3WTPD

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpD00
2BYKB 3VH6W 3MGQA 3AZKA 3AZMC 1M1AA 4R8PC 1P3AC 3X1SC 3AZLC 3A6NC 4J8VD 3MGRD 2YFVA 3O62B 3B0BA 4CSRA 5B40B 4H9NA 5GT0C 1P3KD 4Z5TD 5G49A 4G92B 1P3FC 5B32C 3REJD 1EQZC 3V9RB 1TAFB 3W96A 3UT9A 3MNNB 1P3ID 3AZNC 3RELB 5AY8B 4AWLB 5GSUC 4ZUXA 3B0CT 4J8WC 3WA9A 3KXBB 2FJ7D 3B6FC 3W97C 5F99A 3NQJA 3LZ1D 4ZBJB 2AROB 5CP6A 1P3PC 5B2JA 3C1BD 1HTAA 3LJAB 3KUYD 3O62C 5B40C 5DNNC 1F1EA 3REHA 4YM6A 4WNNA 5B33C 4QLCD 3AZHD 4H9PA 1P3BB 3B6GA 3X1TB 5AV8D 5AV5C 1U35A 5AV6A 3X1UA 3AFAD 4JJNB 3LELD 3MGPA 4KUDA 3MNNC 4YS3D 3RELC 3AYWA 2F8NK 5CPKB 2RVQD 5AY8C 4AWLC 4KGCA 4XZQA 3R45B 3REKD 1P3LD 1AOID 4H9QA 5BT1C 3MGSD 1F66D 1S32B 2JSSA 3AZMA 4ZBJC 2AROC 3REID 1P3AA 3X1SA 5CPIC 1KX5D 3AZLA 3A6NA 5KDMB 3LJAC 3LZ0B 5GT0A 3MGQD 3TU4B 3AZFC 3AZKD 2CV5D 1P3BC 2NQBB 1ZLAC 5DNMD 3X1TC 1P3FA 3WKJD 5B32A 4JJNC 1EQZA 2BYMA 1KX4B 3AZNA 5B1LB 3AZIB 5CPKC 1M18D 4KUDB 4H9SC 4J8WA 1WWIA 3B6FA 5FUGB 3W97A 1S32C 2BYKA 5GT3B 1KX3B 5AVBD 3WAAB 1P3OB 4ZUXD 3AZJC 4R8PB 3WA9D 3X1SB 3O62A 5B40A 5AVCB 2HIOD 3LZ0C 4XUJB 5F99D 3TU4C 5B33A 2NQBC 1HQ3C 3WTPD 5AV5A 5CP6D 4X23B 4Z66B 5GXQC 5B2JD 3NQUB 5BNXB 4H9OB 1TAFA 3V9RA 4WU8B 3MNNA 1KX4C 3RELA 5C3IB 5B1LC 3REHD 5AY8A 3AN2D 3B6GD 5B24C 1U35D 5AV6D 3X1UD 5GSUB 2HUEB 3VH5T 5E5AB 1KX3C 3W99B 3AYWD 1BH8B 2AROA 3WAAC 1P3OC 5CPIA 4XZQD 1B6WA 5B2ID 1P3PB 3LJAA 4WU9C 5AVCC 4XUJC 3KWQC 1P3BA 3AZMD 1ZLAA 4KHAB 3X1TA 5DNNB 4X23C 4Z66C 3AV1B 1P3AD 2F8ND 5B33B 3AZLD 2PYOD 3A6ND 4JJNA 5AV5B 4WU8C 1H3OB 4J8UB 5C3IC 5GT0D 5CPKA 3R45A 5B32D 3KUYB 2HUEC 1S32A 5E5AC 3AZND 3W99C 4E45A 5B1MD 3C1CB 5KDMA 4J8WD 3UTBD 1P3MD 5CPIB 1P3IC 3LZ0A 3W97D 3TU4A 3REKB 2NQBA 1HQ3A 3AV1C 5CPJB 3AZFB 5B31G 3MVDB 1ZLAB 3AZEB 2LY8A 3O62D 1KX4A 3B0DB 5B40D 4J8UC 1R4VA 5B1LA 3AZIA 2NZDB 5AV9D 3KUYC 1P3GD 5FUGA 3AZHC 4QLCC 2CV5B 5GT3A 1KX3A 3WKJB 1P34D 3C1CC 5B31B 3UTAB 5AY8D 1P3OA 3WAAA 3LELC 3AZGB 5BT1D 5CHLB 4R8PA 3KXBD 5JA4B 4YS3C 4LD9B 5AVCA 3AZJB 1M18B 4XUJA 3KWQA 3REKC 1TZYD 3X1VB 1P3LC 4X23A 1M19B 4Z66A 5CPJC 3NQUA 5BNXA 3MVDC 1HQ3B 1F66C 3AZEC 4H9OA 5GXQB 3LJAD 4WU8A 1M1AD 5BS7C 3B0DC 5AVBB 5JRGB 4EO5B 3REIC 2NZDC 3VH6T 3X1TD 5GSUA 4JJND 4NFTA 2HIOB 5B24B 2CV5C 3WTPB 5E5AA 5DNMC 3WKJC 3W99A 1BH8A 2YFWB 5B31C 4J8XB 3UTAC 5B0YB 5CPKD 3UT9D 1ID3B 3W96D 3B0CW 3AV2B 4Z2MH 3W98B 3AZGC 1P3PA 3VH5A 1Q9CA 1P3IA 4LD9C 5B0ZB 1S32D 1M18C 4WU9B 3X1VC 4KHAA 5DNNA 1M19C 3AV1A 2CWEA 3KWQB 4DRAA 2F8NG 4G91B 1H3OA 5AVBC 5JRGC 4J8UA 4M6BA 3LZ0D 4EO5C 3TU4D 2NQBD 5B2IB 4Z2MG 2IO5B 3KUYA 4YM6D 1BH9B 2HIOC 4J8VB 3MGRB 3AZHA 1KX4D 3WTPC 5CP6C 3AZID 3C1CA 5B2JC 4J8XC 1ID3C 5B0YC 3MGPD 4Z5TB 1P3KB 4NE6A 2PYOB 4KUDD 3AV2C 3W98C 3REJB 4KGCD 4YS3A 5B0ZC 5GT3D 3AN2C 3REKA 1KX3D 1P3LA 1P3IB 3WAAD 3KSYA 3AZFA 5CPJA 3MVDA 1F66A 4HGAB 3AZEA 4R8PD 4G91C 3X1SD 1JFIB 4CAYB 5BS7A 2FJ7B 5B1MB 5AVCD 2NZDA 3LZ1B 5B2IC 4H9RA 2IO5C 3UTBB 3C1BB 1P3FD 4J8VC 4WU8D 3MGRC 4H9SA 2CV5A 5DNMA 3WKJA 4E44A 1EQZD 5B31A 3UTAA 3AZHB 4QLCB 4Z5TC 1P3KC 2PYOC 5AV8B 3AZGA 5GSUD 3REJC 5JA4A 3AFAB 4LD9A 2L5AA 5BNVB 3LELB 3AZJA 1M18A 5E5AD 3X1VA 3B6FD 3W99D 4YS3B 5BO0B 5AV9B 1M19A 1P3GB 1P3LB 4HGAC 1P3PD 5GXQA 1AOIB 3MGSB 1P34B 5AVBA 5JRGA 2FJ7C 5B1MC 1F66B 3LZ1C 5DNND 3AV1D 3REIB 3UTBC 1P3MC 5B33D 1KX5B 3C1BC 2HIOA 5AV5D 5B24A 4H9RB 1TZYB 1ULYA 4UUZA 3WTPA 4J8UD 2YFWA 3VH6A 4J8XA 1ID3A 5B0YA 3MGQB 3AZKB 3MNND 5DNMB 3AV2A 3W98A 5AV8C 3RELD 1M1AB 3VH5W 3AFAC 5B0ZA 2YFVB 3AN2A 4G92C 4CSRB 4WU9A 5AV9C 3C1CD 4H9NB 1P3GC 1A7WA 2RVQC 5G49B 2AROD 1AOIC 5CPID 3MGSC 1P34C 4WZSB 3W96B 3UT9B 5B2IA 1KU5A 5CPJD 3AZFD 3KXBC 1BH9A 4ZUXB 3MVDD 1P3BD 1KX5C 1ZLAD 3AZED 4J8VA 4NE5A 3MGRA 3WA9B 1TZYC 2F8NH 2NZDD 2F8NA 5F99B 3NQJB 3MGQC 1P3KA 4Z5TA 3AZKC 2PYOA 4UUZB 5CP6B 1M1AC 4DRBA 5B2JB 3REJA 1N1JA 1WWSA 5B31D 3UTAD 3REHB 4YM6B 4WNNB 4H9PB 3AN2B 3B6GB 1U35B 3AZGD 5AV6B 3X1UB 1JFIA 4CAYA 2FJ7A 4LD9D 5B1MA 4WV4B 3AZJD 3W96C 3MGPB 3UT9C 3X1VD 3LZ1A 3AYWB 1M19D 1BFMA 3UTBA 1P3MA 4KGCB 4XZQB 4ZUXC 1HQ3D 3C1BA 5GXQD 4H9QB 3WA9C 5B32G 5JRGD 5F99C 1B67A 4QLCA 3AZMB 5AV8A 5B1LD 1P3AB 2F8NB 3AFAA 3AZLB 3A6NB 5BNVA 5B24D 3LELA 5BO0A 5AV9A 5GT0B 4J8XD 1ID3D 1N1JB 5B0YD 4YM6C 3WTPE 3REHC 1P3GA 3B6GC 3AV2D 1P3FB 3W98D 5B32B 4NE3A 1U35C 1P3OD 5AV6C 3X1UC 1AOIA 3MGSA 1P34A 5B0ZD 3AZIC 1EQZB 2BYMB 3MGPC 4KUDC 4WU9D 3AZNB 3AYWC 3REIA 4XUJD 3KXBA 3KWQD 4KGCC 4XZQC 1KX5A 4X23D 4Z66D 4J8WB 5GT3C 1P3MB 1TZYA 3B6FB 3W97B
