1TAFA

Drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
PKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTSILDDAKVYANHARKKTIDLDDVRLATEVTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TFIID TBP ASSOCIATED FACTOR 42
publication title Structural similarity between TAFs and the heterotetrameric core of the histone octamer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Complex (two transcription factors)
total genus 26
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1996-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tafA00
5B0ZD 4X23C 1P3OD 4KHAB 3AZEB 5CP6A 1KX5D 3AV2B 1P3FA 5FUGB 1P3ID 5B0YA 2BYMA 4CAYB 4JJNB 1KX4A 3MGQA 4ZBJB 1KX3C 4UUZB 5DNMC 5B33D 3A6NC 3REKB 5GT3A 5GXQB 5CP6D 1BH9B 1B6WA 2NZDA 1S32B 5B0YD 3X1VA 3AZLC 1TZYB 4KGCB 4H9NB 3WTPC 3MGQD 4J8WB 5B24A 3UTAB 1P3BB 4H9SA 5E5AA 4EO5B 3LELB 1P3AA 4CSRB 3B0BA 2NZDD 4R8PA 1EQZC 3X1VD 3LJAD 3MGRA 5CPKB 1H3OA 3AZJC 3MNNB 5B24D 3TU4B 2YFVB 3B0CW 5CPJB 3W96C 3B0CT 5E5AD 5BS7A 3LZ1A 1P3AD 3MGPA 1N1JA 3LZ0B 1P3KB 4J8UC 4R8PD 4QLCD 3MGSB 3UTBB 4E44A 3MGRD 2BYKA 1ZLAC 3KUYA 1M18C 3V9RB 3MVDA 1P34C 5B0ZC 4J8XA 3B0DC 1P3OC 2YFWA 1KX5C 3W98D 1P3IC 5AV9C 4HGAC 4X23A 4G91B 3LZ1D 3MGPD 5CPIB 3AZNB 1F66B 3B6GB 3AV1B 4NE3A 1BFMA 5B33C 2FJ7B 3KUYD 1M19B 3MVDD 5CHLB 4J8XD 3W97B 5CP6C 3REIB 1F1EA 3KXBB 5B0YC 2LY8A 1ID3D 4ZUXA 3KWQB 4Z66A 3WTPE 5B1LC 3MGQC 1P3GA 3AZKB 1HQ3B 4WU8B 4H9OA 4H9PB 3W99B 2NZDC 2L5AA 5AVCB 3LJAC 3UT9B 4ZUXD 5AV5A 5DNNB 4Z66D 2NQBB 2HUEB 2CV5B 1P3GD 3X1UA 4KUDB 5JA4A 3AN2D 4H9SC 3WA9C 5E5AC 1WWSA 4YM6A 2HIOC 5GSUB 3X1TC 3W96A 5KDMB 4WU9A 4R8PC 4WNNA 1BH8A 4QLCC 2PYOC 5AV5D 5AV8A 3X1UD 5G49B 1M1AD 1ZLAA 1M18A 3X1SA 3W98C 5B0ZA 3WAAA 3LZ1C 4YM6D 3MGPC 1P3IA 5GT0B 5B32C 5AV9A 3W96D 4WU9D 5B2IB 1P3FB 1U35A 4NE6A 3AYWA 3AZHD 3MVDC 5AV8D 1KX4B 5B33A 1ZLAD 3AZGD 5B1MA 4XZQA 3X1SD 1M18D 4KGCC 3WAAD 5F99A 1ID3C 2F8NB 3C1CA 1AOID 5GT3B 5AV9D 1R4VA 3AZMD 2RVQD 1U35D 2CWEA 3X1VB 1P3MD 3AYWD 3C1BA 5B1LA 5B40C 3REJA 5AV6D 3B6FB 5BNVA 2F8NH 5B1MD 4XZQD 3VH6T 5F99D 3R45A 3C1CD 4ZUXC 1HTAA 4J8VB 4Z66C 3RELA 1P3AB 5AY8A 3LJAA 1P3GC 5BO0A 1P3PB 5JRGB 3AN2C 1H3OB 5B1LD 3C1BD 4YS3B 3REJD 3AZID 3NQUB 3AZFA 5AVBB 3WA9A 4H9RA 3REHA 2HIOA 3X1TA 5AV5C 2F8NK 5B2JD 3RELD 4QLCA 5AY8D 4G92B 2PYOA 2AROC 3X1UC 3AV2A 1M1AC 2IO5B 5C3IC 3WKJB 3KUYB 3NQJB 4YM6C 4J8XB 3W98A 3AZFD 3WA9D 4WU9C 4UUZA 3O62B 5BNXB 3REHD 1ULYA 2HIOD 4X23B 3X1TD 5B32A 3AZHC 5GXQA 2PYOD 1TAFA 5AV8C 3AZED 1BH9A 3AV2D 3AZGC 1S32A 3X1SC 3WAAC 5BT1D 1P3LC 1AOIC 4KGCA 4H9NA 4J8WA 1KX3B 5DNMB 1ID3A 3A6NB 3AZMC 2RVQC 1U35C 1P3BA 5B32D 3W99C 3AYWC 3REKD 1P3MC 5GXQD 5AV6C 5B31C 3AZLB 5B1MC 4XZQC 1S32D 5B40A 3WTPB 1TZYD 5F99C 4KUDC 3C1CC 4KGCD 4J8WD 4AWLB 3MNNA 3AFAB 3UTAD 3TU4A 2YFVA 1P3BD 3C1BC 3LELD 4XUJB 3REJC 3AZIC 1EQZB 3LZ0A 3AN2A 1P3KA 3UTBA 5B40D 5CPKD 3AZJB 3V9RA 4H9QB 5B2JC 3RELC 3MNND 5AY8C 4LD9C 3TU4D 5CPJD 1BH8B 5GT0C 4E45A 2AROA 4J8UB 1M1AA 5CPIA 3VH6A 3LZ0D 1P3KD 1F66A 3MGSD 3UTBD 3AZFC 1ZLAB 1M18B 3AV1A 1JFIB 1P34B 5B0ZB 4Z5TC 3REHC 3B0DB 1P3OB 1M19A 1KX5B 3W97A 5AV9B 4HGAB 3AZEC 1P3IB 3REIA 3AV2C 4M6BA 5B32G 3AZHA 3KXBA 2AROD 5BT1C 4JJNC 3KWQA 5CPID 3AZGA 3AZND 1F66D 3B6GD 4ZBJC 5B33B 3AZKA 3AV1D 1P3LA 1AOIA 3KSYA 1M19D 3REKC 5CP6B 3AZMA 5GXQC 3W97D 5B0YB 4H9PA 2BYMB 3REID 1P3MA 3W99A 1S32C 3KXBD 4WV4B 5AV6A 5B1LB 1TZYC 5B31A 3KWQD 3MGQB 1KU5A 2NQBA 4J8WC 2CV5A 3AZKD 1HQ3D 4KUDA 4WU8D 1P3LD 3UTAC 1P3BC 3R45B 4DRBA 4EO5C 3LELC 2NZDB 5GSUA 3W99D 5KDMA 3LJAB 5AVCD 3AZIA 5CPKC 5B31D 3VH6W 5DNND 2NQBD 5B24B 2CV5D 5G49A 3MNNC 4KUDD 3WA9B 3TU4C 5E5AB 5CPJC 5B2JA 2HIOB 3X1TB 4LD9A 4Z2MG 3O62C 4R8PB 5GSUD 4QLCB 5GT0A 2PYOB 3LZ0C 3MGRB 5B2IA 1P3KC 1Q9CA 3MGSC 3UTBC 3W98B 4Z5TA 3LZ1B 2F8NA 4KHAA 3MGPB 4LD9D 1N1JB 5B32B 4G91C 3AZEA 5FUGA 5CPIC 5GT0D 3AZNC 1TAFB 5B2ID 1F66C 1P3FD 3B6GC 2BYKB 4CAYA 4JJNA 3AV1C 3MVDB 2FJ7C 1M19C 2YFWB 1KX4D 3B6FA 4Z5TD 3W97C 1ID3B 3REIC 3REKA 4AWLC 2F8ND 3KXBC 3AFAC 5GT3D 3KWQC 4J8VA 3AZKC 4XUJC 1HQ3C 1TZYA 5B31G 4JJND 1P3PA 5JRGA 5B40B 4WU8C 4YS3A 3UTAA 3B6FD 3NQUA 5AVBA 1A7WA 4ZUXB 3LELA 4Z66B 4CSRA 5AVCC 3UT9C 1P3GB 5DNNC 4J8VD 3VH5A 2NQBC 2HUEC 5CPKA 2CV5C 4H9OB 3AN2B 1P3PD 5JRGD 3WKJA 4YS3D 3NQJA 5CPJA 5GSUC 5AVBD 5AV5B 3O62A 5BNXA 2AROB 3X1UB 1M1AB 3MGSA 4WZSB 5C3IB 5JA4B 3WKJD 4YM6B 4Z2MH 3W96B 4WU9B 1KX3A 4WNNB 5DNMA 2F8NG 3A6NA 2JSSA 5B2IC 3AZHB 3O62D 1P3FC 4X23D 3AZNA 5AV8B 3B6GA 3AZGB 1KX4C 3X1SB 3WAAB 2FJ7A 3AZLA 1P3LB 1AOIB 3WTPA 1KX3D 5GT3C 3AZMB 5DNMD 1WWIA 1U35B 3A6ND 3AFAA 1P3MB 3AYWB 3X1VC 3VH5W 5AV6B 5B31B 3VH5T 1HQ3A 4XUJA 5B1MB 4XZQB 1EQZA 4WU8A 3B6FC 2FJ7D 3AZLD 5F99B 5B24C 3C1CB 3WTPD 3AZJA 4H9QA 4NFTA 4J8VC 1P3AC 3AFAD 5AVCA 3UT9A 3C1BB 5DNNA 1P3PC 5JRGC 3REJB 3MGRC 3AZIB 4YS3C 4J8UA 4XUJD 5BNVB 1EQZD 4NE5A 5AVBC 1JFIA 1B67A 1P34A 3AZJD 5B2JB 3RELB 1P3OA 5AY8B 4LD9B 5BS7C 1KX5A 5BO0B 4G92C 3UT9D 4DRAA 2IO5C 3WKJC 4J8UD 3KUYC 3AZFB 4J8XC 4H9RB 3REHB 4Z5TB 1P34D
