1TAFA

Drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
PKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTSILDDAKVYANHARKKTIDLDDVRLATEVTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (two transcription factors)
molecule keywords TFIID TBP ASSOCIATED FACTOR 42
publication title Structural similarity between TAFs and the heterotetrameric core of the histone octamer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 26
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1996-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tafA00
3AZMA 3REHC 5AVBB 3X1VD 1P3OA 1N1JB 4R8PD 5AV9B 5BT1C 3B6FD 5DNMB 5B32A 1P3KD 4KUDA 1M19D 1AOIB 2NZDA 3REHA 1P3ID 3O62D 3RELC 5B2JB 3W97D 3X1TD 3AZEB 3TU4D 4WU8C 1P34D 5E5AB 5JA4B 5GT3C 3UTBD 5CPID 5DNND 3AZHB 3RELA 3WA9D 4QLCD 2PYOC 2HUEB 4G91B 5B31D 5GXQB 1M1AC 4JJNB 3AZGC 4KGCC 4WU8A 2F8NA 5GT3A 4J8WA 4X23D 1JFIB 3LZ1C 5AY8D 2PYOA 3KUYC 1M1AA 5B2IC 4WU9D 3AZGA 5B33D 4Z2MH 4KGCA 5B2JC 3WAAC 1P3PB 3LZ1A 2NZDD 3W98B 3KUYA 2L5AA 3MNND 3C1BB 5B2IA 4LD9C 4XZQD 3AZFB 2NQBD 1H3OA 3MGPD 3MVDB 5KDMA 3WAAA 3REKC 5AV6D 4Z66D 1P3LC 4XUJD 3X1SB 2BYKB 4J8XC 3REJD 4LD9A 1S32B 4CSRB 2BYMA 2AROC 5AV5D 3AV1C 1P3MD 5FUGB 3REKA 1P3AB 4J8WD 3AN2C 4EO5B 4J8XA 1P3PC 3B6GD 1B67A 1ZLAD 3LZ0C 3AZNC 4UUZB 2AROA 4NE6A 3AV1A 5AV8B 3WKJC 1P3BC 2YFVA 3AN2A 3AZKC 1KX4D 1M19B 3LZ0A 4ZUXD 5B40D 3AYWD 3AZNA 3A6NC 1KX3C 4NE3A 3AZJC 3WKJA 1P3BA 3NQUA 1TAFB 5GT0C 2F8NH 1P3FC 2CV5B 3MGSD 3AZKA 3AZIB 3A6NA 1KX3A 4H9OB 3B0CW 3KXBC 3LELD 3NQJA 4J8VC 3AZJA 4H9NA 5GT0A 5B0ZC 2HIOD 3X1VC 1P3FA 1P3GD 1ID3A 4DRAA 5BO0B 4R8PC 3X1UB 3AFAD 3B6FC 4YS3D 2FJ7D 4WNNB 5JRGB 1Q9CA 5B24D 3KWQB 4J8VA 2YFWA 3KXBA 5AY8B 3UT9B 1P3KC 1M19C 3AZMB 1P3OB 5B0ZA 1U35D 3X1VA 1KX5D 1P3IC 3O62C 4R8PA 3R45A 3B6FA 5B32B 4H9SC 3W97C 4Z5TA 3X1TC 4KUDB 1P3KA 1BH8A 2NZDB 3REHB 3TU4C 3UTBC 1P3IA 5CPIC 5DNNC 3O62A 3WA9C 4QLCC 4H9SA 3W97A 3X1TA 5B31C 5B0YD 3MGQD 3TU4A 1P34A 3UTBA 4X23C 3RELB 5CPIA 5DNNA 3WA9A 5AY8C 4QLCA 2RVQD 1ID3D 5B31A 2IO5C 4WU9C 4WU8B 2F8NB 5GT3B 4J8WB 5B33C 1F66D 3WTPA 4ZBJC 4X23A 2PYOB 2NZDC 3VH5W 3UTAD 1M1AB 3C1CD 3REID 1KU5A 4HGAC 3MNNC 3AZGB 4KGCB 4XZQC 4WU9A 2NQBC 3W96D 5BNVA 5B33A 4Z5TD 3MGPC 5CP6D 3LZ1B 3KUYB 5AV6C 4Z66C 3B0CT 5B2IB 4XUJC 5CPJD 3REJC 3MNNA 1H3OB 4XZQA 3AZLD 2NQBA 5KDMB 3WAAB 3MGPA 5B1MD 5AV5C 1P3MC 4H9RA 5AV6A 4J8WC 4Z66A 4XUJA 4LD9B 3REJA 3B6GC 1ZLAC 2BYMB 5AV5A 3REKB 1P3MA 1P3LB 3WTPD 4J8XB 3B6GA 1KX4C 1ZLAA 4ZUXC 5B40C 3AYWC 2AROB 3AV1B 3W99D 1M18D 2YFVB 3AN2B 3LZ0B 3MGSC 1KX4A 4ZUXA 3AZNB 5B40A 3AYWA 4J8UA 3WKJB 3LELC 1P3BB 3NQUB 3VH5A 2F8NK 2HIOC 3AZKB 1P3GC 3MGSA 1HQ3D 3AFAC 4YS3C 3A6NB 1KX3B 2FJ7C 3NQJB 5B24C 3AZJB 4H9NB 3LELA 5GT0B 3VH5T 3LJAD 1P3FB 2HIOA 1U35C 1ID3B 1KX5C 1P3GA 4NFTA 3AFAA 4YS3A 4J8VB 2YFWB 3KXBB 2FJ7A 5B24A 5B0ZB 3X1VB 1B6WA 5F99D 1U35A 1KX5A 4KHAA 3R45B 4R8PB 1EQZD 5CPKD 3B6FB 5B1LD 1P3KB 1BH8B 4YM6D 5B0YC 3MGQC 5GSUD 1TZYD 3KSYA 4J8UD 1P3IB 4H9PA 3O62B 3AV2D 3W97B 5BS7C 3X1TB 4E45A 4Z2MG 2RVQC 1ID3C 5AVCD 5B0YA 3TU4B 1P34B 3UTBB 5CHLB 3MGQA 5CPIB 5DNNB 3MGRD 1F66C 3WA9B 4QLCB 3V9RA 5AVBD 5BS7A 3UTAC 5B31B 5AV9D 3C1CC 3REIC 5DNMD 3W96C 4Z5TC 4X23B 5G49A 5CP6C 1BH9A 1AOID 1F66A 5C3IC 3UTAA 5B32G 3C1CA 3REIA 2IO5B 5B2JD 4WU9B 5CPJC 5BNVB 5B33B 3AZLC 3W96A 4ZBJB 3AZED 5B1MC 5CP6A 1HTAA 3B0DC 5E5AD 3AZHD 1P34C 4HGAB 3MNNB 4XZQB 4G92C 5CPJA 2NQBB 3MGPB 5GXQD 3AZLA 4AWLC 5B1MA 4JJND 4H9RB 5BNXA 5AV6B 4Z66B 4XUJB 3WTPC 3REJB 3WTPE 1WWSA 4WZSB 5AV5B 2F8NG 1P3MB 3W99C 4H9QA 1M18C 2CWEA 3B6GB 3W98D 1ZLAB 3C1BD 3AZFD 3W99A 1M18A 3MVDD 1KX4B 4ZUXB 3X1SD 5B40B 1HQ3C 3AYWB 4J8UB 1S32D 3LJAC 3B0BA 1P3AD 3MGSB 1HQ3A 4E44A 3LELB 3LJAA 2HIOB 5AV8D 5F99C 1P3GB 3AFAB 1EQZC 5CPKC 4YS3B 5B1LC 2FJ7B 5B24B 4YM6C 1U35B 1TZYC 5GSUC 5F99A 4KHAB 4J8UC 1KX5B 3AV2C 1EQZA 5CPKA 2CV5D 5B1LA 4YM6A 3AZID 5AVCC 4H9PB 1TZYA 5GSUA 3MGRC 3AV2A 5AVBC 3X1UD 5AV9C 5DNMC 5B0YB 5JRGD 3KWQD 5AVCA 3MGQB 3UT9D 3MGRA 3AZMD 3V9RB 1P3OD 1AOIC 4CAYA 5AVBA 1N1JA 3VH6W 5AV9A 5B32D 5DNMA 4KUDD 5G49B 1BH9B 1F66B 3AZEC 3REHD 1AOIA 5E5AC 3UTAB 5BT1D 3C1CB 3REIB 3AZHC 5B2JA 2HUEC 4G91C 3W96B 4Z5TB 5GXQC 5CP6B 3AZEA 4JJNC 5E5AA 5JA4A 5C3IB 3RELD 3AZHA 5CPJB 2JSSA 3AZLB 5GXQA 5B1MB 3B0DB 4WU8D 4JJNA 5GT3D 5BNXB 2F8ND 1P3LA 1JFIA 1BFMA 2PYOD 4G92B 5B31G 3W98C 1M1AD 4AWLB 3C1BC 3AZGD 4H9QB 3AZFC 4KGCD 3MVDC 1P3PA 3LZ1D 3WTPB 4WV4B 3KUYD 4DRBA 3W98A 5B2ID 3X1SC 3C1BA 3W99B 1M18B 3AZFA 1S32C 1WWIA 3WAAD 3MVDA 1R4VA 3VH6A 1P3AC 3X1SA 4LD9D 2BYKA 4EO5C 1A7WA 1S32A 4CSRA 3VH6T 3REKD 5AV8C 5FUGA 4M6BA 1P3AA 1P3LD 1HQ3B 4J8XD 4NE5A 3LJAB 2AROD 3AV1D 4UUZA 5AV8A 3AN2D 1P3PD 3LZ0D 2CV5C 1M19A 3AZND 3AZIC 5F99B 3WKJD 1P3BD 1EQZB 1TAFA 5CPKB 5B1LB 3AZKD 2CV5A 4YM6B 3X1UC 2LY8A 3A6ND 3AZIA 1KX3D 5JRGC 3KWQC 1F1EA 1TZYB 5GSUB 4H9OA 3UT9C 3AZJD 5GT0D 3AV2B 3AZMC 1P3FD 1P3OC 5BO0A 3X1UA 5B32C 1ULYA 5AVCB 4J8VD 3KXBD 4WNNA 5JRGA 3KWQA 3UT9A 4KUDC 3MGRB 5AY8A 5B0ZD 4CAYB