chains in the Genus database with same CATH superfamily
2BYKB 3VH6W 3MGQA 3AZKA 3AZMC 1M1AA 2XD5A 4R8PC 1P3AC 3X1SC 3AZLC 3A6NC 2XD1A 4J8VD 3MGRD 2YFVA 2JCHA 3O62B 3B0BA 4CSRA 5B40B 3P5JB 4H9NA 5GT0C 1P3KD 4Z5TD 5G49A 4G92B 1P3FC 5B32C 3EPJA 3REJD 3H0MC 1EQZC 3V9RB 1TAFB 3W96A 3UT9A 3MNNB 1P3ID 3AZNC 3RELB 5AY8B 4AWLB 5GSUC 4ZUXA 3B0CT 4J8WC 3WA9A 3KXBB 2FJ7D 3B6FC 3W97C 5F99A 3NQJA 2G5HC 3LZ1D 4ZBJB 2AROB 5CP6A 1P3PC 5B2JA 3C1BD 1HTAA 3LJAB 3KUYD 3O62C 5B40C 5DNNC 1F1EA 3REHA 4YM6A 4WNNA 5B33C 4QLCD 3AZHD 4H9PA 1P3BB 3B6GA 3X1TB 5AV8D 5AV5C 1U35A 5AV6A 3X1UA 3AFAD 4JJNB 3LELD 3IP4C 3MGPA 3MNNC 4KUDA 4YS3D 3RELC 3AYWA 2F8NK 5CPKB 2RVQD 5AY8C 4AWLC 4KGCA 4XZQA 3R45B 3REKD 1P3LD 2Y2QA 1AOID 4H9QA 5BT1C 3MGSD 1F66D 1S32B 2JSSA 3AZMA 4ZBJC 2AROC 3REID 1P3AA 3X1SA 5CPIC 1KX5D 3AZLA 1W2EA 3A6NA 5KDMB 3FDDA 3LJAC 3EPLA 3LZ0B 5GT0A 3MGQD 3TU4B 3AZFC 3AZKD 2CV5D 1P3BC 2NQBB 1ZLAC 5DNMD 3X1TC 1P3FA 3WKJD 5B32A 4JJNC 1EQZA 2ZY3A 2BYMA 1KX4B 3AZNA 5B1LB 3AZIB 2Y2PA 5CPKC 1M18D 2Y2KA 4KUDB 4H9SC 4J8WA 1WWIA 3B6FA 2W8SA 5FUGB 3W97A 1S32C 2ZY5A 2BYKA 5GT3B 1KX3B 5AVBD 3WAAB 1P3OB 4ZUXD 3AZJC 4R8PB 3WA9D 3X1SB 3O62A 5B40A 5AVCB 2HIOD 3LZ0C 4XUJB 5F99D 3TU4C 5B33A 2NQBC 1HQ3C 3WTPD 5AV5A 5CP6D 4X23B 4Z66B 5GXQC 5B2JD 3NQUB 5BNXB 4WJ3C 4H9OB 1TAFA 3V9RA 4WU8B 3MNNA 1KX4C 3RELA 5C3IB 5B1LC 3REHD 2ZY4A 5AY8A 3AN2D 3B6GD 5B24C 1U35D 5AV6D 3X1UD 5GSUB 2HUEB 3VH5T 5E5AB 1KX3C 3W99B 3AYWD 1BH8B 2AROA 3WAAC 1P3OC 5CPIA 2J8PA 4XZQD 1B6WA 5B2ID 1P3PB 3LJAA 2JE5A 4WU9C 2DQNC 5AVCC 4XUJC 3KWQC 1P3BA 3AZMD 1ZLAA 4KHAB 2F2AC 5DNNB 4X23C 3X1TA 4Z66C 3AV1B 1P3AD 2F8ND 5B33B 3AZLD 2PYOD 3A6ND 4JJNA 5AV5B 4WU8C 1H3OB 4J8UB 5C3IC 5GT0D 5CPKA 3R45A 5B32D 2ZY2A 3KUYB 2HUEC 1S32A 5E5AC 3AZND 3W99C 4E45A 5B1MD 3C1CB 5KDMA 4J8WD 3UTBD 1P3MD 5CPIB 1P3IC 3LZ0A 3W97D 3TU4A 3REKB 2NQBA 1HQ3A 2Y2HA 3AV1C 5CPJB 3AZFB 5B31G 3MVDB 1ZLAB 3AZEB 2LY8A 3O62D 1KX4A 3B0DB 5B40D 4J8UC 1R4VA 5B1LA 3AZIA 2NZDB 5AV9D 2Y2OA 3KUYC 1P3GD 5FUGA 3AZHC 2UWXA 4QLCC 2CV5B 5GT3A 1KX3A 3WKJB 1P34D 3C1CC 5B31B 3UTAB 5AY8D 3EPKA 1P3OA 3WAAA 3LELC 3EPHA 3AZGB 5BT1D 5CHLB 4R8PA 3KXBD 5JA4B 4YS3C 4LD9B 5AVCA 3AZJB 1M18B 4XUJA 3KWQA 2Y2GA 3REKC 1TZYD 3X1VB 1P3LC 4X23A 1M19B 4Z66A 3H0RC 5CPJC 3NQUA 5BNXA 3MVDC 1HQ3B 1F66C 1PZRA 3AZEC 4H9OA 5GXQB 3LJAD 4WU8A 1M1AD 5BS7C 3B0DC 5AVBB 5JRGB 4EO5B 3REIC 2NZDC 3VH6T 3X1TD 5GSUA 4JJND 4NFTA 2HIOB 5B24B 2CV5C 3WTPB 5E5AA 5DNMC 3WKJC 3A1IA 3W99A 1BH8A 2YFWB 5B31C 4J8XB 3UTAC 2DF4C 5B0YB 3UT9D 5CPKD 1ID3B 3W96D 3B0CW 3AV2B 4Z2MH 3W98B 3AZGC 1P3PA 3VH5A 1Q9CA 1P3IA 4LD9C 5B0ZB 1S32D 1M18C 4WU9B 3X1VC 4KHAA 5DNNA 1M19C 3AV1A 2CWEA 3KWQB 4DRAA 2F8NG 4G91B 1H3OA 5AVBC 5JRGC 4J8UA 4M6BA 3LZ0D 4EO5C 3TU4D 2NQBD 5B2IB 4Z2MG 2IO5B 3KUYA 4YM6D 1BH9B 2RIQA 2HIOC 4J8VB 3MGRB 3AZHA 1KX4D 3WTPC 1Z2CB 5CP6C 3AZID 3C1CA 5B2JC 4J8XC 1ID3C 5B0YC 3MGPD 4Z5TB 1P3KB 4NE6A 2PYOB 4KUDD 3AV2C 3W98C 3REJB 4KGCD 4YS3A 5B0ZC 2BG1A 5GT3D 3AN2C 3REKA 1KX3D 1P3LA 1P3IB 3WAAD 3KSYA 3AZFA 5CPJA 3MVDA 1F66A 4HGAB 3AZEA 4R8PD 4G91C 3X1SD 1JFIB 4CAYB 5BS7A 2FJ7B 5B1MB 5AVCD 2NZDA 3LZ1B 5B2IC 4H9RA 2IO5C 3UTBB 3C1BB 2G5IC 1P3FD 4J8VC 4WU8D 3MGRC 4H9SA 2CV5A 5DNMA 3WKJA 4E44A 1EQZD 5B31A 3UTAA 3AZHB 4QLCB 4Z5TC 1P3KC 2PYOC 5AV8B 3H0LC 3AZGA 5GSUD 3REJC 5JA4A 3AFAB 4LD9A 2L5AA 5BNVB 3LELB 3AZJA 1M18A 5E5AD 3X1VA 3B6FD 3W99D 4YS3B 5BO0B 5AV9B 1M19A 1P3GB 3AL0C 1P3LB 4HGAC 1P3PD 5GXQA 1AOIB 3MGSB 1P34B 5AVBA 5JRGA 2FJ7C 5B1MC 1F66B 3LZ1C 5DNND 3AV1D 3REIB 3UTBC 1P3MC 5B33D 2Y2NA 1KX5B 3KFUG 3C1BC 2HIOA 5AV5D 5B24A 4H9RB 1TZYB 1ULYA 4UUZA 3WTPA 4J8UD 2YFWA 3VH6A 4J8XA 1ID3A 5B0YA 3MGQB 3AZKB 3MNND 3A1KA 5DNMB 3AV2A 2FFFB 5AV8C 3RELD 1M1AB 3W98A 3VH5W 3AFAC 5B0ZA 2YFVB 3EG5B 3AN2A 4G92C 4CSRB 4WU9A 5AV9C 3C1CD 4H9NB 1P3GC 1A7WA 2RVQC 5G49B 2VQRA 2AROD 1AOIC 5CPID 3MGSC 4DQYB 1P34C 4WZSB 3W96B 3UT9B 5B2IA 1KU5A 5CPJD 3AZFD 3KXBC 1BH9A 4ZUXB 3MVDD 1P3BD 1KX5C 1ZLAD 3AZED 4J8VA 4NE5A 3MGRA 3WA9B 1TZYC 2Y2JA 2Y2MA 2F8NH 2NZDD 2F8NA 5F99B 3NQJB 3MGQC 1P3KA 4Z5TA 3AZKC 2PYOA 4UUZB 5CP6B 1M1AC 4DRBA 5B2JB 2Y2LA 3REJA 2Y2IA 1N1JA 1WWSA 5B31D 3UTAD 3REHB 4YM6B 4WNNB 4H9PB 3AN2B 3B6GB 1U35B 3AZGD 5AV6B 3X1UB 1JFIA 4CAYA 2FJ7A 4LD9D 5B1MA 4WV4B 3AZJD 3W96C 3MGPB 3UT9C 3X1VD 3LZ1A 3AYWB 1M19D 1BFMA 3UTBA 1P3MA 4KGCB 4XZQB 4ZUXC 1HQ3D 3C1BA 5GXQD 4H9QB 3WA9C 5B32G 5JRGD 5F99C 1B67A 4QLCA 3AZMB 5AV8A 3F6TA 5B1LD 1P3AB 2F8NB 3AFAA 3AZLB 3A6NB 5BNVA 5B24D 3LELA 5BO0A 5AV9A 5GT0B 4J8XD 1ID3D 1N1JB 5B0YD 4YM6C 3WTPE 2ZM5A 3REHC 1P3GA 3B6GC 3AV2D 1P3FB 1T3UA 3W98D 5B32B 4NE3A 1U35C 1P3OD 5AV6C 3X1UC 1AOIA 3MGSA 1P34A 5B0ZD 3AZIC 1EQZB 2BYMB 3MGPC 4KUDC 4WU9D 3AZNB 3AYWC 3REIA 4XUJD 3KXBA 3KWQD 4KGCC 4XZQC 1KX5A 4X23D 4UPKA 4Z66D 4J8WB 5GT3C 1P3MB 1TZYA 3B6FB 3W97B