chains in the Genus database with same CATH superfamily
5B0ZD 4X23C 1P3OD 4KHAB 3AZEB 5CP6A 1KX5D 3AV2B 1P3FA 5FUGB 1P3ID 5B0YA 2BYMA 4CAYB 4JJNB 2J8PA 1KX4A 3MGQA 4ZBJB 1KX3C 4UUZB 5DNMC 5B33D 3A6NC 3REKB 5GT3A 5GXQB 5CP6D 1BH9B 1B6WA 2NZDA 1S32B 5B0YD 3X1VA 3EPHA 3AZLC 1TZYB 2FFFB 4KGCB 4H9NB 2W8SA 3WTPC 3MGQD 4J8WB 5B24A 3UTAB 1P3BB 4H9SA 5E5AA 4EO5B 3LELB 1P3AA 4CSRB 3B0BA 2NZDD 4R8PA 1EQZC 3X1VD 3LJAD 3MGRA 5CPKB 1H3OA 3AZJC 3MNNB 5B24D 3TU4B 2YFVB 3B0CW 5CPJB 3W96C 3B0CT 2G5HC 5E5AD 5BS7A 3LZ1A 1P3AD 3MGPA 2Y2GA 1N1JA 4WJ3C 3LZ0B 1P3KB 4J8UC 4R8PD 4QLCD 3MGSB 3UTBB 4E44A 2Y2PA 3MGRD 2BYKA 1ZLAC 3KUYA 1M18C 3V9RB 3MVDA 1P34C 5B0ZC 4J8XA 3B0DC 1P3OC 2YFWA 1KX5C 3W98D 1P3IC 5AV9C 4HGAC 4X23A 4G91B 3LZ1D 3MGPD 5CPIB 3AZNB 1F66B 3B6GB 3AV1B 4NE3A 1BFMA 5B33C 2FJ7B 3KUYD 1M19B 3MVDD 5CHLB 4J8XD 3W97B 5CP6C 3REIB 1F1EA 3KXBB 5B0YC 2LY8A 1ID3D 4ZUXA 3KWQB 4Z66A 2Y2QA 3WTPE 5B1LC 3MGQC 1P3GA 3AZKB 1HQ3B 4WU8B 4H9OA 1PZRA 3A1KA 1T3UA 2ZY4A 4H9PB 3W99B 2NZDC 2L5AA 5AVCB 3LJAC 3UT9B 4ZUXD 5AV5A 5DNNB 4Z66D 2NQBB 2HUEB 2CV5B 1P3GD 3X1UA 4KUDB 5JA4A 3AN2D 4H9SC 3WA9C 5E5AC 1WWSA 4YM6A 2HIOC 5GSUB 3X1TC 3AL0C 3W96A 5KDMB 4WU9A 4R8PC 4WNNA 1BH8A 4QLCC 3EPLA 2PYOC 5AV5D 5AV8A 3X1UD 5G49B 1M1AD 1ZLAA 1M18A 3X1SA 3W98C 5B0ZA 3WAAA 3LZ1C 4YM6D 3MGPC 2UWXA 5GT0B 5B32C 5AV9A 1P3IA 3W96D 4WU9D 5B2IB 1P3FB 1U35A 4NE6A 3AYWA 3AZHD 3A1IA 3MVDC 5AV8D 1KX4B 5B33A 1ZLAD 3AZGD 5B1MA 4XZQA 3X1SD 1M18D 4KGCC 3WAAD 5F99A 1ID3C 2F8NB 3C1CA 1AOID 5GT3B 5AV9D 1R4VA 3AZMD 2RVQD 1U35D 2CWEA 3X1VB 1P3MD 3AYWD 3C1BA 5B1LA 1Z2CB 5B40C 3REJA 5AV6D 3B6FB 5BNVA 2F8NH 5B1MD 4XZQD 3VH6T 5F99D 3R45A 3C1CD 4ZUXC 1HTAA 4J8VB 4Z66C 3RELA 1P3AB 5AY8A 3P5JB 3LJAA 1P3GC 5BO0A 1P3PB 5JRGB 3AN2C 1H3OB 5B1LD 3C1BD 4YS3B 3REJD 3AZID 2DQNC 2ZY2A 3NQUB 3IP4C 3AZFA 5AVBB 3WA9A 2F2AC 4H9RA 3REHA 2HIOA 3EPKA 3X1TA 5AV5C 2F8NK 5B2JD 3RELD 4QLCA 5AY8D 4G92B 2PYOA 2AROC 3X1UC 3AV2A 1M1AC 2IO5B 5C3IC 3WKJB 3KUYB 3NQJB 4YM6C 4J8XB 3W98A 3AZFD 3WA9D 4WU9C 4UUZA 3O62B 5BNXB 3REHD 1ULYA 2HIOD 4X23B 3X1TD 5B32A 3AZHC 5GXQA 2PYOD 1TAFA 5AV8C 3AZED 1BH9A 3AV2D 3AZGC 1S32A 3X1SC 1W2EA 3WAAC 5BT1D 1P3LC 1AOIC 4KGCA 4H9NA 4J8WA 1KX3B 5DNMB 1ID3A 3A6NB 3AZMC 2RVQC 1U35C 1P3BA 5B32D 3EG5B 3W99C 3REKD 3AYWC 1P3MC 2Y2HA 5GXQD 5AV6C 5B31C 3AZLB 5B1MC 4XZQC 1S32D 5B40A 3WTPB 1TZYD 5F99C 4KUDC 3C1CC 4KGCD 4J8WD 4AWLB 3MNNA 3AFAB 4UPKA 3UTAD 3TU4A 2YFVA 1P3BD 3C1BC 3LELD 4XUJB 3REJC 3AZIC 1EQZB 3LZ0A 3AN2A 1P3KA 3UTBA 5B40D 5CPKD 3AZJB 3V9RA 4H9QB 5B2JC 3RELC 3MNND 5AY8C 4LD9C 3TU4D 5CPJD 1BH8B 5GT0C 4E45A 2AROA 4J8UB 1M1AA 5CPIA 3VH6A 3LZ0D 1P3KD 1F66A 3MGSD 3UTBD 3AZFC 1ZLAB 1M18B 3AV1A 1JFIB 1P34B 5B0ZB 4Z5TC 3REHC 3B0DB 1P3OB 1M19A 1KX5B 3W97A 5AV9B 4HGAB 3AZEC 1P3IB 3REIA 3AV2C 4M6BA 5B32G 3AZHA 3KXBA 2AROD 5BT1C 4JJNC 2BG1A 3KWQA 5CPID 3AZGA 3AZND 1F66D 3B6GD 4ZBJC 5B33B 3AZKA 3AV1D 1P3LA 1AOIA 3KSYA 1M19D 3REKC 5CP6B 3H0LC 5GXQC 3AZMA 3W97D 5B0YB 4H9PA 2BYMB 3REID 1P3MA 3W99A 1S32C 3KXBD 4WV4B 5AV6A 5B1LB 1TZYC 5B31A 3KWQD 3MGQB 1KU5A 2NQBA 4J8WC 2CV5A 3AZKD 1HQ3D 4KUDA 4WU8D 1P3LD 3UTAC 1P3BC 3R45B 4DRBA 4EO5C 3LELC 2NZDB 5GSUA 3W99D 5KDMA 3LJAB 5AVCD 3AZIA 5CPKC 5B31D 3VH6W 5DNND 2NQBD 5B24B 2CV5D 5G49A 2ZY5A 3MNNC 4KUDD 3WA9B 3TU4C 5E5AB 5CPJC 5B2JA 2HIOB 3EPJA 3X1TB 4LD9A 4Z2MG 3O62C 4R8PB 5GSUD 4QLCB 5GT0A 2PYOB 3LZ0C 3MGRB 5B2IA 1P3KC 1Q9CA 3MGSC 3UTBC 2Y2OA 3W98B 4Z5TA 3LZ1B 2F8NA 4KHAA 3MGPB 4LD9D 1N1JB 5B32B 4G91C 3AZEA 5FUGA 5CPIC 5GT0D 3AZNC 1TAFB 5B2ID 1F66C 1P3FD 3B6GC 2BYKB 4CAYA 4JJNA 3AV1C 3MVDB 2FJ7C 2G5IC 1M19C 2YFWB 1KX4D 3F6TA 3B6FA 4Z5TD 3W97C 1ID3B 3REIC 3REKA 4AWLC 2F8ND 3KXBC 3AFAC 5GT3D 3KWQC 4J8VA 2XD5A 3AZKC 4XUJC 1HQ3C 1TZYA 5B31G 4JJND 1P3PA 5JRGA 5B40B 4WU8C 4YS3A 3UTAA 3B6FD 3NQUA 2Y2IA 5AVBA 1A7WA 4ZUXB 3LELA 4Z66B 4CSRA 5AVCC 3UT9C 2JE5A 1P3GB 5DNNC 4J8VD 3VH5A 2NQBC 2HUEC 5CPKA 2CV5C 4H9OB 