4WU9C

Structure of cisptnap-ncp145
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9C00
4J8XA 3AYWB 3AZGB 3O62B 3B0DB 4XZQC 3B6GA 5AY8C 5AV9B 5B2ID 4J8VA 3MGQB 1P3MC 3WA9A 3AYWC 3AZGC 2NZDB 2NQBB 3B0DC 5BT1C 4X23B 4YS3D 1P3GD 3VH6T 4WU8B 1KX5D 3TU4D 1EQZA 3A6NA 1M18D 3MGQC 2BYMA 1M19C 3REIC 3REKB 2NZDC 3B0BA 3RELB 1P3LB 2NQBC 4X23C 4ZUXD 1TZYB 2AROD 4WU8C 2YFWB 1ID3D 2YFVB 5DNND 3REKC 1P3IC 4YS3A 1P3LC 1P3GA 1KX5A 3R45A 3MGRB 3TU4A 3AZNB 1M18A 4Z66B 3WAAA 1P3FD 4ZUXA 3X1VB 3AZKD 2BYKB 1F66D 3B0CW 1ID3A 5DNNA 4Z66C 5GSUB 1BH9A 4H9NA 3NQUB 4XZQD 2CV5C 3AZIB 3KUYD 1AOIB 1KX3B 1P3MD 4NE6A 5CHLB 5GSUC 5E5AB 1P3FA 1U35D 5BT1D 3AZKA 1F66A 3AV1D 4Z5TD 1KX3C 5B2JB 1BH8B 3AV2B 1M19D 5GXQC 4H9QA 3REID 3MVDB 3KUYA 5KDMA 4WU8D 1P3MA 5B2JC 3B6GB 5AV5C 3AV2C 1U35A 4J8VB 1P3ID 4G91B 3AV1A 4Z5TA 3LELB 1P3LD 1M19A 4Z2MG 4EO5B 3REIA 3KWQD 5C3IC 3A6NB 4J8VC 4KHAA 2BYMB 3LELC 1B67A 4WU8A 1TAFA 5B1LB 5CPKB 4EO5C 1P3IA 1P3LA 2CV5D 5BO0A 5B1LC 5CPKC 4XUJB 2YFVA 4YS3B 3KWQA 1P3GB 1KX5B 3R45B 3TU4B 3VH5W 1M18B 1S32D 3WAAB 4WZSB 3W99C 1M1AC 5JRGC 4ZUXB 4XUJC 4JJNC 5GXQD 2CV5A 3NQJA 1H3OA 1ID3B 5DNNB 3WAAC 3C1BD 1BH9B 5B2JD 1ZLAD 5AV5D 4ZUXC 3AV2D 4J8UC 1S32A 3VH5A 4YM6D 3X1SA 5DNNC 4QLCA 1P3PC 1P3FB 5JA4A 5GXQA 3C1BA 3LELD 4H9QB 5B2JA 1ZLAA 3KUYB 5AV5A 3AV2A 4KUDB 1P3MB 4UUZA 3VH6W 4YM6A 5B24D 3AZFD 4H9RA 5B1LD 5CPKD 1U35B 3AV1B 4Z5TB 3KUYC 1B6WA 4KUDC 3LELA 1M19B 3REIB 4LD9C 5B0YC 3X1UC 3WKJB 3W99D 1U35C 1M1AD 5JRGD 2RVQC 4KHAB 4Z5TC 4XUJD 4NFTA 4JJND 3AV1C 1TAFB 3MNND 5B0ZB 5B24A 3VH6A 3AZFA 3WAAD 5B1LA 5CPKA 4R8PD 1P3IB 2FJ7D 5AV8D 3WKJC 1P34D 4J8UD 5BO0B 5B0ZC 3KWQB 4WNNA 3W99A 1P3PD 1M1AA 5JRGA 4XUJA 4JJNA 3X1TD 3MGPC 3W97C 3MNNA 2JSSA 4R8PA 3KWQC 2FJ7A 1A7WA 2CV5B 5AV8A 3NQJB 1H3OB 3UT9C 1P34A 2NZDD 5B40D 4J8UA 5GT3C 5F99C 2HIOC 3AZLD 3C1CC 1P3PA 1S32B 3X1TA 5FUGB 3X1SB 4QLCB 4KUDD 5JA4B 5GXQB 4LD9D 5AV6B 5B0YD 3X1UD 1S32C 5B40A 2RVQD 3C1BB 3X1SC 4QLCC 3AZLA 1ZLAB 1BFMA 5AV5B 2PYOB 5AV6C 4UUZB 4YM6B 3WKJD 4KUDA 3C1BC 4H9RB 3AZHA 1ZLAC 5B0ZD 4LD9A 5B0YA 3X1UA 5C3IB 2PYOC 3REJB 4YM6C 3W97D 3MGPD 1P3AC 5CPJC 5AVCD 5CP6C 3B0CT 4KGCC 3WKJA 5B24B 3UT9D 5B1MD 3REJC 5B32A 3AZFB 5GT3D 5B0ZA 5G49A 2HIOD 5F99D 3LZ0D 3C1CD 3WTPE 3UTAA 3W97A 5B24C 3MGPA 3AZFC 2CWEA 4WNNB 3AZJC 1M1AB 3W99B 5AVCA 5JRGB 3AZEC 4JJNB 1P3KC 4H9PA 2HUEC 3MNNB 3UT9A 5B1MA 3UTBC 3LZ1C 5GT3A 3X1SD 4R8PB 2FJ7B 5F99A 2HIOA 4QLCD 5AV8B 3LZ0A 4G92B 1P34B 3C1CA 4J8UB 5AV6D 3MNNC 5DNMB 4NE3A 4R8PC 1P3PB 2FJ7C 3AN2D 4CAYA 5AV8C 4G92C 3X1TB 1P34C 4WU9D 2PYOD 5FUGA 5DNMC 1WWIA 4M6BA 3W98B 1P3AD 5CPJD 5AVBC 5B40B 3X1TC 5CP6D 5AV6A 4KGCD 3AZLB 3KXBC 4HGAC 3REJD 2F8NK 1P3BC 3AN2A 5BNVA 3W98C 4WU9A 5B33D 5B40C 2PYOA 3AZHB 3AZLC 4CSRA 4LD9B 5B0YB 3X1UB 3VH5T 1P3AA 3AZJD 5CPJA 3AZED 5CP6A 5B31C 1P3KD 5CPID 3B6FB 4KGCA 3UTBD 3REJA 3AZHC 3LZ1D 1P3OB 3LJAB 4Z2MH 5B33A 4AWLC 5B32B 3B6FC 5G49B 3REHD 1P3OC 4WV4B 3AZJA 3AZEA 3LJAC 3UTAB 1P3KA 5CPIA 3MGPB 3MGSD 3W97B 5B32C 3UTBA 3LZ1A 5AVCB 5DNMD 4H9PB 1R4VA 3UT9B 5B1MB 3UTAC 5AVBD 5GT3B 5F99B 2HIOB 3LZ0B 3O62C 3KXBD 3REHA 3AZMB 2F8NB 5AVCC 1P3BD 3C1CB 5AV9C 3W98D 3MGSA 5B1MC 1JFIB 1HQ3B 5DNMA 3LZ0C 4CAYB 1F1EA 3AZMC 2IO5B 5B2IA 3AFAD 3W96B 5AVBA 4J8WD 5B31D 3KXBA 1KX4D 1Q9CA 3AZHD 3WTPD 1HQ3C 1P3BA 3RELC 3W98A 1TZYC 2IO5C 3W96C 3B6FD 3AN2B 5BNVB 4WU9B 1P3OD 2AROA 3AFAA 3MGRC 3LJAD 5B31A 4J8WA 3AZNC 2F8NH 3V9RB 1ULYA 4ZBJB 4CSRB 5GT0B 5B32D 1KX4A 3WTPA 3AN2C 1P3AB 5CPJB 1KU5A 5CP6B 4NE5A 4WU9C 4H9SC 3X1VC 4KGCB 5AY8D 1WWSA 5BS7A 3UTAD 3B6FA 4ZBJC 5GT0C 5BNXA 3AYWD 3AZGD 1N1JA 3O62D 5B33B 4DRAA 1P3OA 3AZIC 1AOIC 3LJAA 5AV9D 3MGQD 4H9OA 3AZJB 4XZQA 3AZEB 5E5AC 3AZMD 2HUEB 5B33C 5CPIB 1P3KB 2F8ND 5AY8A 4X23D 2NQBD 4J8XB 3KSYA 3UTBB 3LZ1B 2L5AA 3AYWA 3AZGA 3O62A 1HTAA 3REKD 1HQ3D 3MVDC 3RELD 3WA9B 5CPIC 5AV9A 4J8XC 1TZYD 4E44A 3MGQA 3REHB 3W96D 2LY8A 3B6GC 2F8NA 3AZMA 2NZDA 2NQBA 1EQZB 3MGSB 4X23A 4G91C 3WA9C 3MGRD 3AZND 3REHC 4Z66D 5B2IB 3REKA 1JFIA 1HQ3A 3RELA 5AVBB 1EQZC 3A6NC 3MGSC 3X1VD 1TZYA 3KXBB 3W96A 2YFWA 5B31G 4HGAB 1P3BB 5GT0D 5B2IC 5GSUD 3AZID 1AOID 3MGRA 3AZNA 1KX3D 4Z66A 4YS3C 1P3GC 2AROB 4DRBA 3AFAB 1KX5C 3TU4C 4J8WB 5E5AD 5B31B 1M18C 4H9SA 3X1VA 2BYKA 1KX4B 3WTPB 4H9NB 3V9RA 5B32G 5GT0A 5GSUA 2AROC 3AFAC 4AWLB 3NQUA 4J8WC 3MVDD 3AZIA 1ID3C 1AOIA 1KX3A 5BNXB 4J8XD 1KX4C 1N1JB 3WTPC 3AZKB 1F66B 4E45A 3B6GD 5E5AA 5BS7C 4J8VD 3WA9D 4H9OB 1BH8A 4XZQB 1P3FC 5KDMB 5AY8B 3AZKC 1F66C 2F8NG 3MVDA 1EQZD 3A6ND
