5AV6A

Human nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
total genus 32
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6A00
1P3OC 3AYWC 4R8PC 2HIOD 5DNMD 1JFIA 5B31C 3AZID 3UTBC 1WWSA 4H9NB 5KDMA 5GT0B 3O62C 3LZ1C 3MVDD 4KGCD 3VH5A 4J8UB 3B6FA 3MGRD 3X1TA 1P3AB 3AFAC 3WAAD 5AY8B 5AV9A 4H9QB 3RELC 5B1MD 3NQUB 3AZFA 5C3IC 1P3LB 3AZGC 5B40D 1TZYD 5B0ZB 1F66D 5CPKA 5B0YA 3AZEA 5B1MC 5JRGA 5B33D 3MGSD 5AV5A 1P3MC 1P3BA 2BYMB 4KUDC 4X23D 5B0ZC 3AZGB 3REKB 3AN2B 3REJA 3AZKB 3W98D 4JJND 5C3IB 1P3LC 1M18A 4H9PA 3WAAC 3C1BC 1R4VA 4QLCB 4EO5B 3MGPD 3AZNA 4QLCC 4KGCC 1EQZC 5DNMA 4Z5TA 4J8UC 3REKC 5GT0C 3O62B 1HQ3D 4JJNC 1P3KD 3REIA 5B1LD 3TU4C 4YM6D 3W98A 1S32D 3WKJB 2YFVA 3KUYC 5BNVB 3NQJA 5F99B 3KWQB 4HGAB 5B1LC 3AZJB 1F1EA 3AV2C 1P3IC 3W97C 3KXBB 5JRGD 4YM6C 1M1AB 3UT9B 2NQBA 1M19D 3REJB 3AZKA 5CPKD 4J8WD 5B2JA 4Z66D 3A6NC 4YS3D 3UT9A 1U35B 2FJ7D 3AZLB 5AVCA 1P3AC 4UUZA 5AV5B 4M6BA 1KX5C 5F99A 3LELC 3MGPC 4G91C 1M19C 4ZUXC 3X1VB 5CPIC 5B32G 5BT1C 3X1SA 4Z2MH 1KX3A 3MVDA 4XZQD 5B31A 3VH5W 2CV5C 1ID3D 3X1SD 5B2IA 4Z2MG 3MGQC 4J8XB 3RELD 3LZ1A 2PYOD 3MGQB 3B6FC 5DNMB 3AZHD 1N1JA 3X1UD 3X1TC 4WU9D 5CPJB 2HUEC 3X1TB 5CPJC 5AVCD 2F8NG 4XZQC 3REHA 3V9RA 1Q9CA 2RVQC 4J8UD 4H9NA 5AV6C 4J8XC 3REHD 3MGRB 3AZGA 5AY8D 3VH6T 4WU9C 1KX5D 2NQBD 2AROA 3LZ1D 2BYKB 1P3LD 5B0YC 3AZEC 5B31D 1TZYB 1ID3A 5AV5C 1P3MA 1P3BC 3KXBC 3LELD 1F66B 3W97B 1H3OA 5B0ZA 4XUJA 1P3ID 3WTPC 3AFAD 3A6NB 1P3PB 3REJC 4LD9A 1M18C 1HQ3A 5B24A 3AV1A 2FJ7C 3AZND 5AV8D 3KWQC 4J8WA 3TU4D 3AZKD 3UTAA 4JJNB 2F8ND 5E5AD 1B67A 5KDMB 5GT0A 3WKJC 4JJNA 1M18D 3VH5T 3REIC 3LJAC 3W98C 3REIB 4X23A 3MNNA 4Z66C 2CV5D 3O62D 1S32A 1P3KB 1P3KC 4Z5TB 5B31G 5B0YD 3AZED 3LJAB 4DRBA 4EO5C 5AV8A 1F66A 1TAFA 3C1BB 1ULYA 5B40A 5B32D 5GSUB 3AZFD 1P3FD 3LZ0A 4XUJD 4KUDB 5CP6D 2L5AA 1P3BB 3LELA 1P34B 1AOIB 1P3MD 3WA9A 5CPIA 3UTAB 3WTPB 1B6WA 3AZIA 1KX3C 3MGSA 5B33A 2HIOB 4H9SC 4WNNA 5B24B 4LD9B 5GXQD 4XZQB 3MVDB 5AY8A 3X1SB 3AYWA 1P3OB 1HTAA 3AYWD 3B6FB 3UTBA 3MGRC 3AZHA 5AV6A 5AV9D 5G49B 3X1UB 5DNNB 4G92B 5B2ID 4R8PB 4WU9A 1JFIB 2AROC 4WV4B 2AROB 3B6GB 1BH8B 3RELA 3X1UC 2IO5B 3W99A 1ID3C 1ZLAD 4CAYA 1KX5B 3KXBA 5CPID 5B33B 3V9RB 5E5AC 1U35C 1N1JB 5CPKC 3VH6A 4KHAB 5BO0B 5JRGC 1HQ3C 5B32A 3LELB 4LD9C 2NZDB 5FUGA 5B2JD 4H9RB 5GT3A 4ZBJC 3AN2D 3AV1C 1P3IB 2FJ7A 3AZJC 1KX3B 4YS3A 4WU8B 5GT3B 3VH6W 2JSSA 3W96D 5AVBA 1TAFB 3AZNB 5BNXB 4HGAC 3AV2B 3TU4B 2F8NB 3AZLA 4QLCA 5JA4B 2LY8A 4Z5TC 3W99B 1S32B 1P3KA 3REKA 1P3FC 4J8VD 5BS7A 3B6GA 3AZMD 3TU4A 1ZLAC 5BNXA 5DNNA 4Z5TD 1P3GB 3LJAD 3REJD 4Z66B 1KX4A 3C1CB 1EQZB 2F8NK 1P3OA 1P3IA 2FJ7B 3AZLD 2NQBC 4H9OB 3AZKC 5AV5D 3O62A 3NQUA 5GSUD 3AZFB 1P3FB 4XUJB 4KUDD 5GXQC 3AZIB 1P3BD 5AVCC 1P3AA 5AV9C 1P3MB 1KX5A 3AZFC 1TZYC 2YFWB 3WTPD 3AN2A 2CWEA 3WTPE 3RELB 1A7WA 5AY8C 3MGQD 4WU9B 5GSUA 5B24D 3X1TD 3MGRA 3AZHC 5B1MA 5G49A 5B40B 5CP6C 2PYOA 3REHB 5B0ZD 3AYWB 5CHLB 3B6FD 5CPJA 3KSYA 4XZQA 3LZ1B 5DNND 3W99C 4J8XA 1P3LA 4CSRA 4J8VC 5B2IB 4R8PD 4WNNB 4X23B 2AROD 5B31B 4H9QA 5AV6D 2HUEB 3UTBD 3B6GD 3AZNC 4E44A 3C1CA 1KX4B 1EQZA 3W97D 3REKD 5DNMC 4NE6A 4J8UA 1P3GA 4DRAA 5CPIB 5B32C 4QLCD 3X1VC 4ZUXB 3A6ND 2F8NH 5GT3C 3MGPB 3W96C 1P3PD 3AV1B 1HQ3B 5B2JB 3B0DC 3KUYA 1P3PA 5AVBC 5B24C 3AZMC 5E5AB 1KX3D 2HIOC 3WA9D 4YM6B 1M1AC 4WU8D 3AV2A 3B0CT 3W97A 3WKJD 3R45A 4YM6A 3KWQA 4J8WC 3LZ0D 3W96B 3UTAC 5AVBB 3REID 1P3FA 3B0DB 4NE5A 3KWQD 3KUYB 3WKJA 1P34C 1AOIC 3B6GC 4H9OA 4WU8A 4AWLC 1M1AD 3UT9D 1ZLAA 4X23C 4Z66A 5FUGB 5F99C 4J8VB 3MGPA 3C1BD 1M19A 4KHAA 2NZDA 4ZUXA 1BFMA 1KX4C 3X1SC 3MVDC 5AV8C 3MNND 2CV5A 1WWIA 5B2IC 3MGQA 5CP6B 5B40C 4CSRB 3C1CD 1BH8A 4E45A 5GT0D 3B0CW 5B1LA 5GXQA 4KGCB 3UTAD 4R8PA 2F8NA 3B0BA 1P3AD 2BYMA 4J8XD 3REHC 3WAAB 2PYOB 1TZYA 3AN2C 5CPJD 4NFTA 3AZHB 5B1MB 4UUZB 4LD9D 2BYKA 5AVCB 5BT1D 3AFAA 5GXQB 3AZIC 3MGSC 5GSUC 1P3OD 5CP6A 2YFWA 5BO0A 2PYOC 2NQBB 5AV9B 3MGSB 4XUJC 3WTPA 4CAYB 2YFVB 3AZGD 4J8VA 3W98B 4KUDA 1ZLAB 3C1CC 3AFAB 1P3GC 3X1UA 3X1VA 5AV6B 4NE3A 3W96A 3UTBB 2NZDD 3WAAA 3C1BA 3R45B 1KX4D 5AV8B 3LJAA 4KGCA 5B1LB 5E5AA 3MNNC 1U35A 4ZUXD 1M18B 1S32C 5GT3D 1P3PC 3AZMA 2HIOA 1M1AA 5JA4A 2CV5B 5F99D 3AV1D 3AZJA 1KU5A 1F66C 4YS3C 1BH9A 4AWLB 3AV2D 4ZBJB 3AZJD 3NQJB 5JRGB 3KXBD 5BNVA 5B0YB 3AZEB 1P34A 1AOIA 4G91B 1M19B 3W99D 3WA9B 5CPKB 1BH9B 4WU8C 4J8WB 4YS3B 3LZ0B 3LZ0C 1U35D 5AVBD 4WZSB 3AZLC 3AZMB 3KUYD 4H9RA 2NZDC 3WA9C 5B32B 2IO5C 5B2JC 3A6NA 5BS7C 3X1VD 1P3GD 3UT9C 2RVQD 1H3OB 1EQZD 5B33C 1P34D 1AOID 5DNNC 4G92C 4H9SA 1ID3B 4H9PB 3MNNB
