO0A 5E5AB 3X1TA 1B67A 3C1BD 3AZNB 2BYMB 5BNXA 5CP6A 4J8WD 1P3IC 3MVDA 1BH9B 1S32D 1P3AD 2F8NH 3AZEC 3UTAA 4WJ3C 4KGCC 5AV6B 3R45B 2CWEA 3AFAD 5B40A 3AZLB 5C3IC 3AZHC 3A1KA 3TU4A 3REIB 4ZUXD 3AL0C 3X1TD 5CPIB 2ZY3A 3H0LC 2RVQC 3VH5T 3MVDC 4CSRA 4JJNC 3AZKB 5CP6D 4LD9B 5B1LA 4Z66A 2HIOA 2BG1A 3C1BB 5B33C 1TZYA 4J8WB 3REJC 1S32B 3UTAD 1U35A 1P3AB 4XZQC 1P3KA 1HQ3C 5B40D 3TU4D 4WU8C 4KUDA 1M19A 3AFAB 3W97A 2J8PA 3AZHB 1P3OA 5B2ID 4ZUXB 3FDDA 3H0MC 5B0ZC 4Z66C 2UWXA 5BO0B 5B1LD 3X1TB 2FJ7C 4YM6A 2HIOD 1N1JA 1TZYD 2G5HC 5BNXB 5CP6B 1U35C 3MVDB 3F6TA 1U35D 1P3KC 3W99C 3X1UA 1P3KD 3KXBA 3UTAB 2Y2MA 1AOIC 4KUDD 1M19D 3W97D 5B40B 3KFUG
chains in the Genus database with same CATH topology
4CAYA 3TU4B 3EPKA 3B0DC 1P3OD 4EO5B 5AV9C 5AY8C 4YM6C 4YM6D 5DNNA 1P34A 3W96A 3EPJA 2IO5B 1Z2CB 5B1LB 4Z66B 2HIOB 1TZYB 3X1UD 4HGAB 3KXBC 5AVCA 5B32G 3KXBD 1U35B 1P3KB 3LELA 5AV8A 1M19B 3O62A 4H9NA 3W97B 3LZ1A 5DNNC 2JE5A 1P34C 1P3OB 1B6WA 5DNND 3B0DB 5JA4A 3W96D 2YFVA 3X1VC 2XD1A 4YM6B 3A1IA 5AVCC 5B24A 3AZFD 5AVCD 3WA9D 3X1UB 3LELC 3KXBB 4J8UC 5AV8D 5FUGA 3O62D 3LZ1C 4CAYB 1P3FA 5B2JA 1TAFA 2W8SA 3AZMA 4R8PA 5DNNB 1P34B 3W96B 5B24D 2F2AC 3EPHA 5B32A 1P3LA 5AVCB 1KX3A 4G91B 1P3FC 1HTAA 3VH6A 3LELB 2RIQA 1P3FD 5AV8B 5B2JD 3O62B 4H9NB 3AZND 3AV1A 4YS3A 5AV5A 3AZMD 5BS7A 1EQZC 3B0CT 3LZ1B 4R8PD 3AYWC 2Y2IA 4ZBJC 2Y2JA 3KWQA 5JA4B 2YFVB 1P3IA 2Y2KA 5B32D 5B24B 1P3LD 3AZLD 1P3BA 3AZEA 1KX3D 4KGCA 2Y2HA 3B6FC 3EG5B 4UPKA 2F8NK 3AV1C 5FUGB 5BS7C 4YS3D 5AV5D 2ZM5A 1P3FB 1F1EA 5B2JB 4Z2MG 1TAFB 3VH6T 5B1MA 3KWQC 2HUEC 3AZMB 4JJNA 5CPJC 4R8PB 1P3ID 2NQBC 3RELC 5B33A 5CPKC 3KSYA 4ZBJB 2AROC 1P3BC 4WNNA 3REJA 1P3BD 4AWLC 3AZED 2Y2PA 4KGCD 5B32B 1P3LB 1KX5C 4XZQA 1HQ3A 1KX3B 5CHLB 3AZHD 5AVBC 4WU8A 4UUZB 5B1MC 3B6FB 3AV1B 3LJAC 4YS3B 5B0ZA 5AV5B 4DRAA 2DQNC 2RVQD 3MVDD 4JJND 4G92B 2FJ7A 3KWQB 5B33D 2HUEB 3REJD 3MGPC 1P3IB 4E45A 5BNVA 3W99A 4E44A 4XZQD 1P3BB 1HQ3D 1W2EA 3AZEB 4AWLB 4KGCB 4WU8D 1AOIA 3P5JB 5C3IB 5B0ZD 5JRGA 5AV9A 5AY8A 4Z66D 5B1MB 2FJ7D 3UT9C 4JJNB 1ZLAC 5B31C 3MNNC 3W99D 5B33B 4WNNB 3REJB 5B0YC 1KU5A 2PYOA 3AZIC 2F8NG 1AOID 4XZQB 2CV5A 1HQ3B 2NZDC 3MGQC 3WKJA 4WU8B 5JRGC 5JRGD 5AV9D 5AY8D 5KDMA 3AN2C 5B0ZB 2DF4C 3MGRC 3KUYA 3X1VA 2FJ7B 2Y2GA 2YFWA 5GXQC 2PYOC 1H3OB 5BNVB 3W99B 2CV5C 2PYOD 3MNNB 3WKJC 2CV5D 4DQYB 4NFTA 4J8UA 1AOIB 3AZIB 3C1CC 1P34D 4DRBA 3KUYC 4KHAA 5JRGB 5AV9B 3REKC 3KUYD 5AY8B 3X1VD 4J8VC 3A6NA 5DNMC 3W98A 3LELD 2F8NA 4J8UD 2PYOB 4NE5A 2CV5B 4X23C 3LZ1D 3WKJB 2BYKA 3EPLA 4H9OA 5KDMB 1EQZA 3A6NC 3AYWA 3A6ND 3KUYB 2Y2NA 3X1VB 1P3GA 3W98C 4M6BA 2YFWB 5F99A 3H0RC 2F8ND 4UUZA 5G49A 4Z2MH 3B6FA 4J8UB 4WZSB 5GSUC 5GT0A 4J8XC 4QLCC 4X23B 1EQZD 3AYWD 1R4VA 1WWIA 4WU9A 4KHAB 3NQUA 5CPJA 1P3GC 4WV4B 2Y2QA 4Z5TA 2NQBA 3RELA 5B31G 5F99C 3A6NB 3B0BA 5CPKA 1M1AA 2AROA 5F99D 3X1SC 3W98B 1KX5A 3B6FD 2ZY2A 2F8NB 5GT0C 3AV1D 5AVBA 5E5AC 2BYKB 4H9OB 1P3PA 3MGSA 4WU9C 4NE6A 3KWQD 3LJAA 4WU9D 4H9SA 4J8XB 4QLCB 5CPJD 4Z5TC 1EQZB 3AYWB 4Z5TD 2NQBD 1F66A 3RELD 1M1AC 5AV6C 1T3UA 5CPKD 5BT1C 1M1AD 2AROD 3MGPA 1P3GB 3REIC 5F99B 1KX5D 3VH5W 2JSSA 3AV2C 2XD5A 5AVBD 3B6GA 5G49B 3VH5A 1P3PC 3MGSC 5B1MD 3AZKC 3MGSD 4H9SC 1JFIA 5GT0B 3LJAD 3C1BC 4J8WC 1F66C 2G5IC 1S32C 4WU9B 1F66D 1ULYA 3UT9A 3NQUB 4NE3A 5CPJB 1P3AC 1ZLAA 