3AN2B 1P3PD 5JRGD 3WKJA 3FDDA 4DQYB 4YS3D 2Y2KA 3NQJA 5CPJA 5GSUC 3KFUG 5AVBD 5AV5B 3O62A 5BNXA 2AROB 3X1UB 2ZY3A 1M1AB 3MGSA 4WZSB 5C3IB 5JA4B 3WKJD 4YM6B 4Z2MH 3W96B 4WU9B 1KX3A 5DNMA 4WNNB 2F8NG 3A6NA 2JCHA 2JSSA 5B2IC 3AZHB 3O62D 1P3FC 4X23D 3AZNA 5AV8B 3B6GA 3AZGB 2XD1A 3X1SB 1KX4C 3WAAB 2FJ7A 3AZLA 3H0RC 1P3LB 1AOIB 3WTPA 2VQRA 2Y2JA 1KX3D 5GT3C 3AZMB 5DNMD 2DF4C 1WWIA 1U35B 3A6ND 3AFAA 1P3MB 3AYWB 3X1VC 3VH5W 5AV6B 5B31B 2ZM5A 3H0MC 3VH5T 1HQ3A 4XUJA 5B1MB 4XZQB 1EQZA 4WU8A 3B6FC 2FJ7D 3AZLD 5F99B 5B24C 3C1CB 2Y2MA 3WTPD 2RIQA 3AZJA 4H9QA 4NFTA 4J8VC 1P3AC 3AFAD 5AVCA 3UT9A 3C1BB 5DNNA 1P3PC 5JRGC 3REJB 3MGRC 3AZIB 4YS3C 4J8UA 4XUJD 5BNVB 1EQZD 4NE5A 5AVBC 1JFIA 1B67A 1P34A 3AZJD 5B2JB 3RELB 2Y2LA 1P3OA 5AY8B 4LD9B 5BS7C 1KX5A 5BO0B 4G92C 3UT9D 4DRAA 2IO5C 3WKJC 4J8UD 3KUYC 3AZFB 2Y2NA 4J8XC 4H9RB 3REHB 4Z5TB 1P34D
chains in the Genus database with same CATH topology
5B0ZD 4X23C 1P3OD 4KHAB 3AZEB 5CP6A 1KX5D 3AV2B 1P3FA 5FUGB 1P3ID 5B0YA 2BYMA 4CAYB 4JJNB 2J8PA 1KX4A 3MGQA 4ZBJB 1KX3C 4UUZB 5DNMC 5B33D 3A6NC 3REKB 5GT3A 5GXQB 5CP6D 1BH9B 1B6WA 2NZDA 1S32B 5B0YD 3X1VA 3EPHA 3AZLC 1TZYB 2FFFB 4KGCB 4H9NB 2W8SA 3WTPC 3MGQD 4J8WB 5B24A 3UTAB 1P3BB 4H9SA 5E5AA 4EO5B 3LELB 1P3AA 4CSRB 3B0BA 2NZDD 4R8PA 1EQZC 3X1VD 3LJAD 3MGRA 5CPKB 1H3OA 3AZJC 3MNNB 5B24D 3TU4B 2YFVB 3B0CW 5CPJB 3W96C 3B0CT 2G5HC 5E5AD 5BS7A 3LZ1A 1P3AD 3MGPA 2Y2GA 1N1JA 4WJ3C 3LZ0B 1P3KB 4J8UC 4R8PD 4QLCD 3MGSB 3UTBB 4E44A 2Y2PA 3MGRD 2BYKA 1ZLAC 3KUYA 1M18C 3V9RB 3MVDA 1P34C 5B0ZC 4J8XA 3B0DC 1P3OC 2YFWA 1KX5C 3W98D 1P3IC 5AV9C 4HGAC 4X23A 4G91B 3LZ1D 3MGPD 5CPIB 3AZNB 1F66B 3B6GB 3AV1B 4NE3A 1BFMA 5B33C 2FJ7B 3KUYD 1M19B 3MVDD 5CHLB 4J8XD 3W97B 5CP6C 3REIB 1F1EA 3KXBB 5B0YC 2LY8A 1ID3D 4ZUXA 3KWQB 4Z66A 2Y2QA 3WTPE 5B1LC 3MGQC 1P3GA 3AZKB 1HQ3B 4WU8B 4H9OA 1PZRA 3A1KA 1T3UA 2ZY4A 4H9PB 3W99B 2NZDC 2L5AA 5AVCB 3LJAC 3UT9B 4ZUXD 5AV5A 5DNNB 4Z66D 2NQBB 2HUEB 2CV5B 1P3GD 3X1UA 4KUDB 5JA4A 3AN2D 4H9SC 3WA9C 5E5AC 1WWSA 4YM6A 2HIOC 5GSUB 3X1TC 3AL0C 3W96A 5KDMB 4WU9A 4R8PC 4WNNA 1BH8A 4QLCC 3EPLA 2PYOC 5AV5D 5AV8A 3X1UD 5G49B 1M1AD 1ZLAA 1M18A 3X1SA 3W98C 5B0ZA 3WAAA 3LZ1C 4YM6D 3MGPC 2UWXA 5GT0B 5B32C 5AV9A 1P3IA 3W96D 4WU9D 5B2IB 1P3FB 1U35A 4NE6A 3AYWA 3AZHD 3A1IA 3MVDC 5AV8D 1KX4B 5B33A 1ZLAD 3AZGD 5B1MA 4XZQA 3X1SD 1M18D 4KGCC 3WAAD 5F99A 1ID3C 2F8NB 3C1CA 1AOID 5GT3B 5AV9D 1R4VA 3AZMD 2RVQD 1U35D 2CWEA 3X1VB 1P3MD 3AYWD 3C1BA 5B1LA 1Z2CB 5B40C 3REJA 5AV6D 3B6FB 5BNVA 2F8NH 5B1MD 4XZQD 3VH6T 5F99D 3R45A 3C1CD 4ZUXC 1HTAA 4J8VB 4Z66C 3RELA 1P3AB 5AY8A 3P5JB 3LJAA 1P3GC 5BO0A 1P3PB 5JRGB 3AN2C 1H3OB 5B1LD 3C1BD 4YS3B 3REJD 3AZID 2DQNC 2ZY2A 3NQUB 3IP4C 3AZFA 5AVBB 3WA9A 2F2AC 4H9RA 3REHA 2HIOA 3EPKA 3X1TA 5AV5C 2F8NK 5B2JD 3RELD 4QLCA 5AY8D 4G92B 2PYOA 2AROC 3X1UC 3AV2A 1M1AC 2IO5B 5C3IC 3WKJB 3KUYB 3NQJB 4YM6C 4J8XB 3W98A 3AZFD 3WA9D 4WU9C 4UUZA 3O62B 5BNXB 3REHD 1ULYA 2HIOD 4X23B 3X1TD 5B32A 3AZHC 5GXQA 2PYOD 1TAFA 5AV8C 3AZED 1BH9A 3AV2D 3AZGC 1S32A 3X1SC 1W2EA 3WAAC 5BT1D 1P3LC 1AOIC 4KGCA 4H9NA 4J8WA 1KX3B 5DNMB 1ID3A 3A6NB 3AZMC 2RVQC 1U35C 1P3BA 5B32D 3EG5B 3W99C 3REKD 3AYWC 1P3MC 2Y2HA 5GXQD 5AV6C 5B31C 3AZLB 5B1MC 4XZQC 1S32D 5B40A 3WTPB 1TZYD 5F99C 4KUDC 3C1CC 4KGCD 4J8WD 4AWLB 3MNNA 3AFAB 4UPKA 3UTAD 3TU4A 2YFVA 1P3BD 3C1BC 3LELD 4XUJB 3REJC 3AZIC 1EQZB 3LZ0A 3AN2A 1P3KA 3UTBA 5B40D 5CPKD 3AZJB 3V9RA 4H9QB 5B2JC 3RELC 3MNND 5AY8C 4LD9C 3TU4D 5CPJD 1BH8B 5GT0C 4E45A 2AROA 4J8UB 1M1AA 5CPIA 3VH6A 3LZ0D 1P3KD 1F66A 3MGSD 3UTBD 3AZFC 1ZLAB 1M18B 3AV1A 1JFIB 1P34B 5B0ZB 4Z5TC 3REHC 3B0DB 1P3OB 1M19A 1KX5B 3W97A 5AV9B 4HGAB 3AZEC 1P3IB 3REIA 3AV2C 4M6BA 5B32G 3AZHA 3KXBA 2AROD 5BT1C 4JJNC 2BG1A 3KWQA 5CPID 3AZGA 3AZND 1F66D 3B6GD 4ZBJC 5B33B 3AZKA 3AV1D 1P3LA 1AOIA 3KSYA 1M19D 3REKC 5CP6B 3H0LC 5GXQC 3AZMA 3W97D 5B0YB 4H9PA 2BYMB 3REID 1P3MA 3W99A 1S32C 3KXBD 4WV4B 5AV6A 5B1LB 1TZYC 5B31A 3KWQD 3MGQB 1KU5A 2NQBA 4J8WC 2CV5A 3AZKD 1HQ3D 4KUDA 4WU8D 1P3LD 3UTAC 1P3BC 3R45B 4DRBA 4EO5C 3LELC 2NZDB 5GSUA 3W99D 5KDMA 3LJAB 5AVCD 3AZIA 5CPKC 5B31D 3VH6W 5DNND 2NQBD 5B24B 2CV5D 5G49A 2ZY5A 3MNNC 4KUDD 3WA9B 3TU4C 5E5AB 5CPJC 5B2JA 2HIOB 3EPJA 3X1TB 4LD9A 4Z2MG 3O62C 4R8PB 5GSUD 4QLCB 5GT0A 2PYOB 3LZ0C 3MGRB 5B2IA 1P3KC 1Q9CA 3MGSC 3UTBC 2Y2OA 3W98B 4Z5TA 3LZ1B 2F8NA 4KHAA 3MGPB 4LD9D 1N1JB 5B32B 4G91C 3AZEA 5FUGA 5CPIC 5GT0D 3AZNC 1TAFB 5B2ID 1F66C 1P3FD 3B6GC 2BYKB 4CAYA 4JJNA 