chains in the Genus database with same CATH superfamily
1P3OC 3AYWC 4R8PC 2HIOD 5DNMD 1JFIA 5B31C 3AZID 3UTBC 1WWSA 4H9NB 5KDMA 5GT0B 3O62C 3LZ1C 3MVDD 4KGCD 3VH5A 4J8UB 3B6FA 3MGRD 2J8PA 3X1TA 1P3AB 3AFAC 3WAAD 5AY8B 5AV9A 4H9QB 3RELC 5B1MD 3NQUB 3AZFA 5C3IC 1P3LB 3AZGC 5B40D 1TZYD 5B0ZB 1F66D 2XD1A 5CPKA 5B0YA 3AZEA 5B1MC 5JRGA 5B33D 3MGSD 5AV5A 1P3MC 1P3BA 1PZRA 2BYMB 4KUDC 4X23D 5B0ZC 3AZGB 3REKB 3AN2B 3REJA 3AZKB 3W98D 4JJND 5C3IB 1P3LC 1M18A 4H9PA 3WAAC 3C1BC 1R4VA 4QLCB 4EO5B 3MGPD 3AZNA 4QLCC 4KGCC 1EQZC 5DNMA 2XD5A 4Z5TA 4J8UC 3REKC 5GT0C 3O62B 1HQ3D 4JJNC 1P3KD 3REIA 5B1LD 1W2EA 3TU4C 4YM6D 3W98A 1S32D 3WKJB 2YFVA 3KUYC 5BNVB 2Y2GA 3NQJA 5F99B 3KWQB 4HGAB 3AV2C 3AZJB 1F1EA 3H0MC 1P3IC 3W97C 5JRGD 4YM6C 3KXBB 1M1AB 3UT9B 2NQBA 3EG5B 1M19D 2FFFB 3REJB 3AZKA 5CPKD 4J8WD 5B2JA 4Z66D 3A6NC 4YS3D 3UT9A 1U35B 2FJ7D 3AZLB 5AVCA 1P3AC 4UUZA 5AV5B 4M6BA 1KX5C 5F99A 3LELC 3MGPC 4G91C 1M19C 4ZUXC 2ZY5A 3X1VB 5CPIC 2Y2MA 5B32G 5BT1C 3X1SA 4Z2MH 1KX3A 3MVDA 4XZQD 5B31A 3VH5W 2CV5C 1ID3D 3X1SD 5B2IA 4Z2MG 3MGQC 4J8XB 3RELD 3LZ1A 2PYOD 3MGQB 3B6FC 5DNMB 3AZHD 1N1JA 3X1UD 3X1TC 2Y2HA 4WU9D 5CPJB 2HUEC 3X1TB 5CPJC 5AVCD 2F8NG 4XZQC 3REHA 3V9RA 2ZY4A 1Q9CA 1Z2CB 2RVQC 3FDDA 4J8UD 4H9NA 5AV6C 4J8XC 3REHD 3MGRB 3AZGA 3MNNB 5AY8D 3VH6T 4WU9C 1KX5D 2NQBD 2AROA 3EPHA 3LZ1D 2BYKB 1P3LD 2VQRA 5B0YC 3AZEC 3IP4C 5B31D 1TZYB 1ID3A 5AV5C 1P3MA 1P3BC 3KXBC 3LELD 1F66B 3W97B 1H3OA 5B0ZA 4XUJA 1P3ID 3WTPC 3AFAD 3A6NB 1P3PB 2JE5A 1T3UA 3REJC 4LD9A 1M18C 4UPKA 1HQ3A 5B24A 3AV1A 2FJ7C 3AZND 5AV8D 3KWQC 4J8WA 3TU4D 3AZKD 3UTAA 4JJNB 2F8ND 5E5AD 1B67A 5KDMB 5GT0A 3WKJC 4JJNA 1M18D 3VH5T 3REIC 3LJAC 3W98C 3REIB 4X23A 3MNNA 4Z66C 2CV5D 3O62D 1S32A 1P3KB 1P3KC 4Z5TB 3A1IA 5B31G 5B0YD 2Y2OA 3AZED 3LJAB 4DRBA 4EO5C 5AV8A 1F66A 1TAFA 3C1BB 1ULYA 5B40A 2RIQA 5B32D 5GSUB 3AZFD 1P3FD 4DQYB 3LZ0A 4XUJD 4KUDB 5CP6D 2L5AA 1P3BB 3LELA 1P34B 1AOIB 1P3MD 3WA9A 5CPIA 2ZM5A 3UTAB 3WTPB 1B6WA 3AZIA 1KX3C 3MGSA 3EPJA 5B33A 2HIOB 4H9SC 4WNNA 5B24B 2W8SA 4LD9B 5GXQD 4XZQB 3MVDB 5AY8A 3EPLA 3X1SB 3AYWA 1P3OB 1HTAA 3AYWD 3B6FB 3UTBA 3MGRC 3AZHA 5AV6A 5AV9D 5G49B 3X1UB 5DNNB 4G92B 3P5JB 5B2ID 4R8PB 4WU9A 1JFIB 2AROC 4WV4B 2AROB 2Y2IA 3B6GB 1BH8B 3RELA 3X1UC 2IO5B 3W99A 1ID3C 1ZLAD 4CAYA 1KX5B 3KXBA 5CPID 5B33B 3V9RB 5E5AC 1U35C 1N1JB 5CPKC 3VH6A 4KHAB 5BO0B 5JRGC 1HQ3C 5B32A 2JCHA 3LELB 4LD9C 5FUGA 5B2JD 4H9RB 5GT3A 4ZBJC 3AN2D 3AV1C 1P3IB 2FJ7A 3AZJC 1KX3B 4YS3A 4WU8B 5GT3B 3VH6W 2JSSA 3W96D 5AVBA 1TAFB 3AZNB 5BNXB 2F2AC 4HGAC 3TU4B 3AV2B 4WJ3C 2F8NB 3AZLA 4QLCA 5JA4B 2LY8A 4Z5TC 3W99B 1S32B 1P3KA 3REKA 1P3FC 4J8VD 5BS7A 3B6GA 3AZMD 3TU4A 1ZLAC 5BNXA 5DNNA 4Z5TD 1P3GB 3LJAD 3REJD 4Z66B 1KX4A 3C1CB 1EQZB 2F8NK 1P3OA 1P3IA 2FJ7B 3AZLD 2NQBC 4H9OB 3AZKC 5AV5D 3O62A 3NQUA 5GSUD 3AZFB 1P3FB 4XUJB 4KUDD 5GXQC 3AZIB 1P3BD 5AVCC 1P3AA 5AV9C 1P3MB 1KX5A 3AZFC 1TZYC 2YFWB 3WTPD 3AN2A 2CWEA 3WTPE 3RELB 1A7WA 2NZDB 5AY8C 3MGQD 4WU9B 5GSUA 5B24D 3X1TD 3MGRA 3AZHC 5B1MA 5G49A 5B40B 5CP6C 2PYOA 3REHB 5B0ZD 3AYWB 5CHLB 3B6FD 5CPJA 2Y2NA 3KSYA 4XZQA 2G5HC 3LZ1B 5DNND 3W99C 4J8XA 1P3LA 4CSRA 4J8VC 5B2IB 4R8PD 4WNNB 4X23B 2AROD 5B31B 4H9QA 5AV6D 3EPKA 2HUEB 3UTBD 3B6GD 3AZNC 4E44A 3C1CA 1KX4B 1EQZA 3W97D 3REKD 5DNMC 4NE6A 4J8UA 1P3GA 4DRAA 5CPIB 5B32C 4QLCD 4ZUXB 3X1VC 3A6ND 2F8NH 5GT3C 3MGPB 3W96C 1P3PD 3H0LC 3AV1B 1HQ3B 5B2JB 3B0DC 3KUYA 1P3PA 5AVBC 5B24C 2Y2LA 3AZMC 5E5AB 2DF4C 1KX3D 2HIOC 3WA9D 4YM6B 1M1AC 4WU8D 3AV2A 3B0CT 3W97A 3WKJD 3R45A 4YM6A 3KWQA 4J8WC 3LZ0D 3W96B 3UTAC 5AVBB 3REID 1P3FA 3B0DB 4NE5A 3KWQD 3KUYB 3WKJA 1P34C 1AOIC 3B6GC 4H9OA 4WU8A 4AWLC 1M1AD 3UT9D 1ZLAA 4X23C 4Z66A 5FUGB 5F99C 4J8VB 3MGPA 3C1BD 1M19A 4KHAA 2NZDA 4ZUXA 1BFMA 1KX4C 3X1SC 3MVDC 5AV8C 3MNND 2CV5A 1WWIA 5B2IC 3MGQA 5CP6B 5B40C 4CSRB 2Y2QA 2UWXA 3C1CD 1BH8A 4E45A 5GT0D 3B0CW 5B1LA 5GXQA 4KGCB 3UTAD 4R8PA 2F8NA 3B0BA 1P3AD 2BYMA 4J8XD 3REHC 3WAAB 2PYOB 1TZYA 3AN2C 5CPJD 4NFTA 3AZHB 5B1MB 4UUZB 4LD9D 2BYKA 3F6TA 5AVCB 5BT1D 3AFAA 5GXQB 3AZIC 3MGSC 5GSUC 1P3OD 5CP6A 2YFWA 3KFUG 5BO0A 2PYOC 2NQBB 5AV9B 2G5IC 3MGSB 4XUJC 3WTPA 4CAYB 2YFVB 3AZGD 4J8VA 3W98B 4KUDA 2ZY3A 1ZLAB 3C1CC 3AFAB 1P3GC 3X1UA 3X1VA 2ZY2A 5AV6B 4NE3A 3W96A 3UTBB 2Y2PA 3WAAA 3C1BA 3R45B 2NZDD 1KX4D 5AV8B 3LJAA 4KGCA 5B1LB 5E5AA 3MNNC 1U35A 4ZUXD 1M18B 1S32C 5GT3D 1P3PC 3AZMA 2HIOA 1M1AA 5JA4A 2CV5B 5F99D 3AV1D 3AZJA 1KU5A 1F66C 4YS3C 1BH9A 4AWLB 3AV2D 4ZBJB 3AZJD 3NQJB 5JRGB 3KXBD 5BNVA 5B0YB 3AZEB 1P34A 1AOIA 4G91B 1M19B 3W99D 3WA9B 5CPKB 1BH9B 4WU8C 4J8WB 3AL0C 3A1KA 4YS3B 3LZ0B 3LZ0C 1U35D 2Y2JA 5AVBD 4WZSB 3AZLC 3AZMB 3H0RC 3KUYD 4H9RA 2NZDC 3WA9C 5B32B 2IO5C 2Y2KA 5B2JC 3A6NA 5BS7C 3X1VD 1P3GD 3UT9C 2RVQD 1H3OB 2BG1A 1EQZD 5B33C 1P34D 1AOID 5DNNC 4G92C 2DQNC 4H9SA 1ID3B 4H9PB 5B1LC
