4WU9C

Structure of cisptnap-ncp145
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9C00
5CPJB 3UT9D 1M1AD 3AZFA 4YS3B 4CAYA 5AV9A 4XZQB 1P3MA 5B1LD 4NFTA 1KX5A 3AYWA 3X1TC 2AROA 3LZ1D 4J8XB 3LZ1A 3REHC 4R8PC 1P3LD 3WA9C 2NZDB 3LELD 3C1CC 3W96B 1U35B 5CPJD 4WU9B 2YFWB 4KGCB 3KUYD 5AV9C 2CV5C 3AZEC 3X1VB 1M1AA 5CP6B 3WTPE 4YS3A 3AYWC 3MNNC 3AZNB 3MGPA 3VH5T 4ZUXB 4R8PD 2AROC 3AZGB 1S32A 2AROD 3W99D 1P3MB 4H9OA 5DNNC 3REJB 1KX5D 3AV2B 4EO5B 3MVDD 4ZUXC 3X1TB 2HIOA 3V9RB 3AN2A 1P3PA 1ID3B 1WWIA 3AZLB 1TZYC 1ZLAC 2BYMA 2CV5A 5CPKA 3AZEA 3X1SB 1HQ3A 5B1MB 5GXQC 5DNMB 5B24A 5B0ZA 1P3OA 5B0ZD 1A7WA 1P3OD 3B6GA 3AZHA 1ID3D 5AV6D 4Z5TC 5B32B 2FJ7D 4WV4B 3UT9B 2CV5D 5BT1D 3W99B 3B6FA 3B6FD 1P3AD 3REKB 5FUGB 5G49A 1TZYA 3W99C 3AV2A 3AV1B 1TAFA 3B0DB 3NQUA 5AY8A 3VH5W 4E44A 5AV6A 4XUJD 3KXBB 3B6GD 5AV8B 4R8PA 5B24C 4KGCD 3AFAD 4X23A 3MGSA 1P3BB 5B32D 1P3LB 5BNVB 2JSSA 3AZHB 1P3PD 5AVCB 3C1CD 3X1VD 3MGPC 3W99A 1S32C 4H9QA 5B24D 3VH5A 5GSUA 4YS3D 3AZMC 2HIOC 1TAFB 5AVBC 3NQUB 4LD9B 3AV1C 3REHB 5JRGD 3LJAA 4NE5A 3NQJB 5AV8C 1HQ3C 5GXQA 1BH9A 3WTPA 1S32D 5C3IB 2YFVA 4YM6D 4YM6A 3REID 5CP6A 5B1LA 3MGPB 3AZMA 3MGQA 5AVBA 5BO0B 1JFIB 3AV2C 3MGRB 5F99A 2NQBA 3AZFD 4KHAA 4LD9A 1KX3C 2LY8A 5B31B 1P34D 3NQJA 3W97C 2IO5C 3W97D 4H9RB 5B31C 3AZEB 1HQ3B 5B1MA 4QLCB 1WWSA 5CP6C 5GT0D 4J8UA 3W97B 3AFAB 5BT1C 2PYOC 5E5AB 3UTBA 5B32A 3MGSD 4J8WB 3KWQB 3UT9A 4WNNA 4WU8A 1P3GB 3REKA 3TU4B 1JFIA 5E5AD 4H9PA 1P3FA 1TZYD 5B2IA 5GT0B 3AV1A 3WAAA 3REIC 5AY8B 3KXBA 3RELD 2RVQC 4HGAB 3W98C 3REIB 3A6NA 2F8NB 2FJ7A 4ZBJC 4QLCA 2F8NG 3VH6W 1P3ID 5GT3B 3UTBB 5AVCA 3AZLD 4XZQA 4G91C 5JA4A 4WNNB 3KWQC 3MGQC 1H3OB 5B2IC 3REJD 1KX5B 1M18A 3AZNC 3B0DC 1HTAA 1M19D 5GSUB 2BYKA 2HUEC 5JRGC 1F66C 1BFMA 1P34B 3AZJB 1P3IB 3W98A 4G92B 2NZDA 3MGRD 2F8ND 3C1CB 3WKJD 5AVCC 3WTPB 1U35D 3AZKD 3LELB 5GT3C 3AZNA 4DRBA 1P3GD 3O62A 1F66A 4Z66D 1N1JB 1R4VA 1H3OA 3AZMB 3WKJC 3AZJD 3KWQD 3AZIB 1P3FC 1AOID 3RELB 2HUEB 5JRGB 2NQBB 4KUDB 1ID3C 4KHAB 1P3IC 2BYMB 5B2JA 5CPID 3A6NC 3UTAD 2PYOD 1ZLAA 4J8VA 1P3BC 3AZFB 2PYOB 4E45A 5B0ZC 1P3OC 5B0YD 3AZHC 1B67A 4J8WA 1P3AB 3B6FB 1M18C 3B6FC 3TU4A 3AZIA 5BS7A 1EQZD 3WA9B 1P3KD 2NZDC 3WAAB 3X1UD 3C1BD 4KUDC 4AWLC 1B6WA 3W96A 5CPJC 3MGSB 1P3BA 3B0CW 5B33D 4CSRA 3REHD 2F8NH 4M6BA 3MGSC 1KX3D 3MVDB 3AZFC 3O62C 1EQZC 4JJND 4H9QB 3AZGA 3AZGD 1S32B 5B31D 1P3MC 1KX5C 4EO5C 3REJA 2BYKB 4Z66B 3REHA 3MNND 4JJNB 3WA9A 3W98B 1KX4D 4ZBJB 3W96D 5B40D 1BH9B 3X1SA 4DRAA 5DNMA 3X1VC 3X1UA 3C1BA 2YFVB 5GT3D 3B6GB 3MNNB 1EQZA 3REJC 5AV9B 4YS3C 4WU9D 1N1JA 1TZYB 4NE3A 3AYWB 5DNNA 4WZSB 4H9SA 5BS7C 1P3GC 5AV6B 4J8XA 4JJNA 4KUDA 5AV5B 5CPIA 2RVQD 3X1UB 3C1BB 3W97A 2L5AA 3B6GC 5E5AC 4Z5TA 1BH8B 1P3KA 2NQBD 5F99D 3UTBC 5B32C 1P3GA 3RELC 3VH6T 3MGQD 5B2IB 5CHLB 5AV5D 3LZ0B 3AN2B 3KUYB 5AV6C 5AV5A 5CPIB 4G92C 3REIA 3LZ0C 5CPKB 1KX4B 3KXBC 4J8VD 3WTPD 4NE6A 3W98D 5B0ZB 1P3OB 4YM6B 1P3KC 4CSRB 1F1EA 1KX4C 5DNMD 3X1SD 4Z5TD 5JA4B 5B1LB 4XZQD 5GSUD 3LZ1C 5G49B 4H9SC 2NZDD 4AWLB 3AZJC 1KX3B 4J8XC 3LZ0A 4Z66A 4JJNC 5B33B 3LZ1B 4J8XD 4ZUXD 5AV8A 4R8PB 5DNND 1KX4A 5B33C 1U35A 2F8NK 4UUZB 1M1AC 4WU9A 5BNVA 4X23D 3MNNA 1EQZB 5E5AA 4YM6C 1P3BD 5B32G 1M1AB 5C3IC 5AY8D 5B1LC 4ZUXA 5AV8D 4WU8B 4Z66C 3WKJB 3LZ0D 5F99C 3UTBD 4H9OB 1M18D 3WAAD 1KX3A 2HIOB 3V9RA 1P3FD 5B33A 1Q9CA 5B2JB 1U35C 5AV5C 1AOIC 4WU9C 3AZLA 4HGAC 5AVCD 1M19B 3UTAB 2CV5B 3A6NB 5GXQB 5B1MC 2FJ7B 4QLCD 1HQ3D 4XUJC 4J8VB 3A6ND 3UTAC 2PYOA 5B31G 5BNXA 5B0YB 4J8UC 3UT9C 5AVBD 1BH8A 2HIOD 3R45B 1P3AC 3B0CT 1M18B 3REKC 5AY8C 5BO0A 4J8WC 4WU8C 1AOIA 3REKD 5FUGA 2CWEA 1P34A 3AZLC 3AZJA 5F99B 3MGPD 4X23C 3AZKB 3TU4C 5GXQD 3AZND 3UTAA 4X23B 3AZKC 3W96C 5CPJA 5B1MD 2FJ7C 3LELA 4KGCC 3MVDC 5BNXB 5B0YA 1KU5A 5B40B 3KSYA 3O62B 3KWQA 5GSUC 1F66B 4XZQC 4LD9D 1P34C 4H9NA 1ZLAD 4KUDD 3AYWD 1F66D 5B40C 2AROB 4Z2MG 4G91B 3LJAC 3AZGC 1P3MD 5B2JD 5JRGA 3LJAD 5AV9D 3AZKA 5GT0C 5CP6D 3LJAB 3WTPC 4Z2MH 3LELC 4KGCA 1ZLAB 2F8NA 4XUJA 4UUZA 5DNMC 3X1SC 3O62D 3X1VA 5GT3A 3X1UC 3C1BC 5KDMB 5B40A 1P3AA 3VH6A 4H9NB 2NQBC 3WA9D 3MGQB 5AVBB 5DNNB 4LD9C 3WKJA 3X1TA 3MGRA 3AZHD 1P3PB 1ID3A 1P3IA 5B2JC 5B31A 3AZED 5CPKD 3C1CA 3KUYC 1M19A 5B24B 3B0BA 5CPIC 4J8UD 4H9RA 4XUJB 3KXBD 4J8VC 3AN2D 3AV1D 4Z5TB 3MVDA 5B0YC 4J8UB 1P3LC 3AFAA 4CAYB 5KDMA 1P3KB 1ULYA 4WU8D 3R45A 3X1TD 3MGRC 3AV2D 3WAAC 3AZID 1AOIB 3TU4D 3RELA 4H9PB 3KUYA 3AZIC 1P3FB 3AN2C 3AZMD 1P3PC 5GT0A 1M19C 2IO5B 5B2ID 4QLCC 4J8WD 5CPKC 1P3LA 2YFWA 3AFAC