3AV1C 3MVDB 2FJ7C 2G5IC 1M19C 2YFWB 1KX4D 3F6TA 3B6FA 4Z5TD 3W97C 1ID3B 3REIC 3REKA 4AWLC 2F8ND 3KXBC 3AFAC 5GT3D 3KWQC 4J8VA 2XD5A 3AZKC 4XUJC 1HQ3C 1TZYA 5B31G 4JJND 1P3PA 5JRGA 5B40B 4WU8C 4YS3A 3UTAA 3B6FD 3NQUA 2Y2IA 5AVBA 1A7WA 4ZUXB 3LELA 4Z66B 4CSRA 5AVCC 3UT9C 2JE5A 1P3GB 5DNNC 4J8VD 3VH5A 2NQBC 2HUEC 5CPKA 2CV5C 4H9OB 3AN2B 1P3PD 5JRGD 3WKJA 3FDDA 4DQYB 4YS3D 2Y2KA 3NQJA 5CPJA 5GSUC 3KFUG 5AVBD 5AV5B 3O62A 5BNXA 2AROB 3X1UB 2ZY3A 1M1AB 3MGSA 4WZSB 5C3IB 5JA4B 3WKJD 4YM6B 4Z2MH 3W96B 4WU9B 1KX3A 5DNMA 4WNNB 2F8NG 3A6NA 2JCHA 2JSSA 5B2IC 3AZHB 3O62D 1P3FC 4X23D 3AZNA 5AV8B 3B6GA 3AZGB 2XD1A 3X1SB 1KX4C 3WAAB 2FJ7A 3AZLA 3H0RC 1P3LB 1AOIB 3WTPA 2VQRA 2Y2JA 1KX3D 5GT3C 3AZMB 5DNMD 2DF4C 1WWIA 1U35B 3A6ND 3AFAA 1P3MB 3AYWB 3X1VC 3VH5W 5AV6B 5B31B 2ZM5A 3H0MC 3VH5T 1HQ3A 4XUJA 5B1MB 4XZQB 1EQZA 4WU8A 3B6FC 2FJ7D 3AZLD 5F99B 5B24C 3C1CB 2Y2MA 3WTPD 2RIQA 3AZJA 4H9QA 4NFTA 4J8VC 1P3AC 3AFAD 5AVCA 3UT9A 3C1BB 5DNNA 1P3PC 5JRGC 3REJB 3MGRC 3AZIB 4YS3C 4J8UA 4XUJD 5BNVB 1EQZD 4NE5A 5AVBC 1JFIA 1B67A 1P34A 3AZJD 5B2JB 3RELB 2Y2LA 1P3OA 5AY8B 4LD9B 5BS7C 1KX5A 5BO0B 4G92C 3UT9D 4DRAA 2IO5C 3WKJC 4J8UD 3KUYC 3AZFB 2Y2NA 4J8XC 4H9RB 3REHB 4Z5TB 1P34D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z D;  4X23 C;  1P3O D;  4KHA B;  3AZE B;  5CP6 A;  1KX5 D;  3AV2 B;  1P3F A;  5FUG B;  1P3I D;  5B0Y A;  2BYM A;  4CAY B;  4JJN B;  1KX4 A;  3MGQ A;  4ZBJ B;  1KX3 C;  4UUZ B;  5DNM C;  5B33 D;  3A6N C;  3REK B;  5GT3 A;  5GXQ B;  5CP6 D;  1BH9 B;  1B6W A;  2NZD A;  1S32 B;  5B0Y D;  3X1V A;  3AZL C;  1TZY B;  4KGC B;  4H9N B;  3WTP C;  3MGQ D;  4J8W B;  5B24 A;  3UTA B;  1P3B B;  4H9S A;  5E5A A;  4EO5 B;  3LEL B;  1P3A A;  4CSR B;  3B0B A;  2NZD D;  4R8P A;  1EQZ C;  3X1V D;  3LJA D;  3MGR A;  5CPK B;  1H3O A;  3AZJ C;  3MNN B;  5B24 D;  3TU4 B;  2YFV B;  3B0C W;  5CPJ B;  3W96 C;  3B0C T;  5E5A D;  5BS7 A;  3LZ1 A;  1P3A D;  3MGP A;  1N1J A;  3LZ0 B;  1P3K B;  4J8U C;  4R8P D;  4QLC D;  3MGS B;  3UTB B;  4E44 A;  3MGR D;  2BYK A;  1ZLA C;  3KUY A;  1M18 C;  3V9R B;  3MVD A;  1P34 C;  5B0Z C;  4J8X A;  3B0D C;  1P3O C;  2YFW A;  1KX5 C;  3W98 D;  1P3I C;  5AV9 C;  4HGA C;  4X23 A;  4G91 B;  3LZ1 D;  3MGP D;  5CPI B;  3AZN B;  1F66 B;  3B6G B;  3AV1 B;  4NE3 A;  1BFM A;  5B33 C;  2FJ7 B;  3KUY D;  1M19 B;  3MVD D;  5CHL B;  4J8X D;  3W97 B;  5CP6 C;  3REI B;  1F1E A;  3KXB B;  5B0Y C;  2LY8 A;  1ID3 D;  4ZUX A;  3KWQ B;  4Z66 A;  3WTP E;  5B1L C;  3MGQ C;  1P3G A;  3AZK B;  1HQ3 B;  4WU8 B;  4H9O A;  4H9P B;  3W99 B;  2NZD C;  2L5A A;  5AVC B;  3LJA C;  3UT9 B;  4ZUX D;  5AV5 A;  5DNN B;  4Z66 D;  2NQB B;  2HUE B;  2CV5 B;  1P3G D;  3X1U A;  4KUD B;  5JA4 A;  3AN2 D;  4H9S C;  3WA9 C;  5E5A C;  1WWS A;  4YM6 A;  2HIO C;  5GSU B;  3X1T C;  3W96 A;  5KDM B;  4WU9 A;  4R8P C;  4WNN A;  1BH8 A;  4QLC C;  2PYO C;  5AV5 D;  5AV8 A;  3X1U D;  5G49 B;  1M1A D;  1ZLA A;  1M18 A;  3X1S A;  3W98 C;  5B0Z A;  3WAA A;  3LZ1 C;  4YM6 D;  3MGP C;  1P3I A;  5GT0 B;  5B32 C;  5AV9 A;  3W96 D;  4WU9 D;  5B2I B;  1P3F B;  1U35 A;  4NE6 A;  3AYW A;  3AZH D;  3MVD C;  5AV8 D;  1KX4 B;  5B33 A;  1ZLA D;  3AZG D;  5B1M A;  4XZQ A;  3X1S D;  1M18 D;  4KGC C;  3WAA D;  5F99 A;  1ID3 C;  2F8N B;  3C1C A;  1AOI D;  5GT3 B;  5AV9 D;  1R4V A;  3AZM D;  2RVQ D;  1U35 D;  2CWE A;  3X1V B;  1P3M D;  3AYW D;  3C1B A;  5B1L A;  5B40 C;  3REJ A;  5AV6 D;  3B6F B;  5BNV A;  2F8N H;  5B1M D;  4XZQ D;  3VH6 T;  5F99 D;  3R45 A;  3C1C D;  4ZUX C;  1HTA A;  4J8V B;  4Z66 C;  3REL A;  1P3A B;  5AY8 A;  3LJA A;  1P3G C;  5BO0 A;  1P3P B;  5JRG B;  3AN2 C;  1H3O B;  5B1L D;  3C1B D;  4YS3 B;  3REJ D;  3AZI D;  3NQU B;  3AZF A;  5AVB B;  3WA9 A;  4H9R A;  3REH A;  2HIO A;  3X1T A;  5AV5 C;  2F8N K;  5B2J D;  3REL D;  4QLC A;  5AY8 D;  4G92 B;  2PYO A;  2ARO C;  3X1U C;  3AV2 A;  1M1A C;  2IO5 B;  5C3I C;  3WKJ B;  3KUY B;  3NQJ B;  4YM6 C;  4J8X B;  3W98 A;  3AZF D;  3WA9 D;  4WU9 C;  4UUZ A;  3O62 B;  5BNX B;  3REH D;  1ULY A;  2HIO D;  4X23 B;  3X1T D;  5B32 A;  3AZH C;  5GXQ A;  2PYO D;  1TAF A;  5AV8 C;  3AZE D;  1BH9 A;  3AV2 D;  3AZG C;  1S32 A;  3X1S C;  3WAA C;  5BT1 D;  1P3L C;  1AOI C;  4KGC A;  4H9N A;  4J8W A;  1KX3 B;  5DNM B;  1ID3 A;  3A6N B;  3AZM C;  2RVQ C;  1U35 C;  1P3B A;  5B32 D;  3W99 C;  3AYW C;  3REK D;  1P3M C;  5GXQ D;  5AV6 C;  5B31 C;  3AZL B;  5B1M C;  4XZQ C;  1S32 D;  