chains in the Genus database with same CATH topology
1P3OC 3AYWC 4R8PC 2HIOD 5DNMD 1JFIA 5B31C 3AZID 3UTBC 1WWSA 4H9NB 5KDMA 5GT0B 3O62C 3LZ1C 3MVDD 4KGCD 3VH5A 4J8UB 3B6FA 3MGRD 2J8PA 3X1TA 1P3AB 3AFAC 3WAAD 5AY8B 5AV9A 4H9QB 3RELC 5B1MD 3NQUB 3AZFA 5C3IC 1P3LB 3AZGC 5B40D 1TZYD 5B0ZB 1F66D 2XD1A 5CPKA 5B0YA 3AZEA 5B1MC 5JRGA 5B33D 3MGSD 5AV5A 1P3MC 1P3BA 1PZRA 2BYMB 4KUDC 4X23D 5B0ZC 3AZGB 3REKB 3AN2B 3REJA 3AZKB 3W98D 4JJND 5C3IB 1P3LC 1M18A 4H9PA 3WAAC 3C1BC 1R4VA 4QLCB 4EO5B 3MGPD 3AZNA 4QLCC 4KGCC 1EQZC 5DNMA 2XD5A 4Z5TA 4J8UC 3REKC 5GT0C 3O62B 1HQ3D 4JJNC 1P3KD 3REIA 5B1LD 1W2EA 3TU4C 4YM6D 3W98A 1S32D 3WKJB 2YFVA 3KUYC 5BNVB 2Y2GA 3NQJA 5F99B 3KWQB 4HGAB 3AV2C 3AZJB 1F1EA 3H0MC 1P3IC 3W97C 5JRGD 4YM6C 3KXBB 1M1AB 3UT9B 2NQBA 3EG5B 1M19D 2FFFB 3REJB 3AZKA 5CPKD 4J8WD 5B2JA 4Z66D 3A6NC 4YS3D 3UT9A 1U35B 2FJ7D 3AZLB 5AVCA 1P3AC 4UUZA 5AV5B 4M6BA 1KX5C 5F99A 3LELC 3MGPC 4G91C 1M19C 4ZUXC 2ZY5A 3X1VB 5CPIC 2Y2MA 5B32G 5BT1C 3X1SA 4Z2MH 1KX3A 3MVDA 4XZQD 5B31A 3VH5W 2CV5C 1ID3D 3X1SD 5B2IA 4Z2MG 3MGQC 4J8XB 3RELD 3LZ1A 2PYOD 3MGQB 3B6FC 5DNMB 3AZHD 1N1JA 3X1UD 3X1TC 2Y2HA 4WU9D 5CPJB 2HUEC 3X1TB 5CPJC 5AVCD 2F8NG 4XZQC 3REHA 3V9RA 2ZY4A 1Q9CA 1Z2CB 2RVQC 3FDDA 4J8UD 4H9NA 5AV6C 4J8XC 3REHD 3MGRB 3AZGA 3MNNB 5AY8D 3VH6T 4WU9C 1KX5D 2NQBD 2AROA 3EPHA 3LZ1D 2BYKB 1P3LD 2VQRA 5B0YC 3AZEC 3IP4C 5B31D 1TZYB 1ID3A 5AV5C 1P3MA 1P3BC 3KXBC 3LELD 1F66B 3W97B 1H3OA 5B0ZA 4XUJA 1P3ID 3WTPC 3AFAD 3A6NB 1P3PB 2JE5A 1T3UA 3REJC 4LD9A 1M18C 4UPKA 1HQ3A 5B24A 3AV1A 2FJ7C 3AZND 5AV8D 3KWQC 4J8WA 3TU4D 3AZKD 3UTAA 4JJNB 2F8ND 5E5AD 1B67A 5KDMB 5GT0A 3WKJC 4JJNA 1M18D 3VH5T 3REIC 3LJAC 3W98C 3REIB 4X23A 3MNNA 4Z66C 2CV5D 3O62D 1S32A 1P3KB 1P3KC 4Z5TB 3A1IA 5B31G 5B0YD 2Y2OA 3AZED 3LJAB 4DRBA 4EO5C 5AV8A 1F66A 1TAFA 3C1BB 1ULYA 5B40A 2RIQA 5B32D 5GSUB 3AZFD 1P3FD 4DQYB 3LZ0A 4XUJD 4KUDB 5CP6D 2L5AA 1P3BB 3LELA 1P34B 1AOIB 1P3MD 3WA9A 5CPIA 2ZM5A 3UTAB 3WTPB 1B6WA 3AZIA 1KX3C 3MGSA 3EPJA 5B33A 2HIOB 4H9SC 4WNNA 5B24B 2W8SA 4LD9B 5GXQD 4XZQB 3MVDB 5AY8A 3EPLA 3X1SB 3AYWA 1P3OB 1HTAA 3AYWD 3B6FB 3UTBA 3MGRC 3AZHA 5AV6A 5AV9D 5G49B 3X1UB 5DNNB 4G92B 3P5JB 5B2ID 4R8PB 4WU9A 1JFIB 2AROC 4WV4B 2AROB 2Y2IA 3B6GB 1BH8B 3RELA 3X1UC 2IO5B 3W99A 1ID3C 1ZLAD 4CAYA 1KX5B 3KXBA 5CPID 5B33B 3V9RB 5E5AC 1U35C 1N1JB 5CPKC 3VH6A 4KHAB 5BO0B 5JRGC 1HQ3C 5B32A 2JCHA 3LELB 4LD9C 5FUGA 5B2JD 4H9RB 5GT3A 4ZBJC 3AN2D 3AV1C 1P3IB 2FJ7A 3AZJC 1KX3B 4YS3A 4WU8B 5GT3B 3VH6W 2JSSA 3W96D 5AVBA 1TAFB 3AZNB 5BNXB 2F2AC 4HGAC 3TU4B 3AV2B 4WJ3C 2F8NB 3AZLA 4QLCA 5JA4B 2LY8A 4Z5TC 3W99B 1S32B 1P3KA 3REKA 1P3FC 4J8VD 5BS7A 3B6GA 3AZMD 3TU4A 1ZLAC 5BNXA 5DNNA 4Z5TD 1P3GB 3LJAD 3REJD 4Z66B 1KX4A 3C1CB 1EQZB 2F8NK 1P3OA 1P3IA 2FJ7B 3AZLD 2NQBC 4H9OB 3AZKC 5AV5D 3O62A 3NQUA 5GSUD 3AZFB 1P3FB 4XUJB 4KUDD 5GXQC 3AZIB 1P3BD 5AVCC 1P3AA 5AV9C 1P3MB 1KX5A 3AZFC 1TZYC 2YFWB 3WTPD 3AN2A 2CWEA 3WTPE 3RELB 1A7WA 2NZDB 5AY8C 3MGQD 4WU9B 5GSUA 5B24D 3X1TD 3MGRA 3AZHC 5B1MA 5G49A 5B40B 5CP6C 2PYOA 3REHB 5B0ZD 3AYWB 5CHLB 3B6FD 5CPJA 2Y2NA 3KSYA 4XZQA 2G5HC 3LZ1B 5DNND 3W99C 4J8XA 1P3LA 4CSRA 4J8VC 5B2IB 4R8PD 4WNNB 4X23B 2AROD 5B31B 4H9QA 5AV6D 3EPKA 2HUEB 3UTBD 3B6GD 3AZNC 4E44A 3C1CA 1KX4B 1EQZA 3W97D 3REKD 5DNMC 4NE6A 4J8UA 1P3GA 4DRAA 5CPIB 5B32C 4QLCD 4ZUXB 3X1VC 3A6ND 2F8NH 5GT3C 3MGPB 3W96C 1P3PD 3H0LC 3AV1B 1HQ3B 5B2JB 3B0DC 3KUYA 1P3PA 5AVBC 5B24C 2Y2LA 3AZMC 5E5AB 2DF4C 1KX3D 2HIOC 3WA9D 4YM6B 1M1AC 4WU8D 3AV2A 3B0CT 3W97A 3WKJD 3R45A 4YM6A 3KWQA 4J8WC 3LZ0D 3W96B 3UTAC 5AVBB 3REID 1P3FA 3B0DB 4NE5A 3KWQD 3KUYB 3WKJA 1P34C 1AOIC 3B6GC 4H9OA 4WU8A 4AWLC 1M1AD 3UT9D 1ZLAA 4X23C 4Z66A 5FUGB 5F99C 4J8VB 3MGPA 3C1BD 1M19A 4KHAA 2NZDA 4ZUXA 1BFMA 1KX4C 3X1SC 3MVDC 5AV8C 3MNND 2CV5A 1WWIA 5B2IC 3MGQA 5CP6B 5B40C 4CSRB 2Y2QA 2UWXA 3C1CD 1BH8A 4E45A 5GT0D 