chains in the Genus database with same CATH superfamily
4J8XA 3AYWB 3AZGB 3O62B 3B0DB 4XZQC 3B6GA 5AY8C 5AV9B 5B2ID 4J8VA 3MGQB 1P3MC 3WA9A 3AYWC 3AZGC 2NZDB 2NQBB 3B0DC 5BT1C 4X23B 4YS3D 2F2AC 1P3GD 3VH6T 4WU8B 1KX5D 3TU4D 1EQZA 3A6NA 1M18D 3EPJA 3MGQC 2ZY2A 2BYMA 1M19C 3REIC 3REKB 2NZDC 3B0BA 3RELB 1P3LB 2NQBC 4X23C 4ZUXD 1TZYB 2G5HC 2AROD 4WU8C 2YFWB 1ID3D 2YFVB 5DNND 2Y2LA 3REKC 1P3IC 4YS3A 1P3LC 1P3GA 1KX5A 3R45A 3MGRB 2Y2QA 3TU4A 3AZNB 1M18A 4Z66B 3WAAA 1P3FD 4ZUXA 3X1VB 3AZKD 2BYKB 1F66D 3B0CW 1ID3A 5DNNA 4Z66C 5GSUB 1BH9A 4H9NA 3NQUB 4XZQD 2CV5C 3AZIB 3KUYD 1AOIB 2ZY5A 1KX3B 1P3MD 3EPLA 4NE6A 5CHLB 5GSUC 5E5AB 1P3FA 1U35D 5BT1D 3AZKA 1F66A 3AV1D 4Z5TD 1KX3C 5B2JB 1BH8B 3AV2B 1M19D 5GXQC 4H9QA 3REID 3MVDB 3KUYA 5KDMA 4WU8D 1P3MA 5B2JC 3B6GB 1W2EA 5AV5C 3AV2C 1U35A 4J8VB 1P3ID 4G91B 3H0LC 3AV1A 4Z5TA 3LELB 1P3LD 2G5IC 1M19A 4Z2MG 4EO5B 3REIA 3KWQD 5C3IC 3A6NB 4J8VC 4KHAA 2BYMB 3LELC 1B67A 4WU8A 1TAFA 5B1LB 2DQNC 5CPKB 4EO5C 1P3IA 1P3LA 2CV5D 5BO0A 5B1LC 5CPKC 4XUJB 2YFVA 4YS3B 3KWQA 1P3GB 1KX5B 3R45B 3TU4B 3VH5W 1M18B 1S32D 3WAAB 4WZSB 3W99C 1M1AC 5JRGC 4ZUXB 4XUJC 4JJNC 5GXQD 2CV5A 3NQJA 1H3OA 1ID3B 5DNNB 1Z2CB 3WAAC 3C1BD 1BH9B 5B2JD 1ZLAD 2JCHA 5AV5D 4ZUXC 3AV2D 4J8UC 1S32A 2Y2OA 3VH5A 4YM6D 3X1SA 5DNNC 4QLCA 1P3PC 1P3FB 5JA4A 5GXQA 3A1KA 3A1IA 3C1BA 3LELD 4H9QB 5B2JA 1ZLAA 3KUYB 5AV5A 2RIQA 3AV2A 4KUDB 1P3MB 4UUZA 3VH6W 4YM6A 5B24D 3AZFD 4H9RA 5B1LD 5CPKD 1U35B 3AV1B 4Z5TB 3KUYC 1B6WA 4KUDC 3LELA 1M19B 3REIB 4LD9C 5B0YC 3X1UC 3WKJB 3W99D 1U35C 1M1AD 5JRGD 2RVQC 4KHAB 4Z5TC 4XUJD 4NFTA 4JJND 3AV1C 1TAFB 3MNND 5B0ZB 2Y2GA 5B24A 3VH6A 3AZFA 3WAAD 5B1LA 5CPKA 4R8PD 1P3IB 2FJ7D 5AV8D 3WKJC 1P34D 4J8UD 5BO0B 5B0ZC 3KFUG 3KWQB 4WNNA 3W99A 1P3PD 1M1AA 5JRGA 4XUJA 4JJNA 3X1TD 3MGPC 3W97C 3MNNA 3H0MC 2JSSA 4R8PA 3KWQC 2FJ7A 1A7WA 2CV5B 5AV8A 3NQJB 1H3OB 3UT9C 1P34A 2NZDD 4WJ3C 2DF4C 5B40D 2Y2PA 4J8UA 5GT3C 5F99C 2HIOC 3AZLD 3C1CC 1P3PA 1S32B 3X1TA 5FUGB 3X1SB 4QLCB 4KUDD 5JA4B 5GXQB 4LD9D 5AV6B 5B0YD 3X1UD 1S32C 5B40A 2RVQD 3C1BB 3X1SC 4QLCC 3AZLA 1ZLAB 1BFMA 5AV5B 2PYOB 5AV6C 4UUZB 4YM6B 3WKJD 4KUDA 3C1BC 4H9RB 3AZHA 1ZLAC 5B0ZD 4LD9A 5B0YA 3X1UA 2UWXA 5C3IB 2PYOC 3REJB 4YM6C 3W97D 3MGPD 1P3AC 5CPJC 5AVCD 5CP6C 3B0CT 4KGCC 2Y2HA 3WKJA 5B24B 3UT9D 5B1MD 3REJC 5B32A 3AZFB 5GT3D 5B0ZA 5G49A 2HIOD 5F99D 3LZ0D 3C1CD 3WTPE 3UTAA 2XD5A 3W97A 5B24C 3MGPA 3AZFC 2CWEA 4WNNB 3AZJC 1M1AB 3W99B 5AVCA 5JRGB 3AZEC 4JJNB 1P3KC 4H9PA 2HUEC 3MNNB 3UT9A 5B1MA 3UTBC 3LZ1C 1T3UA 5GT3A 3X1SD 4R8PB 2FJ7B 5F99A 2HIOA 4QLCD 5AV8B 3LZ0A 4G92B 1P34B 3C1CA 4J8UB 5AV6D 3MNNC 5DNMB 4NE3A 2Y2NA 4R8PC 1P3PB 2FJ7C 3AN2D 4CAYA 5AV8C 4G92C 3X1TB 1P34C 2Y2JA 4WU9D 2W8SA 2PYOD 5FUGA 5DNMC 1WWIA 3EG5B 4M6BA 3W98B 1P3AD 5CPJD 5AVBC 5B40B 3X1TC 5CP6D 5AV6A 4KGCD 3AZLB 3KXBC 4HGAC 3REJD 2F8NK 1P3BC 3F6TA 2ZM5A 3AN2A 5BNVA 3W98C 4WU9A 5B33D 4UPKA 5B40C 2PYOA 3AZHB 3AZLC 3AL0C 4CSRA 4LD9B 5B0YB 3X1UB 3VH5T 1P3AA 3AZJD 5CPJA 3AZED 5CP6A 5B31C 1P3KD 5CPID 3B6FB 4KGCA 3UTBD 3REJA 3AZHC 3LZ1D 1P3OB 2Y2MA 3LJAB 4Z2MH 5B33A 4AWLC 5B32B 3B6FC 5G49B 3REHD 1P3OC 4WV4B 3AZJA 3AZEA 3LJAC 3UTAB 1P3KA 5CPIA 3MGPB 3MGSD 3W97B 5B32C 3UTBA 3LZ1A 5AVCB 5DNMD 4H9PB 1R4VA 3UT9B 5B1MB 3UTAC 5AVBD 5GT3B 2JE5A 5F99B 2HIOB 3LZ0B 3O62C 3KXBD 3REHA 3AZMB 2F8NB 5AVCC 1P3BD 3C1CB 5AV9C 3W98D 3MGSA 5B1MC 1JFIB 1HQ3B 5DNMA 3LZ0C 4CAYB 1F1EA 3AZMC 2IO5B 5B2IA 3AFAD 3W96B 5AVBA 4J8WD 5B31D 3KXBA 1KX4D 1Q9CA 3AZHD 3WTPD 1HQ3C 1P3BA 3RELC 3W98A 1TZYC 2IO5C 3W96C 3B6FD 3AN2B 5BNVB 4WU9B 3P5JB 1P3OD 2AROA 3AFAA 3MGRC 3LJAD 5B31A 4J8WA 3AZNC 2F8NH 3V9RB 1ULYA 4ZBJB 4CSRB 5GT0B 5B32D 1KX4A 3WTPA 3AN2C 1P3AB 2BG1A 2ZY4A 5CPJB 1KU5A 5CP6B 4NE5A 4WU9C 4H9SC 3X1VC 4KGCB 5AY8D 1WWSA 5BS7A 3UTAD 3B6FA 4ZBJC 5GT0C 5BNXA 2XD1A 3AYWD 3AZGD 1N1JA 3O62D 5B33B 4DRAA 1P3OA 3EPKA 3AZIC 1AOIC 3LJAA 5AV9D 2J8PA 3MGQD 4H9OA 3AZJB 4XZQA 3AZEB 5E5AC 3AZMD 2HUEB 5B33C 5CPIB 1P3KB 2F8ND 5AY8A 2ZY3A 4X23D 4J8XB 2NQBD 3KSYA 3UTBB 3LZ1B 2L5AA 3AYWA 3AZGA 3O62A 3H0RC 1HTAA 3REKD 1HQ3D 3MVDC 3RELD 3WA9B 5CPIC 5AV9A 4J8XC 1TZYD 4E44A 3MGQA 3REHB 3W96D 3EPHA 2LY8A 3B6GC 2F8NA 3AZMA 2NZDA 2NQBA 2Y2IA 3MGSB 1EQZB 4X23A 4G91C 3WA9C 3MGRD 3AZND 3REHC 4Z66D 5B2IB 3REKA 1JFIA 1HQ3A 3RELA 5AVBB 1EQZC 3A6NC 3MGSC 3X1VD 1TZYA 2VQRA 3KXBB 3W96A 2YFWA 5B31G 4HGAB 1P3BB 3IP4C 5GT0D 5B2IC 5GSUD 4DQYB 3AZID 1AOID 3MGRA 3AZNA 1KX3D 4Z66A 4YS3C 1P3GC 2AROB 4DRBA 3AFAB 1KX5C 3TU4C 4J8WB 5E5AD 5B31B 1M18C 4H9SA 3X1VA 2BYKA 1KX4B 3WTPB 4H9NB 3V9RA 5B32G 5GT0A 5GSUA 2AROC 3AFAC 4AWLB 3NQUA 4J8WC 3MVDD 3AZIA 1ID3C 1AOIA 2FFFB 1KX3A 5BNXB 1PZRA 4J8XD 1KX4C 1N1JB 3WTPC 3AZKB 1F66B 4E45A 3B6GD 5E5AA 5BS7C 4J8VD 3WA9D 4H9OB 1BH8A 4XZQB 2Y2KA 1P3FC 5KDMB 5AY8B 3AZKC 1F66C 2F8NG 3MVDA 3FDDA 1EQZD 3A6ND