1H3OA 3MGPD 4Z5TB 5B31A 2NQBB 3RELB 3MNNA 5CPKB 1M1AB 2AROB 3AFAC 5B0YA 1BH8B 3B6GC 3AZGA 3AZIA 1KX4A 4ZUXC 3B6GD 1KX5B 2NZDA 3MGQA 5AVBB 3AV2B 3X1TC 4H9RA 5B2IA 5CP6C 1P3PB 3MGSB 3AN2A 3NQJA 3LJAB 2L5AA 3UT9D 1ZLAD 3MGRA 2LY8A 5B31D 3UTAC 1F66B 2Y2LA 3MNND 4XUJA 5GXQA 5B40C 3MGPB 1M18A 5B0YD 3TU4C 3AZGC 1KX4C 3AZGD 3AZID 1KX4D 4EO5C 2NZDD 3MGQD 3B6GB 5B2IC 1P3MA 1JFIB 2IO5C 5B1LC 3C1CA 3AN2D 2HIOC 1TZYC 4HGAC 3REKA 3MGRD 2ZY5A 4XUJC 4J8VA 3UT9B 1M18C 4XUJD 5GXQD 1ZLAB 1WWSA 1M18D 5B31B 3WTPA 5DNMA 4KUDC 4H9QA 1M19C 3W97C 3WKJD 5B0YB 3UTBA 1P3MC 3AZGB 1P3OC 5GT3A 1KX4B 1P3MD 4X23A 2NZDB 3MGQB 1BFMA 3C1CD 4H9RB 5B2IB 3REKD 4CSRB 3AN2B 2FFFB 3NQJB 3REHA 4J8VD 3X1UC 3MGRB 3WTPC 3AZFA 3WTPD 5DNMD 4XUJB 5GXQB 3WA9A 3UTBC 1M18B 5GT3C 3UTBD 4H9PA 3WAAA 5GT3D 2VQRA 4KUDB 3AZJA 4X23D 1P3MB 5GSUA 3LZ0A 4J8XA 4QLCA 3V9RA 3W96C 3WTPE 3REHC 3C1CB 3REHD 1PZRA 3REKB 3AZFC 1N1JB 3W98D 4G91C 3WA9C 4J8VB 1ID3A 3WAAC 3WTPB 3B0CW 3X1SA 5AV8C 5DNMB 3WAAD 4H9QB 3O62C 3AZJC 2Y2OA 3AZJD 3UTBB 3LZ0C 5GT3B 5GSUD 5E5AA 3LZ0D 4J8XD 4QLCD 3AZNA 2BYMA 1BH9A 5B24C 1P3GD 1ID3C 3REHB 5AV6A 1ID3D 2ZY4A 3R45A 1BH8A 3AZFB 3AZLA 3X1SD 3VH6W 3REIA 3WA9B 5B2JC 4H9PB 5GT0D 3AV2A 3WAAB 3AZNC 5E5AD 3AZMC 3AZJB 5CPIA 4R8PC 3AZKA 4LD9A 5GSUB 3LZ0B 1A7WA 3V9RB 3C1BA 4J8WA 1S32A 5AV6D 5B32C 2JCHA 1P3LC 5BT1D 3AZLC 1P3AA 1KX3C 1ID3B 3REID 3AFAA 1Q9CA 3X1SB 3AV2D 5CPIC 3AZHA 4YS3C 4ZUXA 5AV5C 3IP4C 5CPID 4LD9C 1P3PD 4G92C 3AZKD 4LD9D 5BO0A 5E5AB 3X1TA 1B67A 3C1BD 3AZNB 2BYMB 5BNXA 5CP6A 4J8WD 1P3IC 3MVDA 1BH9B 1S32D 1P3AD 2F8NH 3AZEC 3UTAA 4WJ3C 4KGCC 5AV6B 3R45B 2CWEA 3AFAD 5B40A 3AZLB 5C3IC 3AZHC 3A1KA 3TU4A 3REIB 4ZUXD 3AL0C 3X1TD 5CPIB 2ZY3A 3H0LC 2RVQC 3VH5T 3MVDC 4CSRA 4JJNC 3AZKB 5CP6D 4LD9B 5B1LA 4Z66A 2HIOA 2BG1A 3C1BB 5B33C 1TZYA 4J8WB 3REJC 1S32B 3UTAD 1U35A 1P3AB 4XZQC 1P3KA 1HQ3C 5B40D 3TU4D 4WU8C 4KUDA 1M19A 3AFAB 3W97A 2J8PA 3AZHB 1P3OA 5B2ID 4ZUXB 3FDDA 3H0MC 5B0ZC 4Z66C 2UWXA 5BO0B 5B1LD 3X1TB 2FJ7C 4YM6A 2HIOD 1N1JA 1TZYD 2G5HC 5BNXB 5CP6B 1U35C 3MVDB 3F6TA 1U35D 1P3KC 3W99C 3X1UA 1P3KD 3KXBA 3UTAB 2Y2MA 1AOIC 4KUDD 1M19D 3W97D 5B40B 3KFUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAY A;  3TU4 B;  3B0D C;  1P3O D;  4EO5 B;  5AV9 C;  5AY8 C;  4YM6 C;  4YM6 D;  5DNN A;  1P34 A;  3W96 A;  2IO5 B;  5B1L B;  4Z66 B;  2HIO B;  1TZY B;  3X1U D;  4HGA B;  3KXB C;  5AVC A;  5B32 G;  3KXB D;  1U35 B;  1P3K B;  3LEL A;  5AV8 A;  1M19 B;  3O62 A;  4H9N A;  3W97 B;  3LZ1 A;  5DNN C;  1P34 C;  1P3O B;  1B6W A;  5DNN D;  3B0D B;  5JA4 A;  3W96 D;  2YFV A;  3X1V C;  4YM6 B;  5AVC C;  5B24 A;  3AZF D;  5AVC D;  3WA9 D;  3X1U B;  3LEL C;  3KXB B;  4J8U C;  5AV8 D;  5FUG A;  3O62 D;  3LZ1 C;  4CAY B;  1P3F A;  5B2J A;  1TAF A;  3AZM A;  4R8P A;  5DNN B;  1P34 B;  3W96 B;  5B24 D;  5B32 A;  1P3L A;  5AVC B;  1KX3 A;  4G91 B;  1P3F C;  1HTA A;  3VH6 A;  3LEL B;  1P3F D;  5AV8 B;  5B2J D;  3O62 B;  4H9N B;  3AZN D;  3AV1 A;  4YS3 A;  5AV5 A;  3AZM D;  5BS7 A;  1EQZ C;  3B0C T;  3LZ1 B;  4R8P D;  3AYW C;  4ZBJ C;  3KWQ A;  5JA4 B;  2YFV B;  1P3I A;  5B32 D;  5B24 B;  1P3L D;  3AZL D;  1P3B A;  3AZE A;  1KX3 D;  4KGC A;  3B6F C;  2F8N K;  3AV1 C;  5FUG B;  5BS7 C;  4YS3 D;  5AV5 D;  1P3F B;  1F1E A;  5B2J B;  4Z2M G;  1TAF B;  3VH6 T;  