3B0CW 5B1LA 5GXQA 4KGCB 3UTAD 4R8PA 2F8NA 3B0BA 1P3AD 2BYMA 4J8XD 3REHC 3WAAB 2PYOB 1TZYA 3AN2C 5CPJD 4NFTA 3AZHB 5B1MB 4UUZB 4LD9D 2BYKA 3F6TA 5AVCB 5BT1D 3AFAA 5GXQB 3AZIC 3MGSC 5GSUC 1P3OD 5CP6A 2YFWA 3KFUG 5BO0A 2PYOC 2NQBB 5AV9B 2G5IC 3MGSB 4XUJC 3WTPA 4CAYB 2YFVB 3AZGD 4J8VA 3W98B 4KUDA 2ZY3A 1ZLAB 3C1CC 3AFAB 1P3GC 3X1UA 3X1VA 2ZY2A 5AV6B 4NE3A 3W96A 3UTBB 2Y2PA 3WAAA 3C1BA 3R45B 2NZDD 1KX4D 5AV8B 3LJAA 4KGCA 5B1LB 5E5AA 3MNNC 1U35A 4ZUXD 1M18B 1S32C 5GT3D 1P3PC 3AZMA 2HIOA 1M1AA 5JA4A 2CV5B 5F99D 3AV1D 3AZJA 1KU5A 1F66C 4YS3C 1BH9A 4AWLB 3AV2D 4ZBJB 3AZJD 3NQJB 5JRGB 3KXBD 5BNVA 5B0YB 3AZEB 1P34A 1AOIA 4G91B 1M19B 3W99D 3WA9B 5CPKB 1BH9B 4WU8C 4J8WB 3AL0C 3A1KA 4YS3B 3LZ0B 3LZ0C 1U35D 2Y2JA 5AVBD 4WZSB 3AZLC 3AZMB 3H0RC 3KUYD 4H9RA 2NZDC 3WA9C 5B32B 2IO5C 2Y2KA 5B2JC 3A6NA 5BS7C 3X1VD 1P3GD 3UT9C 2RVQD 1H3OB 2BG1A 1EQZD 5B33C 1P34D 1AOID 5DNNC 4G92C 2DQNC 4H9SA 1ID3B 4H9PB 5B1LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O C;  3AYW C;  4R8P C;  2HIO D;  5DNM D;  1JFI A;  5B31 C;  3AZI D;  3UTB C;  1WWS A;  4H9N B;  5KDM A;  5GT0 B;  3O62 C;  3LZ1 C;  3MVD D;  4KGC D;  3VH5 A;  4J8U B;  3B6F A;  3MGR D;  3X1T A;  1P3A B;  3AFA C;  3WAA D;  5AY8 B;  5AV9 A;  4H9Q B;  3REL C;  5B1M D;  3NQU B;  3AZF A;  5C3I C;  1P3L B;  3AZG C;  5B40 D;  1TZY D;  5B0Z B;  1F66 D;  5CPK A;  5B0Y A;  3AZE A;  5B1M C;  5JRG A;  5B33 D;  3MGS D;  5AV5 A;  1P3M C;  1P3B A;  2BYM B;  4KUD C;  4X23 D;  5B0Z C;  3AZG B;  3REK B;  3AN2 B;  3REJ A;  3AZK B;  3W98 D;  4JJN D;  5C3I B;  1P3L C;  1M18 A;  4H9P A;  3WAA C;  3C1B C;  1R4V A;  4QLC B;  4EO5 B;  3MGP D;  3AZN A;  4QLC C;  4KGC C;  1EQZ C;  5DNM A;  4Z5T A;  4J8U C;  3REK C;  5GT0 C;  3O62 B;  1HQ3 D;  4JJN C;  1P3K D;  3REI A;  5B1L D;  3TU4 C;  4YM6 D;  3W98 A;  1S32 D;  3WKJ B;  2YFV A;  3KUY C;  5BNV B;  3NQJ A;  5F99 B;  3KWQ B;  4HGA B;  5B1L C;  3AZJ B;  1F1E A;  3AV2 C;  1P3I C;  3W97 C;  3KXB B;  5JRG D;  4YM6 C;  1M1A B;  3UT9 B;  2NQB A;  1M19 D;  3REJ B;  3AZK A;  5CPK D;  4J8W D;  5B2J A;  4Z66 D;  3A6N C;  4YS3 D;  3UT9 A;  1U35 B;  2FJ7 D;  3AZL B;  5AVC A;  1P3A C;  4UUZ A;  5AV5 B;  4M6B A;  1KX5 C;  5F99 A;  3LEL C;  3MGP C;  4G91 C;  1M19 C;  4ZUX C;  3X1V B;  5CPI C;  5B32 G;  5BT1 C;  3X1S A;  4Z2M H;  1KX3 A;  3MVD A;  4XZQ D;  5B31 A;  3VH5 W;  2CV5 C;  1ID3 D;  3X1S D;  5B2I A;  4Z2M G;  3MGQ C;  4J8X B;  3REL D;  3LZ1 A;  2PYO D;  3MGQ B;  3B6F C;  5DNM B;  3AZH D;  1N1J A;  3X1U D;  3X1T C;  4WU9 D;  5CPJ B;  2HUE C;  3X1T B;  5CPJ C;  5AVC D;  2F8N G;  4XZQ C;  3REH A;  3V9R A;  1Q9C A;  2RVQ C;  4J8U D;  4H9N A;  5AV6 C;  4J8X C;  3REH D;  3MGR B;  3AZG A;  5AY8 D;  3VH6 T;  4WU9 C;  1KX5 D;  2NQB D;  2ARO A;  3LZ1 D;  2BYK B;  1P3L D;  5B0Y C;  3AZE C;  5B31 D;  1TZY B;  1ID3 A;  5AV5 C;  1P3M A;  1P3B C;  3KXB C;  3LEL D;  1F66 B;  3W97 B;  1H3O A;  5B0Z A;  4XUJ A;  1P3I D;  3WTP C;  3AFA D;  3A6N B;  1P3P B;  3REJ C;  4LD9 A;  1M18 C;  1HQ3 A;  5B24 A;  3AV1 A;  2FJ7 C;  3AZN D;  5AV8 D;  3KWQ C;  4J8W A;  3TU4 D;  3AZK D;  3UTA A;  4JJN B;  2F8N D;  5E5A D;  1B67 A;  5KDM B;  5GT0 A;  3WKJ C;  4JJN A;  1M18 D;  3VH5 T;  3REI C;  3LJA C;  3W98 C;  3REI B;  4X23 A;  3MNN A;  4Z66 C;  2CV5 D;  3O62 D;  1S32 A;  1P3K B;  1P3K C;  4Z5T B;  5B31 G;  5B0Y D;  3AZE D;  3LJA B;  4DRB A;  4EO5 C;  5AV8 A;  1F66 A;  1TAF A;  3C1B B;  1ULY A;  5B40 A;  5B32 D;  5GSU B;  3AZF D;  1P3F D;  3LZ0 A;  4XUJ D;  4KUD B;  5CP6 D;  2L5A A;  1P3B B;  3LEL A;  1P34 B;  1AOI B;  1P3M D;  3WA9 A;  5CPI A;  3UTA B;  3WTP B;  1B6W A;  3AZI A;  1KX3 C;  3MGS A;  5B33 A;  2HIO B;  4H9S C;  4WNN A;  5B24 B;  4LD9 B;  5GXQ D;  4XZQ B;  3MVD B;  5AY8 A;  3X1S B;  3AYW A;  1P3O B;  1HTA A;  3AYW D;  3B6F B;  3UTB A;  3MGR C;  3AZH A;  5AV6 A;  5AV9 D;  5G49 B;  3X1U B;  5DNN B;  4G92 B;  5B2I D;  4R8P B;  4WU9 A;  1JFI B;  2ARO C;  4WV4 B;  2ARO B;  3B6G B;  1BH8 B;  3REL A;  3X1U C;  2IO5 B;  3W99 A;  1ID3 C;  1ZLA D;  4CAY A;  1KX5 B;  3KXB A;  5CPI D;  5B33 B;  3V9R B;  5E5A C;  1U35 C;  1N1J B;  5CPK C;  3VH6 A;  4KHA B;  5BO0 B;  5JRG C;  1HQ3 C;  5B32 A;  3LEL B;  4LD9 C;  2NZD B;  5FUG A;  5B2J D;  4H9R B;  5GT3 A;  4ZBJ C;  3AN2 D;  3AV1 C;  1P3I B;  2FJ7 A;  3AZJ C;  1KX3 B;  4YS3 A;  4WU8 B;  5GT3 B;  3VH6 W;  2JSS A;  3W96 D;  5AVB A;  