chains in the Genus database with same CATH topology
4J8XA 3AYWB 3AZGB 3O62B 3B0DB 4XZQC 3B6GA 5AY8C 5AV9B 5B2ID 4J8VA 3MGQB 1P3MC 3WA9A 3AYWC 3AZGC 2NZDB 2NQBB 3B0DC 5BT1C 4X23B 4YS3D 2F2AC 1P3GD 3VH6T 4WU8B 1KX5D 3TU4D 1EQZA 3A6NA 1M18D 3EPJA 3MGQC 2ZY2A 2BYMA 1M19C 3REIC 3REKB 2NZDC 3B0BA 3RELB 1P3LB 2NQBC 4X23C 4ZUXD 1TZYB 2G5HC 2AROD 4WU8C 2YFWB 1ID3D 2YFVB 5DNND 2Y2LA 3REKC 1P3IC 4YS3A 1P3LC 1P3GA 1KX5A 3R45A 3MGRB 2Y2QA 3TU4A 3AZNB 1M18A 4Z66B 3WAAA 1P3FD 4ZUXA 3X1VB 3AZKD 2BYKB 1F66D 3B0CW 1ID3A 5DNNA 4Z66C 5GSUB 1BH9A 4H9NA 3NQUB 4XZQD 2CV5C 3AZIB 3KUYD 1AOIB 2ZY5A 1KX3B 1P3MD 3EPLA 4NE6A 5CHLB 5GSUC 5E5AB 1P3FA 1U35D 5BT1D 3AZKA 1F66A 3AV1D 4Z5TD 1KX3C 5B2JB 1BH8B 3AV2B 1M19D 5GXQC 4H9QA 3REID 3MVDB 3KUYA 5KDMA 4WU8D 1P3MA 5B2JC 3B6GB 1W2EA 5AV5C 3AV2C 1U35A 4J8VB 1P3ID 4G91B 3H0LC 3AV1A 4Z5TA 3LELB 1P3LD 2G5IC 1M19A 4Z2MG 4EO5B 3REIA 3KWQD 5C3IC 3A6NB 4J8VC 4KHAA 2BYMB 3LELC 1B67A 4WU8A 1TAFA 5B1LB 2DQNC 5CPKB 4EO5C 1P3IA 1P3LA 2CV5D 5BO0A 5B1LC 5CPKC 4XUJB 2YFVA 4YS3B 3KWQA 1P3GB 1KX5B 3R45B 3TU4B 3VH5W 1M18B 1S32D 3WAAB 4WZSB 3W99C 1M1AC 5JRGC 4ZUXB 4XUJC 4JJNC 5GXQD 2CV5A 3NQJA 1H3OA 1ID3B 5DNNB 1Z2CB 3WAAC 3C1BD 1BH9B 5B2JD 1ZLAD 2JCHA 5AV5D 4ZUXC 3AV2D 4J8UC 1S32A 2Y2OA 3VH5A 4YM6D 3X1SA 5DNNC 4QLCA 1P3PC 1P3FB 5JA4A 5GXQA 3A1KA 3A1IA 3C1BA 3LELD 4H9QB 5B2JA 1ZLAA 3KUYB 5AV5A 2RIQA 3AV2A 4KUDB 1P3MB 4UUZA 3VH6W 4YM6A 5B24D 3AZFD 4H9RA 5B1LD 5CPKD 1U35B 3AV1B 4Z5TB 3KUYC 1B6WA 4KUDC 3LELA 1M19B 3REIB 4LD9C 5B0YC 3X1UC 3WKJB 3W99D 1U35C 1M1AD 5JRGD 2RVQC 4KHAB 4Z5TC 4XUJD 4NFTA 4JJND 3AV1C 1TAFB 3MNND 5B0ZB 2Y2GA 5B24A 3VH6A 3AZFA 3WAAD 5B1LA 5CPKA 4R8PD 1P3IB 2FJ7D 5AV8D 3WKJC 1P34D 4J8UD 5BO0B 5B0ZC 3KFUG 3KWQB 4WNNA 3W99A 1P3PD 1M1AA 5JRGA 4XUJA 4JJNA 3X1TD 3MGPC 3W97C 3MNNA 3H0MC 2JSSA 4R8PA 3KWQC 2FJ7A 1A7WA 2CV5B 5AV8A 3NQJB 1H3OB 3UT9C 1P34A 2NZDD 4WJ3C 2DF4C 5B40D 2Y2PA 4J8UA 5GT3C 5F99C 2HIOC 3AZLD 3C1CC 1P3PA 1S32B 3X1TA 5FUGB 3X1SB 4QLCB 4KUDD 5JA4B 5GXQB 4LD9D 5AV6B 5B0YD 3X1UD 1S32C 5B40A 2RVQD 3C1BB 3X1SC 4QLCC 3AZLA 1ZLAB 1BFMA 5AV5B 2PYOB 5AV6C 4UUZB 4YM6B 3WKJD 4KUDA 3C1BC 4H9RB 3AZHA 1ZLAC 5B0ZD 4LD9A 5B0YA 3X1UA 2UWXA 5C3IB 2PYOC 3REJB 4YM6C 3W97D 3MGPD 1P3AC 5CPJC 5AVCD 5CP6C 3B0CT 4KGCC 2Y2HA 3WKJA 5B24B 3UT9D 5B1MD 3REJC 5B32A 3AZFB 5GT3D 5B0ZA 5G49A 2HIOD 5F99D 3LZ0D 3C1CD 3WTPE 3UTAA 2XD5A 3W97A 5B24C 3MGPA 3AZFC 2CWEA 4WNNB 3AZJC 1M1AB 3W99B 5AVCA 5JRGB 3AZEC 4JJNB 1P3KC 4H9PA 2HUEC 3MNNB 3UT9A 5B1MA 3UTBC 3LZ1C 1T3UA 5GT3A 3X1SD 4R8PB 2FJ7B 5F99A 2HIOA 4QLCD 5AV8B 3LZ0A 4G92B 1P34B 3C1CA 4J8UB 5AV6D 3MNNC 5DNMB 4NE3A 2Y2NA 4R8PC 1P3PB 2FJ7C 3AN2D 4CAYA 5AV8C 4G92C 3X1TB 1P34C 2Y2JA 4WU9D 2W8SA 2PYOD 5FUGA 5DNMC 1WWIA 3EG5B 4M6BA 3W98B 1P3AD 5CPJD 5AVBC 5B40B 3X1TC 5CP6D 5AV6A 4KGCD 3AZLB 3KXBC 4HGAC 3REJD 2F8NK 1P3BC 3F6TA 2ZM5A 3AN2A 5BNVA 3W98C 4WU9A 5B33D 4UPKA 5B40C 2PYOA 3AZHB 3AZLC 3AL0C 4CSRA 4LD9B 5B0YB 3X1UB 3VH5T 1P3AA 3AZJD 5CPJA 3AZED 5CP6A 5B31C 1P3KD 5CPID 3B6FB 4KGCA 3UTBD 3REJA 3AZHC 3LZ1D 1P3OB 2Y2MA 3LJAB 4Z2MH 5B33A 4AWLC 5B32B 3B6FC 5G49B 3REHD 1P3OC 4WV4B 3AZJA 3AZEA 3LJAC 3UTAB 1P3KA 5CPIA 3MGPB 3MGSD 3W97B 5B32C 3UTBA 3LZ1A 5AVCB 5DNMD 4H9PB 1R4VA 3UT9B 5B1MB 3UTAC 5AVBD 5GT3B 2JE5A 5F99B 2HIOB 3LZ0B 3O62C 3KXBD 3REHA 3AZMB 2F8NB 5AVCC 1P3BD 3C1CB 5AV9C 3W98D 3MGSA 5B1MC 1JFIB 1HQ3B 5DNMA 3LZ0C 4CAYB 1F1EA 3AZMC 2IO5B 5B2IA 3AFAD 3W96B 5AVBA 4J8WD 5B31D 3KXBA 1KX4D 1Q9CA 3AZHD 3WTPD 1HQ3C 1P3BA 3RELC 3W98A 1TZYC 2IO5C 3W96C 3B6FD 3AN2B 5BNVB 4WU9B 3P5JB 1P3OD 2AROA 3AFAA 3MGRC 3LJAD 5B31A 4J8WA 3AZNC 2F8NH 3V9RB 1ULYA 4ZBJB 4CSRB 5GT0B 5B32D 1KX4A 3WTPA 3AN2C 1P3AB 2BG1A 2ZY4A 5CPJB 1KU5A 5CP6B 4NE5A 4WU9C 4H9SC 3X1VC 4KGCB 5AY8D 1WWSA 5BS7A 3UTAD 3B6FA 4ZBJC 5GT0C 5BNXA 2XD1A 3AYWD 3AZGD 1N1JA 3O62D 5B33B 4DRAA 1P3OA 3EPKA 3AZIC 1AOIC 3LJAA 5AV9D 2J8PA 