chains in the Genus database with same CATH topology
2BYKB 3VH6W 3MGQA 3AZKA 3AZMC 1M1AA 2XD5A 4R8PC 1P3AC 3X1SC 3AZLC 3A6NC 2XD1A 4J8VD 3MGRD 2YFVA 2JCHA 3O62B 3B0BA 4CSRA 5B40B 3P5JB 4H9NA 5GT0C 1P3KD 4Z5TD 5G49A 4G92B 1P3FC 5B32C 3EPJA 3REJD 3H0MC 1EQZC 3V9RB 1TAFB 3W96A 3UT9A 3MNNB 1P3ID 3AZNC 3RELB 5AY8B 4AWLB 5GSUC 4ZUXA 3B0CT 4J8WC 3WA9A 3KXBB 2FJ7D 3B6FC 3W97C 5F99A 3NQJA 2G5HC 3LZ1D 4ZBJB 2AROB 5CP6A 1P3PC 5B2JA 3C1BD 1HTAA 3LJAB 3KUYD 3O62C 5B40C 5DNNC 1F1EA 3REHA 4YM6A 4WNNA 5B33C 4QLCD 3AZHD 4H9PA 1P3BB 3B6GA 3X1TB 5AV8D 5AV5C 1U35A 5AV6A 3X1UA 3AFAD 4JJNB 3LELD 3IP4C 3MGPA 3MNNC 4KUDA 4YS3D 3RELC 3AYWA 2F8NK 5CPKB 2RVQD 5AY8C 4AWLC 4KGCA 4XZQA 3R45B 3REKD 1P3LD 2Y2QA 1AOID 4H9QA 5BT1C 3MGSD 1F66D 1S32B 2JSSA 3AZMA 4ZBJC 2AROC 3REID 1P3AA 3X1SA 5CPIC 1KX5D 3AZLA 1W2EA 3A6NA 5KDMB 3FDDA 3LJAC 3EPLA 3LZ0B 5GT0A 3MGQD 3TU4B 3AZFC 3AZKD 2CV5D 1P3BC 2NQBB 1ZLAC 5DNMD 3X1TC 1P3FA 3WKJD 5B32A 4JJNC 1EQZA 2ZY3A 2BYMA 1KX4B 3AZNA 5B1LB 3AZIB 2Y2PA 5CPKC 1M18D 2Y2KA 4KUDB 4H9SC 4J8WA 1WWIA 3B6FA 2W8SA 5FUGB 3W97A 1S32C 2ZY5A 2BYKA 5GT3B 1KX3B 5AVBD 3WAAB 1P3OB 4ZUXD 3AZJC 4R8PB 3WA9D 3X1SB 3O62A 5B40A 5AVCB 2HIOD 3LZ0C 4XUJB 5F99D 3TU4C 5B33A 2NQBC 1HQ3C 3WTPD 5AV5A 5CP6D 4X23B 4Z66B 5GXQC 5B2JD 3NQUB 5BNXB 4WJ3C 4H9OB 1TAFA 3V9RA 4WU8B 3MNNA 1KX4C 3RELA 5C3IB 5B1LC 3REHD 2ZY4A 5AY8A 3AN2D 3B6GD 5B24C 1U35D 5AV6D 3X1UD 5GSUB 2HUEB 3VH5T 5E5AB 1KX3C 3W99B 3AYWD 1BH8B 2AROA 3WAAC 1P3OC 5CPIA 2J8PA 4XZQD 1B6WA 5B2ID 1P3PB 3LJAA 2JE5A 4WU9C 2DQNC 5AVCC 4XUJC 3KWQC 1P3BA 3AZMD 1ZLAA 4KHAB 2F2AC 5DNNB 4X23C 3X1TA 4Z66C 3AV1B 1P3AD 2F8ND 5B33B 3AZLD 2PYOD 3A6ND 4JJNA 5AV5B 4WU8C 1H3OB 4J8UB 5C3IC 5GT0D 5CPKA 3R45A 5B32D 2ZY2A 3KUYB 2HUEC 1S32A 5E5AC 3AZND 3W99C 4E45A 5B1MD 3C1CB 5KDMA 4J8WD 3UTBD 1P3MD 5CPIB 1P3IC 3LZ0A 3W97D 3TU4A 3REKB 2NQBA 1HQ3A 2Y2HA 3AV1C 5CPJB 3AZFB 5B31G 3MVDB 1ZLAB 3AZEB 2LY8A 3O62D 1KX4A 3B0DB 5B40D 4J8UC 1R4VA 5B1LA 3AZIA 2NZDB 5AV9D 2Y2OA 3KUYC 1P3GD 5FUGA 3AZHC 2UWXA 4QLCC 2CV5B 5GT3A 1KX3A 3WKJB 1P34D 3C1CC 5B31B 3UTAB 5AY8D 3EPKA 1P3OA 3WAAA 3LELC 3EPHA 3AZGB 5BT1D 5CHLB 4R8PA 3KXBD 5JA4B 4YS3C 4LD9B 5AVCA 3AZJB 1M18B 4XUJA 3KWQA 2Y2GA 3REKC 1TZYD 3X1VB 1P3LC 4X23A 1M19B 4Z66A 3H0RC 5CPJC 3NQUA 5BNXA 3MVDC 1HQ3B 1F66C 1PZRA 3AZEC 4H9OA 5GXQB 3LJAD 4WU8A 1M1AD 5BS7C 3B0DC 5AVBB 5JRGB 4EO5B 3REIC 2NZDC 3VH6T 3X1TD 5GSUA 4JJND 4NFTA 2HIOB 5B24B 2CV5C 3WTPB 5E5AA 5DNMC 3WKJC 3A1IA 3W99A 1BH8A 2YFWB 5B31C 4J8XB 3UTAC 2DF4C 5B0YB 3UT9D 5CPKD 1ID3B 3W96D 3B0CW 3AV2B 4Z2MH 3W98B 3AZGC 1P3PA 3VH5A 1Q9CA 1P3IA 4LD9C 5B0ZB 1S32D 1M18C 4WU9B 3X1VC 4KHAA 5DNNA 1M19C 3AV1A 2CWEA 3KWQB 4DRAA 2F8NG 4G91B 1H3OA 5AVBC 5JRGC 4J8UA 4M6BA 3LZ0D 4EO5C 3TU4D 2NQBD 5B2IB 4Z2MG 2IO5B 3KUYA 4YM6D 1BH9B 2RIQA 2HIOC 4J8VB 3MGRB 3AZHA 1KX4D 3WTPC 1Z2CB 5CP6C 3AZID 3C1CA 5B2JC 4J8XC 1ID3C 5B0YC 3MGPD 4Z5TB 1P3KB 4NE6A 2PYOB 4KUDD 3AV2C 3W98C 3REJB 4KGCD 4YS3A 5B0ZC 2BG1A 5GT3D 3AN2C 3REKA 1KX3D 1P3LA 1P3IB 3WAAD 3KSYA 3AZFA 5CPJA 3MVDA 1F66A 4HGAB 3AZEA 4R8PD 4G91C 3X1SD 1JFIB 4CAYB 5BS7A 2FJ7B 5B1MB 5AVCD 2NZDA 3LZ1B 5B2IC 4H9RA 2IO5C 3UTBB 3C1BB 2G5IC 1P3FD 4J8VC 4WU8D 3MGRC 4H9SA 2CV5A 5DNMA 3WKJA 4E44A 1EQZD 5B31A 3UTAA 3AZHB 4QLCB 4Z5TC 1P3KC 2PYOC 5AV8B 3H0LC 3AZGA 5GSUD 3REJC 5JA4A 3AFAB 4LD9A 2L5AA 5BNVB 3LELB 3AZJA 1M18A 5E5AD 3X1VA 3B6FD 3W99D 4YS3B 5BO0B 5AV9B 1M19A 1P3GB 3AL0C 1P3LB 4HGAC 1P3PD 5GXQA 1AOIB 3MGSB 1P34B 5AVBA 5JRGA 2FJ7C 5B1MC 1F66B 3LZ1C 5DNND 3AV1D 3REIB 3UTBC 1P3MC 5B33D 2Y2NA 1KX5B 3KFUG 3C1BC 2HIOA 5AV5D 5B24A 4H9RB 1TZYB 1ULYA 4UUZA 3WTPA 4J8UD 2YFWA 3VH6A 4J8XA 1ID3A 5B0YA 3MGQB 3AZKB 3MNND 3A1KA 5DNMB 3AV2A 2FFFB 5AV8C 3RELD 1M1AB 3W98A 3VH5W 3AFAC 5B0ZA 2YFVB 3EG5B 3AN2A 4G92C 4CSRB 4WU9A 5AV9C 3C1CD 4H9NB 1P3GC 1A7WA 2RVQC 5G49B 2VQRA 2AROD 1AOIC 5CPID 3MGSC 4DQYB 1P34C 4WZSB 3W96B 3UT9B 5B2IA 1KU5A 