5B40 A;  3WTP B;  1TZY D;  5F99 C;  4KUD C;  3C1C C;  4KGC D;  4J8W D;  4AWL B;  3MNN A;  3AFA B;  3UTA D;  3TU4 A;  2YFV A;  1P3B D;  3C1B C;  3LEL D;  4XUJ B;  3REJ C;  3AZI C;  1EQZ B;  3LZ0 A;  3AN2 A;  1P3K A;  3UTB A;  5B40 D;  5CPK D;  3AZJ B;  3V9R A;  4H9Q B;  5B2J C;  3REL C;  3MNN D;  5AY8 C;  4LD9 C;  3TU4 D;  5CPJ D;  1BH8 B;  5GT0 C;  4E45 A;  2ARO A;  4J8U B;  1M1A A;  5CPI A;  3VH6 A;  3LZ0 D;  1P3K D;  1F66 A;  3MGS D;  3UTB D;  3AZF C;  1ZLA B;  1M18 B;  3AV1 A;  1JFI B;  1P34 B;  5B0Z B;  4Z5T C;  3REH C;  3B0D B;  1P3O B;  1M19 A;  1KX5 B;  3W97 A;  5AV9 B;  4HGA B;  3AZE C;  1P3I B;  3REI A;  3AV2 C;  4M6B A;  5B32 G;  3AZH A;  3KXB A;  2ARO D;  5BT1 C;  4JJN C;  3KWQ A;  5CPI D;  3AZG A;  3AZN D;  1F66 D;  3B6G D;  4ZBJ C;  5B33 B;  3AZK A;  3AV1 D;  1P3L A;  1AOI A;  3KSY A;  1M19 D;  3REK C;  5CP6 B;  3AZM A;  5GXQ C;  3W97 D;  5B0Y B;  4H9P A;  2BYM B;  3REI D;  1P3M A;  3W99 A;  1S32 C;  3KXB D;  4WV4 B;  5AV6 A;  5B1L B;  1TZY C;  5B31 A;  3KWQ D;  3MGQ B;  1KU5 A;  2NQB A;  4J8W C;  2CV5 A;  3AZK D;  1HQ3 D;  4KUD A;  4WU8 D;  1P3L D;  3UTA C;  1P3B C;  3R45 B;  4DRB A;  4EO5 C;  3LEL C;  2NZD B;  5GSU A;  3W99 D;  5KDM A;  3LJA B;  5AVC D;  3AZI A;  5CPK C;  5B31 D;  3VH6 W;  5DNN D;  2NQB D;  5B24 B;  2CV5 D;  5G49 A;  3MNN C;  4KUD D;  3WA9 B;  3TU4 C;  5E5A B;  5CPJ C;  5B2J A;  2HIO B;  3X1T B;  4LD9 A;  4Z2M G;  3O62 C;  4R8P B;  5GSU D;  4QLC B;  5GT0 A;  2PYO B;  3LZ0 C;  3MGR B;  5B2I A;  1P3K C;  1Q9C A;  3MGS C;  3UTB C;  3W98 B;  4Z5T A;  3LZ1 B;  2F8N A;  4KHA A;  3MGP B;  4LD9 D;  1N1J B;  5B32 B;  4G91 C;  3AZE A;  5FUG A;  5CPI C;  5GT0 D;  3AZN C;  1TAF B;  5B2I D;  1F66 C;  1P3F D;  3B6G C;  2BYK B;  4CAY A;  4JJN A;  3AV1 C;  3MVD B;  2FJ7 C;  1M19 C;  2YFW B;  1KX4 D;  3B6F A;  4Z5T D;  3W97 C;  1ID3 B;  3REI C;  3REK A;  4AWL C;  2F8N D;  3KXB C;  3AFA C;  5GT3 D;  3KWQ C;  4J8V A;  3AZK C;  4XUJ C;  1HQ3 C;  1TZY A;  5B31 G;  4JJN D;  1P3P A;  5JRG A;  5B40 B;  4WU8 C;  4YS3 A;  3UTA A;  3B6F D;  3NQU A;  5AVB A;  1A7W A;  4ZUX B;  3LEL A;  4Z66 B;  4CSR A;  5AVC C;  3UT9 C;  1P3G B;  5DNN C;  4J8V D;  3VH5 A;  2NQB C;  2HUE C;  5CPK A;  2CV5 C;  4H9O B;  3AN2 B;  1P3P D;  5JRG D;  3WKJ A;  4YS3 D;  3NQJ A;  5CPJ A;  5GSU C;  5AVB D;  5AV5 B;  3O62 A;  5BNX A;  2ARO B;  3X1U B;  1M1A B;  3MGS A;  4WZS B;  5C3I B;  5JA4 B;  3WKJ D;  4YM6 B;  4Z2M H;  3W96 B;  4WU9 B;  1KX3 A;  4WNN B;  5DNM A;  2F8N G;  3A6N A;  2JSS A;  5B2I C;  3AZH B;  3O62 D;  1P3F C;  4X23 D;  3AZN A;  5AV8 B;  3B6G A;  3AZG B;  1KX4 C;  3X1S B;  3WAA B;  2FJ7 A;  3AZL A;  1P3L B;  1AOI B;  3WTP A;  1KX3 D;  5GT3 C;  3AZM B;  5DNM D;  1WWI A;  1U35 B;  3A6N D;  3AFA A;  1P3M B;  3AYW B;  3X1V C;  3VH5 W;  5AV6 B;  5B31 B;  3VH5 T;  1HQ3 A;  4XUJ A;  5B1M B;  4XZQ B;  1EQZ A;  4WU8 A;  3B6F C;  2FJ7 D;  3AZL D;  5F99 B;  5B24 C;  3C1C B;  3WTP D;  3AZJ A;  4H9Q A;  4NFT A;  4J8V C;  1P3A C;  3AFA D;  5AVC A;  3UT9 A;  3C1B B;  5DNN A;  1P3P C;  5JRG C;  3REJ B;  3MGR C;  3AZI B;  4YS3 C;  4J8U A;  4XUJ D;  5BNV B;  1EQZ D;  4NE5 A;  5AVB C;  1JFI A;  1B67 A;  1P34 A;  3AZJ D;  5B2J B;  3REL B;  1P3O A;  5AY8 B;  4LD9 B;  5BS7 C;  1KX5 A;  5BO0 B;  4G92 C;  3UT9 D;  4DRA A;  2IO5 C;  3WKJ C;  4J8U D;  3KUY C;  3AZF B;  4J8X C;  4H9R B;  3REH B;  4Z5T B;  1P34 D; 
#chains in the Genus database with same CATH topology
 5B0Z D;  4X23 C;  1P3O D;  4KHA B;  3AZE B;  5CP6 A;  1KX5 D;  3AV2 B;  1P3F A;  5FUG B;  1P3I D;  5B0Y A;  2BYM A;  4CAY B;  4JJN B;  2J8P A;  1KX4 A;  3MGQ A;  4ZBJ B;  1KX3 C;  4UUZ B;  5DNM C;  5B33 D;  3A6N C;  3REK B;  5GT3 A;  5GXQ B;  5CP6 D;  1BH9 B;  1B6W A;  2NZD A;  1S32 B;  5B0Y D;  3X1V A;  3EPH A;  3AZL C;  1TZY B;  2FFF B;  4KGC B;  4H9N B;  2W8S A;  3WTP C;  3MGQ D;  4J8W B;  5B24 A;  3UTA B;  1P3B B;  4H9S A;  5E5A A;  4EO5 B;  3LEL B;  1P3A A;  4CSR B;  3B0B A;  2NZD D;  4R8P A;  1EQZ C;  3X1V D;  3LJA D;  3MGR A;  5CPK B;  1H3O A;  3AZJ C;  3MNN B;  5B24 D;  3TU4 B;  2YFV B;  3B0C W;  5CPJ B;  3W96 C;  3B0C T;  2G5H C;  5E5A D;  5BS7 A;  3LZ1 A;  1P3A D;  3MGP A;  2Y2G A;  1N1J A;  4WJ3 C;  3LZ0 B;  1P3K B;  4J8U C;  4R8P D;  4QLC D;  3MGS B;  3UTB B;  4E44 A;  2Y2P A;  3MGR D;  2BYK A;  1ZLA C;  3KUY A;  1M18 C;  3V9R B;  3MVD A;  1P34 C;  5B0Z C;  4J8X A;  3B0D C;  1P3O C;  2YFW A;  1KX5 C;  3W98 