3MGQD 4H9OA 3AZJB 4XZQA 3AZEB 5E5AC 3AZMD 2HUEB 5B33C 5CPIB 1P3KB 2F8ND 5AY8A 2ZY3A 4X23D 4J8XB 2NQBD 3KSYA 3UTBB 3LZ1B 2L5AA 3AYWA 3AZGA 3O62A 3H0RC 1HTAA 3REKD 1HQ3D 3MVDC 3RELD 3WA9B 5CPIC 5AV9A 4J8XC 1TZYD 4E44A 3MGQA 3REHB 3W96D 3EPHA 2LY8A 3B6GC 2F8NA 3AZMA 2NZDA 2NQBA 2Y2IA 3MGSB 1EQZB 4X23A 4G91C 3WA9C 3MGRD 3AZND 3REHC 4Z66D 5B2IB 3REKA 1JFIA 1HQ3A 3RELA 5AVBB 1EQZC 3A6NC 3MGSC 3X1VD 1TZYA 2VQRA 3KXBB 3W96A 2YFWA 5B31G 4HGAB 1P3BB 3IP4C 5GT0D 5B2IC 5GSUD 4DQYB 3AZID 1AOID 3MGRA 3AZNA 1KX3D 4Z66A 4YS3C 1P3GC 2AROB 4DRBA 3AFAB 1KX5C 3TU4C 4J8WB 5E5AD 5B31B 1M18C 4H9SA 3X1VA 2BYKA 1KX4B 3WTPB 4H9NB 3V9RA 5B32G 5GT0A 5GSUA 2AROC 3AFAC 4AWLB 3NQUA 4J8WC 3MVDD 3AZIA 1ID3C 1AOIA 2FFFB 1KX3A 5BNXB 1PZRA 4J8XD 1KX4C 1N1JB 3WTPC 3AZKB 1F66B 4E45A 3B6GD 5E5AA 5BS7C 4J8VD 3WA9D 4H9OB 1BH8A 4XZQB 2Y2KA 1P3FC 5KDMB 5AY8B 3AZKC 1F66C 2F8NG 3MVDA 3FDDA 1EQZD 3A6ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X A;  3AYW B;  3AZG B;  3O62 B;  3B0D B;  4XZQ C;  3B6G A;  5AY8 C;  5AV9 B;  5B2I D;  4J8V A;  3MGQ B;  1P3M C;  3WA9 A;  3AYW C;  3AZG C;  2NZD B;  2NQB B;  3B0D C;  5BT1 C;  4X23 B;  4YS3 D;  1P3G D;  3VH6 T;  4WU8 B;  1KX5 D;  3TU4 D;  1EQZ A;  3A6N A;  1M18 D;  3MGQ C;  2BYM A;  1M19 C;  3REI C;  3REK B;  2NZD C;  3B0B A;  3REL B;  1P3L B;  2NQB C;  4X23 C;  4ZUX D;  1TZY B;  2ARO D;  4WU8 C;  2YFW B;  1ID3 D;  2YFV B;  5DNN D;  3REK C;  1P3I C;  4YS3 A;  1P3L C;  1P3G A;  1KX5 A;  3R45 A;  3MGR B;  3TU4 A;  3AZN B;  1M18 A;  4Z66 B;  3WAA A;  1P3F D;  4ZUX A;  3X1V B;  3AZK D;  2BYK B;  1F66 D;  3B0C W;  1ID3 A;  5DNN A;  4Z66 C;  5GSU B;  1BH9 A;  4H9N A;  3NQU B;  4XZQ D;  2CV5 C;  3AZI B;  3KUY D;  1AOI B;  1KX3 B;  1P3M D;  4NE6 A;  5CHL B;  5GSU C;  5E5A B;  1P3F A;  1U35 D;  5BT1 D;  3AZK A;  1F66 A;  3AV1 D;  4Z5T D;  1KX3 C;  5B2J B;  1BH8 B;  3AV2 B;  1M19 D;  5GXQ C;  4H9Q A;  3REI D;  3MVD B;  3KUY A;  5KDM A;  4WU8 D;  1P3M A;  5B2J C;  3B6G B;  5AV5 C;  3AV2 C;  1U35 A;  4J8V B;  1P3I D;  4G91 B;  3AV1 A;  4Z5T A;  3LEL B;  1P3L D;  1M19 A;  4Z2M G;  4EO5 B;  3REI A;  3KWQ D;  5C3I C;  3A6N B;  4J8V C;  4KHA A;  2BYM B;  3LEL C;  1B67 A;  4WU8 A;  1TAF A;  5B1L B;  5CPK B;  4EO5 C;  1P3I A;  1P3L A;  2CV5 D;  5BO0 A;  5B1L C;  5CPK C;  4XUJ B;  2YFV A;  4YS3 B;  3KWQ A;  1P3G B;  1KX5 B;  3R45 B;  3TU4 B;  3VH5 W;  1M18 B;  1S32 D;  3WAA B;  4WZS B;  3W99 C;  1M1A C;  5JRG C;  4ZUX B;  4XUJ C;  4JJN C;  5GXQ D;  2CV5 A;  3NQJ A;  1H3O A;  1ID3 B;  5DNN B;  3WAA C;  3C1B D;  1BH9 B;  5B2J D;  1ZLA D;  5AV5 D;  4ZUX C;  3AV2 D;  4J8U C;  1S32 A;  3VH5 A;  4YM6 D;  3X1S A;  5DNN C;  4QLC A;  1P3P C;  1P3F B;  5JA4 A;  5GXQ A;  3C1B A;  3LEL D;  4H9Q B;  5B2J A;  1ZLA A;  3KUY B;  5AV5 A;  3AV2 A;  4KUD B;  1P3M B;  4UUZ A;  3VH6 W;  4YM6 A;  5B24 D;  3AZF D;  4H9R A;  5B1L D;  5CPK D;  1U35 B;  3AV1 B;  4Z5T B;  3KUY C;  1B6W A;  4KUD C;  3LEL A;  1M19 B;  3REI B;  4LD9 C;  5B0Y C;  3X1U C;  3WKJ B;  3W99 D;  1U35 C;  1M1A D;  5JRG D;  2RVQ C;  4KHA B;  4Z5T C;  4XUJ D;  4NFT A;  4JJN D;  3AV1 C;  1TAF B;  3MNN D;  5B0Z B;  5B24 A;  3VH6 A;  3AZF A;  3WAA D;  5B1L A;  5CPK A;  4R8P D;  1P3I B;  2FJ7 D;  5AV8 D;  3WKJ C;  1P34 D;  4J8U D;  5BO0 B;  5B0Z C;  3KWQ B;  4WNN A;  3W99 A;  1P3P D;  1M1A A;  5JRG A;  4XUJ A;  4JJN A;  3X1T D;  3MGP C;  3W97 C;  3MNN A;  2JSS A;  4R8P A;  3KWQ C;  2FJ7 A;  1A7W A;  2CV5 B;  5AV8 A;  3NQJ B;  1H3O B;  3UT9 C;  1P34 A;  2NZD D;  5B40 D;  4J8U A;  5GT3 C;  5F99 C;  2HIO C;  3AZL D;  3C1C C;  1P3P A;  1S32 B;  3X1T A;  5FUG B;  3X1S B;  4QLC B;  4KUD D;  5JA4 B;  5GXQ B;  4LD9 D;  5AV6 B;  5B0Y D;  3X1U D;  1S32 C;  5B40 A;  2RVQ D;  3C1B B;  3X1S C;  4QLC C;  3AZL A;  1ZLA B;  1BFM A;  5AV5 B;  2PYO B;  5AV6 C;  4UUZ B;  4YM6 B;  3WKJ D;  4KUD A;  3C1B C;  4H9R B;  3AZH A;  1ZLA C;  5B0Z D;  4LD9 A;  5B0Y A;  3X1U A;  5C3I B;  2PYO C;  3REJ B;  4YM6 C;  3W97 D;  3MGP D;  1P3A C;  5CPJ C;  5AVC D;  5CP6 C;  3B0C T;  4KGC C;  3WKJ A;  5B24 B;  3UT9 D;  5B1M D;  3REJ C;  5B32 A;  3AZF B;  5GT3 D;  5B0Z A;  5G49 A;  2HIO D;  5F99 D;  3LZ0 D;  3C1C D;  3WTP E;  3UTA A;  3W97 A;  5B24 C;  3MGP A;  3AZF C;  2CWE A;  4WNN B;  3AZJ C;  1M1A B;  3W99 B;  5AVC A;  5JRG B;  3AZE C;  4JJN B;  1P3K C;  4H9P A;  2HUE C;  3MNN B;  3UT9 A;  5B1M A;  