5AV6A

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6A00
5AY8D 4XUJD 1U35C 3A6NB 1P3KD 5B0YA 1P3LB 1P3IC 3UT9B 5BT1C 5AVBA 4WNNA 3AZLD 1P34A 1KX3B 2NQBC 5AVCD 3AN2C 1B6WA 3AZGC 5B31G 5CPJA 1F66B 3O62C 2FJ7D 5GSUD 4J8WA 4J8UA 3WA9A 3REKB 3AZMC 4NE5A 4Z2MH 5B0YD 2YFVA 2AROB 5AVBD 1P34D 3B6FB 1P3BB 5GT0A 3KUYD 5CPJD 5B2ID 5BNXA 4CSRA 1EQZC 5BO0B 4J8WD 4J8UD 3AYWB 4WZSB 5B1LC 3WTPB 4QLCB 1TZYC 1KX5D 1ZLAA 3X1TB 5CP6A 3NQUB 2PYOA 5AV6C 3REJD 1P3IB 5GT3C 5AY8C 4XUJC 2NQBB 3WKJA 2BYKB 2F8NB 3AZGB 5DNNA 3WAAD 3AV1C 5E5AC 3AFAA 3O62B 3MGRA 5CP6D 5AVCC 5G49A 1HTAA 3AZMB 4KUDA 3W99B 3KSYA 4WU8A 5DNND 1BH8B 4Z5TD 1P3PC 3W97D 1P3MD 5F99A 3AZKC 4H9NB 5GXQC 3MGRD 1EQZB 3REHC 4XZQA 1JFIB 1AOIA 2F8NG 5B2IC 1P3GA 1TZYB 1P3FC 2BYMA 3MVDC 4KUDD 1P3AA 4G91B 3AZFA 3WTPE 1M19A 4LD9A 3AZNC 5AV6B 1KX5C 5GT3B 5F99D 5B1MA 5AY8B 4XUJB 3LZ0A 4YM6A 5C3IB 5FUGB 3AV1B 1S32D 5E5AB 1P3KB 5AV8C 3REJC 2HIOC 3UTBD 3AZLB 1BH9A 5AVCB 3WAAC 3AZHA 3AZIA 3B0CT 3AZFD 3B6GA 3B0CW 5CPID 3X1SA 3C1CD 1U35A 3LZ0D 4R8PD 3C1BA 3AZED 3A6NC 3AZKB 5B33A 3X1UD 3LJAD 5GXQB 4J8XA 3AN2A 3AZHD 2CWEA 3KUYB 3AZID 5B2IB 4ZUXA 1KU5A 3MVDB 5BS7C 4Z66D 4NE3A 4J8UB 3LZ1C 3RELD 3C1BD 1KX5B 3VH5T 1F1EA 5JA4B 5B33D 1P3OA 5AV5D 3VH5W 4DRBA 5AV9D 4DRAA 5DNMA 3REIA 5AV8B 1A7WA 3KXBC 3REJB 5B0ZA 3AZJA 3AV2A 3WAAB 3KWQA 4KGCD 4H9QB 3AYWC 5B1LA 4JJNA 3UTBC 3WTPC 5CPKC 3X1TC 1Q9CA 3MNNA 1P3OD 4CAYB 3MGQC 5DNMD 3REID 1TAFB 5B0ZD 3AV2D 3V9RA 4Z5TB 3W97B 1P3MB 1N1JA 5B32A 3X1UC 3LJAC 4JJND 4H9RA 5B40C 1M1AD 4H9SA 1KX4A 3MNND 3LZ1B 2IO5C 4Z66C 2NZDA 3W99C 4X23A 3LELA 3RELC 1P3PA 3W96A 3KXBB 3MGSA 4KHAB 3W98C 2CV5A 5B32D 3MGPA 3TU4A 4YS3A 5JRGA 4UUZA 5AV5C 4J8VC 3REHA 5B2JA 1S32B 3X1VA 3WA9D 3UTBB 1HQ3A 4H9PB 5CPKB 1P3FA 3MGQB 2NZDD 4G91C 4X23D 3LELD 5CPIB 1R4VA 5GT0D 3MGSD 2RVQD 1M1AA 3C1CB 2CV5D 4YS3D 5B31A 5JRGD 3UTAA 5BNVA 4R8PB 4AWLC 1M18A 5C3IC 3AZEB 5B24A 2F8NH 5B40B 3X1UB 3LJAB 1P3KC 3AZLC 1H3OA 1ZLAD 3NQJA 3R45A 1ID3A 2PYOD 4H9OB 2IO5B 4WU9A 4Z66B 2FJ7C 5GSUC 3UTAD 5B31D 3RELB 3WKJD 3W98B 3VH5A 3A6NA 5CHLB 1P3LA 5B0YC 3AFAD 3UT9A 5AV5B 5AVBC 4J8VB 1P34C 1KX3A 5AV9B 1ID3D 3KUYC 5CPJC 3VH6T 1F66A 4WU9D 3VH6W 4KGCB 4J8WC 4J8UC 4WU8D 3REKA 1P3LD 2AROA 5KDMB 3UT9D 3B6FA 4AWLB 4HGAC 1P3BA 5GT0C 4XZQD 1ULYA 1AOID 1P3GD 1F66D 1WWSA 3AV2B 5BO0A 1P3AD 1M19D 4LD9D 4JJNB 3WTPA 1M1AB 4QLCA 2FJ7B 5GSUB 2F8NK 3X1TA 5CP6C 5B1MD 3NQUA 3B6FD 4M6BA 4WV4B 4YM6D 2PYOC 5B0YB 1P3IA 5AVBB 1P34B 4WNNB 2NQBA 2BYKA 2F8NA 3AZGA 5DNNC 4Z5TC 3W97C 5CPJB 1P3MC 3B6GD 3O62A 3AFAC 4QLCD 3X1SD 3MGRC 1U35D 4J8WB 2JSSA 3WA9B 3AZMA 1P3ID 2YFVB 4KUDC 3W99A 2NQBD 4HGAB 4J8XD 3AN2D 4WU8C 2F8ND 1BH8A 5GT0B 4NFTA 5F99C 3O62D 4H9NA 4ZUXD 5BNXB 4CSRB 1EQZA 1S32C 1JFIA 4XZQC 1AOIC 1TZYA 1P3GC 1ZLAB 5CP6B 3AZFC 1M19C 2PYOB 5CPIC 5AV6A 5GT3A 5AY8A 4XUJA 5B1MC 3C1CC 3LZ0C 3AZJD 3WKJB 4R8PC 5DNNB 2YFWA 3KWQD 1EQZD 5FUGA 3AV1A 3AZEC 5E5AA 1P3KA 5B1LD 3AFAB 3AZLA 3MGRB 1TZYD 4G92C 5AVCA 5G49B 3VH6A 3AZHC 3AZIC 3B6GC 5GT3D 4KUDB 4WU8B 3C1BC 3AV1D 5E5AD 5F99B 4NE6A 3AZKA 5B33C 5GXQA 4J8XC 5AV9C 1KX4D 4XZQB 3KUYA 1AOIB 5B2IA 4ZBJC 1P3GB 3MVDA 4ZUXC 2BYMB 2L5AA 1P3AB 3AZFB 4KGCC 1M19B 3AZNA 4LD9B 1BFMA 1P3PD 3W96D 1KX5A 3B0DB 3AZKD 5B1MB 5JA4A 3LZ0B 3MGPD 5GXQD 3TU4D 1P3OC 4YM6B 3REHD 5B2JD 5DNMC 5AV8A 3REIC 2HIOA 3REJA 3X1VD 1HQ3D 5B0ZC 4G92B 3AZJC 1BH9B 1P3FD 3MVDD 3AV2C 4E45A 3WAAA 3AZHB 3KWQC 3AZIB 4H9QA 3B6GB 3AZND 1WWIA 4JJNC 1M1AC 3X1SB 1U35B 3MNNC 4CAYA 3C1BB 1M18D 5B24D 5AV8D 1TAFA 2HIOD 4Z2MG 5B33B 4J8XB 3AN2B 4Z5TA 3W97A 1P3MA 4ZBJB 5B32C 4ZUXB 5BS7A 4H9SC 3LZ1A 1KX4C 3WA9C 3A6ND 4E44A 1P3OB 2NZDC 1KX3D 4X23C 3LELC 5DNMB 3KXBA 3REIB 4KHAA 3W96C 3MGSC 1B67A 2RVQC 5B0ZB 3AZJB 2CV5C 3TU4C 3MGPC 4YS3C 5JRGC 2HUEC 3KWQB 3LZ1D 3AYWA 5B2JC 1S32A 5B1LB 3X1VC 3UTBA 3REKD 1HQ3C 4H9PA 5CPKA 1ZLAC 3MNNB 2AROD 3MGQA 4EO5C 5CPIA 1P3BD 3KXBD 2LY8A 3C1CA 3V9RB 5B31C 4R8PA 3UTAC 3WKJC 2YFWB 1M18C 3AZEA 3AYWD 5B24C 5B40A 3X1UA 3LJAA 1N1JB 5B32B 4H9RB 3WTPD 5CPKD 3X1TD 1KX4B 1ID3C 3MGQD 4H9OA 4WU9C 4Z66A 5BT1D 2NZDB 4X23B 3RELA 3LELB 3AZGD 1P3PB 3W96B 3MGSB 3W98A 5B40D 2CV5B 1P3LC 3TU4B 3MGPB 4YS3B 5AV5A 5JRGB 4J8VA 4UUZB 3UT9C 2HUEB 1KX3C 5AV9A 3REHB 5B2JB 3X1VB 1HQ3B 3AZMD 1P3FB 1F66C 5B32G 4EO5B 4KGCA 3W99D 1P3AC 3AZNB 4LD9C 3W98D 3REKC 3B0DC 3B0BA 5KDMA 5B31B 2AROC 3UTAB 5BNVB 4J8VD 3B6FC 1M18B 4YM6C 5B24B 1P3BC 2HIOB 1H3OB 3NQJB 3R45B 1ID3B 4WU9B 5AV6D 2FJ7A 5GSUA 4QLCC 3X1SC