chains in the Genus database with same CATH superfamily
3AZMA 3REHC 2JCHA 1T3UA 5AVBB 3X1VD 1P3OA 1N1JB 4R8PD 5AV9B 5BT1C 3B6FD 5DNMB 5B32A 1P3KD 4KUDA 1M19D 1AOIB 2NZDA 3REHA 1P3ID 3O62D 3RELC 5B2JB 3W97D 3X1TD 3AZEB 3TU4D 4WU8C 1P34D 5E5AB 3H0LC 5JA4B 5GT3C 3UTBD 5CPID 5DNND 3AZHB 3RELA 3WA9D 4QLCD 2PYOC 2HUEB 4G91B 5B31D 5GXQB 1M1AC 4JJNB 3AZGC 4KGCC 4WU8A 2F8NA 5GT3A 4J8WA 4X23D 1JFIB 3LZ1C 5AY8D 2PYOA 3KUYC 2G5IC 1M1AA 5B2IC 4WU9D 3AZGA 5B33D 4Z2MH 4KGCA 5B2JC 3WAAC 1P3PB 3LZ1A 2NZDD 3W98B 2Y2PA 3KUYA 2L5AA 3MNND 3C1BB 5B2IA 4LD9C 3F6TA 4XZQD 3AZFB 2DQNC 2NQBD 1H3OA 3MGPD 3MVDB 5KDMA 3WAAA 3REKC 5AV6D 4Z66D 1P3LC 4XUJD 3X1SB 2BYKB 4J8XC 3REJD 4LD9A 1S32B 4CSRB 2BYMA 2AROC 5AV5D 2JE5A 3AV1C 1P3MD 5FUGB 3REKA 1P3AB 4J8WD 2DF4C 2ZY2A 3AN2C 4EO5B 4J8XA 1P3PC 3B6GD 1B67A 1ZLAD 3LZ0C 3AZNC 4UUZB 2AROA 2Y2NA 4NE6A 3P5JB 3AV1A 5AV8B 3WKJC 1P3BC 2YFVA 3AN2A 3AZKC 1KX4D 1M19B 3LZ0A 4ZUXD 5B40D 3AYWD 3AZNA 3A6NC 1KX3C 4NE3A 3AZJC 3WKJA 1P3BA 3NQUA 1TAFB 5GT0C 2F8NH 1P3FC 2CV5B 3MGSD 3AZKA 3AZIB 3A6NA 1KX3A 3KFUG 4H9OB 3B0CW 3KXBC 3LELD 3NQJA 4J8VC 3A1IA 3AZJA 4H9NA 5GT0A 5B0ZC 2HIOD 3X1VC 1P3FA 2XD1A 1P3GD 1ID3A 3AL0C 4DRAA 5BO0B 4R8PC 3X1UB 3AFAD 3B6FC 4YS3D 2FJ7D 4WNNB 5JRGB 1Q9CA 5B24D 3KWQB 4J8VA 2YFWA 3KXBA 5AY8B 3UT9B 1P3KC 1M19C 3AZMB 1P3OB 5B0ZA 1U35D 3X1VA 1KX5D 1P3IC 3O62C 4R8PA 3R45A 3B6FA 5B32B 4H9SC 3W97C 4Z5TA 3X1TC 4KUDB 1P3KA 1BH8A 2NZDB 3REHB 3TU4C 3UTBC 1P3IA 5CPIC 5DNNC 3O62A 3WA9C 4QLCC 4H9SA 3W97A 3X1TA 5B31C 5B0YD 3MGQD 3TU4A 1P34A 3UTBA 4X23C 3RELB 5CPIA 5DNNA 3WA9A 5AY8C 4QLCA 2VQRA 2RVQD 1ID3D 5B31A 2IO5C 4WU9C 2ZY3A 4WU8B 2F8NB 5GT3B 4J8WB 3H0MC 5B33C 1F66D 3WTPA 4ZBJC 4X23A 2PYOB 2NZDC 3VH5W 3UTAD 1M1AB 3C1CD 3REID 1KU5A 4HGAC 3MNNC 3AZGB 4KGCB 4XZQC 4WU9A 2NQBC 3W96D 5BNVA 5B33A 4Z5TD 3MGPC 5CP6D 3LZ1B 3KUYB 5AV6C 4Z66C 3B0CT 5B2IB 4XUJC 5CPJD 3REJC 3MNNA 3IP4C 1H3OB 4XZQA 3AZLD 2NQBA 5KDMB 3WAAB 3MGPA 5B1MD 5AV5C 1P3MC 4H9RA 5AV6A 4J8WC 4Z66A 4XUJA 4LD9B 3REJA 3B6GC 1ZLAC 2BYMB 1Z2CB 5AV5A 3REKB 1P3MA 1P3LB 3WTPD 2Y2JA 4J8XB 3B6GA 1KX4C 1ZLAA 4ZUXC 5B40C 3AYWC 2AROB 3AV1B 3W99D 1M18D 2YFVB 3AN2B 3LZ0B 3MGSC 1KX4A 3EG5B 4ZUXA 5B40A 3AYWA 3AZNB 4J8UA 2Y2OA 3WKJB 3LELC 1P3BB 3NQUB 3VH5A 2F8NK 2HIOC 3AZKB 1P3GC 3MGSA 1HQ3D 3AFAC 3EPHA 4YS3C 3A6NB 1KX3B 2FJ7C 3NQJB 5B24C 3AZJB 4H9NB 3LELA 5GT0B 3VH5T 3LJAD 1P3FB 2HIOA 1U35C 1ID3B 1KX5C 1P3GA 4NFTA 3AFAA 4YS3A 4J8VB 2YFWB 3KXBB 2FJ7A 5B24A 5B0ZB 3X1VB 1B6WA 5F99D 1U35A 1KX5A 4KHAA 3R45B 4R8PB 1EQZD 5CPKD 3B6FB 5B1LD 2Y2GA 1BH8B 1P3KB 4YM6D 5B0YC 3MGQC 5GSUD 1TZYD 3KSYA 4J8UD 1P3IB 4H9PA 2W8SA 3O62B 3AV2D 3W97B 5BS7C 3X1TB 4E45A 4Z2MG 2RVQC 1ID3C 5AVCD 5B0YA 3TU4B 1P34B 3UTBB 5CHLB 3MGQA 5CPIB 5DNNB 3MGRD 1F66C 3WA9B 2RIQA 4QLCB 3V9RA 5AVBD 2Y2IA 5BS7A 3UTAC 5B31B 5AV9D 3C1CC 3REIC 5DNMD 2Y2HA 3W96C 4Z5TC 4X23B 5G49A 5CP6C 1BH9A 1AOID 1F66A 5C3IC 3UTAA 5B32G 3C1CA 3REIA 2IO5B 5B2JD 4WU9B 5CPJC 5BNVB 5B33B 3AZLC 3W96A 4ZBJB 3AZED 5B1MC 5CP6A 1HTAA 3B0DC 5E5AD 3AZHD 1P34C 4HGAB 3MNNB 3EPJA 4XZQB 4G92C 5CPJA 2NQBB 3MGPB 5GXQD 3AZLA 4AWLC 1PZRA 5B1MA 4JJND 4H9RB 5BNXA 3H0RC 5AV6B 4Z66B 4XUJB 3WTPC 3REJB 3WTPE 1WWSA 4WZSB 5AV5B 2F8NG 1P3MB 3W99C 4H9QA 1M18C 4WJ3C 2CWEA 1W2EA 3B6GB 3EPKA 3W98D 1ZLAB 3C1BD 3AZFD 3W99A 1M18A 3MVDD 1KX4B 2ZY5A 4ZUXB 3X1SD 2Y2LA 1HQ3C 5B40B 3AYWB 4J8UB 2UWXA 1S32D 2F2AC 3LJAC 3B0BA 2XD5A 1P3AD 3MGSB 4UPKA 1HQ3A 2FFFB 4E44A 3LELB 3LJAA 2HIOB 5AV8D 5F99C 1P3GB 3AFAB 1EQZC 5CPKC 4YS3B 5B1LC 2FJ7B 5B24B 4YM6C 2Y2KA 1U35B 1TZYC 5GSUC 5F99A 4KHAB 4J8UC 1KX5B 3AV2C 1EQZA 5CPKA 2CV5D 5B1LA 4YM6A 3AZID 3A1KA 5AVCC 4H9PB 1TZYA 5GSUA 3MGRC 3AV2A 5AVBC 3X1UD 5AV9C 5DNMC 5B0YB 5JRGD 3KWQD 5AVCA 3MGQB 3UT9D 3MGRA 3AZMD 3V9RB 1P3OD 1AOIC 4CAYA 5AVBA 1N1JA 2Y2MA 3VH6W 5AV9A 5B32D 5DNMA 4KUDD 2J8PA 5G49B 1BH9B 1F66B 3AZEC 3REHD 1AOIA 5E5AC 3UTAB 5BT1D 3C1CB 3REIB 3AZHC 5B2JA 2HUEC 