1TAF B;  3AZN B;  5BNX B;  4HGA C;  3AV2 B;  3TU4 B;  2F8N B;  3AZL A;  4QLC A;  5JA4 B;  2LY8 A;  4Z5T C;  3W99 B;  1S32 B;  1P3K A;  3REK A;  1P3F C;  4J8V D;  5BS7 A;  3B6G A;  3AZM D;  3TU4 A;  1ZLA C;  5BNX A;  5DNN A;  4Z5T D;  1P3G B;  3LJA D;  3REJ D;  4Z66 B;  1KX4 A;  3C1C B;  1EQZ B;  2F8N K;  1P3O A;  1P3I A;  2FJ7 B;  3AZL D;  2NQB C;  4H9O B;  3AZK C;  5AV5 D;  3O62 A;  3NQU A;  5GSU D;  3AZF B;  1P3F B;  4XUJ B;  4KUD D;  5GXQ C;  3AZI B;  1P3B D;  5AVC C;  1P3A A;  5AV9 C;  1P3M B;  1KX5 A;  3AZF C;  1TZY C;  2YFW B;  3WTP D;  3AN2 A;  2CWE A;  3WTP E;  3REL B;  1A7W A;  5AY8 C;  3MGQ D;  4WU9 B;  5GSU A;  5B24 D;  3X1T D;  3MGR A;  3AZH C;  5B1M A;  5G49 A;  5B40 B;  5CP6 C;  2PYO A;  3REH B;  5B0Z D;  3AYW B;  5CHL B;  3B6F D;  5CPJ A;  3KSY A;  4XZQ A;  3LZ1 B;  5DNN D;  3W99 C;  4J8X A;  1P3L A;  4CSR A;  4J8V C;  5B2I B;  4R8P D;  4WNN B;  4X23 B;  2ARO D;  5B31 B;  4H9Q A;  5AV6 D;  2HUE B;  3UTB D;  3B6G D;  3AZN C;  4E44 A;  3C1C A;  1KX4 B;  1EQZ A;  3W97 D;  3REK D;  5DNM C;  4NE6 A;  4J8U A;  1P3G A;  4DRA A;  5CPI B;  5B32 C;  4QLC D;  3X1V C;  4ZUX B;  3A6N D;  2F8N H;  5GT3 C;  3MGP B;  3W96 C;  1P3P D;  3AV1 B;  1HQ3 B;  5B2J B;  3B0D C;  3KUY A;  1P3P A;  5AVB C;  5B24 C;  3AZM C;  5E5A B;  1KX3 D;  2HIO C;  3WA9 D;  4YM6 B;  1M1A C;  4WU8 D;  3AV2 A;  3B0C T;  3W97 A;  3WKJ D;  3R45 A;  4YM6 A;  3KWQ A;  4J8W C;  3LZ0 D;  3W96 B;  3UTA C;  5AVB B;  3REI D;  1P3F A;  3B0D B;  4NE5 A;  3KWQ D;  3KUY B;  3WKJ A;  1P34 C;  1AOI C;  3B6G C;  4H9O A;  4WU8 A;  4AWL C;  1M1A D;  3UT9 D;  1ZLA A;  4X23 C;  4Z66 A;  5FUG B;  5F99 C;  4J8V B;  3MGP A;  3C1B D;  1M19 A;  4KHA A;  2NZD A;  4ZUX A;  1BFM A;  1KX4 C;  3X1S C;  3MVD C;  5AV8 C;  3MNN D;  2CV5 A;  1WWI A;  5B2I C;  3MGQ A;  5CP6 B;  5B40 C;  4CSR B;  3C1C D;  1BH8 A;  4E45 A;  5GT0 D;  3B0C W;  5B1L A;  5GXQ A;  4KGC B;  3UTA D;  4R8P A;  2F8N A;  3B0B A;  1P3A D;  2BYM A;  4J8X D;  3REH C;  3WAA B;  2PYO B;  1TZY A;  3AN2 C;  5CPJ D;  4NFT A;  3AZH B;  5B1M B;  4UUZ B;  4LD9 D;  2BYK A;  5AVC B;  5BT1 D;  3AFA A;  5GXQ B;  3AZI C;  3MGS C;  5GSU C;  1P3O D;  5CP6 A;  2YFW A;  5BO0 A;  2PYO C;  2NQB B;  5AV9 B;  3MGS B;  4XUJ C;  3WTP A;  4CAY B;  2YFV B;  3AZG D;  4J8V A;  3W98 B;  4KUD A;  1ZLA B;  3C1C C;  3AFA B;  1P3G C;  3X1U A;  3X1V A;  5AV6 B;  4NE3 A;  3W96 A;  3UTB B;  2NZD D;  3WAA A;  3C1B A;  3R45 B;  1KX4 D;  5AV8 B;  3LJA A;  4KGC A;  5B1L B;  5E5A A;  3MNN C;  1U35 A;  4ZUX D;  1M18 B;  1S32 C;  5GT3 D;  1P3P C;  3AZM A;  2HIO A;  1M1A A;  5JA4 A;  2CV5 B;  5F99 D;  3AV1 D;  3AZJ A;  1KU5 A;  1F66 C;  4YS3 C;  1BH9 A;  4AWL B;  3AV2 D;  4ZBJ B;  3AZJ D;  3NQJ B;  5JRG B;  3KXB D;  5BNV A;  5B0Y B;  3AZE B;  1P34 A;  1AOI A;  4G91 B;  1M19 B;  3W99 D;  3WA9 B;  5CPK B;  1BH9 B;  4WU8 C;  4J8W B;  4YS3 B;  3LZ0 B;  3LZ0 C;  1U35 D;  5AVB D;  4WZS B;  3AZL C;  3AZM B;  3KUY D;  4H9R A;  2NZD C;  3WA9 C;  5B32 B;  2IO5 C;  5B2J C;  3A6N A;  5BS7 C;  3X1V D;  1P3G D;  3UT9 C;  2RVQ D;  1H3O B;  1EQZ D;  5B33 C;  1P34 D;  1AOI D;  5DNN C;  4G92 C;  4H9S A;  1ID3 B;  4H9P B;  3MNN B; 
#chains in the Genus database with same CATH topology
 1P3O C;  3AYW C;  4R8P C;  2HIO D;  5DNM D;  1JFI A;  5B31 C;  3AZI D;  3UTB C;  1WWS A;  4H9N B;  5KDM A;  5GT0 B;  3O62 C;  3LZ1 C;  3MVD D;  4KGC D;  3VH5 A;  4J8U B;  3B6F A;  3MGR D;  2J8P A;  3X1T A;  1P3A B;  3AFA C;  3WAA D;  5AY8 B;  5AV9 A;  4H9Q B;  3REL C;  5B1M D;  3NQU B;  3AZF A;  5C3I C;  1P3L B;  3AZG C;  5B40 D;  1TZY D;  5B0Z B;  1F66 D;  2XD1 A;  5CPK A;  5B0Y A;  3AZE A;  5B1M C;  5JRG A;  5B33 D;  3MGS D;  5AV5 A;  1P3M C;  1P3B A;  1PZR A;  2BYM B;  4KUD C;  4X23 D;  5B0Z C;  3AZG B;  3REK B;  3AN2 B;  3REJ A;  3AZK B;  3W98 D;  4JJN D;  5C3I B;  1P3L C;  1M18 A;  4H9P A;  3WAA C;  3C1B C;  1R4V A;  4QLC B;  4EO5 B;  3MGP D;  3AZN A;  4QLC C;  4KGC C;  1EQZ C;  5DNM A;  2XD5 A;  4Z5T A;  4J8U C;  3REK C;  5GT0 C;  3O62 B;  1HQ3 D;  4JJN C;  1P3K D;  3REI A;  5B1L D;  1W2E A;  3TU4 C;  4YM6 D;  3W98 A;  1S32 D;  3WKJ B;  2YFV A;  3KUY C;  5BNV B;  2Y2G A;  3NQJ A;  5F99 B;  3KWQ B;  4HGA B;  3AV2 C;  3AZJ B;  1F1E A;  3H0M C;  1P3I C;  3W97 C;  5JRG D;  4YM6 C;  3KXB B;  1M1A B;  3UT9 B;  2NQB A;  3EG5 B;  1M19 D;  2FFF B;  3REJ B;  3AZK A;  5CPK