chains in the Genus database with same CATH superfamily
5AY8D 4XUJD 1U35C 3A6NB 2Y2QA 3EPHA 1P3KD 5B0YA 1P3LB 1P3IC 3UT9B 5BT1C 5AVBA 4WNNA 3AZLD 1P34A 1KX3B 2NQBC 5AVCD 3AN2C 1B6WA 3AZGC 5B31G 5CPJA 1F66B 3O62C 2FJ7D 5GSUD 3A1KA 4J8WA 4J8UA 3WA9A 3AL0C 3REKB 3AZMC 4NE5A 4Z2MH 5B0YD 2YFVA 2AROB 5AVBD 1P34D 3B6FB 1P3BB 5GT0A 3KUYD 5CPJD 5B2ID 2JE5A 5BNXA 4CSRA 1EQZC 5BO0B 4J8WD 4J8UD 3AYWB 4WZSB 5B1LC 3WTPB 4QLCB 1TZYC 1KX5D 1ZLAA 3X1TB 5CP6A 3NQUB 2PYOA 5AV6C 3REJD 1P3IB 5GT3C 5AY8C 4XUJC 2NQBB 3WKJA 2BYKB 2F8NB 3AZGB 5DNNA 3WAAD 3AV1C 5E5AC 3AFAA 3O62B 2VQRA 3MGRA 5CP6D 5AVCC 5G49A 1HTAA 2ZY5A 3AZMB 2Y2PA 4KUDA 3W99B 3KSYA 4WU8A 5DNND 1BH8B 4Z5TD 1P3PC 3W97D 1P3MD 5F99A 3AZKC 4H9NB 5GXQC 3MGRD 3KFUG 1EQZB 3REHC 4XZQA 1JFIB 1AOIA 2F8NG 5B2IC 1P3GA 1TZYB 2Y2LA 1P3FC 2BYMA 3MVDC 4KUDD 1P3AA 4G91B 3AZFA 3WTPE 1M19A 4LD9A 3AZNC 5AV6B 1KX5C 5GT3B 5F99D 5B1MA 5AY8B 4XUJB 3LZ0A 4YM6A 5C3IB 5FUGB 3AV1B 1S32D 5E5AB 1P3KB 5AV8C 3REJC 2HIOC 3UTBD 3AZLB 1BH9A 5AVCB 3WAAC 3AZHA 3AZIA 3B0CT 3AZFD 3B6GA 3B0CW 5CPID 3X1SA 3C1CD 1U35A 3LZ0D 4R8PD 3C1BA 3AZED 3A6NC 3AZKB 5B33A 3X1UD 3LJAD 5GXQB 4J8XA 3AN2A 3AZHD 2CWEA 3KUYB 3AZID 5B2IB 4ZUXA 1KU5A 3MVDB 5BS7C 4Z66D 4NE3A 4J8UB 3LZ1C 3RELD 3C1BD 1KX5B 3VH5T 1F1EA 5JA4B 5B33D 1P3OA 5AV5D 3VH5W 4DRBA 5AV9D 4DRAA 5DNMA 3REIA 5AV8B 1A7WA 3KXBC 3REJB 5B0ZA 3AZJA 3AV2A 3WAAB 3KWQA 4KGCD 4H9QB 3AYWC 1PZRA 5B1LA 4JJNA 3UTBC 2F2AC 3WTPC 5CPKC 3X1TC 1Q9CA 3MNNA 1P3OD 4CAYB 3MGQC 4DQYB 5DNMD 3REID 1W2EA 1TAFB 5B0ZD 3AV2D 3V9RA 2BG1A 4Z5TB 3W97B 1P3MB 1N1JA 5B32A 3X1UC 3LJAC 4JJND 4H9RA 5B40C 1M1AD 4H9SA 1KX4A 3MNND 3LZ1B 2IO5C 4Z66C 2NZDA 3P5JB 3W99C 4X23A 3A1IA 3LELA 3RELC 1P3PA 3W96A 3KXBB 3MGSA 4KHAB 3W98C 3EG5B 3H0LC 2CV5A 5B32D 3MGPA 3TU4A 4YS3A 5JRGA 2ZY2A 4UUZA 5AV5C 4J8VC 3REHA 5B2JA 1S32B 3X1VA 3WA9D 3UTBB 1HQ3A 4H9PB 5CPKB 1P3FA 3MGQB 2NZDD 4G91C 4X23D 3LELD 5CPIB 1R4VA 5GT0D 3MGSD 3EPLA 2RVQD 1M1AA 3C1CB 2CV5D 1T3UA 4YS3D 5B31A 5JRGD 3UTAA 5BNVA 4R8PB 4AWLC 1M18A 5C3IC 3AZEB 5B24A 2F8NH 5B40B 3X1UB 3LJAB 1P3KC 3AZLC 1H3OA 1ZLAD 3NQJA 3R45A 1ID3A 3F6TA 2PYOD 4H9OB 2IO5B 4WU9A 4Z66B 2FJ7C 5GSUC 3UTAD 2J8PA 5B31D 3RELB 3WKJD 3W98B 2DF4C 3VH5A 3A6NA 5CHLB 1P3LA 5B0YC 3AFAD 2Y2GA 3UT9A 5AV5B 5AVBC 4J8VB 1P34C 1KX3A 5AV9B 1ID3D 3KUYC 5CPJC 3VH6T 1F66A 4WU9D 3VH6W 2ZM5A 2RIQA 4KGCB 4J8WC 4J8UC 4WU8D 2DQNC 3REKA 1P3LD 2AROA 5KDMB 3UT9D 3B6FA 4AWLB 4HGAC 1P3BA 5GT0C 4XZQD 1ULYA 1AOID 1P3GD 1F66D 1WWSA 3AV2B 2G5IC 5BO0A 1P3AD 1M19D 4LD9D 4JJNB 3WTPA 1M1AB 4QLCA 2FJ7B 5GSUB 2F8NK 3X1TA 5CP6C 5B1MD 3NQUA 3B6FD 4M6BA 4WV4B 4YM6D 2PYOC 5B0YB 1P3IA 5AVBB 1P34B 2G5HC 4WNNB 2NQBA 3H0RC 2BYKA 2F8NA 3AZGA 5DNNC 4Z5TC 3W97C 2Y2NA 5CPJB 1P3MC 3B6GD 3O62A 3AFAC 4QLCD 3X1SD 3MGRC 1U35D 4J8WB 2W8SA 3FDDA 2JSSA 3WA9B 3AZMA 1P3ID 2YFVB 4KUDC 3W99A 2NQBD 4HGAB 4J8XD 3AN2D 4WU8C 2F8ND 1BH8A 5GT0B 4NFTA 5F99C 3O62D 4H9NA 4ZUXD 5BNXB 4CSRB 1EQZA 1S32C 1JFIA 4XZQC 1AOIC 1TZYA 1P3GC 1ZLAB 5CP6B 3AZFC 1M19C 2PYOB 5CPIC 5AV6A 5GT3A 5AY8A 4XUJA 5B1MC 3C1CC 3LZ0C 3AZJD 3WKJB 4R8PC 5DNNB 2YFWA 3KWQD 1EQZD 5FUGA 3AV1A 3AZEC 5E5AA 1P3KA 5B1LD 3AFAB 3AZLA 3MGRB 1TZYD 2Y2IA 4G92C 5AVCA 5G49B 3VH6A 3AZHC 3AZIC 2UWXA 2Y2KA 3B6GC 5GT3D 4KUDB 4WU8B 3C1BC 3AV1D 5E5AD 5F99B 1Z2CB 4NE6A 3AZKA 5B33C 5GXQA 4J8XC 5AV9C 1KX4D 4XZQB 3KUYA 1AOIB 5B2IA 4ZBJC 1P3GB 3MVDA 4ZUXC 2BYMB 2Y2MA 2L5AA 1P3AB 2Y2JA 3AZFB 4KGCC 1M19B 3AZNA 4LD9B 1BFMA 1P3PD 3EPJA 3W96D 1KX5A 3B0DB 3AZKD 5B1MB 5JA4A 3LZ0B 3MGPD 5GXQD 3TU4D 1P3OC 4YM6B 3REHD 5B2JD 5DNMC 5AV8A 3REIC 2HIOA 3REJA 3X1VD 4WJ3C 1HQ3D 5B0ZC 4G92B 3AZJC 1BH9B 1P3FD 3MVDD 3AV2C 4E45A 3WAAA 3AZHB 2Y2HA 3KWQC 3AZIB 4H9QA 3B6GB 3AZND 1WWIA 4JJNC 1M1AC 3X1SB 1U35B 3MNNC 4CAYA 3C1BB 1M18D 5B24D 5AV8D 1TAFA 2HIOD 4Z2MG 5B33B 3H0MC 4J8XB 2XD5A 3AN2B 2ZY4A 4Z5TA 3W97A 1P3MA 4ZBJB 5B32C 4ZUXB 5BS7A 2ZY3A 4H9SC 3LZ1A 1KX4C 3WA9C 3A6ND 4E44A 1P3OB 2NZDC 1KX3D 4X23C 3LELC 5DNMB 3KXBA 3REIB 4KHAA 3W96C 3MGSC 1B67A 2RVQC 5B0ZB 3AZJB 2CV5C 3TU4C 3MGPC 4YS3C 5JRGC 2HUEC 3KWQB 3LZ1D 3AYWA 5B2JC 1S32A 5B1LB 3X1VC 3UTBA 3REKD 1HQ3C 4H9PA 5CPKA 1ZLAC 3MNNB 2AROD 3MGQA 4EO5C 5CPIA 1P3BD 3KXBD 2LY8A 3C1CA 2Y2OA 3V9RB 5B31C 4R8PA 3UTAC 3WKJC 2YFWB 1M18C 3AZEA 3AYWD 5B24C 2XD1A 5B40A 3X1UA 1N1JB 5B32B 3LJAA 4H9RB 3WTPD 5CPKD 3X1TD 1KX4B 1ID3C 3MGQD 4H9OA 4WU9C 2JCHA 4Z66A 5BT1D 2FFFB 2NZDB 4X23B 3RELA 3LELB 3AZGD 1P3PB 3W96B 3MGSB 3W98A 5B40D 2CV5B 1P3LC 3TU4B 3MGPB 4YS3B 5AV5A 5JRGB 4J8VA 4UUZB 3UT9C 2HUEB 1KX3C 4UPKA 5AV9A 3REHB 5B2JB 3X1VB 1HQ3B 3AZMD 1P3FB 1F66C 5B32G 4EO5B 4KGCA 3W99D 1P3AC 3AZNB 4LD9C 3W98D 3REKC 3B0DC 3B0BA 3IP4C 5KDMA 5B31B 2AROC 3UTAB 5BNVB 4J8VD 3B6FC 1M18B 4YM6C 5B24B 1P3BC 2HIOB 1H3OB 3NQJB 3R45B 1ID3B 3EPKA 4WU9B 5AV6D 2FJ7A 5GSUA 4QLCC 3X1SC