D;  1P3I C;  5AV9 C;  4HGA C;  4X23 A;  4G91 B;  3LZ1 D;  3MGP D;  5CPI B;  3AZN B;  1F66 B;  3B6G B;  3AV1 B;  4NE3 A;  1BFM A;  5B33 C;  2FJ7 B;  3KUY D;  1M19 B;  3MVD D;  5CHL B;  4J8X D;  3W97 B;  5CP6 C;  3REI B;  1F1E A;  3KXB B;  5B0Y C;  2LY8 A;  1ID3 D;  4ZUX A;  3KWQ B;  4Z66 A;  2Y2Q A;  3WTP E;  5B1L C;  3MGQ C;  1P3G A;  3AZK B;  1HQ3 B;  4WU8 B;  4H9O A;  1PZR A;  3A1K A;  1T3U A;  2ZY4 A;  4H9P B;  3W99 B;  2NZD C;  2L5A A;  5AVC B;  3LJA C;  3UT9 B;  4ZUX D;  5AV5 A;  5DNN B;  4Z66 D;  2NQB B;  2HUE B;  2CV5 B;  1P3G D;  3X1U A;  4KUD B;  5JA4 A;  3AN2 D;  4H9S C;  3WA9 C;  5E5A C;  1WWS A;  4YM6 A;  2HIO C;  5GSU B;  3X1T C;  3AL0 C;  3W96 A;  5KDM B;  4WU9 A;  4R8P C;  4WNN A;  1BH8 A;  4QLC C;  3EPL A;  2PYO C;  5AV5 D;  5AV8 A;  3X1U D;  5G49 B;  1M1A D;  1ZLA A;  1M18 A;  3X1S A;  3W98 C;  5B0Z A;  3WAA A;  3LZ1 C;  4YM6 D;  3MGP C;  2UWX A;  5GT0 B;  5B32 C;  5AV9 A;  1P3I A;  3W96 D;  4WU9 D;  5B2I B;  1P3F B;  1U35 A;  4NE6 A;  3AYW A;  3AZH D;  3A1I A;  3MVD C;  5AV8 D;  1KX4 B;  5B33 A;  1ZLA D;  3AZG D;  5B1M A;  4XZQ A;  3X1S D;  1M18 D;  4KGC C;  3WAA D;  5F99 A;  1ID3 C;  2F8N B;  3C1C A;  1AOI D;  5GT3 B;  5AV9 D;  1R4V A;  3AZM D;  2RVQ D;  1U35 D;  2CWE A;  3X1V B;  1P3M D;  3AYW D;  3C1B A;  5B1L A;  1Z2C B;  5B40 C;  3REJ A;  5AV6 D;  3B6F B;  5BNV A;  2F8N H;  5B1M D;  4XZQ D;  3VH6 T;  5F99 D;  3R45 A;  3C1C D;  4ZUX C;  1HTA A;  4J8V B;  4Z66 C;  3REL A;  1P3A B;  5AY8 A;  3P5J B;  3LJA A;  1P3G C;  5BO0 A;  1P3P B;  5JRG B;  3AN2 C;  1H3O B;  5B1L D;  3C1B D;  4YS3 B;  3REJ D;  3AZI D;  2DQN C;  2ZY2 A;  3NQU B;  3IP4 C;  3AZF A;  5AVB B;  3WA9 A;  2F2A C;  4H9R A;  3REH A;  2HIO A;  3EPK A;  3X1T A;  5AV5 C;  2F8N K;  5B2J D;  3REL D;  4QLC A;  5AY8 D;  4G92 B;  2PYO A;  2ARO C;  3X1U C;  3AV2 A;  1M1A C;  2IO5 B;  5C3I C;  3WKJ B;  3KUY B;  3NQJ B;  4YM6 C;  4J8X B;  3W98 A;  3AZF D;  3WA9 D;  4WU9 C;  4UUZ A;  3O62 B;  5BNX B;  3REH D;  1ULY A;  2HIO D;  4X23 B;  3X1T D;  5B32 A;  3AZH C;  5GXQ A;  2PYO D;  1TAF A;  5AV8 C;  3AZE D;  1BH9 A;  3AV2 D;  3AZG C;  1S32 A;  3X1S C;  1W2E A;  3WAA C;  5BT1 D;  1P3L C;  1AOI C;  4KGC A;  4H9N A;  4J8W A;  1KX3 B;  5DNM B;  1ID3 A;  3A6N B;  3AZM C;  2RVQ C;  1U35 C;  1P3B A;  5B32 D;  3EG5 B;  3W99 C;  3REK D;  3AYW C;  1P3M C;  2Y2H A;  5GXQ D;  5AV6 C;  5B31 C;  3AZL B;  5B1M C;  4XZQ C;  1S32 D;  5B40 A;  3WTP B;  1TZY D;  5F99 C;  4KUD C;  3C1C C;  4KGC D;  4J8W D;  4AWL B;  3MNN A;  3AFA B;  4UPK A;  3UTA D;  3TU4 A;  2YFV A;  1P3B D;  3C1B C;  3LEL D;  4XUJ B;  3REJ C;  3AZI C;  1EQZ B;  3LZ0 A;  3AN2 A;  1P3K A;  3UTB A;  5B40 D;  5CPK D;  3AZJ B;  3V9R A;  4H9Q B;  5B2J C;  3REL C;  3MNN D;  5AY8 C;  4LD9 C;  3TU4 D;  5CPJ D;  1BH8 B;  5GT0 C;  4E45 A;  2ARO A;  4J8U B;  1M1A A;  5CPI A;  3VH6 A;  3LZ0 D;  1P3K D;  1F66 A;  3MGS D;  3UTB D;  3AZF C;  1ZLA B;  1M18 B;  3AV1 A;  1JFI B;  1P34 B;  5B0Z B;  4Z5T C;  3REH C;  3B0D B;  1P3O B;  1M19 A;  1KX5 B;  3W97 A;  5AV9 B;  4HGA B;  3AZE C;  1P3I B;  3REI A;  3AV2 C;  4M6B A;  5B32 G;  3AZH A;  3KXB A;  2ARO D;  5BT1 C;  4JJN C;  2BG1 A;  3KWQ A;  5CPI D;  3AZG A;  3AZN D;  1F66 D;  3B6G D;  4ZBJ C;  5B33 B;  3AZK A;  3AV1 D;  1P3L A;  1AOI A;  3KSY A;  1M19 D;  3REK C;  5CP6 B;  3H0L C;  5GXQ C;  3AZM A;  3W97 D;  5B0Y B;  4H9P A;  2BYM B;  3REI D;  1P3M A;  3W99 A;  1S32 C;  3KXB D;  4WV4 B;  5AV6 A;  5B1L B;  1TZY C;  5B31 A;  3KWQ D;  3MGQ B;  1KU5 A;  2NQB A;  4J8W C;  2CV5 A;  3AZK D;  1HQ3 D;  4KUD A;  4WU8 D;  1P3L D;  3UTA C;  1P3B C;  3R45 B;  4DRB A;  4EO5 C;  3LEL C;  2NZD B;  5GSU A;  3W99 D;  5KDM A;  3LJA B;  5AVC D;  3AZI A;  5CPK C;  5B31 D;  3VH6 W;  5DNN D;  2NQB D;  5B24 B;  2CV5 D;  5G49 A;  2ZY5 A;  3MNN C;  4KUD D;  3WA9 B;  3TU4 C;  5E5A B;  5CPJ C;  5B2J A;  2HIO B;  3EPJ A;  3X1T B;  4LD9 A;  4Z2M G;  3O62 C;  4R8P B;  5GSU D;  4QLC B;  5GT0 A;  2PYO B;  3LZ0 C;  3MGR B;  5B2I A;  1P3K C;  1Q9C A;  3MGS C;  3UTB C;  2Y2O A;  3W98 B;  4Z5T A;  3LZ1 B;  2F8N A;  4KHA A;  3MGP B;  4LD9 D;  1N1J B;  5B32 B;  4G91 C;  3AZE A;  5FUG A;  5CPI C;  5GT0 D;  3AZN C;  1TAF B;  5B2I D;  1F66 C;  1P3F D;  3B6G C;  2BYK B;  4CAY A;  4JJN A;  3AV1 C;  3MVD B;  2FJ7 C;  2G5I C;  1M19 C;  2YFW B;  1KX4 D;  3F6T A;  3B6F A;  4Z5T D;  3W97 C;  1ID3 B;  3REI C;  3REK A;  4AWL C;  2F8N D;  3KXB C;  