chains in the Genus database with same CATH superfamily
5CPJB 2Y2KA 3UT9D 1M1AD 3AZFA 2W8SA 4YS3B 4CAYA 3P5JB 5AV9A 4XZQB 1P3MA 5B1LD 4NFTA 1KX5A 3AYWA 3X1TC 2AROA 2ZY4A 3LZ1D 2Y2HA 3LZ1A 4J8XB 3REHC 4R8PC 1P3LD 3WA9C 2NZDB 3LELD 3C1CC 3W96B 1U35B 5CPJD 4WU9B 2YFWB 4KGCB 3KUYD 5AV9C 2CV5C 3AZEC 3X1VB 1M1AA 5CP6B 3WTPE 4YS3A 3AYWC 3MNNC 3AZNB 3MGPA 3VH5T 4ZUXB 4R8PD 2AROC 3AZGB 1S32A 2AROD 3W99D 1P3MB 4H9OA 5DNNC 3REJB 1KX5D 3AV2B 4EO5B 3MVDD 4ZUXC 3X1TB 2HIOA 3V9RB 3AN2A 1P3PA 1ID3B 1WWIA 3AZLB 1TZYC 1ZLAC 2BYMA 2CV5A 5CPKA 3AZEA 3X1SB 1HQ3A 5B1MB 5GXQC 5DNMB 5B24A 2BG1A 5B0ZA 1P3OA 5B0ZD 1A7WA 1P3OD 3B6GA 3AZHA 1ID3D 5AV6D 4Z5TC 5B32B 2FJ7D 4WV4B 3UT9B 2CV5D 5BT1D 3W99B 3B6FA 3B6FD 1P3AD 3REKB 5FUGB 5G49A 1TZYA 3W99C 2DQNC 3AV2A 3AV1B 1TAFA 3B0DB 3NQUA 5AY8A 3VH5W 4E44A 5AV6A 4XUJD 3KXBB 3B6GD 5AV8B 4R8PA 5B24C 4KGCD 3AFAD 4X23A 3H0MC 3MGSA 1P3BB 5B32D 1P3LB 2RIQA 5BNVB 2JSSA 3AZHB 1P3PD 5AVCB 3C1CD 1PZRA 3X1VD 3MGPC 3H0RC 3W99A 3A1KA 1S32C 4H9QA 5B24D 3VH5A 5GSUA 4YS3D 3AZMC 2HIOC 1TAFB 5AVBC 3NQUB 4LD9B 3AV1C 3REHB 5JRGD 3LJAA 4NE5A 3NQJB 5AV8C 1HQ3C 5GXQA 3F6TA 1BH9A 3WTPA 1S32D 5C3IB 2YFVA 4YM6D 4YM6A 3REID 3EG5B 5CP6A 5B1LA 3MGPB 3AZMA 3MGQA 5AVBA 5BO0B 2F2AC 1JFIB 3AV2C 3MGRB 5F99A 2NQBA 3AZFD 4KHAA 4LD9A 1KX3C 2LY8A 5B31B 1P34D 3NQJA 3EPKA 3W97C 2IO5C 3W97D 4H9RB 2ZY3A 5B31C 3AZEB 1HQ3B 5B1MA 4QLCB 2ZM5A 1WWSA 5CP6C 5GT0D 4J8UA 3W97B 3AFAB 5BT1C 2PYOC 5E5AB 3UTBA 5B32A 3MGSD 4J8WB 3KWQB 3UT9A 4WNNA 4WU8A 3H0LC 1P3GB 3REKA 3TU4B 2XD5A 1JFIA 5E5AD 4H9PA 1P3FA 1TZYD 5B2IA 5GT0B 3AV1A 3WAAA 3REIC 5AY8B 3KXBA 3RELD 2RVQC 4HGAB 3W98C 3REIB 3A6NA 2F8NB 2FJ7A 4ZBJC 4QLCA 2F8NG 2Y2OA 3VH6W 1P3ID 5GT3B 3UTBB 5AVCA 3AZLD 4XZQA 4G91C 5JA4A 2Y2PA 4WNNB 3KWQC 3MGQC 1H3OB 5B2IC 3REJD 1KX5B 1M18A 3KFUG 3AZNC 3B0DC 1HTAA 1M19D 5GSUB 2BYKA 2HUEC 5JRGC 1F66C 1BFMA 1P34B 3AZJB 3EPLA 1P3IB 3W98A 4G92B 2NZDA 2Y2JA 3MGRD 2F8ND 4WJ3C 3C1CB 3WKJD 5AVCC 3WTPB 1U35D 3AZKD 3FDDA 3LELB 5GT3C 3AZNA 4DRBA 1P3GD 3O62A 1F66A 4Z66D 1N1JB 1R4VA 1H3OA 3AZMB 3WKJC 3AZJD 3KWQD 3AZIB 1P3FC 1AOID 3RELB 2HUEB 5JRGB 2NQBB 4KUDB 1ID3C 4KHAB 1P3IC 2BYMB 5B2JA 5CPID 3A6NC 3UTAD 1T3UA 2Y2LA 2PYOD 1ZLAA 4J8VA 1P3BC 3AZFB 2PYOB 4E45A 5B0ZC 1P3OC 5B0YD 3AZHC 1B67A 4J8WA 1P3AB 3B6FB 4DQYB 2VQRA 1M18C 3B6FC 3TU4A 3AZIA 5BS7A 1EQZD 3WA9B 1P3KD 2NZDC 3WAAB 3X1UD 3C1BD 4KUDC 4AWLC 3EPHA 1B6WA 3W96A 5CPJC 3MGSB 1P3BA 3IP4C 3B0CW 2UWXA 5B33D 4CSRA 3REHD 2F8NH 4M6BA 3MGSC 1KX3D 3MVDB 3AZFC 3O62C 1EQZC 4JJND 4H9QB 3AZGA 3AZGD 1S32B 5B31D 1P3MC 1KX5C 2XD1A 2J8PA 4EO5C 3REJA 2BYKB 4Z66B 3REHA 3MNND 4JJNB 3WA9A 3W98B 1KX4D 4ZBJB 3W96D 5B40D 1BH9B 3X1SA 4DRAA 5DNMA 3X1VC 3X1UA 3C1BA 2YFVB 5GT3D 3B6GB 3MNNB 1EQZA 2Y2QA 3REJC 5AV9B 4YS3C 4WU9D 1N1JA 1W2EA 2FFFB 2Y2NA 1TZYB 4NE3A 3AYWB 5DNNA 4WZSB 4H9SA 5BS7C 1P3GC 5AV6B 4J8XA 4JJNA 4KUDA 5AV5B 5CPIA 2RVQD 3X1UB 3C1BB 3W97A 2L5AA 3B6GC 5E5AC 4Z5TA 1BH8B 1P3KA 2NQBD 5F99D 3UTBC 5B32C 1P3GA 3RELC 3VH6T 3MGQD 5B2IB 5CHLB 5AV5D 3EPJA 3AL0C 3LZ0B 3AN2B 3KUYB 5AV6C 5AV5A 5CPIB 4G92C 3REIA 3LZ0C 5CPKB 1KX4B 3KXBC 4J8VD 3WTPD 4NE6A 3W98D 5B0ZB 1P3OB 4YM6B 2Y2GA 4CSRB 1P3KC 1F1EA 1KX4C 5DNMD 3X1SD 4Z5TD 5JA4B 5B1LB 4XZQD 5GSUD 3LZ1C 2JCHA 5G49B 4H9SC 2NZDD 4AWLB 3AZJC 1KX3B 4J8XC 3LZ0A 4Z66A 4JJNC 5B33B 3LZ1B 2G5HC 4J8XD 4ZUXD 5AV8A 4R8PB 2Y2IA 5DNND 1KX4A 5B33C 1U35A 2F8NK 4UUZB 1M1AC 4WU9A 5BNVA 4X23D 3MNNA 1EQZB 5E5AA 4YM6C 1P3BD 5B32G 1M1AB 5C3IC 5AY8D 5B1LC 4ZUXA 5AV8D 4WU8B 4Z66C 3WKJB 3LZ0D 5F99C 3UTBD 4H9OB 1M18D 2ZY5A 2G5IC 3WAAD 1KX3A 2HIOB 3V9RA 1P3FD 5B33A 1Q9CA 5B2JB 1U35C 5AV5C 1AOIC 4WU9C 3AZLA 4HGAC 5AVCD 1M19B 3UTAB 2CV5B 3A6NB 5GXQB 5B1MC 2FJ7B 4QLCD 1HQ3D 4XUJC 4J8VB 3A6ND 3UTAC 2PYOA 5B31G 5BNXA 5B0YB 4J8UC 3UT9C 5AVBD 1BH8A 2HIOD 3R45B 1P3AC 3B0CT 1M18B 3REKC 5AY8C 5BO0A 4J8WC 4WU8C 1AOIA 3REKD 5FUGA 2CWEA 1P34A 3AZLC 3AZJA 5F99B 3MGPD 4X23C 3AZKB 3TU4C 5GXQD 3AZND 3UTAA 4X23B 3AZKC 2DF4C 3W96C 5CPJA 5B1MD 2FJ7C 3LELA 4KGCC 3MVDC 5BNXB 5B0YA 1KU5A 5B40B 3KSYA 3O62B 3KWQA 5GSUC 1F66B 4XZQC 2JE5A 1P34C 4LD9D 4H9NA 1ZLAD 4KUDD 3AYWD 1F66D 5B40C 2ZY2A 2AROB 4Z2MG 4G91B 3LJAC 3AZGC 1P3MD 5B2JD 5JRGA 3LJAD 5AV9D 3AZKA 5GT0C 5CP6D 3LJAB 3WTPC 1Z2CB 4Z2MH 3LELC 4KGCA 1ZLAB 2F8NA 4XUJA 2Y2MA 4UUZA 5DNMC 3X1SC 3O62D 3X1VA 5GT3A 3X1UC 3C1BC 5KDMB 5B40A 1P3AA 3VH6A 4H9NB 2NQBC 3WA9D 3MGQB 5AVBB 5DNNB 4LD9C 3WKJA 3X1TA 3MGRA 3AZHD 1P3PB 1ID3A 1P3IA 5B2JC 5B31A 3AZED 5CPKD 3C1CA 3KUYC 1M19A 5B24B 3A1IA 3B0BA 5CPIC 4J8UD 4H9RA 4XUJB 3KXBD 4J8VC 3AN2D 3AV1D 4Z5TB 3MVDA 5B0YC 4J8UB 1P3LC 3AFAA 4CAYB 5KDMA 1P3KB 1ULYA 4WU8D 3R45A 3X1TD 3MGRC 3AV2D 3WAAC 3AZID 1AOIB 3TU4D 3RELA 4H9PB 3KUYA 3AZIC 1P3FB 3AN2C 3AZMD 1P3PC 5GT0A 4UPKA 2IO5B 1M19C 5B2ID 4QLCC 4J8WD 5CPKC 1P3LA 2YFWA 3AFAC