chains in the Genus database with same CATH topology
5AY8D 4XUJD 1U35C 3A6NB 2Y2QA 3EPHA 1P3KD 5B0YA 1P3LB 1P3IC 3UT9B 5BT1C 5AVBA 4WNNA 3AZLD 1P34A 1KX3B 2NQBC 5AVCD 3AN2C 1B6WA 3AZGC 5B31G 5CPJA 1F66B 3O62C 2FJ7D 5GSUD 3A1KA 4J8WA 4J8UA 3WA9A 3AL0C 3REKB 3AZMC 4NE5A 4Z2MH 5B0YD 2YFVA 2AROB 5AVBD 1P34D 3B6FB 1P3BB 5GT0A 3KUYD 5CPJD 5B2ID 2JE5A 5BNXA 4CSRA 1EQZC 5BO0B 4J8WD 4J8UD 3AYWB 4WZSB 5B1LC 3WTPB 4QLCB 1TZYC 1KX5D 1ZLAA 3X1TB 5CP6A 3NQUB 2PYOA 5AV6C 3REJD 1P3IB 5GT3C 5AY8C 4XUJC 2NQBB 3WKJA 2BYKB 2F8NB 3AZGB 5DNNA 3WAAD 3AV1C 5E5AC 3AFAA 3O62B 2VQRA 3MGRA 5CP6D 5AVCC 5G49A 1HTAA 2ZY5A 3AZMB 2Y2PA 4KUDA 3W99B 3KSYA 4WU8A 5DNND 1BH8B 4Z5TD 1P3PC 3W97D 1P3MD 5F99A 3AZKC 4H9NB 5GXQC 3MGRD 3KFUG 1EQZB 3REHC 4XZQA 1JFIB 1AOIA 2F8NG 5B2IC 1P3GA 1TZYB 2Y2LA 1P3FC 2BYMA 3MVDC 4KUDD 1P3AA 4G91B 3AZFA 3WTPE 1M19A 4LD9A 3AZNC 5AV6B 1KX5C 5GT3B 5F99D 5B1MA 5AY8B 4XUJB 3LZ0A 4YM6A 5C3IB 5FUGB 3AV1B 1S32D 5E5AB 1P3KB 5AV8C 3REJC 2HIOC 3UTBD 3AZLB 1BH9A 5AVCB 3WAAC 3AZHA 3AZIA 3B0CT 3AZFD 3B6GA 3B0CW 5CPID 3X1SA 3C1CD 1U35A 3LZ0D 4R8PD 3C1BA 3AZED 3A6NC 3AZKB 5B33A 3X1UD 3LJAD 5GXQB 4J8XA 3AN2A 3AZHD 2CWEA 3KUYB 3AZID 5B2IB 4ZUXA 1KU5A 3MVDB 5BS7C 4Z66D 4NE3A 4J8UB 3LZ1C 3RELD 3C1BD 1KX5B 3VH5T 1F1EA 5JA4B 5B33D 1P3OA 5AV5D 3VH5W 4DRBA 5AV9D 4DRAA 5DNMA 3REIA 5AV8B 1A7WA 3KXBC 3REJB 5B0ZA 3AZJA 3AV2A 3WAAB 3KWQA 4KGCD 4H9QB 3AYWC 1PZRA 5B1LA 4JJNA 3UTBC 2F2AC 3WTPC 5CPKC 3X1TC 1Q9CA 3MNNA 1P3OD 4CAYB 3MGQC 4DQYB 5DNMD 3REID 1W2EA 1TAFB 5B0ZD 3AV2D 3V9RA 2BG1A 4Z5TB 3W97B 1P3MB 1N1JA 5B32A 3X1UC 3LJAC 4JJND 4H9RA 5B40C 1M1AD 4H9SA 1KX4A 3MNND 3LZ1B 2IO5C 4Z66C 2NZDA 3P5JB 3W99C 4X23A 3A1IA 3LELA 3RELC 1P3PA 3W96A 3KXBB 3MGSA 4KHAB 3W98C 3EG5B 3H0LC 2CV5A 5B32D 3MGPA 3TU4A 4YS3A 5JRGA 2ZY2A 4UUZA 5AV5C 4J8VC 3REHA 5B2JA 1S32B 3X1VA 3WA9D 3UTBB 1HQ3A 4H9PB 5CPKB 1P3FA 3MGQB 2NZDD 4G91C 4X23D 3LELD 5CPIB 1R4VA 5GT0D 3MGSD 3EPLA 2RVQD 1M1AA 3C1CB 2CV5D 1T3UA 4YS3D 5B31A 5JRGD 3UTAA 5BNVA 4R8PB 4AWLC 1M18A 5C3IC 3AZEB 5B24A 2F8NH 5B40B 3X1UB 3LJAB 1P3KC 3AZLC 1H3OA 1ZLAD 3NQJA 3R45A 1ID3A 3F6TA 2PYOD 4H9OB 2IO5B 4WU9A 4Z66B 2FJ7C 5GSUC 3UTAD 2J8PA 5B31D 3RELB 3WKJD 3W98B 2DF4C 3VH5A 3A6NA 5CHLB 1P3LA 5B0YC 3AFAD 2Y2GA 3UT9A 5AV5B 5AVBC 4J8VB 1P34C 1KX3A 5AV9B 1ID3D 3KUYC 5CPJC 3VH6T 1F66A 4WU9D 3VH6W 2ZM5A 2RIQA 4KGCB 4J8WC 4J8UC 4WU8D 2DQNC 3REKA 1P3LD 2AROA 5KDMB 3UT9D 3B6FA 4AWLB 4HGAC 1P3BA 5GT0C 4XZQD 1ULYA 1AOID 1P3GD 1F66D 1WWSA 3AV2B 2G5IC 5BO0A 1P3AD 1M19D 4LD9D 4JJNB 3WTPA 1M1AB 4QLCA 2FJ7B 5GSUB 2F8NK 3X1TA 5CP6C 5B1MD 3NQUA 3B6FD 4M6BA 4WV4B 4YM6D 2PYOC 5B0YB 1P3IA 5AVBB 1P34B 2G5HC 4WNNB 2NQBA 3H0RC 2BYKA 2F8NA 3AZGA 5DNNC 4Z5TC 3W97C 2Y2NA 5CPJB 1P3MC 3B6GD 3O62A 3AFAC 4QLCD 3X1SD 3MGRC 1U35D 4J8WB 2W8SA 3FDDA 2JSSA 3WA9B 3AZMA 1P3ID 2YFVB 4KUDC 3W99A 2NQBD 4HGAB 4J8XD 3AN2D 4WU8C 2F8ND 1BH8A 5GT0B 4NFTA 5F99C 3O62D 4H9NA 4ZUXD 5BNXB 4CSRB 1EQZA 1S32C 1JFIA 4XZQC 1AOIC 1TZYA 1P3GC 1ZLAB 5CP6B 3AZFC 1M19C 2PYOB 5CPIC 5AV6A 5GT3A 5AY8A 4XUJA 5B1MC 3C1CC 3LZ0C 3AZJD 3WKJB 4R8PC 5DNNB 2YFWA 3KWQD 1EQZD 5FUGA 3AV1A 3AZEC 5E5AA 1P3KA 5B1LD 3AFAB 3AZLA 3MGRB 1TZYD 2Y2IA 4G92C 5AVCA 5G49B 3VH6A 3AZHC 3AZIC 2UWXA 2Y2KA 3B6GC 5GT3D 4KUDB 4WU8B 3C1BC 3AV1D 5E5AD 5F99B 1Z2CB 4NE6A 3AZKA 5B33C 5GXQA 4J8XC 5AV9C 1KX4D 4XZQB 3KUYA 1AOIB 5B2IA 4ZBJC 1P3GB 3MVDA 4ZUXC 2BYMB 2Y2MA 2L5AA 1P3AB 2Y2JA 3AZFB 4KGCC 1M19B 3AZNA 4LD9B 1BFMA 1P3PD 3EPJA 3W96D 1KX5A 3B0DB 3AZKD 5B1MB 5JA4A 3LZ0B 3MGPD 5GXQD 3TU4D 1P3OC 4YM6B 3REHD 5B2JD 5DNMC 5AV8A 3REIC 2HIOA 3REJA 3X1VD 4WJ3C 1HQ3D 5B0ZC 4G92B 3AZJC 1BH9B 1P3FD 3MVDD 3AV2C 4E45A 3WAAA 3AZHB 2Y2HA 3KWQC 3AZIB 4H9QA 3B6GB 3AZND 1WWIA 4JJNC 1M1AC 3X1SB 1U35B 3MNNC 4CAYA 3C1BB 1M18D 5B24D 5AV8D 1TAFA 2HIOD 4Z2MG 5B33B 3H0MC 4J8XB 2XD5A 3AN2B 2ZY4A 4Z5TA 3W97A 1P3MA 4ZBJB 5B32C 4ZUXB 5BS7A 2ZY3A 4H9SC 3LZ1A 1KX4C 