3WTPD

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3-like centromeric protein A
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpD00
3X1UB 4CAYB 1N1JA 5B32G 3AV2C 5FUGB 5CPKA 5GXQC 4ZUXA 3X1VD 2PYOA 3AZEA 5GSUA 5F99D 3UTAB 5BT1C 5CP6D 3AZLC 4J8UB 5B0ZC 3B0DC 3B6FA 3LELB 2NZDB 4WU9C 5B0ZD 1P3AB 5CP6C 3O62D 2F8NG 1M19D 3AV2D 4Z2MG 2IO5C 1P3BC 2BYKA 3R45A 3W96B 2L5AA 1M18B 3X1VA 2PYOD 3KWQB 3R45B 3W98B 5DNMD 5B33C 4X23C 1ZLAB 3AZIC 5DNMA 5CPKD 2RVQD 5AY8C 4QLCB 3X1SA 2HIOA 3MGQB 5CPJB 2AROC 5B2IB 5GT3A 1F66B 4H9QA 2HIOB 3MGRC 4ZBJB 5AVCB 5E5AA 3REKB 4LD9B 4H9QB 3AFAC 5AV6C 1P3LB 4G91B 3AZEC 5FUGA 3C1CB 5AY8A 3LZ1C 3TU4C 5JRGD 4XUJA 4KGCC 3C1BD 4YM6C 4WU9A 1P3OD 3W97B 4Z2MH 5AV9B 1P3PC 1KX5C 5B33A 4ZUXB 1N1JB 1ID3C 1P3OC 4YM6D 1KX3B 5B24B 3WKJA 4H9RA 3AZND 2F8NB 1TZYB 3MGRA 2NZDA 4EO5C 4KGCA 3REJD 3AYWB 1P3MC 3MGSB 3B6FB 3AZFC 5B2JB 2NQBD 2HUEC 3LZ0D 3MGSD 3MVDC 1AOIA 5BS7A 3AZKB 3B6GB 3B0BA 3WKJC 3X1UC 3B6GA 4YM6A 1P3KC 5GT0C 1M18A 2F8NH 4H9NA 4DRAA 1HQ3C 3AZGB 1KX5B 3AZKD 3KUYB 1P34B 3W99B 5AV5B 5B0ZA 3LZ0B 5AVBD 3AZLA 1M19C 2NQBB 4WNNA 4J8WB 5B40A 3O62C 1Q9CA 5C3IC 1B6WA 3UT9D 3AZFB 3LJAA 3AZJA 3AN2B 3WAAA 3REKD 4LD9D 1BH9A 5DNNA 5B31G 3B6GC 3X1VC 5B33B 3WA9A 4CAYA 2CWEA 4X23B 1KX4A 5AV8A 5B1MB 3MGPA 2HIOC 3MGRB 4H9PA 1P3LD 4KUDC 3KSYA 3REKC 1U35B 1AOID 1P3KA 4LD9C 3O62A 5AV5D 5B31C 3AZMD 4HGAC 3VH6A 4UUZB 1M1AD 1P34D 1KX4C 3WTPA 3KXBA 1P3FB 3C1CC 4CSRA 2NZDD 1HTAA 5AVBC 1KX3D 3W96A 3MGPC 5DNMB 3KWQA 4ZUXD 5F99B 1F66A 4DRBA 1JFIB 4G92C 3W96D 1F1EA 3W98A 3KXBC 4XZQD 1P3ID 1P3KD 4M6BA 3V9RB 5B2JD 3A6NA 3C1CA 3WTPD 3MVDD 3MGSC 4H9OA 3AV1D 1P3MA 4J8UC 3B0DB 5DNNB 5B31B 5AVCD 1S32C 3W97A 5GSUB 3REJC 4X23A 5B2ID 5E5AD 1P3MD 1KX4B 3WKJB 5AV9D 3W97D 3X1UA 3NQJA 3REHC 5B1LB 