D;  4J8W D;  5B2J A;  4Z66 D;  3A6N C;  4YS3 D;  3UT9 A;  1U35 B;  2FJ7 D;  3AZL B;  5AVC A;  1P3A C;  4UUZ A;  5AV5 B;  4M6B A;  1KX5 C;  5F99 A;  3LEL C;  3MGP C;  4G91 C;  1M19 C;  4ZUX C;  2ZY5 A;  3X1V B;  5CPI C;  2Y2M A;  5B32 G;  5BT1 C;  3X1S A;  4Z2M H;  1KX3 A;  3MVD A;  4XZQ D;  5B31 A;  3VH5 W;  2CV5 C;  1ID3 D;  3X1S D;  5B2I A;  4Z2M G;  3MGQ C;  4J8X B;  3REL D;  3LZ1 A;  2PYO D;  3MGQ B;  3B6F C;  5DNM B;  3AZH D;  1N1J A;  3X1U D;  3X1T C;  2Y2H A;  4WU9 D;  5CPJ B;  2HUE C;  3X1T B;  5CPJ C;  5AVC D;  2F8N G;  4XZQ C;  3REH A;  3V9R A;  2ZY4 A;  1Q9C A;  1Z2C B;  2RVQ C;  3FDD A;  4J8U D;  4H9N A;  5AV6 C;  4J8X C;  3REH D;  3MGR B;  3AZG A;  3MNN B;  5AY8 D;  3VH6 T;  4WU9 C;  1KX5 D;  2NQB D;  2ARO A;  3EPH A;  3LZ1 D;  2BYK B;  1P3L D;  2VQR A;  5B0Y C;  3AZE C;  3IP4 C;  5B31 D;  1TZY B;  1ID3 A;  5AV5 C;  1P3M A;  1P3B C;  3KXB C;  3LEL D;  1F66 B;  3W97 B;  1H3O A;  5B0Z A;  4XUJ A;  1P3I D;  3WTP C;  3AFA D;  3A6N B;  1P3P B;  2JE5 A;  1T3U A;  3REJ C;  4LD9 A;  1M18 C;  4UPK A;  1HQ3 A;  5B24 A;  3AV1 A;  2FJ7 C;  3AZN D;  5AV8 D;  3KWQ C;  4J8W A;  3TU4 D;  3AZK D;  3UTA A;  4JJN B;  2F8N D;  5E5A D;  1B67 A;  5KDM B;  5GT0 A;  3WKJ C;  4JJN A;  1M18 D;  3VH5 T;  3REI C;  3LJA C;  3W98 C;  3REI B;  4X23 A;  3MNN A;  4Z66 C;  2CV5 D;  3O62 D;  1S32 A;  1P3K B;  1P3K C;  4Z5T B;  3A1I A;  5B31 G;  5B0Y D;  2Y2O A;  3AZE D;  3LJA B;  4DRB A;  4EO5 C;  5AV8 A;  1F66 A;  1TAF A;  3C1B B;  1ULY A;  5B40 A;  2RIQ A;  5B32 D;  5GSU B;  3AZF D;  1P3F D;  4DQY B;  3LZ0 A;  4XUJ D;  4KUD B;  5CP6 D;  2L5A A;  1P3B B;  3LEL A;  1P34 B;  1AOI B;  1P3M D;  3WA9 A;  5CPI A;  2ZM5 A;  3UTA B;  3WTP B;  1B6W A;  3AZI A;  1KX3 C;  3MGS A;  3EPJ A;  5B33 A;  2HIO B;  4H9S C;  4WNN A;  5B24 B;  2W8S A;  4LD9 B;  5GXQ D;  4XZQ B;  3MVD B;  5AY8 A;  3EPL A;  3X1S B;  3AYW A;  1P3O B;  1HTA A;  3AYW D;  3B6F B;  3UTB A;  3MGR C;  3AZH A;  5AV6 A;  5AV9 D;  5G49 B;  3X1U B;  5DNN B;  4G92 B;  3P5J B;  5B2I D;  4R8P B;  4WU9 A;  1JFI B;  2ARO C;  4WV4 B;  2ARO B;  2Y2I A;  3B6G B;  1BH8 B;  3REL A;  3X1U C;  2IO5 B;  3W99 A;  1ID3 C;  1ZLA D;  4CAY A;  1KX5 B;  3KXB A;  5CPI D;  5B33 B;  3V9R B;  5E5A C;  1U35 C;  1N1J B;  5CPK C;  3VH6 A;  4KHA B;  5BO0 B;  5JRG C;  1HQ3 C;  5B32 A;  2JCH A;  3LEL B;  4LD9 C;  5FUG A;  5B2J D;  4H9R B;  5GT3 A;  4ZBJ C;  3AN2 D;  3AV1 C;  1P3I B;  2FJ7 A;  3AZJ C;  1KX3 B;  4YS3 A;  4WU8 B;  5GT3 B;  3VH6 W;  2JSS A;  3W96 D;  5AVB A;  1TAF B;  3AZN B;  5BNX B;  2F2A C;  4HGA C;  3TU4 B;  3AV2 B;  4WJ3 C;  2F8N B;  3AZL A;  4QLC A;  5JA4 B;  2LY8 A;  4Z5T C;  3W99 B;  1S32 B;  1P3K A;  3REK A;  1P3F C;  4J8V D;  5BS7 A;  3B6G A;  3AZM D;  3TU4 A;  1ZLA C;  5BNX A;  5DNN A;  4Z5T D;  1P3G B;  3LJA D;  3REJ D;  4Z66 B;  1KX4 A;  3C1C B;  1EQZ B;  2F8N K;  1P3O A;  1P3I A;  2FJ7 B;  3AZL D;  2NQB C;  4H9O B;  3AZK C;  5AV5 D;  3O62 A;  3NQU A;  5GSU D;  3AZF B;  1P3F B;  4XUJ B;  4KUD D;  5GXQ C;  3AZI B;  1P3B D;  5AVC C;  1P3A A;  5AV9 C;  1P3M B;  1KX5 A;  3AZF C;  1TZY C;  2YFW B;  3WTP D;  3AN2 A;  2CWE A;  3WTP E;  3REL B;  1A7W A;  2NZD B;  5AY8 C;  3MGQ D;  4WU9 B;  5GSU A;  5B24 D;  3X1T D;  3MGR A;  3AZH C;  5B1M A;  5G49 A;  5B40 B;  5CP6 C;  2PYO A;  3REH B;  5B0Z D;  3AYW B;  5CHL B;  3B6F D;  5CPJ A;  2Y2N A;  3KSY A;  4XZQ A;  2G5H C;  3LZ1 B;  5DNN D;  3W99 C;  4J8X A;  1P3L A;  4CSR A;  4J8V C;  5B2I B;  4R8P D;  4WNN B;  4X23 B;  2ARO D;  5B31 B;  4H9Q A;  5AV6 D;  3EPK A;  2HUE B;  3UTB D;  3B6G D;  3AZN C;  4E44 A;  3C1C A;  1KX4 B;  1EQZ A;  3W97 D;  3REK D;  5DNM C;  4NE6 A;  4J8U A;  1P3G A;  4DRA A;  5CPI B;  5B32 C;  4QLC D;  4ZUX B;  3X1V C;  3A6N D;  2F8N H;  5GT3 C;  3MGP B;  3W96 C;  1P3P D;  3H0L C;  3AV1 B;  1HQ3 B;  5B2J B;  3B0D C;  3KUY A;  1P3P A;  5AVB C;  5B24 C;  2Y2L A;  3AZM C;  5E5A B;  2DF4 C;  1KX3 D;  2HIO C;  3WA9 D;  4YM6 B;  1M1A C;  4WU8 D;  3AV2 A;  3B0C T;  3W97 A;  3WKJ D;  3R45 A;  4YM6 A;  3KWQ A;  4J8W C;  3LZ0 D;  3W96 B;  3UTA C;  5AVB B;  3REI D;  1P3F A;  3B0D B;  4NE5 A;  3KWQ D;  3KUY B;  3WKJ A;  1P34 C;  1AOI C;  3B6G C;  4H9O A;  4WU8 A;  4AWL C;  1M1A D;  3UT9 D;  1ZLA A;  4X23 C;  4Z66 A;  5FUG B;  5F99 C;  4J8V B;  3MGP A;  3C1B D;  1M19 A;  4KHA A;  2NZD A;  4ZUX A;  1BFM A;  1KX4 C;  3X1S C;  3MVD