5B1M A;  3KWQ C;  2HUE C;  3AZM B;  4JJN A;  5CPJ C;  4R8P B;  1P3I D;  2NQB C;  3REL C;  5B33 A;  5CPK C;  3KSY A;  4ZBJ B;  2ARO C;  1P3B C;  4WNN A;  3REJ A;  1P3B D;  4AWL C;  3AZE D;  4KGC D;  5B32 B;  1P3L B;  1KX5 C;  4XZQ A;  1HQ3 A;  1KX3 B;  5CHL B;  3AZH D;  5AVB C;  4WU8 A;  4UUZ B;  5B1M C;  3B6F B;  3AV1 B;  3LJA C;  4YS3 B;  5B0Z A;  5AV5 B;  4DRA A;  2RVQ D;  3MVD D;  4JJN D;  4G92 B;  2FJ7 A;  3KWQ B;  5B33 D;  2HUE B;  3REJ D;  3MGP C;  1P3I B;  4E45 A;  5BNV A;  3W99 A;  4E44 A;  4XZQ D;  1P3B B;  1HQ3 D;  3AZE B;  4AWL B;  4KGC B;  4WU8 D;  1AOI A;  5C3I B;  5B0Z D;  5JRG A;  5AV9 A;  5AY8 A;  4Z66 D;  5B1M B;  2FJ7 D;  3UT9 C;  4JJN B;  1ZLA C;  5B31 C;  3MNN C;  3W99 D;  5B33 B;  4WNN B;  3REJ B;  5B0Y C;  1KU5 A;  2PYO A;  3AZI C;  2F8N G;  1AOI D;  4XZQ B;  2CV5 A;  1HQ3 B;  2NZD C;  3MGQ C;  3WKJ A;  4WU8 B;  5JRG C;  5JRG D;  5AV9 D;  5AY8 D;  5KDM A;  3AN2 C;  5B0Z B;  3KUY A;  3MGR C;  3X1V A;  2FJ7 B;  2YFW A;  5GXQ C;  2PYO C;  1H3O B;  5BNV B;  3W99 B;  2CV5 C;  2PYO D;  3MNN B;  3WKJ C;  2CV5 D;  4NFT A;  4J8U A;  1AOI B;  3AZI B;  3C1C C;  1P34 D;  4DRB A;  3KUY C;  4KHA A;  5JRG B;  5AV9 B;  3REK C;  3KUY D;  5AY8 B;  3X1V D;  4J8V C;  3A6N A;  5DNM C;  3W98 A;  3LEL D;  2F8N A;  4J8U D;  2PYO B;  4NE5 A;  2CV5 B;  4X23 C;  3LZ1 D;  3WKJ B;  2BYK A;  4H9O A;  5KDM B;  1EQZ A;  3A6N C;  3AYW A;  3A6N D;  3KUY B;  3X1V B;  1P3G A;  3W98 C;  4M6B A;  2YFW B;  5F99 A;  2F8N D;  4UUZ A;  5G49 A;  4Z2M H;  3B6F A;  4J8U B;  4WZS B;  5GSU C;  5GT0 A;  4J8X C;  4QLC C;  4X23 B;  1EQZ D;  3AYW D;  1R4V A;  1WWI A;  4WU9 A;  4KHA B;  3NQU A;  5CPJ A;  1P3G C;  4WV4 B;  4Z5T A;  2NQB A;  3REL A;  5B31 G;  5F99 C;  3A6N B;  3B0B A;  5CPK A;  1M1A A;  2ARO A;  5F99 D;  3X1S C;  3W98 B;  1KX5 A;  3B6F D;  2F8N B;  5GT0 C;  3AV1 D;  5AVB A;  5E5A C;  2BYK B;  4H9O B;  1P3P A;  3MGS A;  4WU9 C;  4NE6 A;  3KWQ D;  3LJA A;  4WU9 D;  4H9S A;  4J8X B;  4QLC B;  5CPJ D;  4Z5T C;  1EQZ B;  3AYW B;  4Z5T D;  2NQB D;  1F66 A;  3REL D;  1M1A C;  5AV6 C;  5CPK D;  5BT1 C;  1M1A D;  2ARO D;  3MGP A;  1P3G B;  3REI C;  5F99 B;  1KX5 D;  3VH5 W;  2JSS A;  3AV2 C;  5AVB D;  3B6G A;  5G49 B;  3VH5 A;  1P3P C;  3MGS C;  5B1M D;  3AZK C;  3MGS D;  4H9S C;  1JFI A;  5GT0 B;  3LJA D;  3C1B C;  4J8W C;  1F66 C;  1S32 C;  4WU9 B;  1F66 D;  1ULY A;  3UT9 A;  3NQU B;  4NE3 A;  5CPJ B;  1P3A C;  1ZLA A;  1H3O A;  3MGP D;  4Z5T B;  5B31 A;  2NQB B;  3REL B;  3MNN A;  5CPK B;  1M1A B;  2ARO B;  3AFA C;  5B0Y A;  1BH8 B;  3B6G C;  3AZG A;  3AZI A;  1KX4 A;  4ZUX C;  3B6G D;  1KX5 B;  2NZD A;  3MGQ A;  5AVB B;  3AV2 B;  3X1T C;  4H9R A;  5B2I A;  5CP6 C;  1P3P B;  3MGS B;  3AN2 A;  3NQJ A;  3LJA B;  2L5A A;  3UT9 D;  1ZLA D;  3MGR A;  2LY8 A;  5B31 D;  3UTA C;  1F66 B;  3MNN D;  4XUJ A;  5GXQ A;  5B40 C;  3MGP B;  1M18 A;  5B0Y D;  3TU4 C;  3AZG C;  1KX4 C;  3AZG D;  3AZI D;  1KX4 D;  4EO5 C;  2NZD D;  3MGQ D;  3B6G B;  5B2I C;  1P3M A;  1JFI B;  2IO5 C;  5B1L C;  3C1C A;  3AN2 D;  2HIO C;  1TZY C;  4HGA C;  3REK A;  3MGR D;  4XUJ C;  4J8V A;  3UT9 B;  1M18 C;  4XUJ D;  5GXQ D;  1ZLA B;  1WWS A;  1M18 D;  5B31 B;  3WTP A;  5DNM A;  4KUD C;  4H9Q A;  1M19 C;  3W97 C;  3WKJ D;  5B0Y B;  3UTB A;  