3WA9C 3A6ND 4E44A 1P3OB 2NZDC 1KX3D 4X23C 3LELC 5DNMB 3KXBA 3REIB 4KHAA 3W96C 3MGSC 1B67A 2RVQC 5B0ZB 3AZJB 2CV5C 3TU4C 3MGPC 4YS3C 5JRGC 2HUEC 3KWQB 3LZ1D 3AYWA 5B2JC 1S32A 5B1LB 3X1VC 3UTBA 3REKD 1HQ3C 4H9PA 5CPKA 1ZLAC 3MNNB 2AROD 3MGQA 4EO5C 5CPIA 1P3BD 3KXBD 2LY8A 3C1CA 2Y2OA 3V9RB 5B31C 4R8PA 3UTAC 3WKJC 2YFWB 1M18C 3AZEA 3AYWD 5B24C 2XD1A 5B40A 3X1UA 1N1JB 5B32B 3LJAA 4H9RB 3WTPD 5CPKD 3X1TD 1KX4B 1ID3C 3MGQD 4H9OA 4WU9C 2JCHA 4Z66A 5BT1D 2FFFB 2NZDB 4X23B 3RELA 3LELB 3AZGD 1P3PB 3W96B 3MGSB 3W98A 5B40D 2CV5B 1P3LC 3TU4B 3MGPB 4YS3B 5AV5A 5JRGB 4J8VA 4UUZB 3UT9C 2HUEB 1KX3C 4UPKA 5AV9A 3REHB 5B2JB 3X1VB 1HQ3B 3AZMD 1P3FB 1F66C 5B32G 4EO5B 4KGCA 3W99D 1P3AC 3AZNB 4LD9C 3W98D 3REKC 3B0DC 3B0BA 3IP4C 5KDMA 5B31B 2AROC 3UTAB 5BNVB 4J8VD 3B6FC 1M18B 4YM6C 5B24B 1P3BC 2HIOB 1H3OB 3NQJB 3R45B 1ID3B 3EPKA 4WU9B 5AV6D 2FJ7A 5GSUA 4QLCC 3X1SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 D;  4XUJ D;  1U35 C;  3A6N B;  1P3K D;  5B0Y A;  1P3L B;  1P3I C;  3UT9 B;  5BT1 C;  5AVB A;  4WNN A;  3AZL D;  1P34 A;  1KX3 B;  2NQB C;  5AVC D;  3AN2 C;  1B6W A;  3AZG C;  5B31 G;  5CPJ A;  1F66 B;  3O62 C;  2FJ7 D;  5GSU D;  4J8W A;  4J8U A;  3WA9 A;  3REK B;  3AZM C;  4NE5 A;  4Z2M H;  5B0Y D;  2YFV A;  2ARO B;  5AVB D;  1P34 D;  3B6F B;  1P3B B;  5GT0 A;  3KUY D;  5CPJ D;  5B2I D;  5BNX A;  4CSR A;  1EQZ C;  5BO0 B;  4J8W D;  4J8U D;  3AYW B;  4WZS B;  5B1L C;  3WTP B;  4QLC B;  1TZY C;  1KX5 D;  1ZLA A;  3X1T B;  5CP6 A;  3NQU B;  2PYO A;  5AV6 C;  3REJ D;  1P3I B;  5GT3 C;  5AY8 C;  4XUJ C;  2NQB B;  3WKJ A;  2BYK B;  2F8N B;  3AZG B;  5DNN A;  3WAA D;  3AV1 C;  5E5A C;  3AFA A;  3O62 B;  3MGR A;  5CP6 D;  5AVC C;  5G49 A;  1HTA A;  3AZM B;  4KUD A;  3W99 B;  3KSY A;  4WU8 A;  5DNN D;  1BH8 B;  4Z5T D;  1P3P C;  3W97 D;  1P3M D;  5F99 A;  3AZK C;  4H9N B;  5GXQ C;  3MGR D;  1EQZ B;  3REH C;  4XZQ A;  1JFI B;  1AOI A;  2F8N G;  5B2I C;  1P3G A;  1TZY B;  1P3F C;  2BYM A;  3MVD C;  4KUD D;  1P3A A;  4G91 B;  3AZF A;  3WTP E;  1M19 A;  4LD9 A;  3AZN C;  5AV6 B;  1KX5 C;  5GT3 B;  5F99 D;  5B1M A;  5AY8 B;  4XUJ B;  3LZ0 A;  4YM6 A;  5C3I B;  5FUG B;  3AV1 B;  1S32 D;  5E5A B;  1P3K B;  5AV8 C;  3REJ C;  2HIO C;  3UTB D;  3AZL B;  1BH9 A;  5AVC B;  3WAA C;  3AZH A;  3AZI A;  3B0C T;  3AZF D;  3B6G A;  3B0C W;  5CPI D;  3X1S A;  3C1C D;  1U35 A;  3LZ0 D;  4R8P D;  3C1B A;  3AZE D;  3A6N C;  3AZK B;  5B33 A;  3X1U D;  3LJA D;  5GXQ B;  4J8X A;  3AN2 A;  3AZH D;  2CWE A;  3KUY B;  3AZI D;  5B2I B;  4ZUX A;  1KU5 A;  3MVD B;  5BS7 C;  4Z66 D;  4NE3 A;  4J8U B;  3LZ1 C;  3REL D;  3C1B D;  1KX5 B;  3VH5 T;  1F1E A;  5JA4 B;  5B33 D;  1P3O A;  5AV5 D;  3VH5 W;  4DRB A;  5AV9 D;  4DRA A;  5DNM A;  3REI A;  5AV8 B;  1A7W A;  3KXB C;  3REJ B;  5B0Z A;  3AZJ A;  3AV2 A;  3WAA B;  3KWQ A;  4KGC D;  4H9Q B;  3AYW C;  5B1L A;  4JJN A;  3UTB C;  3WTP C;  5CPK C;  3X1T C;  1Q9C A;  3MNN A;  1P3O D;  4CAY B;  3MGQ C;  5DNM D;  3REI D;  1TAF B;  5B0Z D;  3AV2 D;  3V9R A;  4Z5T B;  3W97 B;  1P3M B;  1N1J A;  5B32 A;  3X1U C;  3LJA C;  4JJN D;  4H9R A;  5B40 C;  1M1A D;  4H9S A;  1KX4 A;  3MNN D;  3LZ1 B;  2IO5 C;  4Z66 C;  2NZD A;  3W99 C;  4X23 A;  3LEL A;  3REL C;  1P3P A;  3W96 A;  3KXB B;  3MGS A;  4KHA B;  3W98 C;  2CV5 A;  5B32 D;  3MGP A;  3TU4 A;  4YS3 A;  5JRG A;  4UUZ A;  5AV5 C;  4J8V C;  3REH A;  5B2J A;  1S32 B;  3X1V A;  3WA9 D;  3UTB B;  1HQ3 A;  4H9P B;  5CPK B;  1P3F A;  3MGQ B;  2NZD D;  4G91 C;  4X23 D;  3LEL D;  5CPI B;  1R4V A;  5GT0 D;  3MGS D;  2RVQ D;  1M1A A;  3C1C B;  2CV5 D;  4YS3 D;  5B31 A;  5JRG D;  3UTA A;  5BNV A;  4R8P B;  4AWL C;  1M18 A;  5C3I C;  3AZE B;  5B24 A;  2F8N H;  5B40 B;  3X1U B;  3LJA B;  1P3K C;  3AZL C;  1H3O A;  1ZLA D;  3NQJ A;  3R45 A;  1ID3 A;  2PYO D;  4H9O B;  2IO5 B;  4WU9 A;  4Z66 B;  2FJ7 C;  5GSU C;  3UTA D;  5B31 D;  3REL B;  3WKJ D;  3W98 B;  3VH5 A;  3A6N A;  5CHL B;  1P3L A;  5B0Y C;  3AFA D;  3UT9 A;  5AV5 B;  5AVB C;  4J8V B;  1P34 C;  1KX3 A;  5AV9 B;  1ID3 D;  3KUY C;  5CPJ C;  3VH6 T;  1F66 A;  4WU9 D;  3VH6 W;  4KGC B;  4J8W C;  4J8U C;  4WU8 D;  3REK A;  1P3L D;  2ARO A;  5KDM B;  3UT9 D;  3B6F A;  4AWL B;  4HGA C;  1P3B A;  5GT0 C;  4XZQ D;  1ULY A;  1AOI D;  1P3G D;  1F66 D;  1WWS A;  3AV2 B;  5BO0 A;  1P3A D;  1M19 D;  4LD9 D;  4JJN B;  3WTP