5CPJD 3AZFD 3KXBC 1BH9A 4ZUXB 3MVDD 1P3BD 1KX5C 1ZLAD 3AZED 4J8VA 4NE5A 3MGRA 3WA9B 1TZYC 2Y2JA 2Y2MA 2F8NH 2NZDD 2F8NA 5F99B 3NQJB 3MGQC 1P3KA 4Z5TA 3AZKC 2PYOA 4UUZB 5CP6B 1M1AC 4DRBA 5B2JB 2Y2LA 3REJA 2Y2IA 1N1JA 1WWSA 5B31D 3UTAD 3REHB 4YM6B 4WNNB 4H9PB 3AN2B 3B6GB 1U35B 3AZGD 5AV6B 3X1UB 1JFIA 4CAYA 2FJ7A 4LD9D 5B1MA 4WV4B 3AZJD 3W96C 3MGPB 3UT9C 3X1VD 3LZ1A 3AYWB 1M19D 1BFMA 3UTBA 1P3MA 4KGCB 4XZQB 4ZUXC 1HQ3D 3C1BA 5GXQD 4H9QB 3WA9C 5B32G 5JRGD 5F99C 1B67A 4QLCA 3AZMB 5AV8A 3F6TA 5B1LD 1P3AB 2F8NB 3AFAA 3AZLB 3A6NB 5BNVA 5B24D 3LELA 5BO0A 5AV9A 5GT0B 4J8XD 1ID3D 1N1JB 5B0YD 4YM6C 3WTPE 2ZM5A 3REHC 1P3GA 3B6GC 3AV2D 1P3FB 1T3UA 3W98D 5B32B 4NE3A 1U35C 1P3OD 5AV6C 3X1UC 1AOIA 3MGSA 1P34A 5B0ZD 3AZIC 1EQZB 2BYMB 3MGPC 4KUDC 4WU9D 3AZNB 3AYWC 3REIA 4XUJD 3KXBA 3KWQD 4KGCC 4XZQC 1KX5A 4X23D 4UPKA 4Z66D 4J8WB 5GT3C 1P3MB 1TZYA 3B6FB 3W97B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK B;  3VH6 W;  3MGQ A;  3AZK A;  3AZM C;  1M1A A;  4R8P C;  1P3A C;  3X1S C;  3AZL C;  3A6N C;  4J8V D;  3MGR D;  2YFV A;  3O62 B;  3B0B A;  4CSR A;  5B40 B;  4H9N A;  5GT0 C;  1P3K D;  4Z5T D;  5G49 A;  4G92 B;  1P3F C;  5B32 C;  3REJ D;  1EQZ C;  3V9R B;  1TAF B;  3W96 A;  3UT9 A;  3MNN B;  1P3I D;  3AZN C;  3REL B;  5AY8 B;  4AWL B;  5GSU C;  4ZUX A;  3B0C T;  4J8W C;  3WA9 A;  3KXB B;  2FJ7 D;  3B6F C;  3W97 C;  5F99 A;  3NQJ A;  3LZ1 D;  4ZBJ B;  2ARO B;  5CP6 A;  1P3P C;  5B2J A;  3C1B D;  1HTA A;  3LJA B;  3KUY D;  3O62 C;  5B40 C;  5DNN C;  1F1E A;  3REH A;  4YM6 A;  4WNN A;  5B33 C;  4QLC D;  3AZH D;  4H9P A;  1P3B B;  3B6G A;  3X1T B;  5AV8 D;  5AV5 C;  1U35 A;  5AV6 A;  3X1U A;  3AFA D;  4JJN B;  3LEL D;  3MGP A;  4KUD A;  3MNN C;  4YS3 D;  3REL C;  3AYW A;  2F8N K;  5CPK B;  2RVQ D;  5AY8 C;  4AWL C;  4KGC A;  4XZQ A;  3R45 B;  3REK D;  1P3L D;  1AOI D;  4H9Q A;  5BT1 C;  3MGS D;  1F66 D;  1S32 B;  2JSS A;  3AZM A;  4ZBJ C;  2ARO C;  3REI D;  1P3A A;  3X1S A;  5CPI C;  1KX5 D;  3AZL A;  3A6N A;  5KDM B;  3LJA C;  3LZ0 B;  5GT0 A;  3MGQ D;  3TU4 B;  3AZF C;  3AZK D;  2CV5 D;  1P3B C;  2NQB B;  1ZLA C;  5DNM D;  3X1T C;  1P3F A;  3WKJ D;  5B32 A;  4JJN C;  1EQZ A;  2BYM A;  1KX4 B;  3AZN A;  5B1L B;  3AZI B;  5CPK C;  1M18 D;  4KUD B;  4H9S C;  4J8W A;  1WWI A;  3B6F A;  5FUG B;  3W97 A;  1S32 C;  2BYK A;  5GT3 B;  1KX3 B;  5AVB D;  3WAA B;  1P3O B;  4ZUX D;  3AZJ C;  4R8P B;  3WA9 D;  3X1S B;  3O62 A;  5B40 A;  5AVC B;  2HIO D;  3LZ0 C;  4XUJ B;  5F99 D;  3TU4 C;  5B33 A;  2NQB C;  1HQ3 C;  3WTP D;  5AV5 A;  5CP6 D;  4X23 B;  4Z66 B;  5GXQ C;  5B2J D;  3NQU B;  5BNX B;  4H9O B;  1TAF A;  3V9R A;  4WU8 B;  3MNN A;  1KX4 C;  3REL A;  5C3I B;  5B1L C;  3REH D;  5AY8 A;  3AN2 D;  3B6G D;  5B24 C;  1U35 D;  5AV6 D;  3X1U D;  5GSU B;  2HUE B;  3VH5 T;  5E5A B;  1KX3 C;  3W99 B;  3AYW D;  1BH8 B;  2ARO A;  3WAA C;  1P3O C;  5CPI A;  4XZQ D;  1B6W A;  5B2I D;  1P3P B;  3LJA A;  4WU9 C;  5AVC C;  4XUJ C;  3KWQ C;  1P3B A;  3AZM D;  1ZLA A;  4KHA B;  3X1T A;  5DNN B;  4X23 C;  4Z66 C;  3AV1 B;  1P3A D;  2F8N D;  5B33 B;  3AZL D;  2PYO D;  3A6N D;  4JJN A;  5AV5 B;  4WU8 C;  1H3O B;  4J8U B;  5C3I C;  5GT0 D;  5CPK A;  3R45 A;  5B32 D;  3KUY B;  2HUE C;  1S32 A;  5E5A C;  3AZN D;  3W99 C;  4E45 A;  5B1M D;  3C1C B;  5KDM A;  4J8W D;  3UTB D;  1P3M D;  5CPI B;  1P3I C;  3LZ0 A;  3W97 D;  3TU4 A;  3REK B;  2NQB A;  1HQ3 A;  3AV1 C;  5CPJ B;  3AZF B;  5B31 G;  3MVD B;  1ZLA B;  3AZE B;  2LY8 A;  3O62 D;  1KX4 A;  3B0D B;  5B40 D;  4J8U C;  1R4V A;  5B1L A;  3AZI A;  2NZD B;  5AV9 D;  3KUY C;  1P3G D;  5FUG A;  3AZH C;  4QLC C;  2CV5 B;  5GT3 A;  1KX3 A;  3WKJ B;  1P34 D;  3C1C C;  5B31 B;  3UTA B;  5AY8 D;  1P3O A;  3WAA A;  3LEL C;  3AZG B;  5BT1 D;  5CHL B;  4R8P A;  3KXB D;  5JA4 B;  4YS3 C;  4LD9 B;  5AVC A;  3AZJ B;  1M18 B;  4XUJ A;  3KWQ A;  3REK C;  1TZY D;  3X1V B;  1P3L C;  4X23 A;  1M19 B;  4Z66 A;  5CPJ C;  3NQU A;  5BNX A;  3MVD C;  1HQ3 B;  1F66 C;  3AZE C;  4H9O A;  5GXQ B;  3LJA D;  4WU8 A;  1M1A D;  5BS7 C;  3B0D C;  5AVB B;  5JRG B;  4EO5 B;  3REI C;  2NZD C;  3VH6 T;  3X1T D;  5GSU A;  4JJN D;  4NFT A;  2HIO B;  5B24 B;  2CV5 C;  3WTP B;  5E5A A;  5DNM C;  3WKJ C;  3W99 A;  1BH8 A;  2YFW B;  5B31 C;  4J8X B;  3UTA C;  5B0Y B;  5CPK D;  3UT9 D;  1ID3 B;  3W96 D;  3B0C W;  3AV2 B;  4Z2M