4XZQA 1P3IA 1HQ3B 4NFTA 3AZGC 1P3GA 3UTBC 5CPID 4G92B 4KGCD 5AVBA 4R8PB 4H9PB 1P3GD 4QLCC 3MGQC 1M19A 4YS3C 5B32D 4QLCD 3MGQD 4JJNA 3LELA 3VH5W 4AWLB 1KX5A 3WA9B 1EQZD 5AV6B 1BH8B 3AZHB 5B32B 5CPIC 3REID 2AROD 1BFMA 1M18D 5GT3C 2RVQC 5AY8D 1H3OA 3MGSA 3AZID 4H9SC 3LZ1B 3REHB 3MNND 1TZYA 5BNXA 5AV8D 1R4VA 5AV9C 3KUYA 5B2JA 3A6ND 2PYOC 4WZSB 1BH9B 4KUDB 5KDMB 1P3AD 5B0ZB 3LZ0A 1S32D 3LELD 3X1SD 4R8PC 3WA9D 4KUDA 4WU9B 4HGAB 5CP6B 3AZGA 4YS3B 1P3MB 2YFVB 3UTBA 4WU9D 1P3OA 5B40D 5B2JC 4Z66C 5BT1D 1P34A 5CPIB 5F99C 3KWQC 3AYWA 4H9SA 5GXQD 3C1BA 5BO0A 4Z5TA 3AZFA 5GT0B 5B1LA 4XZQB 1P3IB 3MNNB 3X1TC 3AZIB 5AY8B 5CPJC 3AZKA 2F8NA 1KX4D 1P3FA 4Z66A 1A7WA 1P34C 4ZBJC 3AZHD 1EQZB 5DNNC 3AZMC 4UUZA 1B67A 1P3LC 4KUDD 1TAFA 1HQ3A 3X1TA 2CV5D 4CSRB 3UT9A 3X1TD 5B0YC 2FJ7C 4KHAB 4KGCB 4R8PA 5BNVB 1P3PB 1U35A 2YFWB 1ID3B 4J8XD 2BYMA 4Z66D 5B1LD 2YFWA 3WAAC 4Z5TD 3LJAC 3AZJC 3WTPE 3NQJB 3UT9C 1M1AA 5F99A 5GSUD 3AYWC 3B6FC 1M1AB 4YS3A 4H9OB 4JJNC 1U35C 4R8PD 2HUEB 3WA9C 3LELC 1P3AC 3MVDB 3AZKC 3A6NC 1HQ3D 4XUJB 4J8WD 3B0CT 1P3KB 2IO5B 3W99D 4J8UA 3KUYD 5GT3D 1M18C 3WKJD 3NQUB 3VH5T 3KUYC 1P3AA 3MNNA 3B0CW 5B0YA 2FJ7A 2NQBC 3AZHA 1ZLAC 4J8WC 3AZFD 1P3FD 3UT9B 3RELD 5C3IB 1F66C 3WTPB 1EQZA 1P3GC 1AOIB 4WV4B 4J8VB 4JJND 1U35D 3B6FD 2LY8A 5GSUC 3AYWD 2BYKB 3UTBD 3AZEB 1KX5D 3AZGD 5B1MD 2CV5A 4Z5TC 5JA4B 5JRGC 3TU4D 5B1LC 4YM6B 1S32A 1P3PA 4NE6A 3W97C 2YFVA 3UTBB 3AZED 3UTAC 1BH8A 1H3OB 1P3OB 3AZLB 5CPIA 2NQBA 3AZMB 3REHA 3AN2D 4E44A 3AZMA 5B31A 3MGRD 1TZYC 4EO5B 3WTPC 2F8ND 3AZNB 3AV2A 5CPKC 5AVBB 1P3BB 4X23D 4J8VC 5B33D 5DNMC 3AZHC 1ZLAA 3W96C 5KDMA 3REIA 5CPJD 5GT0A 4J8XA 3AFAA 1KU5A 3C1BB 5AV6A 1P3BD 5JRGB 5B32A 3C1CD 4WU8A 3KWQD 1M1AC 5B24A 4J8VD 4JJNB 5AV5C 5B40C 1M19B 3AZLD 2HIOD 3O62B 3REJB 