A;  1M1A B;  4QLC A;  2FJ7 B;  5GSU B;  2F8N K;  3X1T A;  5CP6 C;  5B1M D;  3NQU A;  3B6F D;  4M6B A;  4WV4 B;  4YM6 D;  2PYO C;  5B0Y B;  1P3I A;  5AVB B;  1P34 B;  4WNN B;  2NQB A;  2BYK A;  2F8N A;  3AZG A;  5DNN C;  4Z5T C;  3W97 C;  5CPJ B;  1P3M C;  3B6G D;  3O62 A;  3AFA C;  4QLC D;  3X1S D;  3MGR C;  1U35 D;  4J8W B;  2JSS A;  3WA9 B;  3AZM A;  1P3I D;  2YFV B;  4KUD C;  3W99 A;  2NQB D;  4HGA B;  4J8X D;  3AN2 D;  4WU8 C;  2F8N D;  1BH8 A;  5GT0 B;  4NFT A;  5F99 C;  3O62 D;  4H9N A;  4ZUX D;  5BNX B;  4CSR B;  1EQZ A;  1S32 C;  1JFI A;  4XZQ C;  1AOI C;  1TZY A;  1P3G C;  1ZLA B;  5CP6 B;  3AZF C;  1M19 C;  2PYO B;  5CPI C;  5AV6 A;  5GT3 A;  5AY8 A;  4XUJ A;  5B1M C;  3C1C C;  3LZ0 C;  3AZJ D;  3WKJ B;  4R8P C;  5DNN B;  2YFW A;  3KWQ D;  1EQZ D;  5FUG A;  3AV1 A;  3AZE C;  5E5A A;  1P3K A;  5B1L D;  3AFA B;  3AZL A;  3MGR B;  1TZY D;  4G92 C;  5AVC A;  5G49 B;  3VH6 A;  3AZH C;  3AZI C;  3B6G C;  5GT3 D;  4KUD B;  4WU8 B;  3C1B C;  3AV1 D;  5E5A D;  5F99 B;  4NE6 A;  3AZK A;  5B33 C;  5GXQ A;  4J8X C;  5AV9 C;  1KX4 D;  4XZQ B;  3KUY A;  1AOI B;  5B2I A;  4ZBJ C;  1P3G B;  3MVD A;  4ZUX C;  2BYM B;  2L5A A;  1P3A B;  3AZF B;  4KGC C;  1M19 B;  3AZN A;  4LD9 B;  1BFM A;  1P3P D;  3W96 D;  1KX5 A;  3B0D B;  3AZK D;  5B1M B;  5JA4 A;  3LZ0 B;  3MGP D;  5GXQ D;  3TU4 D;  1P3O C;  4YM6 B;  3REH D;  5B2J D;  5DNM C;  5AV8 A;  3REI C;  2HIO A;  3REJ A;  3X1V D;  1HQ3 D;  5B0Z C;  4G92 B;  3AZJ C;  1BH9 B;  1P3F D;  3MVD D;  3AV2 C;  4E45 A;  3WAA A;  3AZH B;  3KWQ C;  3AZI B;  4H9Q A;  3B6G B;  3AZN D;  1WWI A;  4JJN C;  1M1A C;  3X1S B;  1U35 B;  3MNN C;  4CAY A;  3C1B B;  1M18 D;  5B24 D;  5AV8 D;  1TAF A;  2HIO D;  4Z2M G;  5B33 B;  4J8X B;  3AN2 B;  4Z5T A;  3W97 A;  1P3M A;  4ZBJ B;  5B32 C;  4ZUX B;  5BS7 A;  4H9S C;  3LZ1 A;  1KX4 C;  3WA9 C;  3A6N D;  4E44 A;  1P3O B;  2NZD C;  1KX3 D;  4X23 C;  3LEL C;  5DNM B;  3KXB A;  3REI B;  4KHA A;  3W96 C;  3MGS C;  1B67 A;  2RVQ C;  5B0Z B;  3AZJ B;  2CV5 C;  3TU4 C;  3MGP C;  4YS3 C;  5JRG C;  2HUE C;  3KWQ B;  3LZ1 D;  3AYW A;  5B2J C;  1S32 A;  5B1L B;  3X1V C;  3UTB A;  3REK D;  1HQ3 C;  4H9P A;  5CPK A;  1ZLA C;  3MNN B;  2ARO D;  3MGQ A;  4EO5 C;  5CPI A;  1P3B D;  3KXB D;  2LY8 A;  3C1C A;  3V9R B;  5B31 C;  4R8P A;  3UTA C;  3WKJ C;  2YFW B;  1M18 C;  3AZE A;  3AYW D;  5B24 C;  5B40 A;  3X1U A;  3LJA A;  1N1J B;  5B32 B;  4H9R B;  3WTP D;  5CPK D;  3X1T D;  1KX4 B;  1ID3 C;  3MGQ D;  4H9O A;  4WU9 C;  4Z66 A;  5BT1 D;  2NZD B;  4X23 B;  3REL A;  3LEL B;  3AZG D;  1P3P B;  3W96 B;  3MGS B;  3W98 A;  5B40 D;  2CV5 B;  1P3L C;  3TU4 B;  3MGP B;  4YS3 B;  5AV5 A;  5JRG B;  4J8V A;  4UUZ B;  3UT9 C;  2HUE B;  1KX3 C;  5AV9 A;  3REH B;  5B2J B;  3X1V B;  1HQ3 B;  3AZM D;  1P3F B;  1F66 C;  5B32 G;  4EO5 B;  4KGC A;  3W99 D;  1P3A C;  3AZN B;  4LD9 C;  3W98 D;  3REK C;  3B0D C;  3B0B A;  5KDM A;  5B31 B;  2ARO C;  3UTA B;  5BNV B;  4J8V D;  3B6F C;  1M18 B;  4YM6 C;  5B24 B;  1P3B C;  2HIO B;  1H3O B;  3NQJ B;  3R45 B;  1ID3 B;  4WU9 B;  5AV6 D;  2FJ7 A;  5GSU A;  4QLC C;  3X1S C; 
#chains in the Genus database with same CATH topology
 5AY8 D;  4XUJ D;  1U35 C;  3A6N B;  2Y2Q A;  3EPH A;  1P3K D;  5B0Y A;  1P3L B;  1P3I C;  3UT9 B;  5BT1 C;  5AVB A;  4WNN A;  3AZL D;  1P34 A;  1KX3 B;  2NQB C;  5AVC D;  3AN2 C;  1B6W A;  3AZG C;  5B31 G;  5CPJ A;  1F66 B;  3O62 C;  2FJ7 D;  5GSU D;  3A1K A;  4J8W A;  4J8U A;  3WA9 A;  3AL0 C;  3REK B;  3AZM C;  4NE5 A;  4Z2M H;  5B0Y D;  2YFV A;  2ARO B;  5AVB D;  1P34 D;  3B6F B;  1P3B B;  5GT0 A;  3KUY D;  5CPJ D;  5B2I D;  2JE5 A;  5BNX A;  4CSR A;  1EQZ C;  5BO0 B;  4J8W D;  4J8U D;  3AYW B;  4WZS B;  5B1L C;  3WTP B;  4QLC B;  1TZY C;  1KX5 D;  1ZLA A;  3X1T B;  5CP6 A;  3NQU B;  2PYO A;  5AV6 C;  3REJ D;  1P3I B;  5GT3 C;  5AY8 C;  4XUJ C;  2NQB B;  3WKJ A;  2BYK B;  2F8N B;  3AZG B;  5DNN A;  3WAA D;  3AV1 C;  5E5A C;  3AFA A;  3O62 B;  2VQR A;  3MGR A;  5CP6 D;  5AVC C;  5G49 A;  1HTA A;  2ZY5 A;  3AZM B;  2Y2P A;  4KUD A;  3W99 B;  3KSY A;  4WU8 A;  5DNN D;  1BH8 B;  4Z5T D;  1P3P C;  3W97 D;  1P3M D;  5F99 A;  3AZK C;  4H9N B;  5GXQ C;  3MGR D;  3KFU G;  1EQZ B;  3REH C;  4XZQ A;  1JFI B;  1AOI A;  2F8N G;  5B2I C;  1P3G A;  1TZY B;  2Y2L A;  1P3F C;  2BYM A;  3MVD C;  4KUD D;  1P3A A;  