H;  3W98 B;  3AZG C;  1P3P A;  3VH5 A;  1Q9C A;  1P3I A;  4LD9 C;  5B0Z B;  1S32 D;  1M18 C;  4WU9 B;  3X1V C;  4KHA A;  5DNN A;  1M19 C;  3AV1 A;  2CWE A;  3KWQ B;  4DRA A;  2F8N G;  4G91 B;  1H3O A;  5AVB C;  5JRG C;  4J8U A;  4M6B A;  3LZ0 D;  4EO5 C;  3TU4 D;  2NQB D;  5B2I B;  4Z2M G;  2IO5 B;  3KUY A;  4YM6 D;  1BH9 B;  2HIO C;  4J8V B;  3MGR B;  3AZH A;  1KX4 D;  3WTP C;  5CP6 C;  3AZI D;  3C1C A;  5B2J C;  4J8X C;  1ID3 C;  5B0Y C;  3MGP D;  4Z5T B;  1P3K B;  4NE6 A;  2PYO B;  4KUD D;  3AV2 C;  3W98 C;  3REJ B;  4KGC D;  4YS3 A;  5B0Z C;  5GT3 D;  3AN2 C;  3REK A;  1KX3 D;  1P3L A;  1P3I B;  3WAA D;  3KSY A;  3AZF A;  5CPJ A;  3MVD A;  1F66 A;  4HGA B;  3AZE A;  4R8P D;  4G91 C;  3X1S D;  1JFI B;  4CAY B;  5BS7 A;  2FJ7 B;  5B1M B;  5AVC D;  2NZD A;  3LZ1 B;  5B2I C;  4H9R A;  2IO5 C;  3UTB B;  3C1B B;  1P3F D;  4J8V C;  4WU8 D;  3MGR C;  4H9S A;  2CV5 A;  5DNM A;  3WKJ A;  4E44 A;  1EQZ D;  5B31 A;  3UTA A;  3AZH B;  4QLC B;  4Z5T C;  1P3K C;  2PYO C;  5AV8 B;  3AZG A;  5GSU D;  3REJ C;  5JA4 A;  3AFA B;  4LD9 A;  2L5A A;  5BNV B;  3LEL B;  3AZJ A;  1M18 A;  5E5A D;  3X1V A;  3B6F D;  3W99 D;  4YS3 B;  5BO0 B;  5AV9 B;  1M19 A;  1P3G B;  1P3L B;  4HGA C;  1P3P D;  5GXQ A;  1AOI B;  3MGS B;  1P34 B;  5AVB A;  5JRG A;  2FJ7 C;  5B1M C;  1F66 B;  3LZ1 C;  5DNN D;  3AV1 D;  3REI B;  3UTB C;  1P3M C;  5B33 D;  1KX5 B;  3C1B C;  2HIO A;  5AV5 D;  5B24 A;  4H9R B;  1TZY B;  1ULY A;  4UUZ A;  3WTP A;  4J8U D;  2YFW A;  3VH6 A;  4J8X A;  1ID3 A;  5B0Y A;  3MGQ B;  3AZK B;  3MNN D;  5DNM B;  3AV2 A;  3W98 A;  5AV8 C;  3REL D;  1M1A B;  3VH5 W;  3AFA C;  5B0Z A;  2YFV B;  3AN2 A;  4G92 C;  4CSR B;  4WU9 A;  5AV9 C;  3C1C D;  4H9N B;  1P3G C;  1A7W A;  2RVQ C;  5G49 B;  2ARO D;  1AOI C;  5CPI D;  3MGS C;  1P34 C;  4WZS B;  3W96 B;  3UT9 B;  5B2I A;  1KU5 A;  5CPJ D;  3AZF D;  3KXB C;  1BH9 A;  4ZUX B;  3MVD D;  1P3B D;  1KX5 C;  1ZLA D;  3AZE D;  4J8V A;  4NE5 A;  3MGR A;  3WA9 B;  1TZY C;  2F8N H;  2NZD D;  2F8N A;  5F99 B;  3NQJ B;  3MGQ C;  1P3K A;  4Z5T A;  3AZK C;  2PYO A;  4UUZ B;  5CP6 B;  1M1A C;  4DRB A;  5B2J B;  3REJ A;  1N1J A;  1WWS A;  5B31 D;  3UTA D;  3REH B;  4YM6 B;  4WNN B;  4H9P B;  3AN2 B;  3B6G B;  1U35 B;  3AZG D;  5AV6 B;  3X1U B;  1JFI A;  4CAY A;  2FJ7 A;  4LD9 D;  5B1M A;  4WV4 B;  3AZJ D;  3W96 C;  3MGP B;  3UT9 C;  3X1V D;  3LZ1 A;  3AYW B;  1M19 D;  1BFM A;  3UTB A;  1P3M A;  4KGC B;  4XZQ B;  4ZUX C;  1HQ3 D;  3C1B A;  5GXQ D;  4H9Q B;  3WA9 C;  5B32 G;  5JRG D;  5F99 C;  1B67 A;  4QLC A;  3AZM B;  5AV8 A;  5B1L D;  1P3A B;  2F8N B;  3AFA A;  3AZL B;  3A6N B;  5BNV A;  5B24 D;  3LEL A;  5BO0 A;  5AV9 A;  5GT0 B;  4J8X D;  1ID3 D;  1N1J B;  5B0Y D;  4YM6 C;  3WTP E;  3REH C;  1P3G A;  3B6G C;  3AV2 D;  1P3F B;  3W98 D;  5B32 B;  4NE3 A;  1U35 C;  1P3O D;  5AV6 C;  3X1U C;  1AOI A;  3MGS A;  1P34 A;  5B0Z D;  3AZI C;  1EQZ B;  2BYM B;  3MGP C;  4KUD C;  4WU9 D;  3AZN B;  3AYW C;  3REI A;  4XUJ D;  3KXB A;  3KWQ D;  4KGC C;  4XZQ C;  1KX5 A;  4X23 D;  4Z66 D;  4J8W B;  5GT3 C;  1P3M B;  1TZY A;  3B6F B;  3W97 B; 
#chains in the Genus database with same CATH topology
 2BYK B;  3VH6 W;  3MGQ A;  3AZK A;  3AZM C;  1M1A A;  2XD5 A;  4R8P C;  1P3A C;  3X1S C;  3AZL C;  3A6N C;  2XD1 A;  4J8V D;  3MGR D;  2YFV A;  2JCH A;  3O62 B;  3B0B A;  4CSR A;  5B40 B;  3P5J B;  4H9N A;  5GT0 C;  1P3K D;  4Z5T D;  5G49 A;  4G92 B;  1P3F C;  5B32 C;  3EPJ A;  3REJ D;  3H0M C;  1EQZ C;  3V9R B;  1TAF B;  3W96 A;  3UT9 A;  3MNN B;  1P3I D;  3AZN C;  3REL B;  5AY8 B;  4AWL B;  5GSU C;  4ZUX A;  3B0C T;  4J8W C;  3WA9 A;  3KXB B;  2FJ7 D;  3B6F C;  3W97 C;  5F99 A;  3NQJ A;  2G5H C;  3LZ1 D;  4ZBJ B;  2ARO B;  5CP6 A;  1P3P C;  5B2J A;  3C1B D;  1HTA A;  3LJA B;  3KUY D;  3O62 C;  5B40 C;  5DNN C;  1F1E A;  3REH A;  4YM6 A;  4WNN A;  5B33 C;  4QLC D;  3AZH D;  4H9P A;  1P3B B;  3B6G A;  3X1T B;  5AV8 D;  5AV5 C;  1U35 A;  5AV6 A;  3X1U A;  3AFA D;  4JJN B;  3LEL D;  3IP4 C;  3MGP A;  3MNN C;  4KUD A;  4YS3 D;  3REL C;  3AYW A;  2F8N K;  5CPK B;  2RVQ D;  5AY8 C;  4AWL C;  4KGC A;  4XZQ A;  3R45 B;  3REK D;  1P3L D;  2Y2Q A;  1AOI D;  4H9Q A;  5BT1 C;  3MGS D;  1F66 D;  1S32 B;  2JSS A;  3AZM A;  4ZBJ C;  2ARO C;  3REI D;  1P3A A;  3X1S A;  5CPI C;  1KX5 D;  3AZL A;  1W2E A;  3A6N A;  