C;  5AV8 C;  3MNN D;  2CV5 A;  1WWI A;  5B2I C;  3MGQ A;  5CP6 B;  5B40 C;  4CSR B;  2Y2Q A;  2UWX A;  3C1C D;  1BH8 A;  4E45 A;  5GT0 D;  3B0C W;  5B1L A;  5GXQ A;  4KGC B;  3UTA D;  4R8P A;  2F8N A;  3B0B A;  1P3A D;  2BYM A;  4J8X D;  3REH C;  3WAA B;  2PYO B;  1TZY A;  3AN2 C;  5CPJ D;  4NFT A;  3AZH B;  5B1M B;  4UUZ B;  4LD9 D;  2BYK A;  3F6T A;  5AVC B;  5BT1 D;  3AFA A;  5GXQ B;  3AZI C;  3MGS C;  5GSU C;  1P3O D;  5CP6 A;  2YFW A;  3KFU G;  5BO0 A;  2PYO C;  2NQB B;  5AV9 B;  2G5I C;  3MGS B;  4XUJ C;  3WTP A;  4CAY B;  2YFV B;  3AZG D;  4J8V A;  3W98 B;  4KUD A;  2ZY3 A;  1ZLA B;  3C1C C;  3AFA B;  1P3G C;  3X1U A;  3X1V A;  2ZY2 A;  5AV6 B;  4NE3 A;  3W96 A;  3UTB B;  2Y2P A;  3WAA A;  3C1B A;  3R45 B;  2NZD D;  1KX4 D;  5AV8 B;  3LJA A;  4KGC A;  5B1L B;  5E5A A;  3MNN C;  1U35 A;  4ZUX D;  1M18 B;  1S32 C;  5GT3 D;  1P3P C;  3AZM A;  2HIO A;  1M1A A;  5JA4 A;  2CV5 B;  5F99 D;  3AV1 D;  3AZJ A;  1KU5 A;  1F66 C;  4YS3 C;  1BH9 A;  4AWL B;  3AV2 D;  4ZBJ B;  3AZJ D;  3NQJ B;  5JRG B;  3KXB D;  5BNV A;  5B0Y B;  3AZE B;  1P34 A;  1AOI A;  4G91 B;  1M19 B;  3W99 D;  3WA9 B;  5CPK B;  1BH9 B;  4WU8 C;  4J8W B;  3AL0 C;  3A1K A;  4YS3 B;  3LZ0 B;  3LZ0 C;  1U35 D;  2Y2J A;  5AVB D;  4WZS B;  3AZL C;  3AZM B;  3H0R C;  3KUY D;  4H9R A;  2NZD C;  3WA9 C;  5B32 B;  2IO5 C;  2Y2K A;  5B2J C;  3A6N A;  5BS7 C;  3X1V D;  1P3G D;  3UT9 C;  2RVQ D;  1H3O B;  2BG1 A;  1EQZ D;  5B33 C;  1P34 D;  1AOI D;  5DNN C;  4G92 C;  2DQN C;  4H9S A;  1ID3 B;  4H9P B;  5B1L C; 
#chains in the Genus database with same CATH homology
 1P3O C;  3AYW C;  4R8P C;  2HIO D;  5DNM D;  1JFI A;  5B31 C;  3AZI D;  3UTB C;  1WWS A;  4H9N B;  5KDM A;  5GT0 B;  3O62 C;  3LZ1 C;  3MVD D;  4KGC D;  3VH5 A;  4J8U B;  3B6F A;  3MGR D;  2J8P A;  3X1T A;  1P3A B;  3AFA C;  3WAA D;  5AY8 B;  5AV9 A;  4H9Q B;  3REL C;  5B1M D;  3NQU B;  3AZF A;  5C3I C;  1P3L B;  3AZG C;  5B40 D;  1TZY D;  5B0Z B;  1F66 D;  2XD1 A;  5CPK A;  5B0Y A;  3AZE A;  5B1M C;  5JRG A;  5B33 D;  3MGS D;  5AV5 A;  1P3M C;  1P3B A;  1PZR A;  2BYM B;  4KUD C;  4X23 D;  5B0Z C;  3AZG B;  3REK B;  3AN2 B;  3REJ A;  3AZK B;  3W98 D;  4JJN D;  5C3I B;  1P3L C;  1M18 A;  4H9P A;  3WAA C;  3C1B C;  1R4V A;  4QLC B;  4EO5 B;  3MGP D;  3AZN A;  4QLC C;  4KGC C;  1EQZ C;  5DNM A;  2XD5 A;  4Z5T A;  4J8U C;  3REK C;  5GT0 C;  3O62 B;  1HQ3 D;  4JJN C;  1P3K D;  3REI A;  5B1L D;  1W2E A;  3TU4 C;  4YM6 D;  3W98 A;  1S32 D;  3WKJ B;  2YFV A;  3KUY C;  5BNV B;  2Y2G A;  3NQJ A;  5F99 B;  3KWQ B;  4HGA B;  3AV2 C;  3AZJ B;  1F1E A;  3H0M C;  1P3I C;  3W97 C;  5JRG D;  4YM6 C;  3KXB B;  1M1A B;  3UT9 B;  2NQB A;  3EG5 B;  1M19 D;  2FFF B;  3REJ B;  3AZK A;  5CPK D;  4J8W D;  5B2J A;  4Z66 D;  3A6N C;  4YS3 D;  3UT9 A;  1U35 B;  2FJ7 D;  3AZL B;  5AVC A;  1P3A C;  4UUZ A;  5AV5 B;  4M6B A;  1KX5 C;  5F99 A;  3LEL C;  3MGP C;  4G91 C;  1M19 C;  4ZUX C;  2ZY5 A;  3X1V B;  5CPI C;  2Y2M A;  5B32 G;  5BT1 C;  3X1S A;  4Z2M H;  1KX3 A;  3MVD A;  4XZQ D;  5B31 A;  3VH5 W;  2CV5 C;  1ID3 D;  3X1S D;  5B2I A;  4Z2M G;  3MGQ C;  4J8X B;  3REL D;  3LZ1 A;  2PYO D;  3MGQ B;  3B6F C;  5DNM B;  3AZH D;  1N1J A;  3X1U D;  3X1T C;  2Y2H A;  4WU9 D;  5CPJ B;  2HUE C;  3X1T B;  5CPJ C;  5AVC D;  2F8N G;  4XZQ C;  3REH A;  3V9R A;  2ZY4 A;  1Q9C A;  1Z2C B;  2RVQ C;  3FDD A;  4J8U D;  4H9N A;  5AV6 C;  4J8X C;  3REH D;  3MGR B;  3AZG A;  3MNN B;  5AY8 D;  3VH6 T;  4WU9 C;  1KX5 D;  2NQB D;  2ARO A;  3EPH A;  3LZ1 D;  2BYK B;  1P3L D;  2VQR A;  5B0Y C;  3AZE C;  3IP4 C;  5B31 D;  1TZY B;  1ID3 A;  5AV5 C;  1P3M A;  1P3B C;  3KXB C;  3LEL D;  1F66 B;  3W97 B;  1H3O A;  5B0Z A;  4XUJ A;  1P3I D;  3WTP C;  3AFA D;  3A6N B;  1P3P B;  2JE5 A;  1T3U A;  3REJ C;  4LD9 A;  1M18 C;  4UPK A;  1HQ3 A;  5B24 A;  3AV1 A;  2FJ7 C;  3AZN D;  5AV8 D;  3KWQ C;  4J8W A;  3TU4 D;  3AZK D;  3UTA A;  4JJN B;  2F8N D;  5E5A D;  1B67 A;  5KDM B;  5GT0 A;  3WKJ C;  4JJN A;  1M18 D;  3VH5 T;  3REI C;  3LJA C;  3W98 C;  3REI B;  4X23 A;  3MNN A;  4Z66 C;  2CV5 D;  3O62 D;  1S32 A;  1P3K B;  1P3K C;  4Z5T B;  3A1I A;  5B31 G;  5B0Y D;  2Y2O A;  3AZE D;  3LJA B;  4DRB A;  4EO5 C;  5AV8 A;  1F66 A;  1TAF A;  3C1B B;  1ULY A;  5B40 A;  2RIQ A;  5B32 D;  5GSU B;  3AZF D;  1P3F D;  4DQY B;  3LZ0 A;  4XUJ D;  4KUD B;  5CP6 D;  