4G91 B;  3AZF A;  3WTP E;  1M19 A;  4LD9 A;  3AZN C;  5AV6 B;  1KX5 C;  5GT3 B;  5F99 D;  5B1M A;  5AY8 B;  4XUJ B;  3LZ0 A;  4YM6 A;  5C3I B;  5FUG B;  3AV1 B;  1S32 D;  5E5A B;  1P3K B;  5AV8 C;  3REJ C;  2HIO C;  3UTB D;  3AZL B;  1BH9 A;  5AVC B;  3WAA C;  3AZH A;  3AZI A;  3B0C T;  3AZF D;  3B6G A;  3B0C W;  5CPI D;  3X1S A;  3C1C D;  1U35 A;  3LZ0 D;  4R8P D;  3C1B A;  3AZE D;  3A6N C;  3AZK B;  5B33 A;  3X1U D;  3LJA D;  5GXQ B;  4J8X A;  3AN2 A;  3AZH D;  2CWE A;  3KUY B;  3AZI D;  5B2I B;  4ZUX A;  1KU5 A;  3MVD B;  5BS7 C;  4Z66 D;  4NE3 A;  4J8U B;  3LZ1 C;  3REL D;  3C1B D;  1KX5 B;  3VH5 T;  1F1E A;  5JA4 B;  5B33 D;  1P3O A;  5AV5 D;  3VH5 W;  4DRB A;  5AV9 D;  4DRA A;  5DNM A;  3REI A;  5AV8 B;  1A7W A;  3KXB C;  3REJ B;  5B0Z A;  3AZJ A;  3AV2 A;  3WAA B;  3KWQ A;  4KGC D;  4H9Q B;  3AYW C;  1PZR A;  5B1L A;  4JJN A;  3UTB C;  2F2A C;  3WTP C;  5CPK C;  3X1T C;  1Q9C A;  3MNN A;  1P3O D;  4CAY B;  3MGQ C;  4DQY B;  5DNM D;  3REI D;  1W2E A;  1TAF B;  5B0Z D;  3AV2 D;  3V9R A;  2BG1 A;  4Z5T B;  3W97 B;  1P3M B;  1N1J A;  5B32 A;  3X1U C;  3LJA C;  4JJN D;  4H9R A;  5B40 C;  1M1A D;  4H9S A;  1KX4 A;  3MNN D;  3LZ1 B;  2IO5 C;  4Z66 C;  2NZD A;  3P5J B;  3W99 C;  4X23 A;  3A1I A;  3LEL A;  3REL C;  1P3P A;  3W96 A;  3KXB B;  3MGS A;  4KHA B;  3W98 C;  3EG5 B;  3H0L C;  2CV5 A;  5B32 D;  3MGP A;  3TU4 A;  4YS3 A;  5JRG A;  2ZY2 A;  4UUZ A;  5AV5 C;  4J8V C;  3REH A;  5B2J A;  1S32 B;  3X1V A;  3WA9 D;  3UTB B;  1HQ3 A;  4H9P B;  5CPK B;  1P3F A;  3MGQ B;  2NZD D;  4G91 C;  4X23 D;  3LEL D;  5CPI B;  1R4V A;  5GT0 D;  3MGS D;  3EPL A;  2RVQ D;  1M1A A;  3C1C B;  2CV5 D;  1T3U A;  4YS3 D;  5B31 A;  5JRG D;  3UTA A;  5BNV A;  4R8P B;  4AWL C;  1M18 A;  5C3I C;  3AZE B;  5B24 A;  2F8N H;  5B40 B;  3X1U B;  3LJA B;  1P3K C;  3AZL C;  1H3O A;  1ZLA D;  3NQJ A;  3R45 A;  1ID3 A;  3F6T A;  2PYO D;  4H9O B;  2IO5 B;  4WU9 A;  4Z66 B;  2FJ7 C;  5GSU C;  3UTA D;  2J8P A;  5B31 D;  3REL B;  3WKJ D;  3W98 B;  2DF4 C;  3VH5 A;  3A6N A;  5CHL B;  1P3L A;  5B0Y C;  3AFA D;  2Y2G A;  3UT9 A;  5AV5 B;  5AVB C;  4J8V B;  1P34 C;  1KX3 A;  5AV9 B;  1ID3 D;  3KUY C;  5CPJ C;  3VH6 T;  1F66 A;  4WU9 D;  3VH6 W;  2ZM5 A;  2RIQ A;  4KGC B;  4J8W C;  4J8U C;  4WU8 D;  2DQN C;  3REK A;  1P3L D;  2ARO A;  5KDM B;  3UT9 D;  3B6F A;  4AWL B;  4HGA C;  1P3B A;  5GT0 C;  4XZQ D;  1ULY A;  1AOI D;  1P3G D;  1F66 D;  1WWS A;  3AV2 B;  2G5I C;  5BO0 A;  1P3A D;  1M19 D;  4LD9 D;  4JJN B;  3WTP A;  1M1A B;  4QLC A;  2FJ7 B;  5GSU B;  2F8N K;  3X1T A;  5CP6 C;  5B1M D;  3NQU A;  3B6F D;  4M6B A;  4WV4 B;  4YM6 D;  2PYO C;  5B0Y B;  1P3I A;  5AVB B;  1P34 B;  2G5H C;  4WNN B;  2NQB A;  3H0R C;  2BYK A;  2F8N A;  3AZG A;  5DNN C;  4Z5T C;  3W97 C;  2Y2N A;  5CPJ B;  1P3M C;  3B6G D;  3O62 A;  3AFA C;  4QLC D;  3X1S D;  3MGR C;  1U35 D;  4J8W B;  2W8S A;  3FDD A;  2JSS A;  3WA9 B;  3AZM A;  1P3I D;  2YFV B;  4KUD C;  3W99 A;  2NQB D;  4HGA B;  4J8X D;  3AN2 D;  4WU8 C;  2F8N D;  1BH8 A;  5GT0 B;  4NFT A;  5F99 C;  3O62 D;  4H9N A;  4ZUX D;  5BNX B;  4CSR B;  1EQZ A;  1S32 C;  1JFI A;  4XZQ C;  1AOI C;  1TZY A;  1P3G C;  1ZLA B;  5CP6 B;  3AZF C;  1M19 C;  2PYO B;  5CPI C;  5AV6 A;  5GT3 A;  5AY8 A;  4XUJ A;  5B1M C;  3C1C C;  3LZ0 C;  3AZJ D;  3WKJ B;  4R8P C;  5DNN B;  2YFW A;  3KWQ D;  1EQZ D;  5FUG A;  3AV1 A;  3AZE C;  5E5A A;  1P3K A;  5B1L D;  3AFA B;  3AZL A;  3MGR B;  1TZY D;  2Y2I A;  4G92 C;  5AVC A;  5G49 B;  3VH6 A;  3AZH C;  3AZI C;  2UWX A;  2Y2K A;  3B6G C;  5GT3 D;  4KUD B;  4WU8 B;  3C1B C;  3AV1 D;  5E5A D;  5F99 B;  1Z2C B;  4NE6 A;  3AZK A;  5B33 C;  5GXQ A;  4J8X C;  5AV9 C;  1KX4 D;  4XZQ B;  3KUY A;  1AOI B;  5B2I A;  4ZBJ C;  1P3G B;  3MVD A;  4ZUX C;  2BYM B;  2Y2M A;  2L5A A;  1P3A B;  2Y2J A;  3AZF B;  4KGC C;  1M19 B;  3AZN A;  4LD9 B;  1BFM A;  1P3P D;  3EPJ A;  3W96 D;  1KX5 A;  3B0D B;  3AZK D;  5B1M B;  5JA4 A;  3LZ0 B;  3MGP D;  5GXQ D;  3TU4 D;  1P3O C;  4YM6 B;  3REH D;  5B2J D;  5DNM C;  5AV8 A;  3REI C;  2HIO A;  3REJ A;  3X1V D;  4WJ3 C;  1HQ3 D;  5B0Z C;  4G92 B;  3AZJ C;  1BH9 B;  1P3F D;  3MVD D;  3AV2 C;  4E45 A;  3WAA A;  3AZH B;  2Y2H A;  3KWQ C;  3AZI B;  4H9Q A;  3B6G B;  3AZN D;  1WWI A;  4JJN C;  1M1A C;  3X1S B;  1U35 B;  3MNN C;  4CAY A;  3C1B B;  1M18 D;  5B24 