chains in the Genus database with same CATH topology
5CPJB 2Y2KA 3UT9D 1M1AD 3AZFA 2W8SA 4YS3B 4CAYA 3P5JB 5AV9A 4XZQB 1P3MA 5B1LD 4NFTA 1KX5A 3AYWA 3X1TC 2AROA 2ZY4A 3LZ1D 2Y2HA 3LZ1A 4J8XB 3REHC 4R8PC 1P3LD 3WA9C 2NZDB 3LELD 3C1CC 3W96B 1U35B 5CPJD 4WU9B 2YFWB 4KGCB 3KUYD 5AV9C 2CV5C 3AZEC 3X1VB 1M1AA 5CP6B 3WTPE 4YS3A 3AYWC 3MNNC 3AZNB 3MGPA 3VH5T 4ZUXB 4R8PD 2AROC 3AZGB 1S32A 2AROD 3W99D 1P3MB 4H9OA 5DNNC 3REJB 1KX5D 3AV2B 4EO5B 3MVDD 4ZUXC 3X1TB 2HIOA 3V9RB 3AN2A 1P3PA 1ID3B 1WWIA 3AZLB 1TZYC 1ZLAC 2BYMA 2CV5A 5CPKA 3AZEA 3X1SB 1HQ3A 5B1MB 5GXQC 5DNMB 5B24A 2BG1A 5B0ZA 1P3OA 5B0ZD 1A7WA 1P3OD 3B6GA 3AZHA 1ID3D 5AV6D 4Z5TC 5B32B 2FJ7D 4WV4B 3UT9B 2CV5D 5BT1D 3W99B 3B6FA 3B6FD 1P3AD 3REKB 5FUGB 5G49A 1TZYA 3W99C 2DQNC 3AV2A 3AV1B 1TAFA 3B0DB 3NQUA 5AY8A 3VH5W 4E44A 5AV6A 4XUJD 3KXBB 3B6GD 5AV8B 4R8PA 5B24C 4KGCD 3AFAD 4X23A 3H0MC 3MGSA 1P3BB 5B32D 1P3LB 2RIQA 5BNVB 2JSSA 3AZHB 1P3PD 5AVCB 3C1CD 1PZRA 3X1VD 3MGPC 3H0RC 3W99A 3A1KA 1S32C 4H9QA 5B24D 3VH5A 5GSUA 4YS3D 3AZMC 2HIOC 1TAFB 5AVBC 3NQUB 4LD9B 3AV1C 3REHB 5JRGD 3LJAA 4NE5A 3NQJB 5AV8C 1HQ3C 5GXQA 3F6TA 1BH9A 3WTPA 1S32D 5C3IB 2YFVA 4YM6D 4YM6A 3REID 3EG5B 5CP6A 5B1LA 3MGPB 3AZMA 3MGQA 5AVBA 5BO0B 2F2AC 1JFIB 3AV2C 3MGRB 5F99A 2NQBA 3AZFD 4KHAA 4LD9A 1KX3C 2LY8A 5B31B 1P34D 3NQJA 3EPKA 3W97C 2IO5C 3W97D 4H9RB 2ZY3A 5B31C 3AZEB 1HQ3B 5B1MA 4QLCB 2ZM5A 1WWSA 5CP6C 5GT0D 4J8UA 3W97B 3AFAB 5BT1C 2PYOC 5E5AB 3UTBA 5B32A 3MGSD 4J8WB 3KWQB 3UT9A 4WNNA 4WU8A 3H0LC 1P3GB 3REKA 3TU4B 2XD5A 1JFIA 5E5AD 4H9PA 1P3FA 1TZYD 5B2IA 5GT0B 3AV1A 3WAAA 3REIC 5AY8B 3KXBA 3RELD 2RVQC 4HGAB 3W98C 3REIB 3A6NA 2F8NB 2FJ7A 4ZBJC 4QLCA 2F8NG 2Y2OA 3VH6W 1P3ID 5GT3B 3UTBB 5AVCA 3AZLD 4XZQA 4G91C 5JA4A 2Y2PA 4WNNB 3KWQC 3MGQC 1H3OB 5B2IC 3REJD 1KX5B 1M18A 3KFUG 3AZNC 3B0DC 1HTAA 1M19D 5GSUB 2BYKA 2HUEC 5JRGC 1F66C 1BFMA 1P34B 3AZJB 3EPLA 1P3IB 3W98A 4G92B 2NZDA 2Y2JA 3MGRD 2F8ND 4WJ3C 3C1CB 3WKJD 5AVCC 3WTPB 1U35D 3AZKD 3FDDA 3LELB 5GT3C 3AZNA 4DRBA 1P3GD 3O62A 1F66A 4Z66D 1N1JB 1R4VA 1H3OA 3AZMB 3WKJC 3AZJD 3KWQD 3AZIB 1P3FC 1AOID 3RELB 2HUEB 5JRGB 2NQBB 4KUDB 1ID3C 4KHAB 1P3IC 2BYMB 5B2JA 5CPID 3A6NC 3UTAD 1T3UA 2Y2LA 2PYOD 1ZLAA 4J8VA 1P3BC 3AZFB 2PYOB 4E45A 5B0ZC 1P3OC 5B0YD 3AZHC 1B67A 4J8WA 1P3AB 3B6FB 4DQYB 2VQRA 1M18C 3B6FC 3TU4A 3AZIA 5BS7A 1EQZD 3WA9B 1P3KD 2NZDC 3WAAB 3X1UD 3C1BD 4KUDC 4AWLC 3EPHA 1B6WA 3W96A 5CPJC 3MGSB 1P3BA 3IP4C 3B0CW 2UWXA 5B33D 4CSRA 3REHD 2F8NH 4M6BA 3MGSC 1KX3D 3MVDB 3AZFC 3O62C 1EQZC 4JJND 4H9QB 3AZGA 3AZGD 1S32B 5B31D 1P3MC 1KX5C 2XD1A 2J8PA 4EO5C 3REJA 2BYKB 4Z66B 3REHA 3MNND 4JJNB 3WA9A 3W98B 1KX4D 4ZBJB 3W96D 5B40D 1BH9B 3X1SA 4DRAA 5DNMA 3X1VC 3X1UA 3C1BA 2YFVB 5GT3D 3B6GB 3MNNB 1EQZA 2Y2QA 3REJC 5AV9B 4YS3C 4WU9D 1N1JA 1W2EA 2FFFB 2Y2NA 1TZYB 4NE3A 3AYWB 5DNNA 4WZSB 4H9SA 5BS7C 1P3GC 5AV6B 4J8XA 4JJNA 4KUDA 5AV5B 5CPIA 2RVQD 3X1UB 3C1BB 3W97A 2L5AA 3B6GC 5E5AC 4Z5TA 1BH8B 1P3KA 2NQBD 5F99D 3UTBC 5B32C 1P3GA 3RELC 3VH6T 3MGQD 5B2IB 5CHLB 5AV5D 3EPJA 3AL0C 3LZ0B 3AN2B 3KUYB 5AV6C 5AV5A 5CPIB 4G92C 3REIA 3LZ0C 5CPKB 1KX4B 3KXBC 4J8VD 3WTPD 4NE6A 3W98D 5B0ZB 1P3OB 4YM6B 2Y2GA 4CSRB 1P3KC 1F1EA 1KX4C 5DNMD 3X1SD 4Z5TD 5JA4B 5B1LB 4XZQD 5GSUD 3LZ1C 2JCHA 5G49B 4H9SC 2NZDD 4AWLB 3AZJC 1KX3B 4J8XC 3LZ0A 4Z66A 4JJNC 5B33B 3LZ1B 2G5HC 4J8XD 4ZUXD 5AV8A 4R8PB 2Y2IA 5DNND 1KX4A 5B33C 1U35A 2F8NK 4UUZB 1M1AC 4WU9A 5BNVA 4X23D 3MNNA 1EQZB 5E5AA 4YM6C 1P3BD 5B32G 1M1AB 5C3IC 5AY8D 5B1LC 4ZUXA 5AV8D 4WU8B 4Z66C 3WKJB 3LZ0D 5F99C 3UTBD 4H9OB 1M18D 2ZY5A 2G5IC 3WAAD 1KX3A 2HIOB 3V9RA 1P3FD 5B33A 1Q9CA 5B2JB 1U35C 5AV5C 1AOIC 4WU9C 3AZLA 4HGAC 5AVCD 1M19B 3UTAB 2CV5B 3A6NB 5GXQB 5B1MC 2FJ7B 4QLCD 1HQ3D 4XUJC 4J8VB 3A6ND 3UTAC 2PYOA 5B31G 5BNXA 5B0YB 4J8UC 3UT9C 5AVBD 1BH8A 2HIOD 3R45B 1P3AC 3B0CT 1M18B 3REKC 5AY8C 5BO0A 4J8WC 4WU8C 1AOIA 3REKD 5FUGA 2CWEA 