3UTB C;  3LZ1 C;  5GT3 A;  3X1S D;  4R8P B;  2FJ7 B;  5F99 A;  2HIO A;  4QLC D;  5AV8 B;  3LZ0 A;  4G92 B;  1P34 B;  3C1C A;  4J8U B;  5AV6 D;  3MNN C;  5DNM B;  4NE3 A;  4R8P C;  1P3P B;  2FJ7 C;  3AN2 D;  4CAY A;  5AV8 C;  4G92 C;  3X1T B;  1P34 C;  4WU9 D;  2PYO D;  5FUG A;  5DNM C;  1WWI A;  4M6B A;  3W98 B;  1P3A D;  5CPJ D;  5AVB C;  5B40 B;  3X1T C;  5CP6 D;  5AV6 A;  4KGC D;  3AZL B;  3KXB C;  4HGA C;  3REJ D;  2F8N K;  1P3B C;  3AN2 A;  5BNV A;  3W98 C;  4WU9 A;  5B33 D;  5B40 C;  2PYO A;  3AZH B;  3AZL C;  4CSR A;  4LD9 B;  5B0Y B;  3X1U B;  3VH5 T;  1P3A A;  3AZJ D;  5CPJ A;  3AZE D;  5CP6 A;  5B31 C;  1P3K D;  5CPI D;  3B6F B;  4KGC A;  3UTB D;  3REJ A;  3AZH C;  3LZ1 D;  1P3O B;  3LJA B;  4Z2M H;  5B33 A;  4AWL C;  5B32 B;  3B6F C;  5G49 B;  3REH D;  1P3O C;  4WV4 B;  3AZJ A;  3AZE A;  3LJA C;  3UTA B;  1P3K A;  5CPI A;  3MGP B;  3MGS D;  3W97 B;  5B32 C;  3UTB A;  3LZ1 A;  5AVC B;  5DNM D;  4H9P B;  1R4V A;  3UT9 B;  5B1M B;  3UTA C;  5AVB D;  5GT3 B;  5F99 B;  2HIO B;  3LZ0 B;  3O62 C;  3KXB D;  3REH A;  3AZM B;  2F8N B;  5AVC C;  1P3B D;  3C1C B;  5AV9 C;  3W98 D;  3MGS A;  5B1M C;  1JFI B;  1HQ3 B;  5DNM A;  3LZ0 C;  4CAY B;  1F1E A;  3AZM C;  2IO5 B;  5B2I A;  3AFA D;  3W96 B;  5AVB A;  4J8W D;  5B31 D;  3KXB A;  1KX4 D;  1Q9C A;  3AZH D;  3WTP D;  1HQ3 C;  1P3B A;  3REL C;  3W98 A;  1TZY C;  2IO5 C;  3W96 C;  3B6F D;  3AN2 B;  5BNV B;  4WU9 B;  1P3O D;  2ARO A;  3AFA A;  3MGR C;  3LJA D;  5B31 A;  4J8W A;  3AZN C;  2F8N H;  3V9R B;  1ULY A;  4ZBJ B;  4CSR B;  5GT0 B;  5B32 D;  1KX4 A;  3WTP A;  3AN2 C;  1P3A B;  5CPJ B;  1KU5 A;  5CP6 B;  4NE5 A;  4WU9 C;  4H9S C;  3X1V C;  4KGC B;  5AY8 D;  1WWS A;  5BS7 A;  3UTA D;  3B6F A;  4ZBJ C;  5GT0 C;  5BNX A;  3AYW D;  3AZG D;  1N1J A;  3O62 D;  5B33 B;  4DRA A;  1P3O A;  3AZI C;  1AOI C;  3LJA A;  5AV9 D;  3MGQ D;  4H9O A;  3AZJ B;  4XZQ A;  3AZE B;  5E5A C;  3AZM D;  2HUE B;  5B33 C;  5CPI B;  1P3K B;  2F8N D;  5AY8 A;  4X23 D;  2NQB D;  4J8X B;  3KSY A;  3UTB B;  3LZ1 B;  2L5A A;  3AYW A;  3AZG A;  3O62 A;  1HTA A;  3REK D;  1HQ3 D;  3MVD C;  3REL D;  3WA9 B;  5CPI C;  5AV9 A;  4J8X C;  1TZY D;  4E44 A;  3MGQ A;  3REH B;  3W96 D;  2LY8 A;  3B6G C;  2F8N A;  3AZM A;  2NZD A;  2NQB A;  1EQZ B;  3MGS B;  4X23 A;  4G91 C;  3WA9 C;  3MGR D;  3AZN D;  3REH C;  4Z66 D;  5B2I B;  3REK A;  1JFI A;  1HQ3 A;  3REL A;  5AVB B;  1EQZ C;  3A6N C;  3MGS C;  3X1V D;  1TZY A;  3KXB B;  3W96 A;  2YFW A;  5B31 G;  4HGA B;  1P3B B;  5GT0 D;  5B2I C;  5GSU D;  3AZI D;  1AOI D;  3MGR A;  3AZN A;  1KX3 D;  4Z66 A;  4YS3 C;  1P3G C;  2ARO B;  4DRB A;  3AFA B;  1KX5 C;  3TU4 C;  4J8W B;  5E5A D;  5B31 B;  1M18 C;  4H9S A;  3X1V A;  2BYK A;  1KX4 B;  3WTP B;  4H9N B;  3V9R A;  5B32 G;  5GT0 A;  5GSU A;  2ARO C;  3AFA C;  4AWL B;  3NQU A;  4J8W C;  3MVD D;  3AZI A;  1ID3 C;  1AOI A;  1KX3 A;  5BNX B;  4J8X D;  1KX4 C;  1N1J B;  3WTP C;  3AZK B;  1F66 B;  4E45 A;  3B6G D;  5E5A A;  5BS7 C;  4J8V D;  3WA9 D;  4H9O B;  1BH8 A;  4XZQ B;  1P3F C;  5KDM B;  5AY8 B;  3AZK C;  1F66 C;  2F8N G;  3MVD A;  1EQZ D;  3A6N D; 
#chains in the Genus database with same CATH topology
 4J8X A;  3AYW B;  3AZG B;  3O62 B;  3B0D B;  4XZQ C;  3B6G A;  5AY8 C;  5AV9 B;  5B2I D;  4J8V A;  3MGQ B;  1P3M C;  3WA9 A;  3AYW C;  3AZG C;  2NZD B;  2NQB B;  3B0D C;  5BT1 C;  4X23 B;  4YS3 D;  2F2A C;  1P3G D;  3VH6 T;  4WU8 B;  1KX5 D;  3TU4 D;  1EQZ A;  3A6N A;  1M18 D;  3EPJ A;  3MGQ C;  2ZY2 A;  2BYM A;  1M19 C;  3REI C;  3REK B;  2NZD C;  3B0B A;  3REL B;  1P3L B;  2NQB C;  4X23 C;  4ZUX D;  1TZY B;  2G5H C;  2ARO D;  4WU8 C;  2YFW B;  1ID3 D;  2YFV B;  5DNN D;  2Y2L A;  3REK C;  1P3I C;  4YS3 A;  1P3L C;  1P3G A;  1KX5 A;  3R45 A;  3MGR B;  2Y2Q A;  3TU4 A;  3AZN B;  1M18 A;  4Z66 B;  3WAA A;  1P3F D;  4ZUX A;  3X1V B;  3AZK D;  2BYK B;  1F66 D;  3B0C W;  1ID3 A;  5DNN A;  4Z66 C;  5GSU B;  1BH9 A;  4H9N A;  3NQU B;  4XZQ D;  2CV5 C;  3AZI B;  3KUY D;  1AOI B;  2ZY5 A;  1KX3 B;  1P3M D;  3EPL A;  4NE6 A;  5CHL B;  5GSU C;  5E5A B;  1P3F A;  1U35 D;  5BT1 D;  3AZK A;  1F66 A;  3AV1 D;  4Z5T D;  1KX3 C;  5B2J B;  1BH8 B;  3AV2 B;  1M19 D;  5GXQ C;  4H9Q A;  3REI D;  3MVD B;  3KUY A;  5KDM A;  4WU8 D;  1P3M A;  5B2J C;  3B6G B;  1W2E A;  5AV5 C;  3AV2 C;  1U35 A;  4J8V B;  1P3I