1P3M C;  3AZG B;  1P3O C;  5GT3 A;  1KX4 B;  1P3M D;  4X23 A;  2NZD B;  3MGQ B;  1BFM A;  3C1C D;  4H9R B;  5B2I B;  3REK D;  4CSR B;  3AN2 B;  3NQJ B;  3REH A;  4J8V D;  3X1U C;  3MGR B;  3WTP C;  3AZF A;  3WTP D;  5DNM D;  4XUJ B;  5GXQ B;  3WA9 A;  3UTB C;  1M18 B;  5GT3 C;  3UTB D;  4H9P A;  3WAA A;  5GT3 D;  4KUD B;  3AZJ A;  4X23 D;  1P3M B;  5GSU A;  3LZ0 A;  4J8X A;  4QLC A;  3V9R A;  3W96 C;  3WTP E;  3REH C;  3C1C B;  3REH D;  3REK B;  3AZF C;  1N1J B;  3W98 D;  4G91 C;  3WA9 C;  4J8V B;  1ID3 A;  3WAA C;  3WTP B;  3B0C W;  3X1S A;  5AV8 C;  5DNM B;  3WAA D;  4H9Q B;  3O62 C;  3AZJ C;  3AZJ D;  3UTB B;  3LZ0 C;  5GT3 B;  5GSU D;  5E5A A;  3LZ0 D;  4J8X D;  4QLC D;  3AZN A;  2BYM A;  1BH9 A;  5B24 C;  1P3G D;  1ID3 C;  3REH B;  5AV6 A;  1ID3 D;  3R45 A;  1BH8 A;  3AZF B;  3AZL A;  3X1S D;  3VH6 W;  3REI A;  3WA9 B;  5B2J C;  4H9P B;  5GT0 D;  3AV2 A;  3WAA B;  3AZN C;  5E5A D;  3AZM C;  3AZJ B;  5CPI A;  4R8P C;  3AZK A;  4LD9 A;  5GSU B;  3LZ0 B;  1A7W A;  3V9R B;  3C1B A;  4J8W A;  1S32 A;  5AV6 D;  5B32 C;  1P3L C;  5BT1 D;  3AZL C;  1P3A A;  1KX3 C;  1ID3 B;  3REI D;  3AFA A;  1Q9C A;  3X1S B;  3AV2 D;  5CPI C;  3AZH A;  4YS3 C;  4ZUX A;  5AV5 C;  5CPI D;  4LD9 C;  1P3P D;  4G92 C;  3AZK D;  4LD9 D;  5BO0 A;  5E5A B;  3X1T A;  1B67 A;  3C1B D;  3AZN B;  2BYM B;  5BNX A;  5CP6 A;  4J8W D;  1P3I C;  3MVD A;  1BH9 B;  1S32 D;  1P3A D;  2F8N H;  3AZE C;  3UTA A;  4KGC C;  5AV6 B;  3R45 B;  2CWE A;  3AFA D;  5B40 A;  3AZL B;  5C3I C;  3AZH C;  3TU4 A;  3REI B;  4ZUX D;  3X1T D;  5CPI B;  2RVQ C;  3VH5 T;  3MVD C;  4CSR A;  4JJN C;  3AZK B;  5CP6 D;  4LD9 B;  5B1L A;  4Z66 A;  2HIO A;  3C1B B;  5B33 C;  1TZY A;  4J8W B;  3REJ C;  1S32 B;  3UTA D;  1U35 A;  1P3A B;  4XZQ C;  1P3K A;  1HQ3 C;  5B40 D;  3TU4 D;  4WU8 C;  4KUD A;  1M19 A;  3AFA B;  3W97 A;  3AZH B;  1P3O A;  5B2I D;  4ZUX B;  5B0Z C;  4Z66 C;  5BO0 B;  5B1L D;  3X1T B;  2FJ7 C;  4YM6 A;  2HIO D;  1N1J A;  1TZY D;  5BNX B;  5CP6 B;  1U35 C;  3MVD B;  1U35 D;  1P3K C;  3W99 C;  3X1U A;  1P3K D;  3KXB A;  3UTA B;  1AOI C;  4KUD D;  1M19 D;  3W97 D;  5B40 B; 
#chains in the Genus database with same CATH topology
 4CAY A;  3TU4 B;  3EPK A;  3B0D C;  1P3O D;  4EO5 B;  5AV9 C;  5AY8 C;  4YM6 C;  4YM6 D;  5DNN A;  1P34 A;  3W96 A;  3EPJ A;  2IO5 B;  1Z2C B;  5B1L B;  4Z66 B;  2HIO B;  1TZY B;  3X1U D;  4HGA B;  3KXB C;  5AVC A;  5B32 G;  3KXB D;  1U35 B;  1P3K B;  3LEL A;  5AV8 A;  1M19 B;  3O62 A;  4H9N A;  3W97 B;  3LZ1 A;  5DNN C;  2JE5 A;  1P34 C;  1P3O B;  1B6W A;  5DNN D;  3B0D B;  5JA4 A;  3W96 D;  2YFV A;  3X1V C;  2XD1 A;  4YM6 B;  3A1I A;  5AVC C;  5B24 A;  3AZF D;  5AVC D;  3WA9 D;  3X1U B;  3LEL C;  3KXB B;  4J8U C;  5AV8 D;  5FUG A;  3O62 D;  3LZ1 C;  4CAY B;  1P3F A;  5B2J A;  1TAF A;  2W8S A;  3AZM A;  4R8P A;  5DNN B;  1P34 B;  3W96 B;  5B24 D;  2F2A C;  3EPH A;  5B32 A;  1P3L A;  5AVC B;  1KX3 A;  4G91 B;  1P3F C;  1HTA A;  3VH6 A;  3LEL B;  2RIQ A;  1P3F D;  5AV8 B;  5B2J D;  3O62 B;  4H9N B;  3AZN D;  3AV1 A;  4YS3 A;  5AV5 A;  3AZM D;  5BS7 A;  1EQZ C;  3B0C T;  3LZ1 B;  4R8P D;  3AYW C;  2Y2I A;  4ZBJ C;  2Y2J A;  3KWQ A;  5JA4 B;  2YFV B;  1P3I A;  2Y2K A;  5B32 D;  5B24 B;  1P3L D;  3AZL D;  1P3B A;  3AZE