1P34A 3AZLC 3AZJA 5F99B 3MGPD 4X23C 3AZKB 3TU4C 5GXQD 3AZND 3UTAA 4X23B 3AZKC 2DF4C 3W96C 5CPJA 5B1MD 2FJ7C 3LELA 4KGCC 3MVDC 5BNXB 5B0YA 1KU5A 5B40B 3KSYA 3O62B 3KWQA 5GSUC 1F66B 4XZQC 2JE5A 1P34C 4LD9D 4H9NA 1ZLAD 4KUDD 3AYWD 1F66D 5B40C 2ZY2A 2AROB 4Z2MG 4G91B 3LJAC 3AZGC 1P3MD 5B2JD 5JRGA 3LJAD 5AV9D 3AZKA 5GT0C 5CP6D 3LJAB 3WTPC 1Z2CB 4Z2MH 3LELC 4KGCA 1ZLAB 2F8NA 4XUJA 2Y2MA 4UUZA 5DNMC 3X1SC 3O62D 3X1VA 5GT3A 3X1UC 3C1BC 5KDMB 5B40A 1P3AA 3VH6A 4H9NB 2NQBC 3WA9D 3MGQB 5AVBB 5DNNB 4LD9C 3WKJA 3X1TA 3MGRA 3AZHD 1P3PB 1ID3A 1P3IA 5B2JC 5B31A 3AZED 5CPKD 3C1CA 3KUYC 1M19A 5B24B 3A1IA 3B0BA 5CPIC 4J8UD 4H9RA 4XUJB 3KXBD 4J8VC 3AN2D 3AV1D 4Z5TB 3MVDA 5B0YC 4J8UB 1P3LC 3AFAA 4CAYB 5KDMA 1P3KB 1ULYA 4WU8D 3R45A 3X1TD 3MGRC 3AV2D 3WAAC 3AZID 1AOIB 3TU4D 3RELA 4H9PB 3KUYA 3AZIC 1P3FB 3AN2C 3AZMD 1P3PC 5GT0A 4UPKA 2IO5B 1M19C 5B2ID 4QLCC 4J8WD 5CPKC 1P3LA 2YFWA 3AFAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  3UT9 D;  1M1A D;  3AZF A;  4YS3 B;  4CAY A;  5AV9 A;  4XZQ B;  1P3M A;  5B1L D;  4NFT A;  1KX5 A;  3AYW A;  3X1T C;  2ARO A;  3LZ1 D;  4J8X B;  3LZ1 A;  3REH C;  4R8P C;  1P3L D;  3WA9 C;  2NZD B;  3LEL D;  3C1C C;  3W96 B;  1U35 B;  5CPJ D;  4WU9 B;  2YFW B;  4KGC B;  3KUY D;  5AV9 C;  2CV5 C;  3AZE C;  3X1V B;  1M1A A;  5CP6 B;  3WTP E;  4YS3 A;  3AYW C;  3MNN C;  3AZN B;  3MGP A;  3VH5 T;  4ZUX B;  4R8P D;  2ARO C;  3AZG B;  1S32 A;  2ARO D;  3W99 D;  1P3M B;  4H9O A;  5DNN C;  3REJ B;  1KX5 D;  3AV2 B;  4EO5 B;  3MVD D;  4ZUX C;  3X1T B;  2HIO A;  3V9R B;  3AN2 A;  1P3P A;  1ID3 B;  1WWI A;  3AZL B;  1TZY C;  1ZLA C;  2BYM A;  2CV5 A;  5CPK A;  3AZE A;  3X1S B;  1HQ3 A;  5B1M B;  5GXQ C;  5DNM B;  5B24 A;  5B0Z A;  1P3O A;  5B0Z D;  1A7W A;  1P3O D;  3B6G A;  3AZH A;  1ID3 D;  5AV6 D;  4Z5T C;  5B32 B;  2FJ7 D;  4WV4 B;  3UT9 B;  2CV5 D;  5BT1 D;  3W99 B;  3B6F A;  3B6F D;  1P3A D;  3REK B;  5FUG B;  5G49 A;  1TZY A;  3W99 C;  3AV2 A;  3AV1 B;  1TAF A;  3B0D B;  3NQU A;  5AY8 A;  3VH5 W;  4E44 A;  5AV6 A;  4XUJ D;  3KXB B;  3B6G D;  5AV8 B;  4R8P A;  5B24 C;  4KGC D;  3AFA D;  4X23 A;  3MGS A;  1P3B B;  5B32 D;  1P3L B;  5BNV B;  2JSS A;  3AZH B;  1P3P D;  5AVC B;  3C1C D;  3X1V D;  3MGP C;  3W99 A;  1S32 C;  4H9Q A;  5B24 D;  3VH5 A;  5GSU A;  4YS3 D;  3AZM C;  2HIO C;  1TAF B;  5AVB C;  3NQU B;  4LD9 B;  3AV1 C;  3REH B;  5JRG D;  3LJA A;  4NE5 A;  3NQJ B;  5AV8 C;  1HQ3 C;  5GXQ A;  1BH9 A;  3WTP A;  1S32 D;  5C3I B;  2YFV A;  4YM6 D;  4YM6 A;  3REI D;  5CP6 A;  5B1L A;  3MGP B;  3AZM A;  3MGQ A;  5AVB A;  5BO0 B;  1JFI B;  3AV2 C;  3MGR B;  5F99 A;  2NQB A;  3AZF D;  4KHA A;  4LD9 A;  1KX3 C;  2LY8 A;  5B31 B;  1P34 D;  3NQJ A;  3W97 C;  2IO5 C;  3W97 D;  4H9R B;  5B31 C;  3AZE B;  1HQ3 B;  5B1M A;  4QLC B;  1WWS A;  5CP6 C;  5GT0 D;  4J8U A;  3W97 B;  3AFA B;  5BT1 C;  2PYO C;  5E5A B;  3UTB A;  5B32 A;  3MGS D;  4J8W B;  3KWQ B;  3UT9 A;  4WNN A;  4WU8 A;  1P3G B;  3REK A;  3TU4 B;  1JFI A;  5E5A D;  4H9P A;  1P3F A;  1TZY D;  5B2I A;  5GT0 B;  3AV1 A;  3WAA A;  3REI C;  5AY8 B;  3KXB A;  3REL D;  2RVQ C;  4HGA B;  3W98 C;  3REI B;  3A6N A;  2F8N B;  2FJ7 A;  4ZBJ C;  4QLC A;  2F8N G;  3VH6 W;  1P3I D;  5GT3 B;  3UTB B;  5AVC A;  3AZL D;  4XZQ A;  4G91 C;  5JA4 A;  4WNN B;  3KWQ C;  3MGQ C;  1H3O B;  5B2I C;  3REJ D;  1KX5 B;  1M18 A;  3AZN C;  3B0D C;  1HTA A;  1M19 D;  5GSU B;  2BYK A;  2HUE C;  5JRG C;  1F66 C;  1BFM A;  1P34 B;  3AZJ B;  1P3I B;  3W98 A;  4G92 B;  2NZD A;  3MGR D;  2F8N D;  3C1C B;  3WKJ D;  5AVC C;  3WTP B;  1U35 D;  3AZK D;  3LEL B;  5GT3 C;  3AZN A;  4DRB A;  1P3G D;  3O62 A;  1F66 A;  4Z66 D;  1N1J B;  1R4V A;  1H3O A;  3AZM B;  3WKJ C;  3AZJ D;  3KWQ D;  3AZI B;  1P3F C;  1AOI D;  3REL B;  2HUE B;  5JRG B;  2NQB B;  4KUD B;  1ID3 C;  4KHA B;  1P3I C;  2BYM B;  5B2J A;  5CPI D;  3A6N C;  3UTA D;  2PYO D;  1ZLA A;  4J8V A;  1P3B C;  3AZF B;  2PYO B;  4E45 A;  5B0Z C;  1P3O C;  5B0Y D;  3AZH C;  1B67 A;  4J8W A;  1P3A B;  3B6F B;  1M18 C;  3B6F C;  3TU4 A;  3AZI A;  5BS7 A;  1EQZ D;  3WA9 B;  1P3K D;  2NZD C;  3WAA B;  3X1U D;  3C1B D;  4KUD C;  4AWL C;  1B6W A;  3W96 A;  5CPJ C;  3MGS B;  1P3B A;  3B0C W;  5B33 D;  4CSR A;  3REH D;  2F8N H;  4M6B A;  3MGS C;  1KX3 D;  3MVD B;  3AZF C;  3O62 C;  1EQZ C;  4JJN D;  4H9Q B;  3AZG A;  3AZG D;  1S32 B;  