3AFA C;  5GT3 D;  3KWQ C;  4J8V A;  2XD5 A;  3AZK C;  4XUJ C;  1HQ3 C;  1TZY A;  5B31 G;  4JJN D;  1P3P A;  5JRG A;  5B40 B;  4WU8 C;  4YS3 A;  3UTA A;  3B6F D;  3NQU A;  2Y2I A;  5AVB A;  1A7W A;  4ZUX B;  3LEL A;  4Z66 B;  4CSR A;  5AVC C;  3UT9 C;  2JE5 A;  1P3G B;  5DNN C;  4J8V D;  3VH5 A;  2NQB C;  2HUE C;  5CPK A;  2CV5 C;  4H9O B;  3AN2 B;  1P3P D;  5JRG D;  3WKJ A;  3FDD A;  4DQY B;  4YS3 D;  2Y2K A;  3NQJ A;  5CPJ A;  5GSU C;  3KFU G;  5AVB D;  5AV5 B;  3O62 A;  5BNX A;  2ARO B;  3X1U B;  2ZY3 A;  1M1A B;  3MGS A;  4WZS B;  5C3I B;  5JA4 B;  3WKJ D;  4YM6 B;  4Z2M H;  3W96 B;  4WU9 B;  1KX3 A;  5DNM A;  4WNN B;  2F8N G;  3A6N A;  2JCH A;  2JSS A;  5B2I C;  3AZH B;  3O62 D;  1P3F C;  4X23 D;  3AZN A;  5AV8 B;  3B6G A;  3AZG B;  2XD1 A;  3X1S B;  1KX4 C;  3WAA B;  2FJ7 A;  3AZL A;  3H0R C;  1P3L B;  1AOI B;  3WTP A;  2VQR A;  2Y2J A;  1KX3 D;  5GT3 C;  3AZM B;  5DNM D;  2DF4 C;  1WWI A;  1U35 B;  3A6N D;  3AFA A;  1P3M B;  3AYW B;  3X1V C;  3VH5 W;  5AV6 B;  5B31 B;  2ZM5 A;  3H0M C;  3VH5 T;  1HQ3 A;  4XUJ A;  5B1M B;  4XZQ B;  1EQZ A;  4WU8 A;  3B6F C;  2FJ7 D;  3AZL D;  5F99 B;  5B24 C;  3C1C B;  2Y2M A;  3WTP D;  2RIQ A;  3AZJ A;  4H9Q A;  4NFT A;  4J8V C;  1P3A C;  3AFA D;  5AVC A;  3UT9 A;  3C1B B;  5DNN A;  1P3P C;  5JRG C;  3REJ B;  3MGR C;  3AZI B;  4YS3 C;  4J8U A;  4XUJ D;  5BNV B;  1EQZ D;  4NE5 A;  5AVB C;  1JFI A;  1B67 A;  1P34 A;  3AZJ D;  5B2J B;  3REL B;  2Y2L A;  1P3O A;  5AY8 B;  4LD9 B;  5BS7 C;  1KX5 A;  5BO0 B;  4G92 C;  3UT9 D;  4DRA A;  2IO5 C;  3WKJ C;  4J8U D;  3KUY C;  3AZF B;  2Y2N A;  4J8X C;  4H9R B;  3REH B;  4Z5T B;  1P34 D; 
#chains in the Genus database with same CATH homology
 5B0Z D;  4X23 C;  1P3O D;  4KHA B;  3AZE B;  5CP6 A;  1KX5 D;  3AV2 B;  1P3F A;  5FUG B;  1P3I D;  5B0Y A;  2BYM A;  4CAY B;  4JJN B;  2J8P A;  1KX4 A;  3MGQ A;  4ZBJ B;  1KX3 C;  4UUZ B;  5DNM C;  5B33 D;  3A6N C;  3REK B;  5GT3 A;  5GXQ B;  5CP6 D;  1BH9 B;  1B6W A;  2NZD A;  1S32 B;  5B0Y D;  3X1V A;  3EPH A;  3AZL C;  1TZY B;  2FFF B;  4KGC B;  4H9N B;  2W8S A;  3WTP C;  3MGQ D;  4J8W B;  5B24 A;  3UTA B;  1P3B B;  4H9S A;  5E5A A;  4EO5 B;  3LEL B;  1P3A A;  4CSR B;  3B0B A;  2NZD D;  4R8P A;  1EQZ C;  3X1V D;  3LJA D;  3MGR A;  5CPK B;  1H3O A;  3AZJ C;  3MNN B;  5B24 D;  3TU4 B;  2YFV B;  3B0C W;  5CPJ B;  3W96 C;  3B0C T;  2G5H C;  5E5A D;  5BS7 A;  3LZ1 A;  1P3A D;  3MGP A;  2Y2G A;  1N1J A;  4WJ3 C;  3LZ0 B;  1P3K B;  4J8U C;  4R8P D;  4QLC D;  3MGS B;  3UTB B;  4E44 A;  2Y2P A;  3MGR D;  2BYK A;  1ZLA C;  3KUY A;  1M18 C;  3V9R B;  3MVD A;  1P34 C;  5B0Z C;  4J8X A;  3B0D C;  1P3O C;  2YFW A;  1KX5 C;  3W98 D;  1P3I C;  5AV9 C;  4HGA C;  4X23 A;  4G91 B;  3LZ1 D;  3MGP D;  5CPI B;  3AZN B;  1F66 B;  3B6G B;  3AV1 B;  4NE3 A;  1BFM A;  5B33 C;  2FJ7 B;  3KUY D;  1M19 B;  3MVD D;  5CHL B;  4J8X D;  3W97 B;  5CP6 C;  3REI B;  1F1E A;  3KXB B;  5B0Y C;  2LY8 A;  1ID3 D;  4ZUX A;  3KWQ B;  4Z66 A;  2Y2Q A;  3WTP E;  5B1L C;  3MGQ C;  1P3G A;  3AZK B;  1HQ3 B;  4WU8 B;  4H9O A;  1PZR A;  3A1K A;  1T3U A;  2ZY4 A;  4H9P B;  3W99 B;  2NZD C;  2L5A A;  5AVC B;  3LJA C;  3UT9 B;  4ZUX D;  5AV5 A;  5DNN B;  4Z66 D;  2NQB B;  2HUE B;  2CV5 B;  1P3G D;  3X1U A;  4KUD B;  5JA4 A;  3AN2 D;  4H9S C;  3WA9 C;  5E5A C;  1WWS A;  4YM6 A;  2HIO C;  5GSU B;  3X1T C;  3AL0 C;  3W96 A;  5KDM B;  4WU9 A;  4R8P C;  4WNN A;  1BH8 A;  4QLC C;  3EPL A;  2PYO C;  5AV5 D;  5AV8 A;  3X1U D;  5G49 B;  1M1A D;  1ZLA A;  1M18 A;  3X1S A;  3W98 C;  5B0Z A;  3WAA A;  3LZ1 C;  4YM6 D;  3MGP C;  2UWX A;  5GT0 B;  5B32 C;  5AV9 A;  1P3I A;  3W96 D;  4WU9 D;  5B2I B;  1P3F B;  1U35 A;  4NE6 A;  3AYW A;  3AZH D;  3A1I A;  3MVD C;  5AV8 D;  1KX4 B;  5B33 A;  1ZLA D;  3AZG D;  5B1M A;  4XZQ A;  3X1S D;  1M18 D;  4KGC C;  3WAA D;  5F99 A;  1ID3 C;  2F8N B;  3C1C A;  1AOI D;  5GT3 B;  5AV9 D;  1R4V A;  3AZM D;  2RVQ D;  1U35 D;  2CWE A;  3X1V B;  1P3M D;  3AYW D;  3C1B A;  5B1L A;  1Z2C B;  5B40 C;  3REJ A;  5AV6 D;  3B6F B;  5BNV A;  2F8N H;  5B1M D;  4XZQ D;  3VH6 T;  5F99 D;  3R45 A;  3C1C D;  4ZUX C;  1HTA A;  4J8V B;  4Z66 C;  3REL A;  1P3A B;  5AY8 A;  3P5J B;  3LJA A;  1P3G C;  5BO0 A;  1P3P B;  5JRG B;  3AN2 C;  1H3O B;  5B1L D;  3C1B D;  4YS3 B;  3REJ D;  3AZI D;  2DQN C;  2ZY2 A;  3NQU B;  3IP4 C;  3AZF A;  5AVB B;  3WA9 A;  2F2A C;  4H9R A;  3REH A;  