5AV9A 3RELB 1TZYD 3NQUA 1ID3A 3UTAA 5CPJA 3RELA 3AN2C 3TU4B 3X1SC 2AROA 5BNVA 1JFIA 4H9RB 3UTAD 3B6GD 3X1VB 1P3LA 5AV8C 3MNNC 2JSSA 5B1MC 5BS7C 1WWIA 4QLCA 3MGQA 3REIC 3REKA 4LD9A 5G49B 4AWLC 1EQZC 5B24D 3VH6W 5B40B 5G49A 5B32C 2BYMB 1F66D 4YS3D 4WU8C 3RELC 5GT3B 5B1MA 1P3FC 1ZLAD 4Z5TB 5B2IA 5GT0D 3MGPB 4J8XB 4XUJD 3X1UD 2PYOB 3W98C 3W99C 1ULYA 5AV8B 3AV1A 3AZIA 3LJAB 3AZJB 3AN2A 3KXBB 3LZ0C 3WAAB 3REHD 5BO0B 2CV5B 5E5AC 2AROB 1TAFB 4E45A 5B2IC 3REIB 3AZNC 5CPKB 5AVCC 3AFAB 4J8UD 3W99A 1S32B 3REJA 4Z66B 3AV1C 4G91C 4J8VA 1ID3D 2F8NK 3W98D 1KX3A 4WU8B 3LZ1A 3A6NB 3V9RA 1P3PD 3VH5A 4XUJC 4J8WA 3TU4A 5BNXB 4NE3A 3C1BC 4XZQC 3KXBD 1P3IC 1WWSA 3LJAD 3AZJD 3X1TB 4H9NB 3WAAD 3AZNA 3LZ1D 4J8XC 3AV2B 5GXQB 5CHLB 4WU8D 4ZUXC 4KHAA 5GXQA 3MGPD 1KX3C 5AV6D 5B0YD 4WNNB 1P3BA 2FJ7D 5B24C 3AFAD 5JA4A 2NZDC 5AV5A 4NE5A 2CV5C 5E5AB 5AVCA 5JRGA 3VH6T 5CP6A 5B31D 1P3GB 3X1SB 5B0YB 3MVDA 1AOIC 5DNND 2FJ7B 3AV1B
chains in the Genus database with same CATH superfamily
3X1UB 4CAYB 1N1JA 5B32G 3AV2C 5FUGB 5CPKA 5GXQC 4ZUXA 3X1VD 2PYOA 3AZEA 5GSUA 5F99D 3UTAB 5BT1C 5CP6D 3AZLC 4J8UB 5B0ZC 3B0DC 3B6FA 3LELB 2NZDB 4WU9C 5B0ZD 1P3AB 5CP6C 2Y2QA 3O62D 2F8NG 1M19D 3AV2D 4Z2MG 2IO5C 1P3BC 2VQRA 2BYKA 3R45A 3W96B 2L5AA 3H0LC 3X1VA 1M18B 2PYOD 3KWQB 3R45B 3W98B 5DNMD 5B33C 4X23C 1ZLAB 3AL0C 3AZIC 5DNMA 5CPKD 2RVQD 5AY8C 4QLCB 3X1SA 2HIOA 3MGQB 5CPJB 2AROC 5B2IB 5GT3A 1F66B 4H9QA 2HIOB 3MGRC 4ZBJB 5AVCB 5E5AA 3REKB 4LD9B 4H9QB 3AFAC 5AV6C 2ZM5A 1P3LB 4G91B 3AZEC 2DQNC 5FUGA 3C1CB 5AY8A 3LZ1C 3TU4C 5JRGD 4XUJA 4KGCC 3C1BD 4YM6C 2Y2GA 4WU9A 1P3OD 3W97B 4Z2MH 5AV9B 1P3PC 1KX5C 5B33A 4ZUXB 1N1JB 1ID3C 1P3OC 4YM6D 1KX3B 5B24B 3WKJA 4H9RA 3AZND 2F8NB 1TZYB 3MGRA 2NZDA 4EO5C 4KGCA 3REJD 3AYWB 1P3MC 3MGSB 3B6FB 3AZFC 