5B31 D;  1P3M C;  1KX5 C;  4EO5 C;  3REJ A;  2BYK B;  4Z66 B;  3REH A;  3MNN D;  4JJN B;  3WA9 A;  3W98 B;  1KX4 D;  4ZBJ B;  3W96 D;  5B40 D;  1BH9 B;  3X1S A;  4DRA A;  5DNM A;  3X1V C;  3X1U A;  3C1B A;  2YFV B;  5GT3 D;  3B6G B;  3MNN B;  1EQZ A;  3REJ C;  5AV9 B;  4YS3 C;  4WU9 D;  1N1J A;  1TZY B;  4NE3 A;  3AYW B;  5DNN A;  4WZS B;  4H9S A;  5BS7 C;  1P3G C;  5AV6 B;  4J8X A;  4JJN A;  4KUD A;  5AV5 B;  5CPI A;  2RVQ D;  3X1U B;  3C1B B;  3W97 A;  2L5A A;  3B6G C;  5E5A C;  4Z5T A;  1BH8 B;  1P3K A;  2NQB D;  5F99 D;  3UTB C;  5B32 C;  1P3G A;  3REL C;  3VH6 T;  3MGQ D;  5B2I B;  5CHL B;  5AV5 D;  3LZ0 B;  3AN2 B;  3KUY B;  5AV6 C;  5AV5 A;  5CPI B;  4G92 C;  3REI A;  3LZ0 C;  5CPK B;  1KX4 B;  3KXB C;  4J8V D;  3WTP D;  4NE6 A;  3W98 D;  5B0Z B;  1P3O B;  4YM6 B;  1P3K C;  4CSR B;  1F1E A;  1KX4 C;  5DNM D;  3X1S D;  4Z5T D;  5JA4 B;  5B1L B;  4XZQ D;  5GSU D;  3LZ1 C;  5G49 B;  4H9S C;  2NZD D;  4AWL B;  3AZJ C;  1KX3 B;  4J8X C;  3LZ0 A;  4Z66 A;  4JJN C;  5B33 B;  3LZ1 B;  4J8X D;  4ZUX D;  5AV8 A;  4R8P B;  5DNN D;  1KX4 A;  5B33 C;  1U35 A;  2F8N K;  4UUZ B;  1M1A C;  4WU9 A;  5BNV A;  4X23 D;  3MNN A;  1EQZ B;  5E5A A;  4YM6 C;  1P3B D;  5B32 G;  1M1A B;  5C3I C;  5AY8 D;  5B1L C;  4ZUX A;  5AV8 D;  4WU8 B;  4Z66 C;  3WKJ B;  3LZ0 D;  5F99 C;  3UTB D;  4H9O B;  1M18 D;  3WAA D;  1KX3 A;  2HIO B;  3V9R A;  1P3F D;  5B33 A;  1Q9C A;  5B2J B;  1U35 C;  5AV5 C;  1AOI C;  4WU9 C;  3AZL A;  4HGA C;  5AVC D;  1M19 B;  3UTA B;  2CV5 B;  3A6N B;  5GXQ B;  5B1M C;  2FJ7 B;  4QLC D;  1HQ3 D;  4XUJ C;  4J8V B;  3A6N D;  3UTA C;  2PYO A;  5B31 G;  5BNX A;  5B0Y B;  4J8U C;  3UT9 C;  5AVB D;  1BH8 A;  2HIO D;  3R45 B;  1P3A C;  3B0C T;  1M18 B;  3REK C;  5AY8 C;  5BO0 A;  4J8W C;  4WU8 C;  1AOI A;  3REK D;  5FUG A;  2CWE A;  1P34 A;  3AZL C;  3AZJ A;  5F99 B;  3MGP D;  4X23 C;  3AZK B;  3TU4 C;  5GXQ D;  3AZN D;  3UTA A;  4X23 B;  3AZK C;  3W96 C;  5CPJ A;  5B1M D;  2FJ7 C;  3LEL A;  4KGC C;  3MVD C;  5BNX B;  5B0Y A;  1KU5 A;  5B40 B;  3KSY A;  3O62 B;  3KWQ A;  5GSU C;  1F66 B;  4XZQ C;  4LD9 D;  1P34 C;  4H9N A;  1ZLA D;  4KUD D;  3AYW D;  1F66 D;  5B40 C;  2ARO B;  4Z2M G;  4G91 B;  3LJA C;  3AZG C;  1P3M D;  5B2J D;  5JRG A;  3LJA D;  5AV9 D;  3AZK A;  5GT0 C;  5CP6 D;  3LJA B;  3WTP C;  4Z2M H;  3LEL C;  4KGC A;  1ZLA B;  2F8N A;  4XUJ A;  4UUZ A;  5DNM C;  3X1S C;  3O62 D;  3X1V A;  5GT3 A;  3X1U C;  3C1B C;  5KDM B;  5B40 A;  1P3A A;  3VH6 A;  4H9N B;  2NQB C;  3WA9 D;  3MGQ B;  5AVB B;  5DNN B;  4LD9 C;  3WKJ A;  3X1T A;  3MGR A;  3AZH D;  1P3P B;  1ID3 A;  1P3I A;  5B2J C;  5B31 A;  3AZE D;  5CPK D;  3C1C A;  3KUY C;  1M19 A;  5B24 B;  3B0B A;  5CPI C;  4J8U D;  4H9R A;  4XUJ B;  3KXB D;  4J8V C;  3AN2 D;  3AV1 D;  4Z5T B;  3MVD A;  5B0Y C;  4J8U B;  1P3L C;  3AFA A;  4CAY B;  5KDM A;  1P3K B;  1ULY A;  4WU8 D;  3R45 A;  3X1T D;  3MGR C;  3AV2 D;  3WAA C;  3AZI D;  1AOI B;  3TU4 D;  3REL A;  4H9P B;  3KUY A;  3AZI C;  1P3F B;  3AN2 C;  3AZM D;  1P3P C;  5GT0 A;  1M19 C;  2IO5 B;  5B2I D;  4QLC C;  4J8W D;  5CPK C;  1P3L A;  2YFW A;  3AFA C; 
#chains in the Genus database with same CATH topology
 5CPJ B;  2Y2K A;  3UT9 D;  1M1A D;  3AZF A;  2W8S A;  4YS3 B;  4CAY A;  3P5J B;  5AV9 A;  4XZQ B;  1P3M A;  5B1L D;  4NFT A;  1KX5 A;  3AYW A;  3X1T C;  2ARO A;  2ZY4 A;  3LZ1 D;  2Y2H A;  3LZ1 A;  4J8X B;  3REH C;  4R8P C;  1P3L D;  3WA9 C;  2NZD B;  3LEL D;  3C1C C;  3W96 B;  1U35 B;  5CPJ D;  4WU9 B;  2YFW B;  4KGC B;  3KUY D;  5AV9 C;  2CV5 C;  3AZE C;  3X1V B;  1M1A A;  5CP6 B;  3WTP E;  4YS3 A;  3AYW C;  3MNN C;  3AZN B;  3MGP A;  3VH5 T;  4ZUX B;  4R8P D;  2ARO C;  3AZG B;  1S32 A;  2ARO D;  3W99 D;  1P3M B;  4H9O A;  5DNN C;  3REJ B;  1KX5 D;  3AV2 B;  4EO5 B;  3MVD D;  4ZUX C;  3X1T B;  2HIO A;  3V9R B;  3AN2 A;  1P3P A;  1ID3 B;  1WWI A;  3AZL B;  1TZY C;  1ZLA C;  2BYM A;  2CV5 A;  5CPK A;  3AZE A;  3X1S B;  1HQ3 A;  5B1M B;  5GXQ C;  5DNM B;  5B24 A;  2BG1 A;  5B0Z A;  1P3O A;  5B0Z D;  1A7W A;  1P3O D;  3B6G A;  3AZH A;  1ID3 D;  5AV6 D;  4Z5T C;  5B32 B;  2FJ7 D;  4WV4 B;  3UT9 B;  2CV5 D;  5BT1 D;  3W99 B;  3B6F A;  3B6F D;  1P3A D;  3REK B;  5FUG B;  5G49 A;  1TZY A;  3W99 C;  2DQN C;  3AV2 A;  3AV1 B;  1TAF A;  3B0D B;  3NQU A;  5AY8 A;  3VH5 W;  4E44 A;  5AV6 A;  4XUJ D;  