4G91C 3W96B 4Z5TB 5GXQC 5CP6B 2Y2QA 3AZEA 4JJNC 5E5AA 5JA4A 5C3IB 3RELD 3AZHA 5CPJB 2JSSA 3AZLB 5GXQA 5B1MB 3B0DB 4WU8D 4JJNA 5GT3D 5BNXB 2F8ND 1P3LA 1JFIA 1BFMA 2PYOD 4G92B 5B31G 3W98C 1M1AD 4AWLB 3C1BC 3AZGD 4H9QB 3AZFC 4KGCD 3MVDC 1P3PA 3LZ1D 3WTPB 4WV4B 3KUYD 4DRBA 3W98A 3EPLA 5B2ID 3X1SC 3C1BA 3W99B 1M18B 3AZFA 1S32C 1WWIA 3WAAD 3MVDA 1R4VA 3VH6A 3FDDA 1P3AC 2ZM5A 3X1SA 4LD9D 2BYKA 4EO5C 2G5HC 1A7WA 1S32A 4CSRA 3VH6T 3REKD 5AV8C 5FUGA 2BG1A 4M6BA 1P3AA 1P3LD 1HQ3B 4J8XD 4NE5A 3LJAB 2AROD 3AV1D 4UUZA 5AV8A 3AN2D 1P3PD 2ZY4A 3LZ0D 2CV5C 1M19A 3AZND 3AZIC 5F99B 3WKJD 1P3BD 1EQZB 1TAFA 5CPKB 5B1LB 3AZKD 2CV5A 4YM6B 3X1UC 2LY8A 3A6ND 3AZIA 1KX3D 5JRGC 3KWQC 1F1EA 1TZYB 5GSUB 4H9OA 3UT9C 3AZJD 5GT0D 3AV2B 4DQYB 3AZMC 1P3FD 1P3OC 5BO0A 3X1UA 5B32C 1ULYA 5AVCB 4J8VD 3KXBD 4WNNA 5JRGA 3KWQA 3UT9A 4KUDC 3MGRB 5AY8A 5B0ZD 4CAYB
chains in the Genus database with same CATH topology
3AZMA 3REHC 2JCHA 1T3UA 5AVBB 3X1VD 1P3OA 1N1JB 4R8PD 5AV9B 5BT1C 3B6FD 5DNMB 5B32A 1P3KD 4KUDA 1M19D 1AOIB 2NZDA 3REHA 1P3ID 3O62D 3RELC 5B2JB 3W97D 3X1TD 3AZEB 3TU4D 4WU8C 1P34D 5E5AB 3H0LC 5JA4B 5GT3C 3UTBD 5CPID 5DNND 3AZHB 3RELA 3WA9D 4QLCD 2PYOC 2HUEB 4G91B 5B31D 5GXQB 1M1AC 4JJNB 3AZGC 4KGCC 4WU8A 2F8NA 5GT3A 4J8WA 4X23D 1JFIB 3LZ1C 5AY8D 2PYOA 3KUYC 2G5IC 1M1AA 5B2IC 4WU9D 3AZGA 5B33D 4Z2MH 4KGCA 5B2JC 3WAAC 1P3PB 3LZ1A 2NZDD 3W98B 2Y2PA 3KUYA 2L5AA 3MNND 3C1BB 5B2IA 4LD9C 3F6TA 4XZQD 3AZFB 2DQNC 2NQBD 1H3OA 3MGPD 3MVDB 5KDMA 3WAAA 3REKC 5AV6D 4Z66D 1P3LC 4XUJD 3X1SB 2BYKB 4J8XC 3REJD 4LD9A 1S32B 4CSRB 2BYMA 2AROC 5AV5D 2JE5A 3AV1C 1P3MD 5FUGB 3REKA 1P3AB 4J8WD 2DF4C 2ZY2A 3AN2C 4EO5B 4J8XA 1P3PC 3B6GD 1B67A 1ZLAD 3LZ0C 3AZNC 4UUZB 2AROA 2Y2NA 4NE6A 3P5JB 3AV1A 5AV8B 3WKJC 1P3BC 2YFVA 3AN2A 3AZKC 1KX4D 1M19B 3LZ0A 4ZUXD 5B40D 3AYWD 3AZNA 3A6NC 1KX3C 4NE3A 3AZJC 3WKJA 1P3BA 3NQUA 1TAFB 5GT0C 2F8NH 1P3FC 2CV5B 3MGSD 3AZKA 3AZIB 3A6NA 1KX3A 3KFUG 4H9OB 3B0CW 3KXBC 3LELD 3NQJA 4J8VC 3A1IA 3AZJA 4H9NA 5GT0A 5B0ZC 2HIOD 3X1VC 1P3FA 2XD1A 1P3GD 1ID3A 3AL0C 4DRAA 5BO0B 4R8PC 3X1UB 3AFAD 3B6FC 4YS3D 2FJ7D 4WNNB 5JRGB 1Q9CA 5B24D 3KWQB 4J8VA 2YFWA 3KXBA 5AY8B 3UT9B 1P3KC 1M19C 3AZMB 1P3OB 5B0ZA 1U35D 3X1VA 1KX5D 1P3IC 3O62C 4R8PA 3R45A 3B6FA 5B32B 4H9SC 3W97C 4Z5TA 3X1TC 4KUDB 1P3KA 1BH8A 2NZDB 3REHB 3TU4C 3UTBC 1P3IA 5CPIC 5DNNC 3O62A 3WA9C 4QLCC 4H9SA 3W97A 3X1TA 5B31C 5B0YD 3MGQD 3TU4A 1P34A 3UTBA 4X23C 3RELB 5CPIA 5DNNA 3WA9A 5AY8C 4QLCA 2VQRA 2RVQD 1ID3D 5B31A 2IO5C 4WU9C 2ZY3A 4WU8B 2F8NB 5GT3B 4J8WB 3H0MC 5B33C 1F66D 3WTPA 4ZBJC 4X23A 2PYOB 2NZDC 3VH5W 3UTAD 1M1AB 3C1CD 3REID 1KU5A 4HGAC 3MNNC 3AZGB 4KGCB 4XZQC 4WU9A 2NQBC 3W96D 5BNVA 5B33A 4Z5TD 3MGPC 5CP6D 3LZ1B 3KUYB 5AV6C 4Z66C 3B0CT 5B2IB 4XUJC 5CPJD 3REJC 3MNNA 3IP4C 1H3OB 4XZQA 3AZLD 2NQBA 5KDMB 3WAAB 3MGPA 5B1MD 5AV5C 1P3MC 4H9RA 5AV6A 4J8WC 4Z66A 4XUJA 4LD9B 3REJA 3B6GC 1ZLAC 2BYMB 1Z2CB 5AV5A 3REKB 1P3MA 1P3LB 3WTPD 2Y2JA 4J8XB 3B6GA 1KX4C 1ZLAA 4ZUXC 5B40C 3AYWC 2AROB 3AV1B 3W99D 1M18D 2YFVB 3AN2B 3LZ0B 3MGSC 1KX4A 3EG5B 4ZUXA 5B40A 3AYWA 3AZNB 4J8UA 2Y2OA 3WKJB 3LELC 1P3BB 3NQUB 3VH5A 2F8NK 2HIOC 3AZKB 1P3GC 3MGSA 1HQ3D 3AFAC 3EPHA 4YS3C 3A6NB 1KX3B 2FJ7C 3NQJB 5B24C 3AZJB 4H9NB 3LELA 5GT0B 3VH5T 3LJAD 1P3FB 2HIOA 1U35C 1ID3B 1KX5C 1P3GA 4NFTA 3AFAA 4YS3A 4J8VB 2YFWB 3KXBB 2FJ7A 5B24A 5B0ZB 3X1VB 1B6WA 5F99D 1U35A 1KX5A 4KHAA 3R45B 4R8PB 1EQZD 5CPKD 3B6FB 5B1LD 2Y2GA 1BH8B 1P3KB 4YM6D 5B0YC 3MGQC 5GSUD 1TZYD 3KSYA 4J8UD 1P3IB 4H9PA 2W8SA 3O62B 3AV2D 3W97B 5BS7C 3X1TB 4E45A 4Z2MG 2RVQC 1ID3C 5AVCD 5B0YA 3TU4B 1P34B 3UTBB 5CHLB 3MGQA 5CPIB 5DNNB 3MGRD 1F66C 3WA9B 2RIQA 4QLCB 3V9RA 5AVBD 2Y2IA 5BS7A 3UTAC 5B31B 5AV9D 3C1CC 3REIC 5DNMD 2Y2HA 3W96C 4Z5TC 4X23B 5G49A 5CP6C 1BH9A 1AOID 1F66A 5C3IC 3UTAA 5B32G 3C1CA 3REIA 2IO5B 5B2JD 4WU9B 5CPJC 5BNVB 5B33B 3AZLC 3W96A 4ZBJB 3AZED 5B1MC 5CP6A 1HTAA 3B0DC 5E5AD 3AZHD 1P34C 4HGAB 3MNNB 3EPJA 4XZQB 4G92C 5CPJA 2NQBB 3MGPB 5GXQD 3AZLA 4AWLC 1PZRA 5B1MA 4JJND 4H9RB 5BNXA 3H0RC 5AV6B 4Z66B 4XUJB 3WTPC 3REJB 3WTPE 1WWSA 4WZSB 5AV5B 2F8NG 1P3MB 3W99C 4H9QA 1M18C 4WJ3C 2CWEA 1W2EA 3B6GB 3EPKA 3W98D 1ZLAB 3C1BD 3AZFD 3W99A 1M18A 3MVDD 1KX4B 2ZY5A 4ZUXB 3X1SD 2Y2LA 1HQ3C 5B40B 3AYWB 4J8UB 2UWXA 1S32D 2F2AC 3LJAC 3B0BA 2XD5A 1P3AD 3MGSB 4UPKA 1HQ3A 2FFFB 4E44A 3LELB 3LJAA 2HIOB 5AV8D 5F99C 1P3GB 3AFAB 1EQZC 5CPKC 4YS3B 5B1LC 2FJ7B 5B24B 4YM6C 2Y2KA 1U35B 1TZYC 5GSUC 5F99A 4KHAB 