5B2JB 2NQBD 2HUEC 3LZ0D 3P5JB 3MGSD 3MVDC 1AOIA 5BS7A 3AZKB 3B6GB 3B0BA 3WKJC 3X1UC 3B6GA 4YM6A 1P3KC 5GT0C 2Y2PA 2ZY4A 2ZY5A 1M18A 2F8NH 4H9NA 4DRAA 1HQ3C 3AZGB 1KX5B 3AZKD 3KUYB 1P34B 3W99B 5AV5B 5B0ZA 3LZ0B 5AVBD 3AZLA 1M19C 2NQBB 4WNNA 4J8WB 5B40A 3O62C 1Q9CA 5C3IC 1B6WA 3UT9D 3AZFB 3LJAA 3AZJA 3AN2B 3WAAA 2UWXA 3REKD 4LD9D 1BH9A 5DNNA 5B31G 3B6GC 1T3UA 3X1VC 2W8SA 3H0RC 5B33B 3WA9A 4CAYA 2CWEA 4X23B 1KX4A 5AV8A 5B1MB 3MGPA 2HIOC 3MGRB 4H9PA 1P3LD 4KUDC 3KSYA 3REKC 1U35B 1AOID 1P3KA 4LD9C 3O62A 5AV5D 5B31C 3AZMD 4HGAC 3VH6A 4UUZB 1M1AD 1P34D 1KX4C 2JCHA 3WTPA 3KXBA 1P3FB 3C1CC 4CSRA 2NZDD 4UPKA 1HTAA 5AVBC 1KX3D 3W96A 3MGPC 5DNMB 3KWQA 4ZUXD 5F99B 1F66A 4DRBA 1JFIB 4G92C 3W96D 1F1EA 3W98A 3KXBC 4XZQD 1P3ID 1P3KD 4M6BA 3V9RB 5B2JD 3A6NA 3C1CA 3WTPD 2Y2HA 2Y2LA 3MVDD 3MGSC 3A1KA 4H9OA 3AV1D 1P3MA 4J8UC 3B0DB 5DNNB 2FFFB 5B31B 5AVCD 1S32C 3W97A 5GSUB 3REJC 4X23A 5B2ID 5E5AD 1P3MD 1KX4B 3WKJB 5AV9D 3W97D 3X1UA 3NQJA 3REHC 5B1LB 4XZQA 1P3IA 2JE5A 1HQ3B 4NFTA 3AZGC 1P3GA 3UTBC 5CPID 4G92B 4KGCD 5AVBA 4R8PB 4H9PB 1P3GD 4QLCC 3MGQC 1M19A 1Z2CB 4YS3C 3EG5B 5B32D 4QLCD 3MGQD 4JJNA 2J8PA 3LELA 3VH5W 4AWLB 1KX5A 3WA9B 1EQZD 5AV6B 1BH8B 3AZHB 5B32B 5CPIC 3REID 2AROD 1BFMA 1M18D 5GT3C 2RVQC 5AY8D 1H3OA 3MGSA 3AZID 4H9SC 3LZ1B 3REHB 3MNND 1TZYA 5BNXA 5AV8D 2Y2KA 1R4VA 5AV9C 3KUYA 5B2JA 3A6ND 2PYOC 4WZSB 1BH9B 4KUDB 5KDMB 1P3AD 5B0ZB 3LZ0A 1S32D 3LELD 3X1SD 4R8PC 3WA9D 4KUDA 4WU9B 4HGAB 5CP6B 3AZGA 4YS3B 1P3MB 2YFVB 3UTBA 4WU9D 1P3OA 5B40D 5B2JC 2ZY3A 4Z66C 5BT1D 1P34A 5CPIB 5F99C 3KWQC 3AYWA 4H9SA 5GXQD 3C1BA 5BO0A 4Z5TA 3AZFA 5GT0B 5B1LA 4XZQB 1P3IB 3MNNB 3X1TC 3AZIB 5AY8B 5CPJC 3AZKA 2F8NA 1KX4D 3A1IA 1P3FA 4Z66A 1A7WA 1P34C 4ZBJC 3AZHD 1EQZB 5DNNC 3AZMC 4UUZA 1B67A 1P3LC 4KUDD 1TAFA 