5KDM B;  3FDD A;  3LJA C;  3EPL A;  3LZ0 B;  5GT0 A;  3MGQ D;  3TU4 B;  3AZF C;  3AZK D;  2CV5 D;  1P3B C;  2NQB B;  1ZLA C;  5DNM D;  3X1T C;  1P3F A;  3WKJ D;  5B32 A;  4JJN C;  1EQZ A;  2ZY3 A;  2BYM A;  1KX4 B;  3AZN A;  5B1L B;  3AZI B;  2Y2P A;  5CPK C;  1M18 D;  2Y2K A;  4KUD B;  4H9S C;  4J8W A;  1WWI A;  3B6F A;  2W8S A;  5FUG B;  3W97 A;  1S32 C;  2ZY5 A;  2BYK A;  5GT3 B;  1KX3 B;  5AVB D;  3WAA B;  1P3O B;  4ZUX D;  3AZJ C;  4R8P B;  3WA9 D;  3X1S B;  3O62 A;  5B40 A;  5AVC B;  2HIO D;  3LZ0 C;  4XUJ B;  5F99 D;  3TU4 C;  5B33 A;  2NQB C;  1HQ3 C;  3WTP D;  5AV5 A;  5CP6 D;  4X23 B;  4Z66 B;  5GXQ C;  5B2J D;  3NQU B;  5BNX B;  4WJ3 C;  4H9O B;  1TAF A;  3V9R A;  4WU8 B;  3MNN A;  1KX4 C;  3REL A;  5C3I B;  5B1L C;  3REH D;  2ZY4 A;  5AY8 A;  3AN2 D;  3B6G D;  5B24 C;  1U35 D;  5AV6 D;  3X1U D;  5GSU B;  2HUE B;  3VH5 T;  5E5A B;  1KX3 C;  3W99 B;  3AYW D;  1BH8 B;  2ARO A;  3WAA C;  1P3O C;  5CPI A;  2J8P A;  4XZQ D;  1B6W A;  5B2I D;  1P3P B;  3LJA A;  2JE5 A;  4WU9 C;  2DQN C;  5AVC C;  4XUJ C;  3KWQ C;  1P3B A;  3AZM D;  1ZLA A;  4KHA B;  2F2A C;  5DNN B;  4X23 C;  3X1T A;  4Z66 C;  3AV1 B;  1P3A D;  2F8N D;  5B33 B;  3AZL D;  2PYO D;  3A6N D;  4JJN A;  5AV5 B;  4WU8 C;  1H3O B;  4J8U B;  5C3I C;  5GT0 D;  5CPK A;  3R45 A;  5B32 D;  2ZY2 A;  3KUY B;  2HUE C;  1S32 A;  5E5A C;  3AZN D;  3W99 C;  4E45 A;  5B1M D;  3C1C B;  5KDM A;  4J8W D;  3UTB D;  1P3M D;  5CPI B;  1P3I C;  3LZ0 A;  3W97 D;  3TU4 A;  3REK B;  2NQB A;  1HQ3 A;  2Y2H A;  3AV1 C;  5CPJ B;  3AZF B;  5B31 G;  3MVD B;  1ZLA B;  3AZE B;  2LY8 A;  3O62 D;  1KX4 A;  3B0D B;  5B40 D;  4J8U C;  1R4V A;  5B1L A;  3AZI A;  2NZD B;  5AV9 D;  2Y2O A;  3KUY C;  1P3G D;  5FUG A;  3AZH C;  2UWX A;  4QLC C;  2CV5 B;  5GT3 A;  1KX3 A;  3WKJ B;  1P34 D;  3C1C C;  5B31 B;  3UTA B;  5AY8 D;  3EPK A;  1P3O A;  3WAA A;  3LEL C;  3EPH A;  3AZG B;  5BT1 D;  5CHL B;  4R8P A;  3KXB D;  5JA4 B;  4YS3 C;  4LD9 B;  5AVC A;  3AZJ B;  1M18 B;  4XUJ A;  3KWQ A;  2Y2G A;  3REK C;  1TZY D;  3X1V B;  1P3L C;  4X23 A;  1M19 B;  4Z66 A;  3H0R C;  5CPJ C;  3NQU A;  5BNX A;  3MVD C;  1HQ3 B;  1F66 C;  1PZR A;  3AZE C;  4H9O A;  5GXQ B;  3LJA D;  4WU8 A;  1M1A D;  5BS7 C;  3B0D C;  5AVB B;  5JRG B;  4EO5 B;  3REI C;  2NZD C;  3VH6 T;  3X1T D;  5GSU A;  4JJN D;  4NFT A;  2HIO B;  5B24 B;  2CV5 C;  3WTP B;  5E5A A;  5DNM C;  3WKJ C;  3A1I A;  3W99 A;  1BH8 A;  2YFW B;  5B31 C;  4J8X B;  3UTA C;  2DF4 C;  5B0Y B;  3UT9 D;  5CPK D;  1ID3 B;  3W96 D;  3B0C W;  3AV2 B;  4Z2M H;  3W98 B;  3AZG C;  1P3P A;  3VH5 A;  1Q9C A;  1P3I A;  4LD9 C;  5B0Z B;  1S32 D;  1M18 C;  4WU9 B;  3X1V C;  4KHA A;  5DNN A;  1M19 C;  3AV1 A;  2CWE A;  3KWQ B;  4DRA A;  2F8N G;  4G91 B;  1H3O A;  5AVB C;  5JRG C;  4J8U A;  4M6B A;  3LZ0 D;  4EO5 C;  3TU4 D;  2NQB D;  5B2I B;  4Z2M G;  2IO5 B;  3KUY A;  4YM6 D;  1BH9 B;  2RIQ A;  2HIO C;  4J8V B;  3MGR B;  3AZH A;  1KX4 D;  3WTP C;  1Z2C B;  5CP6 C;  3AZI D;  3C1C A;  5B2J C;  4J8X C;  1ID3 C;  5B0Y C;  3MGP D;  4Z5T B;  1P3K B;  4NE6 A;  2PYO B;  4KUD D;  3AV2 C;  3W98 C;  3REJ B;  4KGC D;  4YS3 A;  5B0Z C;  2BG1 A;  5GT3 D;  3AN2 C;  3REK A;  1KX3 D;  1P3L A;  1P3I B;  3WAA D;  3KSY A;  3AZF A;  5CPJ A;  3MVD A;  1F66 A;  4HGA B;  3AZE A;  4R8P D;  4G91 C;  3X1S D;  1JFI B;  4CAY B;  5BS7 A;  2FJ7 B;  5B1M B;  5AVC D;  2NZD A;  3LZ1 B;  5B2I C;  4H9R A;  2IO5 C;  3UTB B;  3C1B B;  2G5I C;  1P3F D;  4J8V C;  4WU8 D;  3MGR C;  4H9S A;  2CV5 A;  5DNM A;  3WKJ A;  4E44 A;  1EQZ D;  5B31 A;  3UTA A;  3AZH B;  4QLC B;  4Z5T C;  1P3K C;  2PYO C;  5AV8 B;  3H0L C;  3AZG A;  5GSU D;  3REJ C;  5JA4 A;  3AFA B;  4LD9 A;  2L5A A;  5BNV B;  3LEL B;  3AZJ A;  1M18 A;  5E5A D;  3X1V A;  3B6F D;  3W99 D;  4YS3 B;  5BO0 B;  5AV9 B;  1M19 A;  1P3G B;  3AL0 C;  1P3L B;  4HGA C;  1P3P D;  5GXQ A;  1AOI B;  3MGS B;  1P34 B;  5AVB A;  5JRG A;  2FJ7 C;  5B1M C;  1F66 B;  3LZ1 C;  5DNN D;  3AV1 D;  3REI B;  3UTB C;  1P3M C;  5B33 D;  2Y2N A;  1KX5 B;  3KFU G;  3C1B C;  2HIO A;  5AV5 D;  5B24 A;  4H9R B;  1TZY B;  1ULY A;  4UUZ A;  3WTP A;  4J8U D;  2YFW A;  3VH6 A;  4J8X A;  1ID3 A;  5B0Y A;  3MGQ B;  3AZK B;  3MNN D;  3A1K A;  5DNM B;  3AV2 A;  2FFF B;  5AV8 C;  3REL D;  1M1A B;  3W98 A;  3VH5 W;  3AFA C;  5B0Z A;  2YFV B;  3EG5 B;  3AN2 A;  4G92 