D;  5AV8 D;  1TAF A;  2HIO D;  4Z2M G;  5B33 B;  3H0M C;  4J8X B;  2XD5 A;  3AN2 B;  2ZY4 A;  4Z5T A;  3W97 A;  1P3M A;  4ZBJ B;  5B32 C;  4ZUX B;  5BS7 A;  2ZY3 A;  4H9S C;  3LZ1 A;  1KX4 C;  3WA9 C;  3A6N D;  4E44 A;  1P3O B;  2NZD C;  1KX3 D;  4X23 C;  3LEL C;  5DNM B;  3KXB A;  3REI B;  4KHA A;  3W96 C;  3MGS C;  1B67 A;  2RVQ C;  5B0Z B;  3AZJ B;  2CV5 C;  3TU4 C;  3MGP C;  4YS3 C;  5JRG C;  2HUE C;  3KWQ B;  3LZ1 D;  3AYW A;  5B2J C;  1S32 A;  5B1L B;  3X1V C;  3UTB A;  3REK D;  1HQ3 C;  4H9P A;  5CPK A;  1ZLA C;  3MNN B;  2ARO D;  3MGQ A;  4EO5 C;  5CPI A;  1P3B D;  3KXB D;  2LY8 A;  3C1C A;  2Y2O A;  3V9R B;  5B31 C;  4R8P A;  3UTA C;  3WKJ C;  2YFW B;  1M18 C;  3AZE A;  3AYW D;  5B24 C;  2XD1 A;  5B40 A;  3X1U A;  1N1J B;  5B32 B;  3LJA A;  4H9R B;  3WTP D;  5CPK D;  3X1T D;  1KX4 B;  1ID3 C;  3MGQ D;  4H9O A;  4WU9 C;  2JCH A;  4Z66 A;  5BT1 D;  2FFF B;  2NZD B;  4X23 B;  3REL A;  3LEL B;  3AZG D;  1P3P B;  3W96 B;  3MGS B;  3W98 A;  5B40 D;  2CV5 B;  1P3L C;  3TU4 B;  3MGP B;  4YS3 B;  5AV5 A;  5JRG B;  4J8V A;  4UUZ B;  3UT9 C;  2HUE B;  1KX3 C;  4UPK A;  5AV9 A;  3REH B;  5B2J B;  3X1V B;  1HQ3 B;  3AZM D;  1P3F B;  1F66 C;  5B32 G;  4EO5 B;  4KGC A;  3W99 D;  1P3A C;  3AZN B;  4LD9 C;  3W98 D;  3REK C;  3B0D C;  3B0B A;  3IP4 C;  5KDM A;  5B31 B;  2ARO C;  3UTA B;  5BNV B;  4J8V D;  3B6F C;  1M18 B;  4YM6 C;  5B24 B;  1P3B C;  2HIO B;  1H3O B;  3NQJ B;  3R45 B;  1ID3 B;  3EPK A;  4WU9 B;  5AV6 D;  2FJ7 A;  5GSU A;  4QLC C;  3X1S C; 
#chains in the Genus database with same CATH homology
 5AY8 D;  4XUJ D;  1U35 C;  3A6N B;  2Y2Q A;  3EPH A;  1P3K D;  5B0Y A;  1P3L B;  1P3I C;  3UT9 B;  5BT1 C;  5AVB A;  4WNN A;  3AZL D;  1P34 A;  1KX3 B;  2NQB C;  5AVC D;  3AN2 C;  1B6W A;  3AZG C;  5B31 G;  5CPJ A;  1F66 B;  3O62 C;  2FJ7 D;  5GSU D;  3A1K A;  4J8W A;  4J8U A;  3WA9 A;  3AL0 C;  3REK B;  3AZM C;  4NE5 A;  4Z2M H;  5B0Y D;  2YFV A;  2ARO B;  5AVB D;  1P34 D;  3B6F B;  1P3B B;  5GT0 A;  3KUY D;  5CPJ D;  5B2I D;  2JE5 A;  5BNX A;  4CSR A;  1EQZ C;  5BO0 B;  4J8W D;  4J8U D;  3AYW B;  4WZS B;  5B1L C;  3WTP B;  4QLC B;  1TZY C;  1KX5 D;  1ZLA A;  3X1T B;  5CP6 A;  3NQU B;  2PYO A;  5AV6 C;  3REJ D;  1P3I B;  5GT3 C;  5AY8 C;  4XUJ C;  2NQB B;  3WKJ A;  2BYK B;  2F8N B;  3AZG B;  5DNN A;  3WAA D;  3AV1 C;  5E5A C;  3AFA A;  3O62 B;  2VQR A;  3MGR A;  5CP6 D;  5AVC C;  5G49 A;  1HTA A;  2ZY5 A;  3AZM B;  2Y2P A;  4KUD A;  3W99 B;  3KSY A;  4WU8 A;  5DNN D;  1BH8 B;  4Z5T D;  1P3P C;  3W97 D;  1P3M D;  5F99 A;  3AZK C;  4H9N B;  5GXQ C;  3MGR D;  3KFU G;  1EQZ B;  3REH C;  4XZQ A;  1JFI B;  1AOI A;  2F8N G;  5B2I C;  1P3G A;  1TZY B;  2Y2L A;  1P3F C;  2BYM A;  3MVD C;  4KUD D;  1P3A A;  4G91 B;  3AZF A;  3WTP E;  1M19 A;  4LD9 A;  3AZN C;  5AV6 B;  1KX5 C;  5GT3 B;  5F99 D;  5B1M A;  5AY8 B;  4XUJ B;  3LZ0 A;  4YM6 A;  5C3I B;  5FUG B;  3AV1 B;  1S32 D;  5E5A B;  1P3K B;  5AV8 C;  3REJ C;  2HIO C;  3UTB D;  3AZL B;  1BH9 A;  5AVC B;  3WAA C;  3AZH A;  3AZI A;  3B0C T;  3AZF D;  3B6G A;  3B0C W;  5CPI D;  3X1S A;  3C1C D;  1U35 A;  3LZ0 D;  4R8P D;  3C1B A;  3AZE D;  3A6N C;  3AZK B;  5B33 A;  3X1U D;  3LJA D;  5GXQ B;  4J8X A;  3AN2 A;  3AZH D;  2CWE A;  3KUY B;  3AZI D;  5B2I B;  4ZUX A;  1KU5 A;  3MVD B;  5BS7 C;  4Z66 D;  4NE3 A;  4J8U B;  3LZ1 C;  3REL D;  3C1B D;  1KX5 B;  3VH5 T;  1F1E A;  5JA4 B;  5B33 D;  1P3O A;  5AV5 D;  3VH5 W;  4DRB A;  5AV9 D;  4DRA A;  5DNM A;  3REI A;  5AV8 B;  1A7W A;  3KXB C;  3REJ B;  5B0Z A;  3AZJ A;  3AV2 A;  3WAA B;  3KWQ A;  4KGC D;  4H9Q B;  3AYW C;  1PZR A;  5B1L A;  4JJN A;  3UTB C;  2F2A C;  3WTP C;  5CPK C;  3X1T C;  1Q9C A;  3MNN A;  1P3O D;  4CAY B;  3MGQ C;  4DQY B;  5DNM D;  3REI D;  1W2E A;  1TAF B;  5B0Z D;  3AV2 D;  3V9R A;  2BG1 A;  4Z5T B;  3W97 B;  1P3M B;  1N1J A;  5B32 A;  3X1U C;  3LJA C;  4JJN D;  4H9R A;  5B40 C;  1M1A D;  4H9S A;  1KX4 A;  3MNN D;  3LZ1 B;  2IO5 C;  4Z66 C;  2NZD A;  3P5J B;  3W99 C;  4X23 A;  3A1I A;  3LEL A;  3REL C;  1P3P A;  3W96 A;  3KXB B;  3MGS A;  4KHA B;  3W98 C;  3EG5 B;  3H0L C;  2CV5 A;  5B32 D;  3MGP A;  3TU4 A;  4YS3 A;  5JRG A;  2ZY2 A;  4UUZ A;  5AV5 C;  4J8V C;  3REH A;  5B2J A;  1S32 B;  3X1V A;  3WA9 D;  3UTB B;  1HQ3 A;  4H9P B;  5CPK B;  1P3F A;  3MGQ B;  2NZD D;  4G91 C;  4X23 D;  