1HQ3A 3X1TA 2CV5D 4CSRB 3UT9A 3X1TD 5B0YC 2FJ7C 4KHAB 4KGCB 4R8PA 5BNVB 1P3PB 1U35A 2YFWB 1ID3B 2Y2NA 2BYMA 4Z66D 5B1LD 3EPJA 2YFWA 4J8XD 3WAAC 4Z5TD 3LJAC 3AZJC 3WTPE 3NQJB 3UT9C 1M1AA 5F99A 5GSUD 1PZRA 2F2AC 3AYWC 3B6FC 1M1AB 4YS3A 4H9OB 4JJNC 1U35C 2DF4C 2HUEB 4R8PD 3WA9C 3LELC 1P3AC 3MVDB 3AZKC 3A6NC 1HQ3D 4XUJB 4J8WD 3B0CT 1P3KB 2IO5B 3EPKA 3W99D 4J8UA 3KUYD 5GT3D 1M18C 3WKJD 3NQUB 3VH5T 3KUYC 1P3AA 3MNNA 2Y2JA 3B0CW 5B0YA 2FJ7A 2NQBC 2ZY2A 3AZHA 1ZLAC 4J8WC 3FDDA 3AZFD 1P3FD 3UT9B 3RELD 5C3IB 1F66C 3WTPB 1EQZA 1P3GC 4WJ3C 1AOIB 4WV4B 4J8VB 4JJND 1U35D 3B6FD 2LY8A 5GSUC 3AYWD 2BYKB 3UTBD 3AZEB 1KX5D 3AZGD 5B1MD 2CV5A 3H0MC 4Z5TC 5JA4B 5JRGC 3TU4D 5B1LC 4YM6B 1S32A 1P3PA 4NE6A 3W97C 2YFVA 3UTBB 3AZED 3UTAC 1BH8A 1H3OB 1P3OB 3AZLB 5CPIA 2NQBA 3AZMB 3REHA 3AN2D 4E44A 3AZMA 5B31A 1W2EA 3MGRD 1TZYC 4EO5B 3WTPC 2F8ND 3AZNB 3AV2A 5CPKC 5AVBB 1P3BB 4X23D 4J8VC 5B33D 5DNMC 3AZHC 1ZLAA 3W96C 5KDMA 3REIA 5CPJD 5GT0A 4J8XA 3AFAA 1KU5A 3C1BB 2Y2MA 5AV6A 1P3BD 5JRGB 5B32A 3C1CD 4WU8A 3KWQD 1M1AC 5B24A 4J8VD 4JJNB 5AV5C 5B40C 1M19B 3AZLD 2HIOD 3O62B 3REJB 5AV9A 3RELB 1TZYD 3IP4C 3NQUA 1ID3A 3UTAA 5CPJA 3EPLA 3RELA 3AN2C 3TU4B 3X1SC 2AROA 5BNVA 2XD5A 1JFIA 4H9RB 3UTAD 3EPHA 3B6GD 3X1VB 1P3LA 5AV8C 2Y2OA 3MNNC 2JSSA 5B1MC 5BS7C 1WWIA 4QLCA 3MGQA 3REIC 3REKA 4LD9A 5G49B 4AWLC 1EQZC 5B24D 3VH6W 5B40B 2Y2IA 5G49A 5B32C 2BYMB 1F66D 4YS3D 4WU8C 3RELC 5GT3B 5B1MA 1P3FC 1ZLAD 4Z5TB 2BG1A 5B2IA 5GT0D 3MGPB 4J8XB 4XUJD 3X1UD 4DQYB 2PYOB 3W98C 3W99C 1ULYA 5AV8B 3AV1A 3AZIA 3LJAB 3AZJB 3AN2A 3KXBB 3LZ0C 3WAAB 3REHD 2G5IC 2XD1A 5BO0B 2CV5B 5E5AC 5B2IC 2AROB 1TAFB 4E45A 3REIB 3AZNC 5CPKB 5AVCC 3AFAB 4J8UD 3W99A 1S32B 3REJA 4Z66B 3AV1C 4G91C 4J8VA 1ID3D 2F8NK 3W98D 1KX3A 4WU8B 3LZ1A 3V9RA 3A6NB 1P3PD 