C;  4CSR B;  4WU9 A;  5AV9 C;  3C1C D;  4H9N B;  1P3G C;  1A7W A;  2RVQ C;  5G49 B;  2VQR A;  2ARO D;  1AOI C;  5CPI D;  3MGS C;  4DQY B;  1P34 C;  4WZS B;  3W96 B;  3UT9 B;  5B2I A;  1KU5 A;  5CPJ D;  3AZF D;  3KXB C;  1BH9 A;  4ZUX B;  3MVD D;  1P3B D;  1KX5 C;  1ZLA D;  3AZE D;  4J8V A;  4NE5 A;  3MGR A;  3WA9 B;  1TZY C;  2Y2J A;  2Y2M A;  2F8N H;  2NZD D;  2F8N A;  5F99 B;  3NQJ B;  3MGQ C;  1P3K A;  4Z5T A;  3AZK C;  2PYO A;  4UUZ B;  5CP6 B;  1M1A C;  4DRB A;  5B2J B;  2Y2L A;  3REJ A;  2Y2I A;  1N1J A;  1WWS A;  5B31 D;  3UTA D;  3REH B;  4YM6 B;  4WNN B;  4H9P B;  3AN2 B;  3B6G B;  1U35 B;  3AZG D;  5AV6 B;  3X1U B;  1JFI A;  4CAY A;  2FJ7 A;  4LD9 D;  5B1M A;  4WV4 B;  3AZJ D;  3W96 C;  3MGP B;  3UT9 C;  3X1V D;  3LZ1 A;  3AYW B;  1M19 D;  1BFM A;  3UTB A;  1P3M A;  4KGC B;  4XZQ B;  4ZUX C;  1HQ3 D;  3C1B A;  5GXQ D;  4H9Q B;  3WA9 C;  5B32 G;  5JRG D;  5F99 C;  1B67 A;  4QLC A;  3AZM B;  5AV8 A;  3F6T A;  5B1L D;  1P3A B;  2F8N B;  3AFA A;  3AZL B;  3A6N B;  5BNV A;  5B24 D;  3LEL A;  5BO0 A;  5AV9 A;  5GT0 B;  4J8X D;  1ID3 D;  1N1J B;  5B0Y D;  4YM6 C;  3WTP E;  2ZM5 A;  3REH C;  1P3G A;  3B6G C;  3AV2 D;  1P3F B;  1T3U A;  3W98 D;  5B32 B;  4NE3 A;  1U35 C;  1P3O D;  5AV6 C;  3X1U C;  1AOI A;  3MGS A;  1P34 A;  5B0Z D;  3AZI C;  1EQZ B;  2BYM B;  3MGP C;  4KUD C;  4WU9 D;  3AZN B;  3AYW C;  3REI A;  4XUJ D;  3KXB A;  3KWQ D;  4KGC C;  4XZQ C;  1KX5 A;  4X23 D;  4UPK A;  4Z66 D;  4J8W B;  5GT3 C;  1P3M B;  1TZY A;  3B6F B;  3W97 B; 
#chains in the Genus database with same CATH homology
 2BYK B;  3VH6 W;  3MGQ A;  3AZK A;  3AZM C;  1M1A A;  2XD5 A;  4R8P C;  1P3A C;  3X1S C;  3AZL C;  3A6N C;  2XD1 A;  4J8V D;  3MGR D;  2YFV A;  2JCH A;  3O62 B;  3B0B A;  4CSR A;  5B40 B;  3P5J B;  4H9N A;  5GT0 C;  1P3K D;  4Z5T D;  5G49 A;  4G92 B;  1P3F C;  5B32 C;  3EPJ A;  3REJ D;  3H0M C;  1EQZ C;  3V9R B;  1TAF B;  3W96 A;  3UT9 A;  3MNN B;  1P3I D;  3AZN C;  3REL B;  5AY8 B;  4AWL B;  5GSU C;  4ZUX A;  3B0C T;  4J8W C;  3WA9 A;  3KXB B;  2FJ7 D;  3B6F C;  3W97 C;  5F99 A;  3NQJ A;  2G5H C;  3LZ1 D;  4ZBJ B;  2ARO B;  5CP6 A;  1P3P C;  5B2J A;  3C1B D;  1HTA A;  3LJA B;  3KUY D;  3O62 C;  5B40 C;  5DNN C;  1F1E A;  3REH A;  4YM6 A;  4WNN A;  5B33 C;  4QLC D;  3AZH D;  4H9P A;  1P3B B;  3B6G A;  3X1T B;  5AV8 D;  5AV5 C;  1U35 A;  5AV6 A;  3X1U A;  3AFA D;  4JJN B;  3LEL D;  3IP4 C;  3MGP A;  3MNN C;  4KUD A;  4YS3 D;  3REL C;  3AYW A;  2F8N K;  5CPK B;  2RVQ D;  5AY8 C;  4AWL C;  4KGC A;  4XZQ A;  3R45 B;  3REK D;  1P3L D;  2Y2Q A;  1AOI D;  4H9Q A;  5BT1 C;  3MGS D;  1F66 D;  1S32 B;  2JSS A;  3AZM A;  4ZBJ C;  2ARO C;  3REI D;  1P3A A;  3X1S A;  5CPI C;  1KX5 D;  3AZL A;  1W2E A;  3A6N A;  5KDM B;  3FDD A;  3LJA C;  3EPL A;  3LZ0 B;  5GT0 A;  3MGQ D;  3TU4 B;  3AZF C;  3AZK D;  2CV5 D;  1P3B C;  2NQB B;  1ZLA C;  5DNM D;  3X1T C;  1P3F A;  3WKJ D;  5B32 A;  4JJN C;  1EQZ A;  2ZY3 A;  2BYM A;  1KX4 B;  3AZN A;  5B1L B;  3AZI B;  2Y2P A;  5CPK C;  1M18 D;  2Y2K A;  4KUD B;  4H9S C;  4J8W A;  1WWI A;  3B6F A;  2W8S A;  5FUG B;  3W97 A;  1S32 C;  2ZY5 A;  2BYK A;  5GT3 B;  1KX3 B;  5AVB D;  3WAA B;  1P3O B;  4ZUX D;  3AZJ C;  4R8P B;  3WA9 D;  3X1S B;  3O62 A;  5B40 A;  5AVC B;  2HIO D;  3LZ0 C;  4XUJ B;  5F99 D;  3TU4 C;  5B33 A;  2NQB C;  1HQ3 C;  3WTP D;  5AV5 A;  5CP6 D;  4X23 B;  4Z66 B;  5GXQ C;  5B2J D;  3NQU B;  5BNX B;  4WJ3 C;  4H9O B;  1TAF A;  3V9R A;  4WU8 B;  3MNN A;  1KX4 C;  3REL A;  5C3I B;  5B1L C;  3REH D;  2ZY4 A;  5AY8 A;  3AN2 D;  3B6G D;  5B24 C;  1U35 D;  5AV6 D;  3X1U D;  5GSU B;  2HUE B;  3VH5 T;  5E5A B;  1KX3 C;  3W99 B;  3AYW D;  1BH8 B;  2ARO A;  3WAA C;  1P3O C;  5CPI A;  2J8P A;  4XZQ D;  1B6W A;  5B2I D;  1P3P B;  3LJA A;  2JE5 A;  4WU9 C;  2DQN C;  5AVC C;  4XUJ C;  3KWQ C;  1P3B A;  3AZM D;  1ZLA A;  4KHA B;  2F2A C;  5DNN B;  4X23 C;  3X1T A;  4Z66 C;  3AV1 B;  1P3A D;  2F8N D;  5B33 B;  3AZL D;  2PYO D;  3A6N D;  4JJN A;  5AV5 B;  4WU8 C;  1H3O B;  4J8U B;  5C3I C;  5GT0 D;  5CPK A;  3R45 A;  5B32 D;  2ZY2 A;  3KUY B;  2HUE C;  1S32 A;  5E5A C;  3AZN D;  3W99 C;  4E45 A;  5B1M D;  3C1C B;  5KDM A;  4J8W D;  3UTB D;  1P3M D;  5CPI B;  1P3I C;  3LZ0 A;  3W97 D;  3TU4 A;  3REK B;  2NQB A;  1HQ3 A;  2Y2H A;  3AV1 C;  5CPJ B;  3AZF B;  5B31 G;  3MVD B;  