4J8UC 1KX5B 3AV2C 1EQZA 5CPKA 2CV5D 5B1LA 4YM6A 3AZID 3A1KA 5AVCC 4H9PB 1TZYA 5GSUA 3MGRC 3AV2A 5AVBC 3X1UD 5AV9C 5DNMC 5B0YB 5JRGD 3KWQD 5AVCA 3MGQB 3UT9D 3MGRA 3AZMD 3V9RB 1P3OD 1AOIC 4CAYA 5AVBA 1N1JA 2Y2MA 3VH6W 5AV9A 5B32D 5DNMA 4KUDD 2J8PA 5G49B 1BH9B 1F66B 3AZEC 3REHD 1AOIA 5E5AC 3UTAB 5BT1D 3C1CB 3REIB 3AZHC 5B2JA 2HUEC 4G91C 3W96B 4Z5TB 5GXQC 5CP6B 2Y2QA 3AZEA 4JJNC 5E5AA 5JA4A 5C3IB 3RELD 3AZHA 5CPJB 2JSSA 3AZLB 5GXQA 5B1MB 3B0DB 4WU8D 4JJNA 5GT3D 5BNXB 2F8ND 1P3LA 1JFIA 1BFMA 2PYOD 4G92B 5B31G 3W98C 1M1AD 4AWLB 3C1BC 3AZGD 4H9QB 3AZFC 4KGCD 3MVDC 1P3PA 3LZ1D 3WTPB 4WV4B 3KUYD 4DRBA 3W98A 3EPLA 5B2ID 3X1SC 3C1BA 3W99B 1M18B 3AZFA 1S32C 1WWIA 3WAAD 3MVDA 1R4VA 3VH6A 3FDDA 1P3AC 2ZM5A 3X1SA 4LD9D 2BYKA 4EO5C 2G5HC 1A7WA 1S32A 4CSRA 3VH6T 3REKD 5AV8C 5FUGA 2BG1A 4M6BA 1P3AA 1P3LD 1HQ3B 4J8XD 4NE5A 3LJAB 2AROD 3AV1D 4UUZA 5AV8A 3AN2D 1P3PD 2ZY4A 3LZ0D 2CV5C 1M19A 3AZND 3AZIC 5F99B 3WKJD 1P3BD 1EQZB 1TAFA 5CPKB 5B1LB 3AZKD 2CV5A 4YM6B 3X1UC 2LY8A 3A6ND 3AZIA 1KX3D 5JRGC 3KWQC 1F1EA 1TZYB 5GSUB 4H9OA 3UT9C 3AZJD 5GT0D 3AV2B 4DQYB 3AZMC 1P3FD 1P3OC 5BO0A 3X1UA 5B32C 1ULYA 5AVCB 4J8VD 3KXBD 4WNNA 5JRGA 3KWQA 3UT9A 4KUDC 3MGRB 5AY8A 5B0ZD 4CAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZM A;  3REH C;  5AVB B;  3X1V D;  1P3O A;  1N1J B;  4R8P D;  5AV9 B;  5BT1 C;  3B6F D;  5DNM B;  5B32 A;  1P3K D;  4KUD A;  1M19 D;  1AOI B;  2NZD A;  3REH A;  1P3I D;  3O62 D;  3REL C;  5B2J B;  3W97 D;  3X1T D;  3AZE B;  3TU4 D;  4WU8 C;  1P34 D;  5E5A B;  5JA4 B;  5GT3 C;  3UTB D;  5CPI D;  5DNN D;  3AZH B;  3REL A;  3WA9 D;  4QLC D;  2PYO C;  2HUE B;  4G91 B;  5B31 D;  5GXQ B;  1M1A C;  4JJN B;  3AZG C;  4KGC C;  4WU8 A;  2F8N A;  5GT3 A;  4J8W A;  4X23 D;  1JFI B;  3LZ1 C;  5AY8 D;  2PYO A;  3KUY C;  1M1A A;  5B2I C;  4WU9 D;  3AZG A;  5B33 D;  4Z2M H;  4KGC A;  5B2J C;  3WAA C;  1P3P B;  3LZ1 A;  2NZD D;  3W98 B;  3KUY A;  2L5A A;  3MNN D;  3C1B B;  5B2I A;  4LD9 C;  4XZQ D;  3AZF B;  2NQB D;  1H3O A;  3MGP D;  3MVD B;  5KDM A;  3WAA A;  3REK C;  5AV6 D;  4Z66 D;  1P3L C;  4XUJ D;  3X1S B;  2BYK B;  4J8X C;  3REJ D;  4LD9 A;  1S32 B;  4CSR B;  2BYM A;  2ARO C;  5AV5 D;  3AV1 C;  1P3M D;  5FUG B;  3REK A;  1P3A B;  4J8W D;  3AN2 C;  4EO5 B;  4J8X A;  1P3P C;  3B6G D;  1B67 A;  1ZLA D;  3LZ0 C;  3AZN C;  4UUZ B;  2ARO A;  4NE6 A;  3AV1 A;  5AV8 B;  3WKJ C;  1P3B C;  2YFV A;  3AN2 A;  3AZK C;  1KX4 D;  1M19 B;  3LZ0 A;  4ZUX D;  5B40 D;  3AYW D;  3AZN A;  3A6N C;  1KX3 C;  4NE3 A;  3AZJ C;  3WKJ A;  1P3B A;  3NQU A;  1TAF B;  5GT0 C;  2F8N H;  1P3F C;  2CV5 B;  3MGS D;  3AZK A;  3AZI B;  3A6N A;  1KX3 A;  4H9O B;  3B0C W;  3KXB C;  3LEL D;  3NQJ A;  4J8V C;  3AZJ A;  4H9N A;  5GT0 A;  5B0Z C;  2HIO D;  3X1V C;  1P3F A;  1P3G D;  1ID3 A;  4DRA A;  5BO0 B;  4R8P C;  3X1U B;  3AFA D;  3B6F C;  4YS3 D;  2FJ7 D;  4WNN B;  5JRG B;  1Q9C A;  5B24 D;  3KWQ B;  4J8V A;  2YFW A;  3KXB A;  5AY8 B;  3UT9 B;  1P3K C;  1M19 C;  3AZM B;  1P3O B;  5B0Z A;  1U35 D;  3X1V A;  1KX5 D;  1P3I C;  3O62 C;  4R8P A;  3R45 A;  3B6F A;  5B32 B;  4H9S C;  3W97 C;  4Z5T A;  3X1T C;  4KUD B;  1P3K A;  1BH8 A;  2NZD B;  3REH B;  3TU4 C;  3UTB C;  1P3I A;  5CPI C;  5DNN C;  3O62 A;  3WA9 C;  4QLC C;  4H9S A;  3W97 A;  3X1T A;  5B31 C;  5B0Y D;  3MGQ D;  3TU4 A;  1P34 A;  3UTB A;  4X23 C;  3REL B;  5CPI A;  5DNN A;  3WA9 A;  5AY8 C;  4QLC A;  2RVQ D;  1ID3 D;  5B31 A;  2IO5 C;  4WU9 C;  4WU8 B;  2F8N B;  5GT3 B;  4J8W B;  5B33 C;  1F66 D;  3WTP A;  4ZBJ C;  4X23 A;  2PYO B;  2NZD C;  3VH5 W;  3UTA D;  1M1A B;  3C1C D;  3REI D;  1KU5 A;  4HGA C;  3MNN C;  3AZG B;  4KGC B;  4XZQ C;  4WU9 A;  2NQB C;  3W96 D;  5BNV A;  5B33 A;  4Z5T D;  3MGP C;  5CP6 D;  3LZ1 B;  3KUY B;  5AV6 C;  4Z66 C;  3B0C T;  5B2I B;  4XUJ C;  5CPJ D;  3REJ C;  3MNN A;  1H3O B;  4XZQ A;  3AZL D;  2NQB A;  5KDM B;  3WAA B;  3MGP A;  5B1M D;  5AV5 C;  1P3M C;  4H9R A;  5AV6 A;  4J8W C;  4Z66 A;  4XUJ A;  4LD9 B;  3REJ A;  3B6G C;  1ZLA C;  2BYM B;  5AV5 A;  3REK B;  1P3M A;  1P3L B;  3WTP D;  4J8X B;  3B6G A;  1KX4 C;  1ZLA A;  4ZUX C;  5B40 C;  3AYW C;  2ARO B;  3AV1 B;  3W99 D;  1M18 D;  2YFV B;  3AN2 B;  3LZ0 B;  3MGS C;  1KX4 A;  4ZUX A;  3AZN B;  5B40 A;  3AYW A;  4J8U A;  3WKJ B;  3LEL C;  1P3B B;  3NQU B;  3VH5 A;  2F8N K;  2HIO C;  3AZK B;  1P3G C;  3MGS A;  1HQ3 D;  3AFA C;  4YS3 C;  3A6N B;  1KX3 B;  2FJ7 C;  