3VH5A 4XUJC 4J8WA 3TU4A 5BNXB 4NE3A 3C1BC 4XZQC 3KXBD 1P3IC 1WWSA 3LJAD 3AZJD 3X1TB 4H9NB 3WAAD 3AZNA 3LZ1D 4J8XC 3AV2B 5GXQB 5CHLB 4WU8D 4ZUXC 4KHAA 5GXQA 3MGPD 3KFUG 1KX3C 5AV6D 5B0YD 4WNNB 1P3BA 2FJ7D 3F6TA 5B24C 5JA4A 3AFAD 2NZDC 5AV5A 2G5HC 4NE5A 2CV5C 5E5AB 5AVCA 5JRGA 3VH6T 5CP6A 2RIQA 5B31D 1P3GB 3X1SB 5B0YB 3MVDA 1AOIC 5DNND 2FJ7B 3AV1B
chains in the Genus database with same CATH topology
3X1UB 4CAYB 1N1JA 5B32G 3AV2C 5FUGB 5CPKA 5GXQC 4ZUXA 3X1VD 2PYOA 3AZEA 5GSUA 5F99D 3UTAB 5BT1C 5CP6D 3AZLC 4J8UB 5B0ZC 3B0DC 3B6FA 3LELB 2NZDB 4WU9C 5B0ZD 1P3AB 5CP6C 2Y2QA 3O62D 2F8NG 1M19D 3AV2D 4Z2MG 2IO5C 1P3BC 2VQRA 2BYKA 3R45A 3W96B 2L5AA 3H0LC 3X1VA 1M18B 2PYOD 3KWQB 3R45B 3W98B 5DNMD 5B33C 4X23C 1ZLAB 3AL0C 3AZIC 5DNMA 5CPKD 2RVQD 5AY8C 4QLCB 3X1SA 2HIOA 3MGQB 5CPJB 2AROC 5B2IB 5GT3A 1F66B 4H9QA 2HIOB 3MGRC 4ZBJB 5AVCB 5E5AA 3REKB 4LD9B 4H9QB 3AFAC 5AV6C 2ZM5A 1P3LB 4G91B 3AZEC 2DQNC 5FUGA 3C1CB 5AY8A 3LZ1C 3TU4C 5JRGD 4XUJA 4KGCC 3C1BD 4YM6C 2Y2GA 4WU9A 1P3OD 3W97B 4Z2MH 5AV9B 1P3PC 1KX5C 5B33A 4ZUXB 1N1JB 1ID3C 1P3OC 4YM6D 1KX3B 5B24B 3WKJA 4H9RA 3AZND 2F8NB 1TZYB 3MGRA 2NZDA 4EO5C 4KGCA 3REJD 3AYWB 1P3MC 3MGSB 3B6FB 3AZFC 5B2JB 2NQBD 2HUEC 3LZ0D 3P5JB 3MGSD 3MVDC 1AOIA 5BS7A 3AZKB 3B6GB 3B0BA 3WKJC 3X1UC 3B6GA 4YM6A 1P3KC 5GT0C 2Y2PA 2ZY4A 2ZY5A 1M18A 2F8NH 4H9NA 4DRAA 1HQ3C 3AZGB 1KX5B 3AZKD 3KUYB 1P34B 3W99B 5AV5B 5B0ZA 3LZ0B 5AVBD 3AZLA 1M19C 2NQBB 4WNNA 4J8WB 5B40A 3O62C 1Q9CA 5C3IC 1B6WA 3UT9D 3AZFB 3LJAA 3AZJA 3AN2B 3WAAA 2UWXA 3REKD 4LD9D 1BH9A 5DNNA 5B31G 3B6GC 1T3UA 3X1VC 2W8SA 3H0RC 5B33B 3WA9A 4CAYA 2CWEA 4X23B 1KX4A 5AV8A 5B1MB 3MGPA 2HIOC 3MGRB 4H9PA 1P3LD 4KUDC 3KSYA 3REKC 1U35B 1AOID 1P3KA 4LD9C 3O62A 5AV5D 5B31C 3AZMD 4HGAC 3VH6A 4UUZB 1M1AD 1P34D 1KX4C 2JCHA 