D;  4G91 B;  3H0L C;  3AV1 A;  4Z5T A;  3LEL B;  1P3L D;  2G5I C;  1M19 A;  4Z2M G;  4EO5 B;  3REI A;  3KWQ D;  5C3I C;  3A6N B;  4J8V C;  4KHA A;  2BYM B;  3LEL C;  1B67 A;  4WU8 A;  1TAF A;  5B1L B;  2DQN C;  5CPK B;  4EO5 C;  1P3I A;  1P3L A;  2CV5 D;  5BO0 A;  5B1L C;  5CPK C;  4XUJ B;  2YFV A;  4YS3 B;  3KWQ A;  1P3G B;  1KX5 B;  3R45 B;  3TU4 B;  3VH5 W;  1M18 B;  1S32 D;  3WAA B;  4WZS B;  3W99 C;  1M1A C;  5JRG C;  4ZUX B;  4XUJ C;  4JJN C;  5GXQ D;  2CV5 A;  3NQJ A;  1H3O A;  1ID3 B;  5DNN B;  1Z2C B;  3WAA C;  3C1B D;  1BH9 B;  5B2J D;  1ZLA D;  2JCH A;  5AV5 D;  4ZUX C;  3AV2 D;  4J8U C;  1S32 A;  2Y2O A;  3VH5 A;  4YM6 D;  3X1S A;  5DNN C;  4QLC A;  1P3P C;  1P3F B;  5JA4 A;  5GXQ A;  3A1K A;  3A1I A;  3C1B A;  3LEL D;  4H9Q B;  5B2J A;  1ZLA A;  3KUY B;  5AV5 A;  2RIQ A;  3AV2 A;  4KUD B;  1P3M B;  4UUZ A;  3VH6 W;  4YM6 A;  5B24 D;  3AZF D;  4H9R A;  5B1L D;  5CPK D;  1U35 B;  3AV1 B;  4Z5T B;  3KUY C;  1B6W A;  4KUD C;  3LEL A;  1M19 B;  3REI B;  4LD9 C;  5B0Y C;  3X1U C;  3WKJ B;  3W99 D;  1U35 C;  1M1A D;  5JRG D;  2RVQ C;  4KHA B;  4Z5T C;  4XUJ D;  4NFT A;  4JJN D;  3AV1 C;  1TAF B;  3MNN D;  5B0Z B;  2Y2G A;  5B24 A;  3VH6 A;  3AZF A;  3WAA D;  5B1L A;  5CPK A;  4R8P D;  1P3I B;  2FJ7 D;  5AV8 D;  3WKJ C;  1P34 D;  4J8U D;  5BO0 B;  5B0Z C;  3KFU G;  3KWQ B;  4WNN A;  3W99 A;  1P3P D;  1M1A A;  5JRG A;  4XUJ A;  4JJN A;  3X1T D;  3MGP C;  3W97 C;  3MNN A;  3H0M C;  2JSS A;  4R8P A;  3KWQ C;  2FJ7 A;  1A7W A;  2CV5 B;  5AV8 A;  3NQJ B;  1H3O B;  3UT9 C;  1P34 A;  2NZD D;  4WJ3 C;  2DF4 C;  5B40 D;  2Y2P A;  4J8U A;  5GT3 C;  5F99 C;  2HIO C;  3AZL D;  3C1C C;  1P3P A;  1S32 B;  3X1T A;  5FUG B;  3X1S B;  4QLC B;  4KUD D;  5JA4 B;  5GXQ B;  4LD9 D;  5AV6 B;  5B0Y D;  3X1U D;  1S32 C;  5B40 A;  2RVQ D;  3C1B B;  3X1S C;  4QLC C;  3AZL A;  1ZLA B;  1BFM A;  5AV5 B;  2PYO B;  5AV6 C;  4UUZ B;  4YM6 B;  3WKJ D;  4KUD A;  3C1B C;  4H9R B;  3AZH A;  1ZLA C;  5B0Z D;  4LD9 A;  5B0Y A;  3X1U A;  2UWX A;  5C3I B;  2PYO C;  3REJ B;  4YM6 C;  3W97 D;  3MGP D;  1P3A C;  5CPJ C;  5AVC D;  5CP6 C;  3B0C T;  4KGC C;  2Y2H A;  3WKJ A;  5B24 B;  3UT9 D;  5B1M D;  3REJ C;  5B32 A;  3AZF B;  5GT3 D;  5B0Z A;  5G49 A;  2HIO D;  5F99 D;  3LZ0 D;  3C1C D;  3WTP E;  3UTA A;  2XD5 A;  3W97 A;  5B24 C;  3MGP A;  3AZF C;  2CWE A;  4WNN B;  3AZJ C;  1M1A B;  3W99 B;  5AVC A;  5JRG B;  3AZE C;  4JJN B;  1P3K C;  4H9P A;  2HUE C;  3MNN B;  3UT9 A;  5B1M A;  3UTB C;  3LZ1 C;  1T3U A;  5GT3 A;  3X1S D;  4R8P B;  2FJ7 B;  5F99 A;  2HIO A;  4QLC D;  5AV8 B;  3LZ0 A;  4G92 B;  1P34 B;  3C1C A;  4J8U B;  5AV6 D;  3MNN C;  5DNM B;  4NE3 A;  2Y2N A;  4R8P C;  1P3P B;  2FJ7 C;  3AN2 D;  4CAY A;  5AV8 C;  4G92 C;  3X1T B;  1P34 C;  2Y2J A;  4WU9 D;  2W8S A;  2PYO D;  5FUG A;  5DNM C;  1WWI A;  3EG5 B;  4M6B A;  3W98 B;  1P3A D;  5CPJ D;  5AVB C;  5B40 B;  3X1T C;  5CP6 D;  5AV6 A;  4KGC D;  3AZL B;  3KXB C;  4HGA C;  3REJ D;  2F8N K;  1P3B C;  3F6T A;  2ZM5 A;  3AN2 A;  5BNV A;  3W98 C;  4WU9 A;  5B33 D;  4UPK A;  5B40 C;  2PYO A;  3AZH B;  3AZL C;  3AL0 C;  4CSR A;  4LD9 B;  5B0Y B;  3X1U B;  3VH5 T;  1P3A A;  3AZJ D;  5CPJ A;  3AZE D;  5CP6 A;  5B31 C;  1P3K D;  5CPI D;  3B6F B;  4KGC A;  3UTB D;  3REJ A;  3AZH C;  3LZ1 D;  1P3O B;  2Y2M A;  3LJA B;  4Z2M H;  5B33 A;  4AWL C;  5B32 B;  3B6F C;  5G49 B;  3REH D;  1P3O C;  4WV4 B;  3AZJ A;  3AZE A;  3LJA C;  3UTA B;  1P3K A;  5CPI A;  3MGP B;  3MGS D;  3W97 B;  5B32 C;  3UTB A;  3LZ1 A;  5AVC B;  5DNM D;  4H9P B;  1R4V A;  3UT9 B;  5B1M B;  3UTA C;  5AVB D;  5GT3 B;  2JE5 A;  5F99 B;  2HIO B;  3LZ0 B;  3O62 C;  3KXB D;  3REH A;  3AZM B;  2F8N B;  5AVC C;  1P3B D;  3C1C B;  5AV9 C;  3W98 D;  3MGS A;  5B1M C;  1JFI B;  1HQ3 B;  5DNM A;  3LZ0 C;  4CAY B;  1F1E A;  3AZM C;  2IO5 B;  5B2I A;  3AFA D;  3W96 B;  5AVB A;  4J8W D;  5B31 D;  3KXB A;  1KX4 D;  1Q9C A;  3AZH D;  3WTP D;  1HQ3 C;  1P3B A;  3REL C;  3W98 A;  1TZY C;  2IO5 C;  3W96 C;  3B6F D;  3AN2 B;  5BNV B;  4WU9 B;  3P5J B;  1P3O D;  2ARO A;  3AFA A;  3MGR C;  3LJA D;  5B31 A;  4J8W A;  3AZN C;  2F8N H;  3V9R B;  1ULY A;  4ZBJ B;  4CSR B;  5GT0 B;  5B32 D;  1KX4 A;  3WTP A;  3AN2 C;  1P3A B;  2BG1 A;  2ZY4 A;  5CPJ B;  1KU5 A;  5CP6 B;  4NE5 A;  4WU9 C;  4H9S C;  3X1V C;  4KGC B;  5AY8 D;  1WWS A;  5BS7 