3KXB B;  3B6G D;  5AV8 B;  4R8P A;  5B24 C;  4KGC D;  3AFA D;  4X23 A;  3H0M C;  3MGS A;  1P3B B;  5B32 D;  1P3L B;  2RIQ A;  5BNV B;  2JSS A;  3AZH B;  1P3P D;  5AVC B;  3C1C D;  1PZR A;  3X1V D;  3MGP C;  3H0R C;  3W99 A;  3A1K A;  1S32 C;  4H9Q A;  5B24 D;  3VH5 A;  5GSU A;  4YS3 D;  3AZM C;  2HIO C;  1TAF B;  5AVB C;  3NQU B;  4LD9 B;  3AV1 C;  3REH B;  5JRG D;  3LJA A;  4NE5 A;  3NQJ B;  5AV8 C;  1HQ3 C;  5GXQ A;  3F6T A;  1BH9 A;  3WTP A;  1S32 D;  5C3I B;  2YFV A;  4YM6 D;  4YM6 A;  3REI D;  3EG5 B;  5CP6 A;  5B1L A;  3MGP B;  3AZM A;  3MGQ A;  5AVB A;  5BO0 B;  2F2A C;  1JFI B;  3AV2 C;  3MGR B;  5F99 A;  2NQB A;  3AZF D;  4KHA A;  4LD9 A;  1KX3 C;  2LY8 A;  5B31 B;  1P34 D;  3NQJ A;  3EPK A;  3W97 C;  2IO5 C;  3W97 D;  4H9R B;  2ZY3 A;  5B31 C;  3AZE B;  1HQ3 B;  5B1M A;  4QLC B;  2ZM5 A;  1WWS A;  5CP6 C;  5GT0 D;  4J8U A;  3W97 B;  3AFA B;  5BT1 C;  2PYO C;  5E5A B;  3UTB A;  5B32 A;  3MGS D;  4J8W B;  3KWQ B;  3UT9 A;  4WNN A;  4WU8 A;  3H0L C;  1P3G B;  3REK A;  3TU4 B;  2XD5 A;  1JFI A;  5E5A D;  4H9P A;  1P3F A;  1TZY D;  5B2I A;  5GT0 B;  3AV1 A;  3WAA A;  3REI C;  5AY8 B;  3KXB A;  3REL D;  2RVQ C;  4HGA B;  3W98 C;  3REI B;  3A6N A;  2F8N B;  2FJ7 A;  4ZBJ C;  4QLC A;  2F8N G;  2Y2O A;  3VH6 W;  1P3I D;  5GT3 B;  3UTB B;  5AVC A;  3AZL D;  4XZQ A;  4G91 C;  5JA4 A;  2Y2P A;  4WNN B;  3KWQ C;  3MGQ C;  1H3O B;  5B2I C;  3REJ D;  1KX5 B;  1M18 A;  3KFU G;  3AZN C;  3B0D C;  1HTA A;  1M19 D;  5GSU B;  2BYK A;  2HUE C;  5JRG C;  1F66 C;  1BFM A;  1P34 B;  3AZJ B;  3EPL A;  1P3I B;  3W98 A;  4G92 B;  2NZD A;  2Y2J A;  3MGR D;  2F8N D;  4WJ3 C;  3C1C B;  3WKJ D;  5AVC C;  3WTP B;  1U35 D;  3AZK D;  3FDD A;  3LEL B;  5GT3 C;  3AZN A;  4DRB A;  1P3G D;  3O62 A;  1F66 A;  4Z66 D;  1N1J B;  1R4V A;  1H3O A;  3AZM B;  3WKJ C;  3AZJ D;  3KWQ D;  3AZI B;  1P3F C;  1AOI D;  3REL B;  2HUE B;  5JRG B;  2NQB B;  4KUD B;  1ID3 C;  4KHA B;  1P3I C;  2BYM B;  5B2J A;  5CPI D;  3A6N C;  3UTA D;  1T3U A;  2Y2L A;  2PYO D;  1ZLA A;  4J8V A;  1P3B C;  3AZF B;  2PYO B;  4E45 A;  5B0Z C;  1P3O C;  5B0Y D;  3AZH C;  1B67 A;  4J8W A;  1P3A B;  3B6F B;  4DQY B;  2VQR A;  1M18 C;  3B6F C;  3TU4 A;  3AZI A;  5BS7 A;  1EQZ D;  3WA9 B;  1P3K D;  2NZD C;  3WAA B;  3X1U D;  3C1B D;  4KUD C;  4AWL C;  3EPH A;  1B6W A;  3W96 A;  5CPJ C;  3MGS B;  1P3B A;  3IP4 C;  3B0C W;  2UWX A;  5B33 D;  4CSR A;  3REH D;  2F8N H;  4M6B A;  3MGS C;  1KX3 D;  3MVD B;  3AZF C;  3O62 C;  1EQZ C;  4JJN D;  4H9Q B;  3AZG A;  3AZG D;  1S32 B;  5B31 D;  1P3M C;  1KX5 C;  2XD1 A;  2J8P A;  4EO5 C;  3REJ A;  2BYK B;  4Z66 B;  3REH A;  3MNN D;  4JJN B;  3WA9 A;  3W98 B;  1KX4 D;  4ZBJ B;  3W96 D;  5B40 D;  1BH9 B;  3X1S A;  4DRA A;  5DNM A;  3X1V C;  3X1U A;  3C1B A;  2YFV B;  5GT3 D;  3B6G B;  3MNN B;  1EQZ A;  2Y2Q A;  3REJ C;  5AV9 B;  4YS3 C;  4WU9 D;  1N1J A;  1W2E A;  2FFF B;  2Y2N A;  1TZY B;  4NE3 A;  3AYW B;  5DNN A;  4WZS B;  4H9S A;  5BS7 C;  1P3G C;  5AV6 B;  4J8X A;  4JJN A;  4KUD A;  5AV5 B;  5CPI A;  2RVQ D;  3X1U B;  3C1B B;  3W97 A;  2L5A A;  3B6G C;  5E5A C;  4Z5T A;  1BH8 B;  1P3K A;  2NQB D;  5F99 D;  3UTB C;  5B32 C;  1P3G A;  3REL C;  3VH6 T;  3MGQ D;  5B2I B;  5CHL B;  5AV5 D;  3EPJ A;  3AL0 C;  3LZ0 B;  3AN2 B;  3KUY B;  5AV6 C;  5AV5 A;  5CPI B;  4G92 C;  3REI A;  3LZ0 C;  5CPK B;  1KX4 B;  3KXB C;  4J8V D;  3WTP D;  4NE6 A;  3W98 D;  5B0Z B;  1P3O B;  4YM6 B;  2Y2G A;  4CSR B;  1P3K C;  1F1E A;  1KX4 C;  5DNM D;  3X1S D;  4Z5T D;  5JA4 B;  5B1L B;  4XZQ D;  5GSU D;  3LZ1 C;  2JCH A;  5G49 B;  4H9S C;  2NZD D;  4AWL B;  3AZJ C;  1KX3 B;  4J8X C;  3LZ0 A;  4Z66 A;  4JJN C;  5B33 B;  3LZ1 B;  2G5H C;  4J8X D;  4ZUX D;  5AV8 A;  4R8P B;  2Y2I A;  5DNN D;  1KX4 A;  5B33 C;  1U35 A;  2F8N K;  4UUZ B;  1M1A C;  4WU9 A;  5BNV A;  4X23 D;  3MNN A;  1EQZ B;  5E5A A;  4YM6 C;  1P3B D;  5B32 G;  1M1A B;  5C3I C;  5AY8 D;  5B1L C;  4ZUX A;  5AV8 D;  4WU8 B;  4Z66 C;  3WKJ B;  3LZ0 D;  5F99 C;  3UTB D;  4H9O B;  1M18 D;  2ZY5 A;  2G5I C;  3WAA D;  1KX3 A;  2HIO B;  3V9R A;  1P3F D;  5B33 A;  1Q9C A;  5B2J B;  1U35 C;  5AV5 C;  1AOI C;  4WU9 C;  3AZL A;  4HGA C;  5AVC D;  1M19 B;  3UTA B;  2CV5 B;  3A6N B;  5GXQ B;  5B1M C;  2FJ7 B;  4QLC D;  1HQ3 D;  4XUJ C;  4J8V B;  3A6N D;  3UTA C;  2PYO A;  5B31 G;  5BNX A;  5B0Y B;  4J8U C;  3UT9 C;  5AVB D;  1BH8 A;  2HIO D;  3R45 B;  1P3A C;  3B0C T;  1M18 B;  3REK C;  5AY8 C;  5BO0 A;  4J8W C;  4WU8 C;  1AOI A;  3REK D;  5FUG A;  2CWE A;  1P34 A;  3AZL C;  3AZJ A;  5F99 B;  3MGP D;  4X23 C;  3AZK B;  3TU4 C;  5GXQ D;  3AZN D;  3UTA A;  4X23 B;  3AZK C;  2DF4 C;  3W96 C;  5CPJ A;  5B1M D;  2FJ7 C;  3LEL A;  4KGC C;  3MVD C;  5BNX B;  5B0Y A;  1KU5 A;  5B40 B;  3KSY A;  3O62 B;  3KWQ A;  5GSU C;  1F66 B;  4XZQ C;  2JE5 A;  1P34 C;  4LD9 D;  4H9N A;  1ZLA D;  4KUD D;  3AYW D;  1F66 D;  5B40 C;  2ZY2 A;  2ARO B;  4Z2M G;  4G91 B;  3LJA C;  3AZG C;  1P3M D;  5B2J D;  5JRG A;  3LJA D;  5AV9 D;  3AZK A;  5GT0 C;  5CP6 D;  3LJA B;  3WTP C;  1Z2C B;  4Z2M H;  3LEL C;  4KGC A;  1ZLA B;  2F8N A;  4XUJ A;  2Y2M A;  4UUZ A;  5DNM C;  3X1S C;  3O62 D;  3X1V A;  5GT3 A;  3X1U C;  3C1B C;  5KDM B;  5B40 A;  1P3A A;  3VH6 A;  4H9N B;  2NQB C;  3WA9 D;  3MGQ B;  5AVB B;  5DNN B;  4LD9 C;  3WKJ A;  3X1T A;  3MGR A;  3AZH D;  1P3P B;  1ID3 A;  1P3I A;  5B2J C;  5B31 A;  3AZE D;  5CPK D;  3C1C A;  3KUY C;  1M19 A;  5B24 B;  3A1I A;  3B0B A;  5CPI C;  4J8U D;  4H9R A;  4XUJ B;  3KXB D;  4J8V C;  3AN2 D;  3AV1 D;  4Z5T B;  3MVD A;  5B0Y C;  4J8U B;  1P3L C;  3AFA A;  4CAY B;  5KDM A;  1P3K B;  1ULY A;  4WU8 D;  3R45 A;  3X1T D;  3MGR C;  3AV2 D;  3WAA C;  3AZI D;  1AOI B;  3TU4 D;  3REL A;  4H9P B;  3KUY A;  3AZI C;  1P3F B;  3AN2 C;  3AZM D;  1P3P C;  5GT0 A;  4UPK A;  2IO5 B;  1M19 C;  5B2I D;  4QLC C;  4J8W D;  5CPK C;  1P3L A;  2YFW A;  3AFA C; 
#chains in the Genus database with same CATH homology
 5CPJ B;  2Y2K A;  3UT9 D;  1M1A D;  3AZF A;  2W8S A;  4YS3 B;  4CAY A;  3P5J B;  5AV9 A;  4XZQ B;  1P3M A;  5B1L D;  4NFT A;  1KX5 A;  3AYW A;  3X1T C;  2ARO A;  2ZY4 A;  3LZ1 D;  2Y2H A;  3LZ1 A;  4J8X B;  3REH C;  4R8P C;  1P3L D;  3WA9 C;  2NZD B;  3LEL D;  3C1C C;  3W96 B;  1U35 B;  5CPJ D;  4WU9 B;  2YFW B;  4KGC B;  3KUY D;  5AV9 C;  2CV5 C;  3AZE C;  3X1V B;  1M1A A;  5CP6 B;  3WTP E;  4YS3 A;  3AYW C;  3MNN C;  3AZN B;  3MGP A;  3VH5 T;  4ZUX B;  4R8P D;  2ARO C;  3AZG B;  1S32 A;  2ARO D;  3W99 D;  1P3M B;  4H9O A;  5DNN C;  3REJ B;  1KX5 D;  3AV2 B;  4EO5 B;  3MVD D;  4ZUX C;  3X1T B;  2HIO A;  3V9R B;  3AN2 A;  1P3P A;  1ID3 B;  1WWI A;  3AZL B;  1TZY C;  1ZLA C;  2BYM A;  2CV5 A;  5CPK A;  3AZE A;  3X1S B;  1HQ3 A;  5B1M B;  5GXQ C;  5DNM B;  5B24 A;  2BG1 A;  5B0Z A;  1P3O A;  5B0Z D;  1A7W A;  1P3O D;  3B6G A;  3AZH A;  1ID3 D;  5AV6 D;  4Z5T C;  5B32 B;  2FJ7 D;  4WV4 B;  3UT9 B;  2CV5 D;  5BT1 D;  3W99 B;  3B6F A;  3B6F D;  1P3A D;  3REK B;  5FUG B;  5G49 A;  1TZY A;  3W99 C;  2DQN C;  3AV2 A;  3AV1 B;  1TAF A;  3B0D B;  3NQU A;  5AY8 A;  3VH5 W;  4E44 A;  5AV6 A;  4XUJ D;  3KXB B;  3B6G D;  5AV8 B;  4R8P A;  5B24 C;  4KGC D;  3AFA D;  4X23 A;  3H0M C;  3MGS A;  1P3B B;  5B32 D;  1P3L B;  2RIQ A;  5BNV B;  2JSS A;  3AZH B;  1P3P D;  5AVC B;  3C1C D;  1PZR A;  3X1V D;  3MGP C;  3H0R C;  3W99 A;  3A1K A;  1S32 C;  4H9Q A;  5B24 D;  3VH5 A;  5GSU A;  4YS3 D;  3AZM C;  2HIO C;  1TAF B;  5AVB C;  3NQU B;  4LD9 B;  3AV1 C;  3REH B;  5JRG D;  3LJA A;  4NE5 A;  3NQJ B;  5AV8 C;  1HQ3 C;  5GXQ A;  3F6T A;  1BH9 A;  3WTP A;  1S32 D;  5C3I B;  2YFV A;  4YM6 D;  4YM6 A;  3REI D;  3EG5 B;  5CP6 A;  5B1L A;  3MGP B;  3AZM A;  3MGQ A;  5AVB A;  5BO0 B;  2F2A C;  1JFI B;  3AV2 C;  3MGR B;  5F99 A;  2NQB A;  3AZF D;  4KHA A;  4LD9 A;  1KX3 C;  2LY8 A;  5B31 B;  1P34 D;  3NQJ A;  3EPK A;  3W97 C;  2IO5 C;  3W97 D;  4H9R B;  2ZY3 A;  5B31 C;  3AZE B;  1HQ3 B;  5B1M A;  4QLC B;  2ZM5 A;  1WWS A;  5CP6 C;  5GT0 D;  4J8U A;  3W97 B;  3AFA B;  5BT1 C;  2PYO C;  5E5A B;  3UTB A;  5B32 A;  3MGS D;  4J8W B;  3KWQ B;  3UT9 A;  4WNN A;  4WU8 A;  3H0L C;  1P3G B;  3REK A;  3TU4 B;  2XD5 A;  1JFI A;  5E5A D;  4H9P A;  1P3F A;  1TZY D;  5B2I A;  5GT0 B;  3AV1 A;  3WAA A;  3REI C;  5AY8 B;  3KXB A;  3REL D;  2RVQ C;  4HGA B;  3W98 C;  3REI B;  3A6N A;  2F8N B;  2FJ7 A;  4ZBJ C;  4QLC A;  2F8N G;  2Y2O A;  3VH6 W;  1P3I D;  5GT3 B;  3UTB B;  5AVC A;  3AZL D;  4XZQ A;  4G91 C;  5JA4 A;  2Y2P A;  4WNN B;  3KWQ C;  3MGQ C;  1H3O B;  5B2I C;  3REJ D;  1KX5 B;  1M18 A;  3KFU G;  3AZN C;  3B0D C;  1HTA A;  1M19 D;  5GSU B;  2BYK A;  2HUE C;  5JRG C;  1F66 C;  1BFM A;  1P34 B;  3AZJ B;  3EPL A;  1P3I B;  3W98 