A;  1KX3 D;  4KGC A;  2Y2H A;  3B6F C;  3EG5 B;  4UPK A;  2F8N K;  3AV1 C;  5FUG B;  5BS7 C;  4YS3 D;  5AV5 D;  2ZM5 A;  1P3F B;  1F1E A;  5B2J B;  4Z2M G;  1TAF B;  3VH6 T;  5B1M A;  3KWQ C;  2HUE C;  3AZM B;  4JJN A;  5CPJ C;  4R8P B;  1P3I D;  2NQB C;  3REL C;  5B33 A;  5CPK C;  3KSY A;  4ZBJ B;  2ARO C;  1P3B C;  4WNN A;  3REJ A;  1P3B D;  4AWL C;  3AZE D;  2Y2P A;  4KGC D;  5B32 B;  1P3L B;  1KX5 C;  4XZQ A;  1HQ3 A;  1KX3 B;  5CHL B;  3AZH D;  5AVB C;  4WU8 A;  4UUZ B;  5B1M C;  3B6F B;  3AV1 B;  3LJA C;  4YS3 B;  5B0Z A;  5AV5 B;  4DRA A;  2DQN C;  2RVQ D;  3MVD D;  4JJN D;  4G92 B;  2FJ7 A;  3KWQ B;  5B33 D;  2HUE B;  3REJ D;  3MGP C;  1P3I B;  4E45 A;  5BNV A;  3W99 A;  4E44 A;  4XZQ D;  1P3B B;  1HQ3 D;  1W2E A;  3AZE B;  4AWL B;  4KGC B;  4WU8 D;  1AOI A;  3P5J B;  5C3I B;  5B0Z D;  5JRG A;  5AV9 A;  5AY8 A;  4Z66 D;  5B1M B;  2FJ7 D;  3UT9 C;  4JJN B;  1ZLA C;  5B31 C;  3MNN C;  3W99 D;  5B33 B;  4WNN B;  3REJ B;  5B0Y C;  1KU5 A;  2PYO A;  3AZI C;  2F8N G;  1AOI D;  4XZQ B;  2CV5 A;  1HQ3 B;  2NZD C;  3MGQ C;  3WKJ A;  4WU8 B;  5JRG C;  5JRG D;  5AV9 D;  5AY8 D;  5KDM A;  3AN2 C;  5B0Z B;  2DF4 C;  3MGR C;  3KUY A;  3X1V A;  2FJ7 B;  2Y2G A;  2YFW A;  5GXQ C;  2PYO C;  1H3O B;  5BNV B;  3W99 B;  2CV5 C;  2PYO D;  3MNN B;  3WKJ C;  2CV5 D;  4DQY B;  4NFT A;  4J8U A;  1AOI B;  3AZI B;  3C1C C;  1P34 D;  4DRB A;  3KUY C;  4KHA A;  5JRG B;  5AV9 B;  3REK C;  3KUY D;  5AY8 B;  3X1V D;  4J8V C;  3A6N A;  5DNM C;  3W98 A;  3LEL D;  2F8N A;  4J8U D;  2PYO B;  4NE5 A;  2CV5 B;  4X23 C;  3LZ1 D;  3WKJ B;  2BYK A;  3EPL A;  4H9O A;  5KDM B;  1EQZ A;  3A6N C;  3AYW A;  3A6N D;  3KUY B;  2Y2N A;  3X1V B;  1P3G A;  3W98 C;  4M6B A;  2YFW B;  5F99 A;  3H0R C;  2F8N D;  4UUZ A;  5G49 A;  4Z2M H;  3B6F A;  4J8U B;  4WZS B;  5GSU C;  5GT0 A;  4J8X C;  4QLC C;  4X23 B;  1EQZ D;  3AYW D;  1R4V A;  1WWI A;  4WU9 A;  4KHA B;  3NQU A;  5CPJ A;  1P3G C;  4WV4 B;  2Y2Q A;  4Z5T A;  2NQB A;  3REL A;  5B31 G;  5F99 C;  3A6N B;  3B0B A;  5CPK A;  1M1A A;  2ARO A;  5F99 D;  3X1S C;  3W98 B;  1KX5 A;  3B6F D;  2ZY2 A;  2F8N B;  5GT0 C;  3AV1 D;  5AVB A;  5E5A C;  2BYK B;  4H9O B;  1P3P A;  3MGS A;  4WU9 C;  4NE6 A;  3KWQ D;  3LJA A;  4WU9 D;  4H9S A;  4J8X B;  4QLC B;  5CPJ D;  4Z5T C;  1EQZ B;  3AYW B;  4Z5T D;  2NQB D;  1F66 A;  3REL D;  1M1A C;  5AV6 C;  1T3U A;  5CPK D;  5BT1 C;  1M1A D;  2ARO D;  3MGP A;  1P3G B;  3REI C;  5F99 B;  1KX5 D;  3VH5 W;  2JSS A;  3AV2 C;  2XD5 A;  5AVB D;  3B6G A;  5G49 B;  3VH5 A;  1P3P C;  3MGS C;  5B1M D;  3AZK C;  3MGS D;  4H9S C;  1JFI A;  5GT0 B;  3LJA D;  3C1B C;  4J8W C;  1F66 C;  2G5I C;  1S32 C;  4WU9 B;  1F66 D;  1ULY A;  3UT9 A;  3NQU B;  4NE3 A;  5CPJ B;  1P3A C;  1ZLA A;  1H3O A;  3MGP D;  4Z5T B;  5B31 A;  2NQB B;  3REL B;  3MNN A;  5CPK B;  1M1A B;  2ARO B;  3AFA C;  5B0Y A;  1BH8 B;  3B6G C;  3AZG A;  3AZI A;  1KX4 A;  4ZUX C;  3B6G D;  1KX5 B;  2NZD A;  3MGQ A;  5AVB B;  3AV2 B;  3X1T C;  4H9R A;  5B2I A;  5CP6 C;  1P3P B;  3MGS B;  3AN2 A;  3NQJ A;  3LJA B;  2L5A A;  3UT9 D;  1ZLA D;  3MGR A;  2LY8 A;  5B31 D;  3UTA C;  1F66 B;  2Y2L A;  3MNN D;  4XUJ A;  5GXQ A;  5B40 C;  3MGP B;  1M18 A;  5B0Y D;  3TU4 C;  3AZG C;  1KX4 C;  3AZG D;  3AZI D;  1KX4 