2HIO A;  3EPK A;  3X1T A;  5AV5 C;  2F8N K;  5B2J D;  3REL D;  4QLC A;  5AY8 D;  4G92 B;  2PYO A;  2ARO C;  3X1U C;  3AV2 A;  1M1A C;  2IO5 B;  5C3I C;  3WKJ B;  3KUY B;  3NQJ B;  4YM6 C;  4J8X B;  3W98 A;  3AZF D;  3WA9 D;  4WU9 C;  4UUZ A;  3O62 B;  5BNX B;  3REH D;  1ULY A;  2HIO D;  4X23 B;  3X1T D;  5B32 A;  3AZH C;  5GXQ A;  2PYO D;  1TAF A;  5AV8 C;  3AZE D;  1BH9 A;  3AV2 D;  3AZG C;  1S32 A;  3X1S C;  1W2E A;  3WAA C;  5BT1 D;  1P3L C;  1AOI C;  4KGC A;  4H9N A;  4J8W A;  1KX3 B;  5DNM B;  1ID3 A;  3A6N B;  3AZM C;  2RVQ C;  1U35 C;  1P3B A;  5B32 D;  3EG5 B;  3W99 C;  3REK D;  3AYW C;  1P3M C;  2Y2H A;  5GXQ D;  5AV6 C;  5B31 C;  3AZL B;  5B1M C;  4XZQ C;  1S32 D;  5B40 A;  3WTP B;  1TZY D;  5F99 C;  4KUD C;  3C1C C;  4KGC D;  4J8W D;  4AWL B;  3MNN A;  3AFA B;  4UPK A;  3UTA D;  3TU4 A;  2YFV A;  1P3B D;  3C1B C;  3LEL D;  4XUJ B;  3REJ C;  3AZI C;  1EQZ B;  3LZ0 A;  3AN2 A;  1P3K A;  3UTB A;  5B40 D;  5CPK D;  3AZJ B;  3V9R A;  4H9Q B;  5B2J C;  3REL C;  3MNN D;  5AY8 C;  4LD9 C;  3TU4 D;  5CPJ D;  1BH8 B;  5GT0 C;  4E45 A;  2ARO A;  4J8U B;  1M1A A;  5CPI A;  3VH6 A;  3LZ0 D;  1P3K D;  1F66 A;  3MGS D;  3UTB D;  3AZF C;  1ZLA B;  1M18 B;  3AV1 A;  1JFI B;  1P34 B;  5B0Z B;  4Z5T C;  3REH C;  3B0D B;  1P3O B;  1M19 A;  1KX5 B;  3W97 A;  5AV9 B;  4HGA B;  3AZE C;  1P3I B;  3REI A;  3AV2 C;  4M6B A;  5B32 G;  3AZH A;  3KXB A;  2ARO D;  5BT1 C;  4JJN C;  2BG1 A;  3KWQ A;  5CPI D;  3AZG A;  3AZN D;  1F66 D;  3B6G D;  4ZBJ C;  5B33 B;  3AZK A;  3AV1 D;  1P3L A;  1AOI A;  3KSY A;  1M19 D;  3REK C;  5CP6 B;  3H0L C;  5GXQ C;  3AZM A;  3W97 D;  5B0Y B;  4H9P A;  2BYM B;  3REI D;  1P3M A;  3W99 A;  1S32 C;  3KXB D;  4WV4 B;  5AV6 A;  5B1L B;  1TZY C;  5B31 A;  3KWQ D;  3MGQ B;  1KU5 A;  2NQB A;  4J8W C;  2CV5 A;  3AZK D;  1HQ3 D;  4KUD A;  4WU8 D;  1P3L D;  3UTA C;  1P3B C;  3R45 B;  4DRB A;  4EO5 C;  3LEL C;  2NZD B;  5GSU A;  3W99 D;  5KDM A;  3LJA B;  5AVC D;  3AZI A;  5CPK C;  5B31 D;  3VH6 W;  5DNN D;  2NQB D;  5B24 B;  2CV5 D;  5G49 A;  2ZY5 A;  3MNN C;  4KUD D;  3WA9 B;  3TU4 C;  5E5A B;  5CPJ C;  5B2J A;  2HIO B;  3EPJ A;  3X1T B;  4LD9 A;  4Z2M G;  3O62 C;  4R8P B;  5GSU D;  4QLC B;  5GT0 A;  2PYO B;  3LZ0 C;  3MGR B;  5B2I A;  1P3K C;  1Q9C A;  3MGS C;  3UTB C;  2Y2O A;  3W98 B;  4Z5T A;  3LZ1 B;  2F8N A;  4KHA A;  3MGP B;  4LD9 D;  1N1J B;  5B32 B;  4G91 C;  3AZE A;  5FUG A;  5CPI C;  5GT0 D;  3AZN C;  1TAF B;  5B2I D;  1F66 C;  1P3F D;  3B6G C;  2BYK B;  4CAY A;  4JJN A;  3AV1 C;  3MVD B;  2FJ7 C;  2G5I C;  1M19 C;  2YFW B;  1KX4 D;  3F6T A;  3B6F A;  4Z5T D;  3W97 C;  1ID3 B;  3REI C;  3REK A;  4AWL C;  2F8N D;  3KXB C;  3AFA C;  5GT3 D;  3KWQ C;  4J8V A;  2XD5 A;  3AZK C;  4XUJ C;  1HQ3 C;  1TZY A;  5B31 G;  4JJN D;  1P3P A;  5JRG A;  5B40 B;  4WU8 C;  4YS3 A;  3UTA A;  3B6F D;  3NQU A;  2Y2I A;  5AVB A;  1A7W A;  4ZUX B;  3LEL A;  4Z66 B;  4CSR A;  5AVC C;  3UT9 C;  2JE5 A;  1P3G B;  5DNN C;  4J8V D;  3VH5 A;  2NQB C;  2HUE C;  5CPK A;  2CV5 C;  4H9O B;  3AN2 B;  1P3P D;  5JRG D;  3WKJ A;  3FDD A;  4DQY B;  4YS3 D;  2Y2K A;  3NQJ A;  5CPJ A;  5GSU C;  3KFU G;  5AVB D;  5AV5 B;  3O62 A;  5BNX A;  2ARO B;  3X1U B;  2ZY3 A;  1M1A B;  3MGS A;  4WZS B;  5C3I B;  5JA4 B;  3WKJ D;  4YM6 B;  4Z2M H;  3W96 B;  4WU9 B;  1KX3 A;  5DNM A;  4WNN B;  2F8N G;  3A6N A;  2JCH A;  2JSS A;  5B2I C;  3AZH B;  3O62 D;  1P3F C;  4X23 D;  3AZN A;  5AV8 B;  3B6G A;  3AZG B;  2XD1 A;  3X1S B;  1KX4 C;  3WAA B;  2FJ7 A;  3AZL A;  3H0R C;  1P3L B;  1AOI B;  3WTP A;  2VQR A;  2Y2J A;  1KX3 D;  5GT3 C;  3AZM B;  5DNM D;  2DF4 C;  1WWI A;  1U35 B;  3A6N D;  3AFA A;  1P3M B;  3AYW B;  3X1V C;  3VH5 W;  5AV6 B;  5B31 B;  2ZM5 A;  3H0M C;  3VH5 T;  1HQ3 A;  4XUJ A;  5B1M B;  4XZQ B;  1EQZ A;  4WU8 A;  3B6F C;  2FJ7 D;  3AZL D;  5F99 B;  5B24 C;  3C1C B;  2Y2M A;  3WTP D;  2RIQ A;  3AZJ A;  4H9Q A;  4NFT A;  4J8V C;  1P3A C;  3AFA D;  5AVC A;  3UT9 A;  3C1B B;  5DNN A;  1P3P C;  5JRG C;  3REJ B;  3MGR C;  3AZI B;  4YS3 C;  4J8U A;  4XUJ D;  5BNV B;  1EQZ D;  4NE5 A;  5AVB C;  1JFI A;  1B67 A;  1P34 A;  3AZJ D;  5B2J B;  3REL B;  2Y2L A;  1P3O A;  5AY8 B;  4LD9 B;  5BS7 C;  1KX5 A;  5BO0 B;  4G92 C;  3UT9 D;  4DRA A;  2IO5 C;  3WKJ C;  4J8U D;  3KUY C;  3AZF B;  2Y2N A;  4J8X C;  4H9R B;  3REH B;  4Z5T B;  1P34 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...