A;  4G92 B;  2NZD A;  2Y2J A;  3MGR D;  2F8N D;  4WJ3 C;  3C1C B;  3WKJ D;  5AVC C;  3WTP B;  1U35 D;  3AZK D;  3FDD A;  3LEL B;  5GT3 C;  3AZN A;  4DRB A;  1P3G D;  3O62 A;  1F66 A;  4Z66 D;  1N1J B;  1R4V A;  1H3O A;  3AZM B;  3WKJ C;  3AZJ D;  3KWQ D;  3AZI B;  1P3F C;  1AOI D;  3REL B;  2HUE B;  5JRG B;  2NQB B;  4KUD B;  1ID3 C;  4KHA B;  1P3I C;  2BYM B;  5B2J A;  5CPI D;  3A6N C;  3UTA D;  1T3U A;  2Y2L A;  2PYO D;  1ZLA A;  4J8V A;  1P3B C;  3AZF B;  2PYO B;  4E45 A;  5B0Z C;  1P3O C;  5B0Y D;  3AZH C;  1B67 A;  4J8W A;  1P3A B;  3B6F B;  4DQY B;  2VQR A;  1M18 C;  3B6F C;  3TU4 A;  3AZI A;  5BS7 A;  1EQZ D;  3WA9 B;  1P3K D;  2NZD C;  3WAA B;  3X1U D;  3C1B D;  4KUD C;  4AWL C;  3EPH A;  1B6W A;  3W96 A;  5CPJ C;  3MGS B;  1P3B A;  3IP4 C;  3B0C W;  2UWX A;  5B33 D;  4CSR A;  3REH D;  2F8N H;  4M6B A;  3MGS C;  1KX3 D;  3MVD B;  3AZF C;  3O62 C;  1EQZ C;  4JJN D;  4H9Q B;  3AZG A;  3AZG D;  1S32 B;  5B31 D;  1P3M C;  1KX5 C;  2XD1 A;  2J8P A;  4EO5 C;  3REJ A;  2BYK B;  4Z66 B;  3REH A;  3MNN D;  4JJN B;  3WA9 A;  3W98 B;  1KX4 D;  4ZBJ B;  3W96 D;  5B40 D;  1BH9 B;  3X1S A;  4DRA A;  5DNM A;  3X1V C;  3X1U A;  3C1B A;  2YFV B;  5GT3 D;  3B6G B;  3MNN B;  1EQZ A;  2Y2Q A;  3REJ C;  5AV9 B;  4YS3 C;  4WU9 D;  1N1J A;  1W2E A;  2FFF B;  2Y2N A;  1TZY B;  4NE3 A;  3AYW B;  5DNN A;  4WZS B;  4H9S A;  5BS7 C;  1P3G C;  5AV6 B;  4J8X A;  4JJN A;  4KUD A;  5AV5 B;  5CPI A;  2RVQ D;  3X1U B;  3C1B B;  3W97 A;  2L5A A;  3B6G C;  5E5A C;  4Z5T A;  1BH8 B;  1P3K A;  2NQB D;  5F99 D;  3UTB C;  5B32 C;  1P3G A;  3REL C;  3VH6 T;  3MGQ D;  5B2I B;  5CHL B;  5AV5 D;  3EPJ A;  3AL0 C;  3LZ0 B;  3AN2 B;  3KUY B;  5AV6 C;  5AV5 A;  5CPI B;  4G92 C;  3REI A;  3LZ0 C;  5CPK B;  1KX4 B;  3KXB C;  4J8V D;  3WTP D;  4NE6 A;  3W98 D;  5B0Z B;  1P3O B;  4YM6 B;  2Y2G A;  4CSR B;  1P3K C;  1F1E A;  1KX4 C;  5DNM D;  3X1S D;  4Z5T D;  5JA4 B;  5B1L B;  4XZQ D;  5GSU D;  3LZ1 C;  2JCH A;  5G49 B;  4H9S C;  2NZD D;  4AWL B;  3AZJ C;  1KX3 B;  4J8X C;  3LZ0 A;  4Z66 A;  4JJN C;  5B33 B;  3LZ1 B;  2G5H C;  4J8X D;  4ZUX D;  5AV8 A;  4R8P B;  2Y2I A;  5DNN D;  1KX4 A;  5B33 C;  1U35 A;  2F8N K;  4UUZ B;  1M1A C;  4WU9 A;  5BNV A;  4X23 D;  3MNN A;  1EQZ B;  5E5A A;  4YM6 C;  1P3B D;  5B32 G;  1M1A B;  5C3I C;  5AY8 D;  5B1L C;  4ZUX A;  5AV8 D;  4WU8 B;  4Z66 C;  3WKJ B;  3LZ0 D;  5F99 C;  3UTB D;  4H9O B;  1M18 D;  2ZY5 A;  2G5I C;  3WAA D;  1KX3 A;  2HIO B;  3V9R A;  1P3F D;  5B33 A;  1Q9C A;  5B2J B;  1U35 C;  5AV5 C;  1AOI C;  4WU9 C;  3AZL A;  4HGA C;  5AVC D;  1M19 B;  3UTA B;  2CV5 B;  3A6N B;  5GXQ B;  5B1M C;  2FJ7 B;  4QLC D;  1HQ3 D;  4XUJ C;  4J8V B;  3A6N D;  3UTA C;  2PYO A;  5B31 G;  5BNX A;  5B0Y B;  4J8U C;  3UT9 C;  5AVB D;  1BH8 A;  2HIO D;  3R45 B;  1P3A C;  3B0C T;  1M18 B;  3REK C;  5AY8 C;  5BO0 A;  4J8W C;  4WU8 C;  1AOI A;  3REK D;  5FUG A;  2CWE A;  1P34 A;  3AZL C;  3AZJ A;  5F99 B;  3MGP D;  4X23 C;  3AZK B;  3TU4 C;  5GXQ D;  3AZN D;  3UTA A;  4X23 B;  3AZK C;  2DF4 C;  3W96 C;  5CPJ A;  5B1M D;  2FJ7 C;  3LEL A;  4KGC C;  3MVD C;  5BNX B;  5B0Y A;  1KU5 A;  5B40 B;  3KSY A;  3O62 B;  3KWQ A;  5GSU C;  1F66 B;  4XZQ C;  2JE5 A;  1P34 C;  4LD9 D;  4H9N A;  1ZLA D;  4KUD D;  3AYW D;  1F66 D;  5B40 C;  2ZY2 A;  2ARO B;  4Z2M G;  4G91 B;  3LJA C;  3AZG C;  1P3M D;  5B2J D;  5JRG A;  3LJA D;  5AV9 D;  3AZK A;  5GT0 C;  5CP6 D;  3LJA B;  3WTP C;  1Z2C B;  4Z2M H;  3LEL C;  4KGC A;  1ZLA B;  2F8N A;  4XUJ A;  2Y2M A;  4UUZ A;  5DNM C;  3X1S C;  3O62 D;  3X1V A;  5GT3 A;  3X1U C;  3C1B C;  5KDM B;  5B40 A;  1P3A A;  3VH6 A;  4H9N B;  2NQB C;  3WA9 D;  3MGQ B;  5AVB B;  5DNN B;  4LD9 C;  3WKJ A;  3X1T A;  3MGR A;  3AZH D;  1P3P B;  1ID3 A;  1P3I A;  5B2J C;  5B31 A;  3AZE D;  5CPK D;  3C1C A;  3KUY C;  1M19 A;  5B24 B;  3A1I A;  3B0B A;  5CPI C;  4J8U D;  4H9R A;  4XUJ B;  3KXB D;  4J8V C;  3AN2 D;  3AV1 D;  4Z5T B;  3MVD A;  5B0Y C;  4J8U B;  1P3L C;  3AFA A;  4CAY B;  5KDM A;  1P3K B;  1ULY A;  4WU8 D;  3R45 A;  3X1T D;  3MGR C;  3AV2 D;  3WAA C;  3AZI D;  1AOI B;  3TU4 D;  3REL A;  4H9P B;  3KUY A;  3AZI C;  1P3F B;  3AN2 C;  3AZM D;  1P3P C;  5GT0 A;  4UPK A;  2IO5 B;  1M19 C;  5B2I D;  4QLC C;  4J8W D;  5CPK C;  1P3L A;  2YFW A;  3AFA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...