D;  4EO5 C;  2NZD D;  3MGQ D;  3B6G B;  5B2I C;  1P3M A;  1JFI B;  2IO5 C;  5B1L C;  3C1C A;  3AN2 D;  2HIO C;  1TZY C;  4HGA C;  3REK A;  3MGR D;  2ZY5 A;  4XUJ C;  4J8V A;  3UT9 B;  1M18 C;  4XUJ D;  5GXQ D;  1ZLA B;  1WWS A;  1M18 D;  5B31 B;  3WTP A;  5DNM A;  4KUD C;  4H9Q A;  1M19 C;  3W97 C;  3WKJ D;  5B0Y B;  3UTB A;  1P3M C;  3AZG B;  1P3O C;  5GT3 A;  1KX4 B;  1P3M D;  4X23 A;  2NZD B;  3MGQ B;  1BFM A;  3C1C D;  4H9R B;  5B2I B;  3REK D;  4CSR B;  3AN2 B;  2FFF B;  3NQJ B;  3REH A;  4J8V D;  3X1U C;  3MGR B;  3WTP C;  3AZF A;  3WTP D;  5DNM D;  4XUJ B;  5GXQ B;  3WA9 A;  3UTB C;  1M18 B;  5GT3 C;  3UTB D;  4H9P A;  3WAA A;  5GT3 D;  2VQR A;  4KUD B;  3AZJ A;  4X23 D;  1P3M B;  5GSU A;  3LZ0 A;  4J8X A;  4QLC A;  3V9R A;  3W96 C;  3WTP E;  3REH C;  3C1C B;  3REH D;  1PZR A;  3REK B;  3AZF C;  1N1J B;  3W98 D;  4G91 C;  3WA9 C;  4J8V B;  1ID3 A;  3WAA C;  3WTP B;  3B0C W;  3X1S A;  5AV8 C;  5DNM B;  3WAA D;  4H9Q B;  3O62 C;  3AZJ C;  2Y2O A;  3AZJ D;  3UTB B;  3LZ0 C;  5GT3 B;  5GSU D;  5E5A A;  3LZ0 D;  4J8X D;  4QLC D;  3AZN A;  2BYM A;  1BH9 A;  5B24 C;  1P3G D;  1ID3 C;  3REH B;  5AV6 A;  1ID3 D;  2ZY4 A;  3R45 A;  1BH8 A;  3AZF B;  3AZL A;  3X1S D;  3VH6 W;  3REI A;  3WA9 B;  5B2J C;  4H9P B;  5GT0 D;  3AV2 A;  3WAA B;  3AZN C;  5E5A D;  3AZM C;  3AZJ B;  5CPI A;  4R8P C;  3AZK A;  4LD9 A;  5GSU B;  3LZ0 B;  1A7W A;  3V9R B;  3C1B A;  4J8W A;  1S32 A;  5AV6 D;  5B32 C;  2JCH A;  1P3L C;  5BT1 D;  3AZL C;  1P3A A;  1KX3 C;  1ID3 B;  3REI D;  3AFA A;  1Q9C A;  3X1S B;  3AV2 D;  5CPI C;  3AZH A;  4YS3 C;  4ZUX A;  5AV5 C;  3IP4 C;  5CPI D;  4LD9 C;  1P3P D;  4G92 C;  3AZK D;  4LD9 D;  5BO0 A;  5E5A B;  3X1T A;  1B67 A;  3C1B D;  3AZN B;  2BYM B;  5BNX A;  5CP6 A;  4J8W D;  1P3I C;  3MVD A;  1BH9 B;  1S32 D;  1P3A D;  2F8N H;  3AZE C;  3UTA A;  4WJ3 C;  4KGC C;  5AV6 B;  3R45 B;  2CWE A;  3AFA D;  5B40 A;  3AZL B;  5C3I C;  3AZH C;  3A1K A;  3TU4 A;  3REI B;  4ZUX D;  3AL0 C;  3X1T D;  5CPI B;  2ZY3 A;  3H0L C;  2RVQ C;  3VH5 T;  3MVD C;  4CSR A;  4JJN C;  3AZK B;  5CP6 D;  4LD9 B;  5B1L A;  4Z66 A;  2HIO A;  2BG1 A;  3C1B B;  5B33 C;  1TZY A;  4J8W B;  3REJ C;  1S32 B;  3UTA D;  1U35 A;  1P3A B;  4XZQ C;  1P3K A;  1HQ3 C;  5B40 D;  3TU4 D;  4WU8 C;  4KUD A;  1M19 A;  3AFA B;  3W97 A;  2J8P A;  3AZH B;  1P3O A;  5B2I D;  4ZUX B;  3FDD A;  3H0M C;  5B0Z C;  4Z66 C;  2UWX A;  5BO0 B;  5B1L D;  3X1T B;  2FJ7 C;  4YM6 A;  2HIO D;  1N1J A;  1TZY D;  2G5H C;  5BNX B;  5CP6 B;  1U35 C;  3MVD B;  3F6T A;  1U35 D;  1P3K C;  3W99 C;  3X1U A;  1P3K D;  3KXB A;  3UTA B;  2Y2M A;  1AOI C;  4KUD D;  1M19 D;  3W97 D;  5B40 B;  3KFU G; 
#chains in the Genus database with same CATH homology
 4CAY A;  3TU4 B;  3EPK A;  3B0D C;  1P3O D;  4EO5 B;  5AV9 C;  5AY8 C;  4YM6 C;  4YM6 D;  5DNN A;  1P34 A;  3W96 A;  3EPJ A;  2IO5 B;  1Z2C B;  5B1L B;  4Z66 B;  2HIO B;  1TZY B;  3X1U D;  4HGA B;  3KXB C;  5AVC A;  5B32 G;  3KXB D;  1U35 B;  1P3K B;  3LEL A;  5AV8 A;  1M19 B;  3O62 A;  4H9N A;  3W97 B;  3LZ1 A;  5DNN C;  2JE5 A;  1P34 C;  1P3O B;  1B6W A;  5DNN D;  3B0D B;  5JA4 A;  3W96 D;  2YFV A;  3X1V C;  2XD1 A;  4YM6 B;  3A1I A;  5AVC C;  5B24 A;  3AZF D;  5AVC D;  3WA9 D;  3X1U B;  3LEL C;  3KXB B;  