2L5A A;  1P3B B;  3LEL A;  1P34 B;  1AOI B;  1P3M D;  3WA9 A;  5CPI A;  2ZM5 A;  3UTA B;  3WTP B;  1B6W A;  3AZI A;  1KX3 C;  3MGS A;  3EPJ A;  5B33 A;  2HIO B;  4H9S C;  4WNN A;  5B24 B;  2W8S A;  4LD9 B;  5GXQ D;  4XZQ B;  3MVD B;  5AY8 A;  3EPL A;  3X1S B;  3AYW A;  1P3O B;  1HTA A;  3AYW D;  3B6F B;  3UTB A;  3MGR C;  3AZH A;  5AV6 A;  5AV9 D;  5G49 B;  3X1U B;  5DNN B;  4G92 B;  3P5J B;  5B2I D;  4R8P B;  4WU9 A;  1JFI B;  2ARO C;  4WV4 B;  2ARO B;  2Y2I A;  3B6G B;  1BH8 B;  3REL A;  3X1U C;  2IO5 B;  3W99 A;  1ID3 C;  1ZLA D;  4CAY A;  1KX5 B;  3KXB A;  5CPI D;  5B33 B;  3V9R B;  5E5A C;  1U35 C;  1N1J B;  5CPK C;  3VH6 A;  4KHA B;  5BO0 B;  5JRG C;  1HQ3 C;  5B32 A;  2JCH A;  3LEL B;  4LD9 C;  5FUG A;  5B2J D;  4H9R B;  5GT3 A;  4ZBJ C;  3AN2 D;  3AV1 C;  1P3I B;  2FJ7 A;  3AZJ C;  1KX3 B;  4YS3 A;  4WU8 B;  5GT3 B;  3VH6 W;  2JSS A;  3W96 D;  5AVB A;  1TAF B;  3AZN B;  5BNX B;  2F2A C;  4HGA C;  3TU4 B;  3AV2 B;  4WJ3 C;  2F8N B;  3AZL A;  4QLC A;  5JA4 B;  2LY8 A;  4Z5T C;  3W99 B;  1S32 B;  1P3K A;  3REK A;  1P3F C;  4J8V D;  5BS7 A;  3B6G A;  3AZM D;  3TU4 A;  1ZLA C;  5BNX A;  5DNN A;  4Z5T D;  1P3G B;  3LJA D;  3REJ D;  4Z66 B;  1KX4 A;  3C1C B;  1EQZ B;  2F8N K;  1P3O A;  1P3I A;  2FJ7 B;  3AZL D;  2NQB C;  4H9O B;  3AZK C;  5AV5 D;  3O62 A;  3NQU A;  5GSU D;  3AZF B;  1P3F B;  4XUJ B;  4KUD D;  5GXQ C;  3AZI B;  1P3B D;  5AVC C;  1P3A A;  5AV9 C;  1P3M B;  1KX5 A;  3AZF C;  1TZY C;  2YFW B;  3WTP D;  3AN2 A;  2CWE A;  3WTP E;  3REL B;  1A7W A;  2NZD B;  5AY8 C;  3MGQ D;  4WU9 B;  5GSU A;  5B24 D;  3X1T D;  3MGR A;  3AZH C;  5B1M A;  5G49 A;  5B40 B;  5CP6 C;  2PYO A;  3REH B;  5B0Z D;  3AYW B;  5CHL B;  3B6F D;  5CPJ A;  2Y2N A;  3KSY A;  4XZQ A;  2G5H C;  3LZ1 B;  5DNN D;  3W99 C;  4J8X A;  1P3L A;  4CSR A;  4J8V C;  5B2I B;  4R8P D;  4WNN B;  4X23 B;  2ARO D;  5B31 B;  4H9Q A;  5AV6 D;  3EPK A;  2HUE B;  3UTB D;  3B6G D;  3AZN C;  4E44 A;  3C1C A;  1KX4 B;  1EQZ A;  3W97 D;  3REK D;  5DNM C;  4NE6 A;  4J8U A;  1P3G A;  4DRA A;  5CPI B;  5B32 C;  4QLC D;  4ZUX B;  3X1V C;  3A6N D;  2F8N H;  5GT3 C;  3MGP B;  3W96 C;  1P3P D;  3H0L C;  3AV1 B;  1HQ3 B;  5B2J B;  3B0D C;  3KUY A;  1P3P A;  5AVB C;  5B24 C;  2Y2L A;  3AZM C;  5E5A B;  2DF4 C;  1KX3 D;  2HIO C;  3WA9 D;  4YM6 B;  1M1A C;  4WU8 D;  3AV2 A;  3B0C T;  3W97 A;  3WKJ D;  3R45 A;  4YM6 A;  3KWQ A;  4J8W C;  3LZ0 D;  3W96 B;  3UTA C;  5AVB B;  3REI D;  1P3F A;  3B0D B;  4NE5 A;  3KWQ D;  3KUY B;  3WKJ A;  1P34 C;  1AOI C;  3B6G C;  4H9O A;  4WU8 A;  4AWL C;  1M1A D;  3UT9 D;  1ZLA A;  4X23 C;  4Z66 A;  5FUG B;  5F99 C;  4J8V B;  3MGP A;  3C1B D;  1M19 A;  4KHA A;  2NZD A;  4ZUX A;  1BFM A;  1KX4 C;  3X1S C;  3MVD C;  5AV8 C;  3MNN D;  2CV5 A;  1WWI A;  5B2I C;  3MGQ A;  5CP6 B;  5B40 C;  4CSR B;  2Y2Q A;  2UWX A;  3C1C D;  1BH8 A;  4E45 A;  5GT0 D;  3B0C W;  5B1L A;  5GXQ A;  4KGC B;  3UTA D;  4R8P A;  2F8N A;  3B0B A;  1P3A D;  2BYM A;  4J8X D;  3REH C;  3WAA B;  2PYO B;  1TZY A;  3AN2 C;  5CPJ D;  4NFT A;  3AZH B;  5B1M B;  4UUZ B;  4LD9 D;  2BYK A;  3F6T A;  5AVC B;  5BT1 D;  3AFA A;  5GXQ B;  3AZI C;  3MGS C;  5GSU C;  1P3O D;  5CP6 A;  2YFW A;  3KFU G;  5BO0 A;  2PYO C;  2NQB B;  5AV9 B;  2G5I C;  3MGS B;  4XUJ C;  3WTP A;  4CAY B;  2YFV B;  3AZG D;  4J8V A;  3W98 B;  4KUD A;  2ZY3 A;  1ZLA B;  3C1C C;  3AFA B;  1P3G C;  3X1U A;  3X1V A;  2ZY2 A;  5AV6 B;  4NE3 A;  3W96 A;  3UTB B;  2Y2P A;  3WAA A;  3C1B A;  3R45 B;  2NZD D;  1KX4 D;  5AV8 B;  3LJA A;  4KGC A;  5B1L B;  5E5A A;  3MNN C;  1U35 A;  4ZUX D;  1M18 B;  1S32 C;  5GT3 D;  1P3P C;  3AZM A;  2HIO A;  1M1A A;  5JA4 A;  2CV5 B;  5F99 D;  3AV1 D;  3AZJ A;  1KU5 A;  1F66 C;  4YS3 C;  1BH9 A;  4AWL B;  3AV2 D;  4ZBJ B;  3AZJ D;  3NQJ B;  5JRG B;  3KXB D;  5BNV A;  5B0Y B;  3AZE B;  1P34 A;  1AOI A;  4G91 B;  1M19 B;  3W99 D;  3WA9 B;  5CPK B;  1BH9 B;  4WU8 C;  4J8W B;  3AL0 C;  3A1K A;  4YS3 B;  3LZ0 B;  3LZ0 C;  1U35 D;  2Y2J A;  5AVB D;  4WZS B;  3AZL C;  3AZM B;  3H0R C;  3KUY D;  4H9R A;  2NZD C;  3WA9 C;  5B32 B;  2IO5 C;  2Y2K A;  5B2J C;  3A6N A;  5BS7 C;  3X1V D;  1P3G D;  3UT9 C;  2RVQ D;  1H3O B;  2BG1 A;  1EQZ D;  5B33 C;  1P34 D;  1AOI D;  5DNN C;  4G92 C;  2DQN C;  4H9S A;  1ID3 B;  4H9P B;  5B1L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...