3LEL D;  5CPI B;  1R4V A;  5GT0 D;  3MGS D;  3EPL A;  2RVQ D;  1M1A A;  3C1C B;  2CV5 D;  1T3U A;  4YS3 D;  5B31 A;  5JRG D;  3UTA A;  5BNV A;  4R8P B;  4AWL C;  1M18 A;  5C3I C;  3AZE B;  5B24 A;  2F8N H;  5B40 B;  3X1U B;  3LJA B;  1P3K C;  3AZL C;  1H3O A;  1ZLA D;  3NQJ A;  3R45 A;  1ID3 A;  3F6T A;  2PYO D;  4H9O B;  2IO5 B;  4WU9 A;  4Z66 B;  2FJ7 C;  5GSU C;  3UTA D;  2J8P A;  5B31 D;  3REL B;  3WKJ D;  3W98 B;  2DF4 C;  3VH5 A;  3A6N A;  5CHL B;  1P3L A;  5B0Y C;  3AFA D;  2Y2G A;  3UT9 A;  5AV5 B;  5AVB C;  4J8V B;  1P34 C;  1KX3 A;  5AV9 B;  1ID3 D;  3KUY C;  5CPJ C;  3VH6 T;  1F66 A;  4WU9 D;  3VH6 W;  2ZM5 A;  2RIQ A;  4KGC B;  4J8W C;  4J8U C;  4WU8 D;  2DQN C;  3REK A;  1P3L D;  2ARO A;  5KDM B;  3UT9 D;  3B6F A;  4AWL B;  4HGA C;  1P3B A;  5GT0 C;  4XZQ D;  1ULY A;  1AOI D;  1P3G D;  1F66 D;  1WWS A;  3AV2 B;  2G5I C;  5BO0 A;  1P3A D;  1M19 D;  4LD9 D;  4JJN B;  3WTP A;  1M1A B;  4QLC A;  2FJ7 B;  5GSU B;  2F8N K;  3X1T A;  5CP6 C;  5B1M D;  3NQU A;  3B6F D;  4M6B A;  4WV4 B;  4YM6 D;  2PYO C;  5B0Y B;  1P3I A;  5AVB B;  1P34 B;  2G5H C;  4WNN B;  2NQB A;  3H0R C;  2BYK A;  2F8N A;  3AZG A;  5DNN C;  4Z5T C;  3W97 C;  2Y2N A;  5CPJ B;  1P3M C;  3B6G D;  3O62 A;  3AFA C;  4QLC D;  3X1S D;  3MGR C;  1U35 D;  4J8W B;  2W8S A;  3FDD A;  2JSS A;  3WA9 B;  3AZM A;  1P3I D;  2YFV B;  4KUD C;  3W99 A;  2NQB D;  4HGA B;  4J8X D;  3AN2 D;  4WU8 C;  2F8N D;  1BH8 A;  5GT0 B;  4NFT A;  5F99 C;  3O62 D;  4H9N A;  4ZUX D;  5BNX B;  4CSR B;  1EQZ A;  1S32 C;  1JFI A;  4XZQ C;  1AOI C;  1TZY A;  1P3G C;  1ZLA B;  5CP6 B;  3AZF C;  1M19 C;  2PYO B;  5CPI C;  5AV6 A;  5GT3 A;  5AY8 A;  4XUJ A;  5B1M C;  3C1C C;  3LZ0 C;  3AZJ D;  3WKJ B;  4R8P C;  5DNN B;  2YFW A;  3KWQ D;  1EQZ D;  5FUG A;  3AV1 A;  3AZE C;  5E5A A;  1P3K A;  5B1L D;  3AFA B;  3AZL A;  3MGR B;  1TZY D;  2Y2I A;  4G92 C;  5AVC A;  5G49 B;  3VH6 A;  3AZH C;  3AZI C;  2UWX A;  2Y2K A;  3B6G C;  5GT3 D;  4KUD B;  4WU8 B;  3C1B C;  3AV1 D;  5E5A D;  5F99 B;  1Z2C B;  4NE6 A;  3AZK A;  5B33 C;  5GXQ A;  4J8X C;  5AV9 C;  1KX4 D;  4XZQ B;  3KUY A;  1AOI B;  5B2I A;  4ZBJ C;  1P3G B;  3MVD A;  4ZUX C;  2BYM B;  2Y2M A;  2L5A A;  1P3A B;  2Y2J A;  3AZF B;  4KGC C;  1M19 B;  3AZN A;  4LD9 B;  1BFM A;  1P3P D;  3EPJ A;  3W96 D;  1KX5 A;  3B0D B;  3AZK D;  5B1M B;  5JA4 A;  3LZ0 B;  3MGP D;  5GXQ D;  3TU4 D;  1P3O C;  4YM6 B;  3REH D;  5B2J D;  5DNM C;  5AV8 A;  3REI C;  2HIO A;  3REJ A;  3X1V D;  4WJ3 C;  1HQ3 D;  5B0Z C;  4G92 B;  3AZJ C;  1BH9 B;  1P3F D;  3MVD D;  3AV2 C;  4E45 A;  3WAA A;  3AZH B;  2Y2H A;  3KWQ C;  3AZI B;  4H9Q A;  3B6G B;  3AZN D;  1WWI A;  4JJN C;  1M1A C;  3X1S B;  1U35 B;  3MNN C;  4CAY A;  3C1B B;  1M18 D;  5B24 D;  5AV8 D;  1TAF A;  2HIO D;  4Z2M G;  5B33 B;  3H0M C;  4J8X B;  2XD5 A;  3AN2 B;  2ZY4 A;  4Z5T A;  3W97 A;  1P3M A;  4ZBJ B;  5B32 C;  4ZUX B;  5BS7 A;  2ZY3 A;  4H9S C;  3LZ1 A;  1KX4 C;  3WA9 C;  3A6N D;  4E44 A;  1P3O B;  2NZD C;  1KX3 D;  4X23 C;  3LEL C;  5DNM B;  3KXB A;  3REI B;  4KHA A;  3W96 C;  3MGS C;  1B67 A;  2RVQ C;  5B0Z B;  3AZJ B;  2CV5 C;  3TU4 C;  3MGP C;  4YS3 C;  5JRG C;  2HUE C;  3KWQ B;  3LZ1 D;  3AYW A;  5B2J C;  1S32 A;  5B1L B;  3X1V C;  3UTB A;  3REK D;  1HQ3 C;  4H9P A;  5CPK A;  1ZLA C;  3MNN B;  2ARO D;  3MGQ A;  4EO5 C;  5CPI A;  1P3B D;  3KXB D;  2LY8 A;  3C1C A;  2Y2O A;  3V9R B;  5B31 C;  4R8P A;  3UTA C;  3WKJ C;  2YFW B;  1M18 C;  3AZE A;  3AYW D;  5B24 C;  2XD1 A;  5B40 A;  3X1U A;  1N1J B;  5B32 B;  3LJA A;  4H9R B;  3WTP D;  5CPK D;  3X1T D;  1KX4 B;  1ID3 C;  3MGQ D;  4H9O A;  4WU9 C;  2JCH A;  4Z66 A;  5BT1 D;  2FFF B;  2NZD B;  4X23 B;  3REL A;  3LEL B;  3AZG D;  1P3P B;  3W96 B;  3MGS B;  3W98 A;  5B40 D;  2CV5 B;  1P3L C;  3TU4 B;  3MGP B;  4YS3 B;  5AV5 A;  5JRG B;  4J8V A;  4UUZ B;  3UT9 C;  2HUE B;  1KX3 C;  4UPK A;  5AV9 A;  3REH B;  5B2J B;  3X1V B;  1HQ3 B;  3AZM D;  1P3F B;  1F66 C;  5B32 G;  4EO5 B;  4KGC A;  3W99 D;  1P3A C;  3AZN B;  4LD9 C;  3W98 D;  3REK C;  3B0D C;  3B0B A;  3IP4 C;  5KDM A;  5B31 B;  2ARO C;  3UTA B;  5BNV B;  4J8V D;  3B6F C;  1M18 B;  4YM6 C;  5B24 B;  1P3B C;  2HIO B;  1H3O B;  3NQJ B;  3R45 B;  1ID3 B;  3EPK A;  4WU9 B;  5AV6 D;  2FJ7 A;  5GSU A;  4QLC C;  3X1S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...