4J8U C;  5AV8 D;  5FUG A;  3O62 D;  3LZ1 C;  4CAY B;  1P3F A;  5B2J A;  1TAF A;  2W8S A;  3AZM A;  4R8P A;  5DNN B;  1P34 B;  3W96 B;  5B24 D;  2F2A C;  3EPH A;  5B32 A;  1P3L A;  5AVC B;  1KX3 A;  4G91 B;  1P3F C;  1HTA A;  3VH6 A;  3LEL B;  2RIQ A;  1P3F D;  5AV8 B;  5B2J D;  3O62 B;  4H9N B;  3AZN D;  3AV1 A;  4YS3 A;  5AV5 A;  3AZM D;  5BS7 A;  1EQZ C;  3B0C T;  3LZ1 B;  4R8P D;  3AYW C;  2Y2I A;  4ZBJ C;  2Y2J A;  3KWQ A;  5JA4 B;  2YFV B;  1P3I A;  2Y2K A;  5B32 D;  5B24 B;  1P3L D;  3AZL D;  1P3B A;  3AZE A;  1KX3 D;  4KGC A;  2Y2H A;  3B6F C;  3EG5 B;  4UPK A;  2F8N K;  3AV1 C;  5FUG B;  5BS7 C;  4YS3 D;  5AV5 D;  2ZM5 A;  1P3F B;  1F1E A;  5B2J B;  4Z2M G;  1TAF B;  3VH6 T;  5B1M A;  3KWQ C;  2HUE C;  3AZM B;  4JJN A;  5CPJ C;  4R8P B;  1P3I D;  2NQB C;  3REL C;  5B33 A;  5CPK C;  3KSY A;  4ZBJ B;  2ARO C;  1P3B C;  4WNN A;  3REJ A;  1P3B D;  4AWL C;  3AZE D;  2Y2P A;  4KGC D;  5B32 B;  1P3L B;  1KX5 C;  4XZQ A;  1HQ3 A;  1KX3 B;  5CHL B;  3AZH D;  5AVB C;  4WU8 A;  4UUZ B;  5B1M C;  3B6F B;  3AV1 B;  3LJA C;  4YS3 B;  5B0Z A;  5AV5 B;  4DRA A;  2DQN C;  2RVQ D;  3MVD D;  4JJN D;  4G92 B;  2FJ7 A;  3KWQ B;  5B33 D;  2HUE B;  3REJ D;  3MGP C;  1P3I B;  4E45 A;  5BNV A;  3W99 A;  4E44 A;  4XZQ D;  1P3B B;  1HQ3 D;  1W2E A;  3AZE B;  4AWL B;  4KGC B;  4WU8 D;  1AOI A;  3P5J B;  5C3I B;  5B0Z D;  5JRG A;  5AV9 A;  5AY8 A;  4Z66 D;  5B1M B;  2FJ7 D;  3UT9 C;  4JJN B;  1ZLA C;  5B31 C;  3MNN C;  3W99 D;  5B33 B;  4WNN B;  3REJ B;  5B0Y C;  1KU5 A;  2PYO A;  3AZI C;  2F8N G;  1AOI D;  4XZQ B;  2CV5 A;  1HQ3 B;  2NZD C;  3MGQ C;  3WKJ A;  4WU8 B;  5JRG C;  5JRG D;  5AV9 D;  5AY8 D;  5KDM A;  3AN2 C;  5B0Z B;  2DF4 C;  3MGR C;  3KUY A;  3X1V A;  2FJ7 B;  2Y2G A;  2YFW A;  5GXQ C;  2PYO C;  1H3O B;  5BNV B;  3W99 B;  2CV5 C;  2PYO D;  3MNN B;  3WKJ C;  2CV5 D;  4DQY B;  4NFT A;  4J8U A;  1AOI B;  3AZI B;  3C1C C;  1P34 D;  4DRB A;  3KUY C;  4KHA A;  5JRG B;  5AV9 B;  3REK C;  3KUY D;  5AY8 B;  3X1V D;  4J8V C;  3A6N A;  5DNM C;  3W98 A;  3LEL D;  2F8N A;  4J8U D;  2PYO B;  4NE5 A;  2CV5 B;  4X23 C;  3LZ1 D;  3WKJ B;  2BYK A;  3EPL A;  4H9O A;  5KDM B;  1EQZ A;  3A6N C;  3AYW A;  3A6N D;  3KUY B;  2Y2N A;  3X1V B;  1P3G A;  3W98 C;  4M6B A;  2YFW B;  5F99 A;  3H0R C;  2F8N D;  4UUZ A;  5G49 A;  4Z2M H;  3B6F A;  4J8U B;  4WZS B;  5GSU C;  5GT0 A;  4J8X C;  4QLC C;  4X23 B;  1EQZ D;  3AYW D;  1R4V A;  1WWI A;  4WU9 A;  4KHA B;  3NQU A;  5CPJ A;  1P3G C;  4WV4 B;  2Y2Q A;  4Z5T A;  2NQB A;  3REL A;  5B31 G;  5F99 C;  3A6N B;  3B0B A;  5CPK A;  1M1A A;  2ARO A;  5F99 D;  3X1S C;  3W98 B;  1KX5 A;  3B6F D;  2ZY2 A;  2F8N B;  5GT0 C;  3AV1 D;  5AVB A;  5E5A C;  2BYK B;  4H9O B;  1P3P A;  3MGS A;  4WU9 C;  4NE6 A;  3KWQ D;  3LJA A;  4WU9 D;  4H9S A;  4J8X B;  4QLC B;  5CPJ D;  4Z5T C;  1EQZ B;  3AYW B;  4Z5T D;  2NQB D;  1F66 A;  3REL D;  1M1A C;  5AV6 C;  1T3U A;  5CPK D;  5BT1 C;  1M1A D;  2ARO D;  3MGP A;  1P3G B;  3REI C;  5F99 B;  1KX5 D;  3VH5 W;  2JSS A;  3AV2 C;  2XD5 A;  5AVB D;  3B6G A;  5G49 B;  3VH5 A;  1P3P C;  3MGS C;  5B1M D;  3AZK C;  3MGS D;  4H9S C;  1JFI A;  5GT0 B;  3LJA D;  3C1B C;  4J8W C;  1F66 C;  2G5I C;  1S32 C;  4WU9 B;  1F66 D;  1ULY A;  3UT9 A;  3NQU B;  4NE3 A;  5CPJ B;  1P3A C;  1ZLA A;  1H3O A;  3MGP D;  4Z5T B;  5B31 A;  2NQB B;  3REL B;  3MNN A;  5CPK B;  1M1A B;  2ARO B;  3AFA C;  5B0Y A;  1BH8 B;  3B6G C;  3AZG A;  3AZI A;  1KX4 A;  4ZUX C;  3B6G D;  1KX5 B;  2NZD A;  3MGQ A;  5AVB B;  3AV2 B;  3X1T C;  4H9R A;  5B2I A;  5CP6 C;  1P3P B;  3MGS B;  3AN2 A;  3NQJ A;  3LJA B;  2L5A A;  3UT9 D;  1ZLA D;  3MGR A;  2LY8 A;  5B31 D;  3UTA C;  1F66 B;  2Y2L A;  3MNN D;  4XUJ A;  5GXQ A;  5B40 C;  3MGP B;  1M18 A;  5B0Y D;  3TU4 C;  3AZG C;  1KX4 C;  3AZG D;  3AZI D;  1KX4 D;  4EO5 C;  2NZD D;  3MGQ D;  3B6G B;  5B2I C;  1P3M A;  1JFI B;  2IO5 C;  5B1L C;  3C1C A;  3AN2 D;  2HIO C;  1TZY C;  4HGA C;  3REK A;  3MGR D;  2ZY5 A;  4XUJ C;  4J8V A;  3UT9 B;  1M18 C;  4XUJ D;  5GXQ D;  1ZLA B;  1WWS A;  1M18 D;  5B31 B;  3WTP A;  5DNM A;  4KUD C;  4H9Q A;  1M19 C;  3W97 C;  3WKJ D;  5B0Y B;  3UTB A;  1P3M C;  3AZG B;  1P3O C;  5GT3 A;  1KX4 B;  1P3M D;  4X23 A;  2NZD B;  3MGQ B;  1BFM A;  3C1C D;  4H9R B;  5B2I B;  3REK D;  4CSR B;  3AN2 B;  2FFF B;  3NQJ B;  3REH A;  4J8V D;  3X1U C;  3MGR B;  3WTP C;  3AZF A;  3WTP D;  5DNM D;  4XUJ B;  5GXQ B;  3WA9 A;  3UTB C;  1M18 B;  5GT3 C;  3UTB D;  4H9P A;  3WAA A;  5GT3 D;  2VQR A;  4KUD B;  3AZJ A;  4X23 D;  1P3M B;  5GSU A;  3LZ0 A;  4J8X A;  4QLC A;  3V9R A;  3W96 C;  3WTP E;  3REH C;  3C1C B;  3REH D;  1PZR A;  3REK B;  3AZF C;  1N1J B;  3W98 D;  4G91 C;  3WA9 C;  4J8V B;  1ID3 A;  3WAA C;  3WTP B;  3B0C W;  3X1S A;  5AV8 C;  5DNM B;  3WAA D;  4H9Q B;  3O62 C;  3AZJ C;  2Y2O A;  3AZJ D;  3UTB B;  3LZ0 C;  5GT3 B;  5GSU D;  5E5A A;  3LZ0 D;  4J8X D;  4QLC D;  3AZN A;  2BYM A;  1BH9 A;  5B24 C;  1P3G D;  1ID3 C;  3REH B;  5AV6 A;  1ID3 D;  2ZY4 A;  3R45 A;  1BH8 A;  3AZF B;  3AZL A;  3X1S D;  3VH6 W;  3REI A;  3WA9 B;  5B2J C;  4H9P B;  5GT0 D;  3AV2 A;  3WAA B;  3AZN C;  5E5A D;  3AZM C;  3AZJ B;  5CPI A;  4R8P C;  3AZK A;  4LD9 A;  5GSU B;  3LZ0 B;  1A7W A;  3V9R B;  3C1B A;  4J8W A;  1S32 A;  5AV6 D;  5B32 C;  2JCH A;  1P3L C;  5BT1 D;  3AZL C;  1P3A A;  1KX3 C;  1ID3 B;  3REI D;  3AFA A;  1Q9C A;  3X1S B;  3AV2 D;  5CPI C;  3AZH A;  4YS3 C;  4ZUX A;  5AV5 C;  3IP4 C;  5CPI D;  4LD9 C;  1P3P D;  4G92 C;  3AZK D;  4LD9 D;  5BO0 A;  5E5A B;  3X1T A;  1B67 A;  3C1B D;  3AZN B;  2BYM B;  5BNX A;  5CP6 A;  4J8W D;  1P3I C;  3MVD A;  1BH9 B;  1S32 D;  1P3A D;  2F8N H;  3AZE C;  3UTA A;  4WJ3 C;  4KGC C;  5AV6 B;  3R45 B;  2CWE A;  3AFA D;  5B40 A;  3AZL B;  5C3I C;  3AZH C;  3A1K A;  3TU4 A;  3REI B;  4ZUX D;  3AL0 C;  3X1T D;  5CPI B;  2ZY3 A;  3H0L C;  2RVQ C;  3VH5 T;  3MVD C;  4CSR A;  4JJN C;  3AZK B;  5CP6 D;  4LD9 B;  5B1L A;  4Z66 A;  2HIO A;  2BG1 A;  3C1B B;  5B33 C;  1TZY A;  4J8W B;  3REJ C;  1S32 B;  3UTA D;  1U35 A;  1P3A B;  4XZQ C;  1P3K A;  1HQ3 C;  5B40 D;  3TU4 D;  4WU8 C;  4KUD A;  1M19 A;  3AFA B;  3W97 A;  2J8P A;  3AZH B;  1P3O A;  5B2I D;  4ZUX B;  3FDD A;  3H0M C;  5B0Z C;  4Z66 C;  2UWX A;  5BO0 B;  5B1L D;  3X1T B;  2FJ7 C;  4YM6 A;  2HIO D;  1N1J A;  1TZY D;  2G5H C;  5BNX B;  5CP6 B;  1U35 C;  3MVD B;  3F6T A;  1U35 D;  1P3K C;  3W99 C;  3X1U A;  1P3K D;  3KXB A;  3UTA B;  2Y2M A;  1AOI C;  4KUD D;  1M19 D;  3W97 D;  5B40 B;  3KFU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...