A;  3UTA D;  3B6F A;  4ZBJ C;  5GT0 C;  5BNX A;  2XD1 A;  3AYW D;  3AZG D;  1N1J A;  3O62 D;  5B33 B;  4DRA A;  1P3O A;  3EPK A;  3AZI C;  1AOI C;  3LJA A;  5AV9 D;  2J8P A;  3MGQ D;  4H9O A;  3AZJ B;  4XZQ A;  3AZE B;  5E5A C;  3AZM D;  2HUE B;  5B33 C;  5CPI B;  1P3K B;  2F8N D;  5AY8 A;  2ZY3 A;  4X23 D;  4J8X B;  2NQB D;  3KSY A;  3UTB B;  3LZ1 B;  2L5A A;  3AYW A;  3AZG A;  3O62 A;  3H0R C;  1HTA A;  3REK D;  1HQ3 D;  3MVD C;  3REL D;  3WA9 B;  5CPI C;  5AV9 A;  4J8X C;  1TZY D;  4E44 A;  3MGQ A;  3REH B;  3W96 D;  3EPH A;  2LY8 A;  3B6G C;  2F8N A;  3AZM A;  2NZD A;  2NQB A;  2Y2I A;  3MGS B;  1EQZ B;  4X23 A;  4G91 C;  3WA9 C;  3MGR D;  3AZN D;  3REH C;  4Z66 D;  5B2I B;  3REK A;  1JFI A;  1HQ3 A;  3REL A;  5AVB B;  1EQZ C;  3A6N C;  3MGS C;  3X1V D;  1TZY A;  2VQR A;  3KXB B;  3W96 A;  2YFW A;  5B31 G;  4HGA B;  1P3B B;  3IP4 C;  5GT0 D;  5B2I C;  5GSU D;  4DQY B;  3AZI D;  1AOI D;  3MGR A;  3AZN A;  1KX3 D;  4Z66 A;  4YS3 C;  1P3G C;  2ARO B;  4DRB A;  3AFA B;  1KX5 C;  3TU4 C;  4J8W B;  5E5A D;  5B31 B;  1M18 C;  4H9S A;  3X1V A;  2BYK A;  1KX4 B;  3WTP B;  4H9N B;  3V9R A;  5B32 G;  5GT0 A;  5GSU A;  2ARO C;  3AFA C;  4AWL B;  3NQU A;  4J8W C;  3MVD D;  3AZI A;  1ID3 C;  1AOI A;  2FFF B;  1KX3 A;  5BNX B;  1PZR A;  4J8X D;  1KX4 C;  1N1J B;  3WTP C;  3AZK B;  1F66 B;  4E45 A;  3B6G D;  5E5A A;  5BS7 C;  4J8V D;  3WA9 D;  4H9O B;  1BH8 A;  4XZQ B;  2Y2K A;  1P3F C;  5KDM B;  5AY8 B;  3AZK C;  1F66 C;  2F8N G;  3MVD A;  3FDD A;  1EQZ D;  3A6N D; 
#chains in the Genus database with same CATH homology
 4J8X A;  3AYW B;  3AZG B;  3O62 B;  3B0D B;  4XZQ C;  3B6G A;  5AY8 C;  5AV9 B;  5B2I D;  4J8V A;  3MGQ B;  1P3M C;  3WA9 A;  3AYW C;  3AZG C;  2NZD B;  2NQB B;  3B0D C;  5BT1 C;  4X23 B;  4YS3 D;  2F2A C;  1P3G D;  3VH6 T;  4WU8 B;  1KX5 D;  3TU4 D;  1EQZ A;  3A6N A;  1M18 D;  3EPJ A;  3MGQ C;  2ZY2 A;  2BYM A;  1M19 C;  3REI C;  3REK B;  2NZD C;  3B0B A;  3REL B;  1P3L B;  2NQB C;  4X23 C;  4ZUX D;  1TZY B;  2G5H C;  2ARO D;  4WU8 C;  2YFW B;  1ID3 D;  2YFV B;  5DNN D;  2Y2L A;  3REK C;  1P3I C;  4YS3 A;  1P3L C;  1P3G A;  1KX5 A;  3R45 A;  3MGR B;  2Y2Q A;  3TU4 A;  3AZN B;  1M18 A;  4Z66 B;  3WAA A;  1P3F D;  4ZUX A;  3X1V B;  3AZK D;  2BYK B;  1F66 D;  3B0C W;  1ID3 A;  5DNN A;  4Z66 C;  5GSU B;  1BH9 A;  4H9N A;  3NQU B;  4XZQ D;  2CV5 C;  3AZI B;  3KUY D;  1AOI B;  2ZY5 A;  1KX3 B;  1P3M D;  3EPL A;  4NE6 A;  5CHL B;  5GSU C;  5E5A B;  1P3F A;  1U35 D;  5BT1 D;  3AZK A;  1F66 A;  3AV1 D;  4Z5T D;  1KX3 C;  5B2J B;  1BH8 B;  3AV2 B;  1M19 D;  5GXQ C;  4H9Q A;  3REI D;  3MVD B;  3KUY A;  5KDM A;  4WU8 D;  1P3M A;  5B2J C;  3B6G B;  1W2E A;  5AV5 C;  3AV2 C;  1U35 A;  4J8V B;  1P3I D;  4G91 B;  3H0L C;  3AV1 A;  4Z5T A;  3LEL B;  1P3L D;  2G5I C;  1M19 A;  4Z2M G;  4EO5 B;  3REI A;  3KWQ D;  5C3I C;  3A6N B;  4J8V C;  4KHA A;  2BYM B;  3LEL C;  1B67 A;  4WU8 A;  1TAF A;  5B1L B;  2DQN C;  5CPK B;  4EO5 C;  1P3I A;  1P3L A;  2CV5 D;  5BO0 A;  5B1L C;  5CPK C;  4XUJ B;  2YFV A;  4YS3 B;  3KWQ A;  1P3G B;  1KX5 B;  3R45 B;  3TU4 B;  3VH5 W;  1M18 B;  1S32 D;  3WAA B;  4WZS B;  3W99 C;  1M1A C;  5JRG C;  4ZUX B;  4XUJ C;  4JJN C;  5GXQ D;  2CV5 A;  3NQJ A;  1H3O A;  1ID3 B;  5DNN B;  1Z2C B;  3WAA C;  3C1B D;  1BH9 B;  5B2J D;  1ZLA D;  2JCH A;  5AV5 D;  4ZUX C;  3AV2 D;  4J8U C;  1S32 A;  2Y2O A;  3VH5 A;  4YM6 D;  3X1S A;  5DNN C;  4QLC A;  1P3P C;  1P3F B;  5JA4 A;  5GXQ A;  3A1K A;  3A1I A;  3C1B A;  3LEL D;  4H9Q B;  5B2J A;  1ZLA A;  3KUY B;  5AV5 A;  2RIQ A;  3AV2 A;  4KUD B;  1P3M B;  4UUZ A;  3VH6 W;  4YM6 A;  5B24 D;  3AZF D;  4H9R A;  5B1L D;  5CPK D;  1U35 B;  3AV1 B;  4Z5T B;  3KUY C;  1B6W A;  4KUD C;  3LEL A;  1M19 B;  3REI B;  4LD9 C;  5B0Y C;  3X1U C;  3WKJ B;  3W99 D;  1U35 C;  1M1A D;  5JRG D;  2RVQ C;  4KHA B;  4Z5T C;  4XUJ D;  4NFT A;  4JJN D;  3AV1 C;  1TAF B;  3MNN D;  5B0Z B;  2Y2G A;  5B24 A;  3VH6 A;  3AZF A;  3WAA D;  5B1L A;  5CPK A;  4R8P D;  1P3I B;  2FJ7 D;  5AV8 D;  3WKJ C;  1P34 D;  4J8U D;  5BO0 B;  5B0Z C;  3KFU G;  3KWQ B;  4WNN A;  3W99 A;  1P3P D;  1M1A A;  5JRG A;  4XUJ A;  4JJN A;  3X1T D;  3MGP C;  3W97 C;  3MNN A;  3H0M C;  2JSS A;  4R8P A;  3KWQ C;  2FJ7 A;  1A7W A;  2CV5 B;  5AV8 A;  3NQJ B;  1H3O B;  3UT9 C;  1P34 A;  2NZD D;  4WJ3 C;  2DF4 