3NQJ B;  5B24 C;  3AZJ B;  4H9N B;  3LEL A;  5GT0 B;  3VH5 T;  3LJA D;  1P3F B;  2HIO A;  1U35 C;  1ID3 B;  1KX5 C;  1P3G A;  4NFT A;  3AFA A;  4YS3 A;  4J8V B;  2YFW B;  3KXB B;  2FJ7 A;  5B24 A;  5B0Z B;  3X1V B;  1B6W A;  5F99 D;  1U35 A;  1KX5 A;  4KHA A;  3R45 B;  4R8P B;  1EQZ D;  5CPK D;  3B6F B;  5B1L D;  1P3K B;  1BH8 B;  4YM6 D;  5B0Y C;  3MGQ C;  5GSU D;  1TZY D;  3KSY A;  4J8U D;  1P3I B;  4H9P A;  3O62 B;  3AV2 D;  3W97 B;  5BS7 C;  3X1T B;  4E45 A;  4Z2M G;  2RVQ C;  1ID3 C;  5AVC D;  5B0Y A;  3TU4 B;  1P34 B;  3UTB B;  5CHL B;  3MGQ A;  5CPI B;  5DNN B;  3MGR D;  1F66 C;  3WA9 B;  4QLC B;  3V9R A;  5AVB D;  5BS7 A;  3UTA C;  5B31 B;  5AV9 D;  3C1C C;  3REI C;  5DNM D;  3W96 C;  4Z5T C;  4X23 B;  5G49 A;  5CP6 C;  1BH9 A;  1AOI D;  1F66 A;  5C3I C;  3UTA A;  5B32 G;  3C1C A;  3REI A;  2IO5 B;  5B2J D;  4WU9 B;  5CPJ C;  5BNV B;  5B33 B;  3AZL C;  3W96 A;  4ZBJ B;  3AZE D;  5B1M C;  5CP6 A;  1HTA A;  3B0D C;  5E5A D;  3AZH D;  1P34 C;  4HGA B;  3MNN B;  4XZQ B;  4G92 C;  5CPJ A;  2NQB B;  3MGP B;  5GXQ D;  3AZL A;  4AWL C;  5B1M A;  4JJN D;  4H9R B;  5BNX A;  5AV6 B;  4Z66 B;  4XUJ B;  3WTP C;  3REJ B;  3WTP E;  1WWS A;  4WZS B;  5AV5 B;  2F8N G;  1P3M B;  3W99 C;  4H9Q A;  1M18 C;  2CWE A;  3B6G B;  3W98 D;  1ZLA B;  3C1B D;  3AZF D;  3W99 A;  1M18 A;  3MVD D;  1KX4 B;  4ZUX B;  3X1S D;  5B40 B;  1HQ3 C;  3AYW B;  4J8U B;  1S32 D;  3LJA C;  3B0B A;  1P3A D;  3MGS B;  1HQ3 A;  4E44 A;  3LEL B;  3LJA A;  2HIO B;  5AV8 D;  5F99 C;  1P3G B;  3AFA B;  1EQZ C;  5CPK C;  4YS3 B;  5B1L C;  2FJ7 B;  5B24 B;  4YM6 C;  1U35 B;  1TZY C;  5GSU C;  5F99 A;  4KHA B;  4J8U C;  1KX5 B;  3AV2 C;  1EQZ A;  5CPK A;  2CV5 D;  5B1L A;  4YM6 A;  3AZI D;  5AVC C;  4H9P B;  1TZY A;  5GSU A;  3MGR C;  3AV2 A;  5AVB C;  3X1U D;  5AV9 C;  5DNM C;  5B0Y B;  5JRG D;  3KWQ D;  5AVC A;  3MGQ B;  3UT9 D;  3MGR A;  3AZM D;  3V9R B;  1P3O D;  1AOI C;  4CAY A;  5AVB A;  1N1J A;  3VH6 W;  5AV9 A;  5B32 D;  5DNM A;  4KUD D;  5G49 B;  1BH9 B;  1F66 B;  3AZE C;  3REH D;  1AOI A;  5E5A C;  3UTA B;  5BT1 D;  3C1C B;  3REI B;  3AZH C;  5B2J A;  2HUE C;  4G91 C;  3W96 B;  4Z5T B;  5GXQ C;  5CP6 B;  3AZE A;  4JJN C;  5E5A A;  5JA4 A;  5C3I B;  3REL D;  3AZH A;  5CPJ B;  2JSS A;  3AZL B;  5GXQ A;  5B1M B;  3B0D B;  4WU8 D;  4JJN A;  5GT3 D;  5BNX B;  2F8N D;  1P3L A;  1JFI A;  1BFM A;  2PYO D;  4G92 B;  5B31 G;  3W98 C;  1M1A D;  4AWL B;  3C1B C;  3AZG D;  4H9Q B;  3AZF C;  4KGC D;  3MVD C;  1P3P A;  3LZ1 D;  3WTP B;  4WV4 B;  3KUY D;  4DRB A;  3W98 A;  5B2I D;  3X1S C;  3C1B A;  3W99 B;  1M18 B;  3AZF A;  1S32 C;  1WWI A;  3WAA D;  3MVD A;  1R4V A;  3VH6 A;  1P3A C;  3X1S A;  4LD9 D;  2BYK A;  4EO5 C;  1A7W A;  1S32 A;  4CSR A;  3VH6 T;  3REK D;  5AV8 C;  5FUG A;  4M6B A;  1P3A A;  1P3L D;  1HQ3 B;  4J8X D;  4NE5 A;  3LJA B;  2ARO D;  3AV1 D;  4UUZ A;  5AV8 A;  3AN2 D;  1P3P D;  3LZ0 D;  2CV5 C;  1M19 A;  3AZN D;  3AZI C;  5F99 B;  3WKJ D;  1P3B D;  1EQZ B;  1TAF A;  5CPK B;  5B1L B;  3AZK D;  2CV5 A;  4YM6 B;  3X1U C;  2LY8 A;  3A6N D;  3AZI A;  1KX3 D;  5JRG C;  3KWQ C;  1F1E A;  1TZY B;  5GSU B;  4H9O A;  3UT9 C;  3AZJ D;  5GT0 D;  3AV2 B;  3AZM C;  1P3F D;  1P3O C;  5BO0 A;  3X1U A;  5B32 C;  1ULY A;  5AVC B;  4J8V D;  3KXB D;  4WNN A;  5JRG A;  3KWQ A;  3UT9 A;  4KUD C;  3MGR B;  5AY8 A;  5B0Z D;  4CAY B; 
#chains in the Genus database with same CATH topology
 3AZM A;  3REH C;  2JCH A;  1T3U A;  5AVB B;  3X1V D;  1P3O A;  1N1J B;  4R8P D;  5AV9 B;  5BT1 C;  3B6F D;  5DNM B;  5B32 A;  1P3K D;  4KUD A;  1M19 D;  1AOI B;  2NZD A;  3REH A;  1P3I D;  3O62 D;  3REL C;  5B2J B;  3W97 D;  3X1T D;  3AZE B;  3TU4 D;  4WU8 C;  1P34 D;  5E5A B;  3H0L C;  5JA4 B;  5GT3 C;  3UTB D;  5CPI D;  5DNN D;  3AZH B;  3REL A;  3WA9 D;  4QLC D;  2PYO C;  2HUE B;  4G91 B;  5B31 D;  5GXQ B;  1M1A C;  4JJN B;  3AZG C;  4KGC C;  4WU8 A;  2F8N A;  5GT3 A;  4J8W A;  4X23 D;  1JFI B;  3LZ1 C;  5AY8 D;  2PYO A;  3KUY C;  2G5I C;  1M1A A;  5B2I C;  4WU9 D;  3AZG A;  5B33 D;  4Z2M H;  4KGC A;  5B2J C;  3WAA C;  1P3P B;  3LZ1 A;  2NZD D;  3W98 B;  2Y2P A;  3KUY A;  2L5A A;  3MNN D;  3C1B B;  5B2I A;  4LD9 C;  3F6T A;  4XZQ D;  3AZF B;  2DQN C;  2NQB D;  1H3O A;  3MGP D;  3MVD B;  5KDM A;  3WAA A;  3REK C;  5AV6 D;  4Z66 D;  1P3L C;  4XUJ D;  3X1S B;  2BYK B;  4J8X C;  3REJ D;  4LD9 A;  1S32 B;  4CSR B;  2BYM