1ZLA B;  3AZE B;  2LY8 A;  3O62 D;  1KX4 A;  3B0D B;  5B40 D;  4J8U C;  1R4V A;  5B1L A;  3AZI A;  2NZD B;  5AV9 D;  2Y2O A;  3KUY C;  1P3G D;  5FUG A;  3AZH C;  2UWX A;  4QLC C;  2CV5 B;  5GT3 A;  1KX3 A;  3WKJ B;  1P34 D;  3C1C C;  5B31 B;  3UTA B;  5AY8 D;  3EPK A;  1P3O A;  3WAA A;  3LEL C;  3EPH A;  3AZG B;  5BT1 D;  5CHL B;  4R8P A;  3KXB D;  5JA4 B;  4YS3 C;  4LD9 B;  5AVC A;  3AZJ B;  1M18 B;  4XUJ A;  3KWQ A;  2Y2G A;  3REK C;  1TZY D;  3X1V B;  1P3L C;  4X23 A;  1M19 B;  4Z66 A;  3H0R C;  5CPJ C;  3NQU A;  5BNX A;  3MVD C;  1HQ3 B;  1F66 C;  1PZR A;  3AZE C;  4H9O A;  5GXQ B;  3LJA D;  4WU8 A;  1M1A D;  5BS7 C;  3B0D C;  5AVB B;  5JRG B;  4EO5 B;  3REI C;  2NZD C;  3VH6 T;  3X1T D;  5GSU A;  4JJN D;  4NFT A;  2HIO B;  5B24 B;  2CV5 C;  3WTP B;  5E5A A;  5DNM C;  3WKJ C;  3A1I A;  3W99 A;  1BH8 A;  2YFW B;  5B31 C;  4J8X B;  3UTA C;  2DF4 C;  5B0Y B;  3UT9 D;  5CPK D;  1ID3 B;  3W96 D;  3B0C W;  3AV2 B;  4Z2M H;  3W98 B;  3AZG C;  1P3P A;  3VH5 A;  1Q9C A;  1P3I A;  4LD9 C;  5B0Z B;  1S32 D;  1M18 C;  4WU9 B;  3X1V C;  4KHA A;  5DNN A;  1M19 C;  3AV1 A;  2CWE A;  3KWQ B;  4DRA A;  2F8N G;  4G91 B;  1H3O A;  5AVB C;  5JRG C;  4J8U A;  4M6B A;  3LZ0 D;  4EO5 C;  3TU4 D;  2NQB D;  5B2I B;  4Z2M G;  2IO5 B;  3KUY A;  4YM6 D;  1BH9 B;  2RIQ A;  2HIO C;  4J8V B;  3MGR B;  3AZH A;  1KX4 D;  3WTP C;  1Z2C B;  5CP6 C;  3AZI D;  3C1C A;  5B2J C;  4J8X C;  1ID3 C;  5B0Y C;  3MGP D;  4Z5T B;  1P3K B;  4NE6 A;  2PYO B;  4KUD D;  3AV2 C;  3W98 C;  3REJ B;  4KGC D;  4YS3 A;  5B0Z C;  2BG1 A;  5GT3 D;  3AN2 C;  3REK A;  1KX3 D;  1P3L A;  1P3I B;  3WAA D;  3KSY A;  3AZF A;  5CPJ A;  3MVD A;  1F66 A;  4HGA B;  3AZE A;  4R8P D;  4G91 C;  3X1S D;  1JFI B;  4CAY B;  5BS7 A;  2FJ7 B;  5B1M B;  5AVC D;  2NZD A;  3LZ1 B;  5B2I C;  4H9R A;  2IO5 C;  3UTB B;  3C1B B;  2G5I C;  1P3F D;  4J8V C;  4WU8 D;  3MGR C;  4H9S A;  2CV5 A;  5DNM A;  3WKJ A;  4E44 A;  1EQZ D;  5B31 A;  3UTA A;  3AZH B;  4QLC B;  4Z5T C;  1P3K C;  2PYO C;  5AV8 B;  3H0L C;  3AZG A;  5GSU D;  3REJ C;  5JA4 A;  3AFA B;  4LD9 A;  2L5A A;  5BNV B;  3LEL B;  3AZJ A;  1M18 A;  5E5A D;  3X1V A;  3B6F D;  3W99 D;  4YS3 B;  5BO0 B;  5AV9 B;  1M19 A;  1P3G B;  3AL0 C;  1P3L B;  4HGA C;  1P3P D;  5GXQ A;  1AOI B;  3MGS B;  1P34 B;  5AVB A;  5JRG A;  2FJ7 C;  5B1M C;  1F66 B;  3LZ1 C;  5DNN D;  3AV1 D;  3REI B;  3UTB C;  1P3M C;  5B33 D;  2Y2N A;  1KX5 B;  3KFU G;  3C1B C;  2HIO A;  5AV5 D;  5B24 A;  4H9R B;  1TZY B;  1ULY A;  4UUZ A;  3WTP A;  4J8U D;  2YFW A;  3VH6 A;  4J8X A;  1ID3 A;  5B0Y A;  3MGQ B;  3AZK B;  3MNN D;  3A1K A;  5DNM B;  3AV2 A;  2FFF B;  5AV8 C;  3REL D;  1M1A B;  3W98 A;  3VH5 W;  3AFA C;  5B0Z A;  2YFV B;  3EG5 B;  3AN2 A;  4G92 C;  4CSR B;  4WU9 A;  5AV9 C;  3C1C D;  4H9N B;  1P3G C;  1A7W A;  2RVQ C;  5G49 B;  2VQR A;  2ARO D;  1AOI C;  5CPI D;  3MGS C;  4DQY B;  1P34 C;  4WZS B;  3W96 B;  3UT9 B;  5B2I A;  1KU5 A;  5CPJ D;  3AZF D;  3KXB C;  1BH9 A;  4ZUX B;  3MVD D;  1P3B D;  1KX5 C;  1ZLA D;  3AZE D;  4J8V A;  4NE5 A;  3MGR A;  3WA9 B;  1TZY C;  2Y2J A;  2Y2M A;  2F8N H;  2NZD D;  2F8N A;  5F99 B;  3NQJ B;  3MGQ C;  1P3K A;  4Z5T A;  3AZK C;  2PYO A;  4UUZ B;  5CP6 B;  1M1A C;  4DRB A;  5B2J B;  2Y2L A;  3REJ A;  2Y2I A;  1N1J A;  1WWS A;  5B31 D;  3UTA D;  3REH B;  4YM6 B;  4WNN B;  4H9P B;  3AN2 B;  3B6G B;  1U35 B;  3AZG D;  5AV6 B;  3X1U B;  1JFI A;  4CAY A;  2FJ7 A;  4LD9 D;  5B1M A;  4WV4 B;  3AZJ D;  3W96 C;  3MGP B;  3UT9 C;  3X1V D;  3LZ1 A;  3AYW B;  1M19 D;  1BFM A;  3UTB A;  1P3M A;  4KGC B;  4XZQ B;  4ZUX C;  1HQ3 D;  3C1B A;  5GXQ D;  4H9Q B;  3WA9 C;  5B32 G;  5JRG D;  5F99 C;  1B67 A;  4QLC A;  3AZM B;  5AV8 A;  3F6T A;  5B1L D;  1P3A B;  2F8N B;  3AFA A;  3AZL B;  3A6N B;  5BNV A;  5B24 D;  3LEL A;  5BO0 A;  5AV9 A;  5GT0 B;  4J8X D;  1ID3 D;  1N1J B;  5B0Y D;  4YM6 C;  3WTP E;  2ZM5 A;  3REH C;  1P3G A;  3B6G C;  3AV2 D;  1P3F B;  1T3U A;  3W98 D;  5B32 B;  4NE3 A;  1U35 C;  1P3O D;  5AV6 C;  3X1U C;  1AOI A;  3MGS A;  1P34 A;  5B0Z D;  3AZI C;  1EQZ B;  2BYM B;  3MGP C;  4KUD C;  4WU9 D;  3AZN B;  3AYW C;  3REI A;  4XUJ D;  3KXB A;  3KWQ D;  4KGC C;  4XZQ C;  1KX5 A;  4X23 D;  4UPK A;  4Z66 D;  4J8W B;  5GT3 C;  1P3M B;  1TZY A;  3B6F B;  3W97 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...