C;  5B40 D;  2Y2P A;  4J8U A;  5GT3 C;  5F99 C;  2HIO C;  3AZL D;  3C1C C;  1P3P A;  1S32 B;  3X1T A;  5FUG B;  3X1S B;  4QLC B;  4KUD D;  5JA4 B;  5GXQ B;  4LD9 D;  5AV6 B;  5B0Y D;  3X1U D;  1S32 C;  5B40 A;  2RVQ D;  3C1B B;  3X1S C;  4QLC C;  3AZL A;  1ZLA B;  1BFM A;  5AV5 B;  2PYO B;  5AV6 C;  4UUZ B;  4YM6 B;  3WKJ D;  4KUD A;  3C1B C;  4H9R B;  3AZH A;  1ZLA C;  5B0Z D;  4LD9 A;  5B0Y A;  3X1U A;  2UWX A;  5C3I B;  2PYO C;  3REJ B;  4YM6 C;  3W97 D;  3MGP D;  1P3A C;  5CPJ C;  5AVC D;  5CP6 C;  3B0C T;  4KGC C;  2Y2H A;  3WKJ A;  5B24 B;  3UT9 D;  5B1M D;  3REJ C;  5B32 A;  3AZF B;  5GT3 D;  5B0Z A;  5G49 A;  2HIO D;  5F99 D;  3LZ0 D;  3C1C D;  3WTP E;  3UTA A;  2XD5 A;  3W97 A;  5B24 C;  3MGP A;  3AZF C;  2CWE A;  4WNN B;  3AZJ C;  1M1A B;  3W99 B;  5AVC A;  5JRG B;  3AZE C;  4JJN B;  1P3K C;  4H9P A;  2HUE C;  3MNN B;  3UT9 A;  5B1M A;  3UTB C;  3LZ1 C;  1T3U A;  5GT3 A;  3X1S D;  4R8P B;  2FJ7 B;  5F99 A;  2HIO A;  4QLC D;  5AV8 B;  3LZ0 A;  4G92 B;  1P34 B;  3C1C A;  4J8U B;  5AV6 D;  3MNN C;  5DNM B;  4NE3 A;  2Y2N A;  4R8P C;  1P3P B;  2FJ7 C;  3AN2 D;  4CAY A;  5AV8 C;  4G92 C;  3X1T B;  1P34 C;  2Y2J A;  4WU9 D;  2W8S A;  2PYO D;  5FUG A;  5DNM C;  1WWI A;  3EG5 B;  4M6B A;  3W98 B;  1P3A D;  5CPJ D;  5AVB C;  5B40 B;  3X1T C;  5CP6 D;  5AV6 A;  4KGC D;  3AZL B;  3KXB C;  4HGA C;  3REJ D;  2F8N K;  1P3B C;  3F6T A;  2ZM5 A;  3AN2 A;  5BNV A;  3W98 C;  4WU9 A;  5B33 D;  4UPK A;  5B40 C;  2PYO A;  3AZH B;  3AZL C;  3AL0 C;  4CSR A;  4LD9 B;  5B0Y B;  3X1U B;  3VH5 T;  1P3A A;  3AZJ D;  5CPJ A;  3AZE D;  5CP6 A;  5B31 C;  1P3K D;  5CPI D;  3B6F B;  4KGC A;  3UTB D;  3REJ A;  3AZH C;  3LZ1 D;  1P3O B;  2Y2M A;  3LJA B;  4Z2M H;  5B33 A;  4AWL C;  5B32 B;  3B6F C;  5G49 B;  3REH D;  1P3O C;  4WV4 B;  3AZJ A;  3AZE A;  3LJA C;  3UTA B;  1P3K A;  5CPI A;  3MGP B;  3MGS D;  3W97 B;  5B32 C;  3UTB A;  3LZ1 A;  5AVC B;  5DNM D;  4H9P B;  1R4V A;  3UT9 B;  5B1M B;  3UTA C;  5AVB D;  5GT3 B;  2JE5 A;  5F99 B;  2HIO B;  3LZ0 B;  3O62 C;  3KXB D;  3REH A;  3AZM B;  2F8N B;  5AVC C;  1P3B D;  3C1C B;  5AV9 C;  3W98 D;  3MGS A;  5B1M C;  1JFI B;  1HQ3 B;  5DNM A;  3LZ0 C;  4CAY B;  1F1E A;  3AZM C;  2IO5 B;  5B2I A;  3AFA D;  3W96 B;  5AVB A;  4J8W D;  5B31 D;  3KXB A;  1KX4 D;  1Q9C A;  3AZH D;  3WTP D;  1HQ3 C;  1P3B A;  3REL C;  3W98 A;  1TZY C;  2IO5 C;  3W96 C;  3B6F D;  3AN2 B;  5BNV B;  4WU9 B;  3P5J B;  1P3O D;  2ARO A;  3AFA A;  3MGR C;  3LJA D;  5B31 A;  4J8W A;  3AZN C;  2F8N H;  3V9R B;  1ULY A;  4ZBJ B;  4CSR B;  5GT0 B;  5B32 D;  1KX4 A;  3WTP A;  3AN2 C;  1P3A B;  2BG1 A;  2ZY4 A;  5CPJ B;  1KU5 A;  5CP6 B;  4NE5 A;  4WU9 C;  4H9S C;  3X1V C;  4KGC B;  5AY8 D;  1WWS A;  5BS7 A;  3UTA D;  3B6F A;  4ZBJ C;  5GT0 C;  5BNX A;  2XD1 A;  3AYW D;  3AZG D;  1N1J A;  3O62 D;  5B33 B;  4DRA A;  1P3O A;  3EPK A;  3AZI C;  1AOI C;  3LJA A;  5AV9 D;  2J8P A;  3MGQ D;  4H9O A;  3AZJ B;  4XZQ A;  3AZE B;  5E5A C;  3AZM D;  2HUE B;  5B33 C;  5CPI B;  1P3K B;  2F8N D;  5AY8 A;  2ZY3 A;  4X23 D;  4J8X B;  2NQB D;  3KSY A;  3UTB B;  3LZ1 B;  2L5A A;  3AYW A;  3AZG A;  3O62 A;  3H0R C;  1HTA A;  3REK D;  1HQ3 D;  3MVD C;  3REL D;  3WA9 B;  5CPI C;  5AV9 A;  4J8X C;  1TZY D;  4E44 A;  3MGQ A;  3REH B;  3W96 D;  3EPH A;  2LY8 A;  3B6G C;  2F8N A;  3AZM A;  2NZD A;  2NQB A;  2Y2I A;  3MGS B;  1EQZ B;  4X23 A;  4G91 C;  3WA9 C;  3MGR D;  3AZN D;  3REH C;  4Z66 D;  5B2I B;  3REK A;  1JFI A;  1HQ3 A;  3REL A;  5AVB B;  1EQZ C;  3A6N C;  3MGS C;  3X1V D;  1TZY A;  2VQR A;  3KXB B;  3W96 A;  2YFW A;  5B31 G;  4HGA B;  1P3B B;  3IP4 C;  5GT0 D;  5B2I C;  5GSU D;  4DQY B;  3AZI D;  1AOI D;  3MGR A;  3AZN A;  1KX3 D;  4Z66 A;  4YS3 C;  1P3G C;  2ARO B;  4DRB A;  3AFA B;  1KX5 C;  3TU4 C;  4J8W B;  5E5A D;  5B31 B;  1M18 C;  4H9S A;  3X1V A;  2BYK A;  1KX4 B;  3WTP B;  4H9N B;  3V9R A;  5B32 G;  5GT0 A;  5GSU A;  2ARO C;  3AFA C;  4AWL B;  3NQU A;  4J8W C;  3MVD D;  3AZI A;  1ID3 C;  1AOI A;  2FFF B;  1KX3 A;  5BNX B;  1PZR A;  4J8X D;  1KX4 C;  1N1J B;  3WTP C;  3AZK B;  1F66 B;  4E45 A;  3B6G D;  5E5A A;  5BS7 C;  4J8V D;  3WA9 D;  4H9O B;  1BH8 A;  4XZQ B;  2Y2K A;  1P3F C;  5KDM B;  5AY8 B;  3AZK C;  1F66 C;  2F8N G;  3MVD A;  3FDD A;  1EQZ D;  3A6N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...