A;  2ARO C;  5AV5 D;  2JE5 A;  3AV1 C;  1P3M D;  5FUG B;  3REK A;  1P3A B;  4J8W D;  2DF4 C;  2ZY2 A;  3AN2 C;  4EO5 B;  4J8X A;  1P3P C;  3B6G D;  1B67 A;  1ZLA D;  3LZ0 C;  3AZN C;  4UUZ B;  2ARO A;  2Y2N A;  4NE6 A;  3P5J B;  3AV1 A;  5AV8 B;  3WKJ C;  1P3B C;  2YFV A;  3AN2 A;  3AZK C;  1KX4 D;  1M19 B;  3LZ0 A;  4ZUX D;  5B40 D;  3AYW D;  3AZN A;  3A6N C;  1KX3 C;  4NE3 A;  3AZJ C;  3WKJ A;  1P3B A;  3NQU A;  1TAF B;  5GT0 C;  2F8N H;  1P3F C;  2CV5 B;  3MGS D;  3AZK A;  3AZI B;  3A6N A;  1KX3 A;  3KFU G;  4H9O B;  3B0C W;  3KXB C;  3LEL D;  3NQJ A;  4J8V C;  3A1I A;  3AZJ A;  4H9N A;  5GT0 A;  5B0Z C;  2HIO D;  3X1V C;  1P3F A;  2XD1 A;  1P3G D;  1ID3 A;  3AL0 C;  4DRA A;  5BO0 B;  4R8P C;  3X1U B;  3AFA D;  3B6F C;  4YS3 D;  2FJ7 D;  4WNN B;  5JRG B;  1Q9C A;  5B24 D;  3KWQ B;  4J8V A;  2YFW A;  3KXB A;  5AY8 B;  3UT9 B;  1P3K C;  1M19 C;  3AZM B;  1P3O B;  5B0Z A;  1U35 D;  3X1V A;  1KX5 D;  1P3I C;  3O62 C;  4R8P A;  3R45 A;  3B6F A;  5B32 B;  4H9S C;  3W97 C;  4Z5T A;  3X1T C;  4KUD B;  1P3K A;  1BH8 A;  2NZD B;  3REH B;  3TU4 C;  3UTB C;  1P3I A;  5CPI C;  5DNN C;  3O62 A;  3WA9 C;  4QLC C;  4H9S A;  3W97 A;  3X1T A;  5B31 C;  5B0Y D;  3MGQ D;  3TU4 A;  1P34 A;  3UTB A;  4X23 C;  3REL B;  5CPI A;  5DNN A;  3WA9 A;  5AY8 C;  4QLC A;  2VQR A;  2RVQ D;  1ID3 D;  5B31 A;  2IO5 C;  4WU9 C;  2ZY3 A;  4WU8 B;  2F8N B;  5GT3 B;  4J8W B;  3H0M C;  5B33 C;  1F66 D;  3WTP A;  4ZBJ C;  4X23 A;  2PYO B;  2NZD C;  3VH5 W;  3UTA D;  1M1A B;  3C1C D;  3REI D;  1KU5 A;  4HGA C;  3MNN C;  3AZG B;  4KGC B;  4XZQ C;  4WU9 A;  2NQB C;  3W96 D;  5BNV A;  5B33 A;  4Z5T D;  3MGP C;  5CP6 D;  3LZ1 B;  3KUY B;  5AV6 C;  4Z66 C;  3B0C T;  5B2I B;  4XUJ C;  5CPJ D;  3REJ C;  3MNN A;  3IP4 C;  1H3O B;  4XZQ A;  3AZL D;  2NQB A;  5KDM B;  3WAA B;  3MGP A;  5B1M D;  5AV5 C;  1P3M C;  4H9R A;  5AV6 A;  4J8W C;  4Z66 A;  4XUJ A;  4LD9 B;  3REJ A;  3B6G C;  1ZLA C;  2BYM B;  1Z2C B;  5AV5 A;  3REK B;  1P3M A;  1P3L B;  3WTP D;  2Y2J A;  4J8X B;  3B6G A;  1KX4 C;  1ZLA A;  4ZUX C;  5B40 C;  3AYW C;  2ARO B;  3AV1 B;  3W99 D;  1M18 D;  2YFV B;  3AN2 B;  3LZ0 B;  3MGS C;  1KX4 A;  3EG5 B;  4ZUX A;  5B40 A;  3AYW A;  3AZN B;  4J8U A;  2Y2O A;  3WKJ B;  3LEL C;  1P3B B;  3NQU B;  3VH5 A;  2F8N K;  2HIO C;  3AZK B;  1P3G C;  3MGS A;  1HQ3 D;  3AFA C;  3EPH A;  4YS3 C;  3A6N B;  1KX3 B;  2FJ7 C;  3NQJ B;  5B24 C;  3AZJ B;  4H9N B;  3LEL A;  5GT0 B;  3VH5 T;  3LJA D;  1P3F B;  2HIO A;  1U35 C;  1ID3 B;  1KX5 C;  1P3G A;  4NFT A;  3AFA A;  4YS3 A;  4J8V B;  2YFW B;  3KXB B;  2FJ7 A;  5B24 A;  5B0Z B;  3X1V B;  1B6W A;  5F99 D;  1U35 A;  1KX5 A;  4KHA A;  3R45 B;  4R8P B;  1EQZ D;  5CPK D;  3B6F B;  5B1L D;  2Y2G A;  1BH8 B;  1P3K B;  4YM6 D;  5B0Y C;  3MGQ C;  5GSU D;  1TZY D;  3KSY A;  4J8U D;  1P3I B;  4H9P A;  2W8S A;  3O62 B;  3AV2 D;  3W97 B;  5BS7 C;  3X1T B;  4E45 A;  4Z2M G;  2RVQ C;  1ID3 C;  5AVC D;  5B0Y A;  3TU4 B;  1P34 B;  3UTB B;  5CHL B;  3MGQ A;  5CPI B;  5DNN B;  3MGR D;  1F66 C;  3WA9 B;  2RIQ A;  4QLC B;  3V9R A;  5AVB D;  2Y2I A;  5BS7 A;  3UTA C;  5B31 B;  5AV9 D;  3C1C C;  3REI C;  5DNM D;  2Y2H A;  3W96 C;  4Z5T C;  4X23 B;  5G49 A;  5CP6 C;  1BH9 A;  1AOI D;  1F66 A;  5C3I C;  3UTA A;  5B32 G;  3C1C A;  3REI A;  2IO5 B;  5B2J D;  4WU9 B;  5CPJ C;  5BNV B;  5B33 B;  3AZL C;  3W96 A;  4ZBJ B;  3AZE D;  5B1M C;  5CP6 A;  1HTA A;  3B0D C;  5E5A D;  3AZH D;  1P34 C;  4HGA B;  3MNN B;  3EPJ A;  4XZQ B;  4G92 C;  5CPJ A;  2NQB B;  3MGP B;  5GXQ D;  3AZL A;  4AWL C;  1PZR A;  5B1M A;  4JJN D;  4H9R B;  5BNX A;  3H0R C;  5AV6 B;  4Z66 B;  4XUJ B;  3WTP C;  3REJ B;  3WTP E;  1WWS A;  4WZS B;  5AV5 B;  2F8N G;  1P3M B;  3W99 C;  4H9Q A;  1M18 C;  4WJ3 C;  2CWE A;  1W2E A;  3B6G B;  3EPK A;  3W98 D;  1ZLA B;  3C1B D;  3AZF D;  3W99 A;  1M18 A;  3MVD D;  1KX4 B;  2ZY5 A;  4ZUX B;  3X1S D;  2Y2L A;  1HQ3 C;  5B40 B;  3AYW B;  4J8U B;  2UWX A;  1S32 D;  2F2A C;  3LJA C;  3B0B A;  2XD5 A;  1P3A D;  3MGS B;  4UPK A;  1HQ3 A;  2FFF B;  4E44 A;  3LEL B;  3LJA A;  2HIO B;  5AV8 D;  5F99 C;  1P3G B;  3AFA B;  1EQZ C;  5CPK C;  4YS3 B;  5B1L C;  2FJ7 B;  5B24 B;  4YM6 C;  2Y2K A;  1U35 B;  1TZY C;  5GSU C;  5F99 A;  4KHA B;  4J8U C;  1KX5 B;  3AV2 C;  1EQZ A;  5CPK A;  2CV5 D;  5B1L A;  4YM6 A;  3AZI D;  3A1K A;  5AVC C;  4H9P B;  1TZY A;  5GSU A;  3MGR C;  3AV2 A;  5AVB C;  3X1U D;  5AV9 C;  5DNM C;  5B0Y B;  5JRG D;  3KWQ D;  5AVC A;  3MGQ B;  3UT9 D;  3MGR A;  3AZM D;  3V9R B;  1P3O D;  1AOI C;  4CAY A;  5AVB A;  1N1J A;  2Y2M A;  3VH6 W;  5AV9 A;  5B32 D;  5DNM A;  4KUD D;  2J8P A;  5G49 B;  1BH9 B;  1F66 B;  3AZE C;  3REH D;  1AOI A;  5E5A C;  3UTA B;  5BT1 D;  3C1C B;  3REI B;  3AZH C;  5B2J A;  2HUE C;  4G91 C;  3W96 B;  4Z5T B;  5GXQ C;  5CP6 B;  2Y2Q A;  3AZE A;  4JJN C;  5E5A A;  5JA4 A;  5C3I B;  3REL D;  3AZH A;  5CPJ B;  2JSS A;  3AZL B;  5GXQ A;  5B1M B;  3B0D B;  4WU8 D;  4JJN A;  5GT3 D;  5BNX B;  2F8N D;  1P3L A;  1JFI A;  1BFM A;  2PYO D;  4G92 B;  5B31 G;  3W98 C;  1M1A D;  4AWL B;  3C1B C;  3AZG D;  4H9Q B;  3AZF C;  4KGC D;  3MVD C;  1P3P A;  3LZ1 D;  3WTP B;  4WV4 B;  3KUY D;  4DRB A;  3W98 A;  3EPL A;  5B2I D;  3X1S C;  3C1B A;  3W99 B;  1M18 B;  3AZF A;  1S32 C;  1WWI A;  3WAA D;  3MVD A;  1R4V A;  3VH6 A;  3FDD A;  1P3A C;  2ZM5 A;  3X1S A;  4LD9 D;  2BYK A;  4EO5 C;  2G5H C;  1A7W A;  1S32 A;  4CSR A;  3VH6 T;  3REK D;  5AV8 C;  5FUG A;  2BG1 A;  4M6B A;  1P3A A;  1P3L D;  1HQ3 B;  4J8X D;  4NE5 A;  3LJA B;  2ARO D;  3AV1 D;  4UUZ A;  5AV8 A;  3AN2 D;  1P3P D;  2ZY4 A;  3LZ0 D;  2CV5 C;  1M19 A;  3AZN D;  3AZI C;  5F99 B;  3WKJ D;  1P3B D;  1EQZ B;  1TAF A;  5CPK B;  5B1L B;  3AZK D;  2CV5 A;  4YM6 B;  3X1U C;  2LY8 A;  3A6N D;  3AZI A;  1KX3 D;  5JRG C;  3KWQ C;  1F1E A;  1TZY B;  5GSU B;  4H9O A;  3UT9 C;  3AZJ D;  5GT0 D;  3AV2 B;  4DQY B;  3AZM C;  1P3F D;  1P3O C;  5BO0 A;  3X1U A;  5B32 C;  1ULY A;  5AVC B;  4J8V D;  3KXB D;  4WNN A;  5JRG A;  3KWQ A;  3UT9 A;  4KUD C;  3MGR B;  5AY8 A;  5B0Z D;  4CAY B; 
#chains in the Genus database with same CATH homology
 3AZM A;  3REH C;  2JCH A;  1T3U A;  5AVB B;  3X1V D;  1P3O A;  1N1J B;  4R8P D;  5AV9 B;  5BT1 C;  3B6F D;  5DNM B;  5B32 A;  1P3K D;  4KUD A;  1M19 D;  1AOI B;  2NZD A;  3REH A;  1P3I D;  3O62 D;  3REL C;  5B2J B;  3W97 D;  3X1T D;  3AZE B;  3TU4 D;  4WU8 C;  1P34 D;  5E5A B;  3H0L C;  5JA4 B;  5GT3 C;  3UTB D;  5CPI D;  5DNN D;  3AZH B;  3REL A;  3WA9 D;  4QLC D;  2PYO C;  2HUE B;  4G91 B;  5B31 D;  5GXQ B;  1M1A C;  4JJN B;  3AZG C;  4KGC C;  4WU8 A;  2F8N A;  5GT3 A;  4J8W A;  4X23 D;  1JFI B;  3LZ1 C;  5AY8 D;  2PYO A;  3KUY C;  2G5I C;  1M1A A;  5B2I C;  4WU9 D;  3AZG A;  5B33 D;  4Z2M H;  4KGC A;  5B2J C;  3WAA C;  1P3P B;  3LZ1 A;  2NZD D;  3W98 B;  2Y2P A;  3KUY A;  2L5A A;  3MNN D;  3C1B B;  5B2I A;  4LD9 C;  3F6T A;  4XZQ D;  3AZF B;  2DQN C;  2NQB D;  1H3O A;  3MGP D;  3MVD B;  5KDM A;  3WAA A;  3REK C;  5AV6 D;  4Z66 D;  1P3L C;  4XUJ D;  3X1S B;  2BYK B;  4J8X C;  3REJ D;  4LD9 A;  1S32 B;  4CSR B;  2BYM A;  2ARO C;  5AV5 D;  2JE5 A;  3AV1 C;  1P3M D;  5FUG B;  3REK A;  1P3A B;  4J8W D;  2DF4 C;  2ZY2 A;  3AN2 C;  4EO5 B;  4J8X A;  1P3P C;  3B6G D;  1B67 A;  1ZLA D;  3LZ0 C;  3AZN C;  4UUZ B;  2ARO A;  2Y2N A;  4NE6 A;  3P5J B;  3AV1 A;  5AV8 B;  3WKJ C;  1P3B C;  2YFV A;  3AN2 A;  3AZK C;  1KX4 D;  1M19 B;  3LZ0 A;  4ZUX D;  5B40 D;  3AYW D;  3AZN A;  3A6N C;  1KX3 C;  4NE3 A;  3AZJ C;  3WKJ A;  1P3B A;  3NQU A;  1TAF B;  5GT0 C;  2F8N H;  1P3F C;  2CV5 B;  3MGS D;  3AZK A;  3AZI B;  3A6N A;  1KX3 A;  3KFU G;  4H9O B;  3B0C W;  3KXB C;  3LEL D;  3NQJ A;  4J8V C;  3A1I A;  3AZJ A;  4H9N A;  5GT0 A;  5B0Z C;  2HIO D;  3X1V C;  1P3F A;  2XD1 A;  1P3G D;  1ID3 A;  3AL0 C;  4DRA A;  5BO0 B;  4R8P C;  3X1U B;  3AFA D;  3B6F C;  4YS3 D;  2FJ7 D;  4WNN B;  5JRG B;  1Q9C A;  5B24 D;  3KWQ B;  4J8V A;  2YFW A;  3KXB A;  5AY8 B;  3UT9 B;  1P3K C;  1M19 C;  3AZM B;  1P3O B;  5B0Z A;  1U35 D;  3X1V A;  1KX5 D;  1P3I C;  3O62 C;  4R8P A;  3R45 A;  3B6F A;  5B32 B;  4H9S C;  3W97 C;  4Z5T A;  3X1T C;  4KUD B;  1P3K A;  1BH8 A;  2NZD B;  3REH B;  3TU4 C;  3UTB C;  1P3I A;  5CPI C;  5DNN C;  3O62 A;  3WA9 C;  4QLC C;  4H9S A;  3W97 A;  3X1T A;  5B31 C;  5B0Y D;  3MGQ D;  3TU4 A;  1P34 A;  3UTB A;  4X23 C;  3REL B;  5CPI A;  5DNN A;  3WA9 A;  5AY8 C;  4QLC A;  2VQR A;  2RVQ D;  1ID3 D;  5B31 A;  2IO5 C;  4WU9 C;  2ZY3 A;  4WU8 B;  2F8N B;  5GT3 B;  4J8W B;  3H0M C;  5B33 C;  1F66 D;  3WTP A;  4ZBJ C;  4X23 A;  2PYO B;  2NZD C;  3VH5 W;  3UTA D;  1M1A B;  3C1C D;  3REI D;  1KU5 A;  4HGA C;  3MNN C;  3AZG B;  4KGC B;  4XZQ C;  4WU9 A;  2NQB C;  3W96 D;  5BNV A;  5B33 A;  4Z5T D;  3MGP C;  5CP6 D;  3LZ1 B;  3KUY B;  5AV6 C;  4Z66 C;  3B0C T;  5B2I B;  4XUJ C;  5CPJ D;  3REJ C;  3MNN A;  3IP4 C;  1H3O B;  4XZQ A;  3AZL D;  2NQB A;  5KDM B;  3WAA B;  3MGP A;  5B1M D;  5AV5 C;  1P3M C;  4H9R A;  5AV6 A;  4J8W C;  4Z66 A;  4XUJ A;  4LD9 B;  3REJ A;  3B6G C;  1ZLA C;  2BYM B;  1Z2C B;  5AV5 A;  3REK B;  1P3M A;  1P3L B;  3WTP D;  2Y2J A;  4J8X B;  3B6G A;  1KX4 C;  1ZLA A;  4ZUX C;  5B40 C;  3AYW C;  2ARO B;  3AV1 B;  3W99 D;  1M18 D;  2YFV B;  3AN2 B;  3LZ0 B;  3MGS C;  1KX4 A;  3EG5 B;  4ZUX A;  5B40 A;  3AYW A;  3AZN B;  4J8U A;  2Y2O A;  3WKJ B;  3LEL C;  1P3B B;  3NQU B;  3VH5 A;  2F8N K;  2HIO C;  3AZK B;  1P3G C;  3MGS A;  1HQ3 D;  3AFA C;  3EPH A;  4YS3 C;  3A6N B;  1KX3 B;  2FJ7 C;  3NQJ B;  5B24 C;  3AZJ B;  4H9N B;  3LEL A;  5GT0 B;  3VH5 T;  3LJA D;  1P3F B;  2HIO A;  1U35 C;  1ID3 B;  1KX5 C;  1P3G A;  4NFT A;  3AFA A;  4YS3 A;  4J8V B;  2YFW B;  3KXB B;  2FJ7 A;  5B24 A;  5B0Z B;  3X1V B;  1B6W A;  5F99 D;  1U35 A;  1KX5 A;  4KHA A;  3R45 B;  4R8P B;  1EQZ D;  5CPK D;  3B6F B;  5B1L D;  2Y2G A;  1BH8 B;  1P3K B;  4YM6 D;  5B0Y C;  3MGQ C;  5GSU D;  1TZY D;  3KSY A;  4J8U D;  1P3I B;  4H9P A;  2W8S A;  3O62 B;  3AV2 D;  3W97 B;  5BS7 C;  3X1T B;  4E45 A;  4Z2M G;  2RVQ C;  1ID3 C;  5AVC D;  5B0Y A;  3TU4 B;  1P34 B;  3UTB B;  5CHL B;  3MGQ A;  5CPI B;  5DNN B;  3MGR D;  1F66 C;  3WA9 B;  2RIQ A;  4QLC B;  3V9R A;  5AVB D;  2Y2I A;  5BS7 A;  3UTA C;  5B31 B;  5AV9 D;  3C1C C;  3REI C;  5DNM D;  2Y2H A;  3W96 C;  4Z5T C;  4X23 B;  5G49 A;  5CP6 C;  1BH9 A;  1AOI D;  1F66 A;  5C3I C;  3UTA A;  5B32 G;  3C1C A;  3REI A;  2IO5 B;  5B2J D;  4WU9 B;  5CPJ C;  5BNV B;  5B33 B;  3AZL C;  3W96 A;  4ZBJ B;  3AZE D;  5B1M C;  5CP6 A;  1HTA A;  3B0D C;  5E5A D;  3AZH D;  1P34 C;  4HGA B;  3MNN B;  3EPJ A;  4XZQ B;  4G92 C;  5CPJ A;  2NQB B;  3MGP B;  5GXQ D;  3AZL A;  4AWL C;  1PZR A;  5B1M A;  4JJN D;  4H9R B;  5BNX A;  3H0R C;  5AV6 B;  4Z66 B;  4XUJ B;  3WTP C;  3REJ B;  3WTP E;  1WWS A;  4WZS B;  5AV5 B;  2F8N G;  1P3M B;  3W99 C;  4H9Q A;  1M18 C;  4WJ3 C;  2CWE A;  1W2E A;  3B6G B;  3EPK A;  3W98 D;  1ZLA B;  3C1B D;  3AZF D;  3W99 A;  1M18 A;  3MVD D;  1KX4 B;  2ZY5 A;  4ZUX B;  3X1S D;  2Y2L A;  1HQ3 C;  5B40 B;  3AYW B;  4J8U B;  2UWX A;  1S32 D;  2F2A C;  3LJA C;  3B0B A;  2XD5 A;  1P3A D;  3MGS B;  4UPK A;  1HQ3 A;  2FFF B;  4E44 A;  3LEL B;  3LJA A;  2HIO B;  5AV8 D;  5F99 C;  1P3G B;  3AFA B;  1EQZ C;  5CPK C;  4YS3 B;  5B1L C;  2FJ7 B;  5B24 B;  4YM6 C;  2Y2K A;  1U35 B;  1TZY C;  5GSU C;  5F99 A;  4KHA B;  4J8U C;  1KX5 B;  3AV2 C;  1EQZ A;  5CPK A;  2CV5 D;  5B1L A;  4YM6 A;  3AZI D;  3A1K A;  5AVC C;  4H9P B;  1TZY A;  5GSU A;  3MGR C;  3AV2 A;  5AVB C;  3X1U D;  5AV9 C;  5DNM C;  5B0Y B;  5JRG D;  3KWQ D;  5AVC A;  3MGQ B;  3UT9 D;  3MGR A;  3AZM D;  3V9R B;  1P3O D;  1AOI C;  4CAY A;  5AVB A;  1N1J A;  2Y2M A;  3VH6 W;  5AV9 A;  5B32 D;  5DNM A;  4KUD D;  2J8P A;  5G49 B;  1BH9 B;  1F66 B;  3AZE C;  3REH D;  1AOI A;  5E5A C;  3UTA B;  5BT1 D;  3C1C B;  3REI B;  3AZH C;  5B2J A;  2HUE C;  4G91 C;  3W96 B;  4Z5T B;  5GXQ C;  5CP6 B;  2Y2Q A;  3AZE A;  4JJN C;  5E5A A;  5JA4 A;  5C3I B;  3REL D;  3AZH A;  5CPJ B;  2JSS A;  3AZL B;  5GXQ A;  5B1M B;  3B0D B;  4WU8 D;  4JJN A;  5GT3 D;  5BNX B;  2F8N D;  1P3L A;  1JFI A;  1BFM A;  2PYO D;  4G92 B;  5B31 G;  3W98 C;  1M1A D;  4AWL B;  3C1B C;  3AZG D;  4H9Q B;  3AZF C;  4KGC D;  3MVD C;  1P3P A;  3LZ1 D;  3WTP B;  4WV4 B;  3KUY D;  4DRB A;  3W98 A;  3EPL A;  5B2I D;  3X1S C;  3C1B A;  3W99 B;  1M18 B;  3AZF A;  1S32 C;  1WWI A;  3WAA D;  3MVD A;  1R4V A;  3VH6 A;  3FDD A;  1P3A C;  2ZM5 A;  3X1S A;  4LD9 D;  2BYK A;  4EO5 C;  2G5H C;  1A7W A;  1S32 A;  4CSR A;  3VH6 T;  3REK D;  5AV8 C;  5FUG A;  2BG1 A;  4M6B A;  1P3A A;  1P3L D;  1HQ3 B;  4J8X D;  4NE5 A;  3LJA B;  2ARO D;  3AV1 D;  4UUZ A;  5AV8 A;  3AN2 D;  1P3P D;  2ZY4 A;  3LZ0 D;  2CV5 C;  1M19 A;  3AZN D;  3AZI C;  5F99 B;  3WKJ D;  1P3B D;  1EQZ B;  1TAF A;  5CPK B;  5B1L B;  3AZK D;  2CV5 A;  4YM6 B;  3X1U C;  2LY8 A;  3A6N D;  3AZI A;  1KX3 D;  5JRG C;  3KWQ C;  1F1E A;  1TZY B;  5GSU B;  4H9O A;  3UT9 C;  3AZJ D;  5GT0 D;  3AV2 B;  4DQY B;  3AZM C;  1P3F D;  1P3O C;  5BO0 A;  3X1U A;  5B32 C;  1ULY A;  5AVC B;  4J8V D;  3KXB D;  4WNN A;  5JRG A;  3KWQ A;  3UT9 A;  4KUD C;  3MGR B;  5AY8 A;  5B0Z D;  4CAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...