3WTPA 3KXBA 1P3FB 3C1CC 4CSRA 2NZDD 4UPKA 1HTAA 5AVBC 1KX3D 3W96A 3MGPC 5DNMB 3KWQA 4ZUXD 5F99B 1F66A 4DRBA 1JFIB 4G92C 3W96D 1F1EA 3W98A 3KXBC 4XZQD 1P3ID 1P3KD 4M6BA 3V9RB 5B2JD 3A6NA 3C1CA 3WTPD 2Y2HA 2Y2LA 3MVDD 3MGSC 3A1KA 4H9OA 3AV1D 1P3MA 4J8UC 3B0DB 5DNNB 2FFFB 5B31B 5AVCD 1S32C 3W97A 5GSUB 3REJC 4X23A 5B2ID 5E5AD 1P3MD 1KX4B 3WKJB 5AV9D 3W97D 3X1UA 3NQJA 3REHC 5B1LB 4XZQA 1P3IA 2JE5A 1HQ3B 4NFTA 3AZGC 1P3GA 3UTBC 5CPID 4G92B 4KGCD 5AVBA 4R8PB 4H9PB 1P3GD 4QLCC 3MGQC 1M19A 1Z2CB 4YS3C 3EG5B 5B32D 4QLCD 3MGQD 4JJNA 2J8PA 3LELA 3VH5W 4AWLB 1KX5A 3WA9B 1EQZD 5AV6B 1BH8B 3AZHB 5B32B 5CPIC 3REID 2AROD 1BFMA 1M18D 5GT3C 2RVQC 5AY8D 1H3OA 3MGSA 3AZID 4H9SC 3LZ1B 3REHB 3MNND 1TZYA 5BNXA 5AV8D 2Y2KA 1R4VA 5AV9C 3KUYA 5B2JA 3A6ND 2PYOC 4WZSB 1BH9B 4KUDB 5KDMB 1P3AD 5B0ZB 3LZ0A 1S32D 3LELD 3X1SD 4R8PC 3WA9D 4KUDA 4WU9B 4HGAB 5CP6B 3AZGA 4YS3B 1P3MB 2YFVB 3UTBA 4WU9D 1P3OA 5B40D 5B2JC 2ZY3A 4Z66C 5BT1D 1P34A 5CPIB 5F99C 3KWQC 3AYWA 4H9SA 5GXQD 3C1BA 5BO0A 4Z5TA 3AZFA 5GT0B 5B1LA 4XZQB 1P3IB 3MNNB 3X1TC 3AZIB 5AY8B 5CPJC 3AZKA 2F8NA 1KX4D 3A1IA 1P3FA 4Z66A 1A7WA 1P34C 4ZBJC 3AZHD 1EQZB 5DNNC 3AZMC 4UUZA 1B67A 1P3LC 4KUDD 1TAFA 1HQ3A 3X1TA 2CV5D 4CSRB 3UT9A 3X1TD 5B0YC 2FJ7C 4KHAB 4KGCB 4R8PA 5BNVB 1P3PB 1U35A 2YFWB 1ID3B 2Y2NA 2BYMA 4Z66D 5B1LD 3EPJA 2YFWA 4J8XD 3WAAC 4Z5TD 3LJAC 3AZJC 3WTPE 3NQJB 3UT9C 1M1AA 5F99A 5GSUD 1PZRA 2F2AC 3AYWC 3B6FC 1M1AB 4YS3A 4H9OB 4JJNC 1U35C 2DF4C 2HUEB 4R8PD 3WA9C 3LELC 1P3AC 3MVDB 3AZKC 3A6NC 1HQ3D 4XUJB 4J8WD 3B0CT 1P3KB 2IO5B 3EPKA 3W99D 4J8UA 3KUYD 5GT3D 1M18C 3WKJD 3NQUB 3VH5T 3KUYC 1P3AA 3MNNA 2Y2JA 3B0CW 5B0YA 2FJ7A 2NQBC 2ZY2A 3AZHA 1ZLAC 4J8WC 3FDDA 3AZFD 1P3FD 3UT9B 3RELD 5C3IB 1F66C 3WTPB 1EQZA 1P3GC 4WJ3C 1AOIB 4WV4B 4J8VB 4JJND 1U35D 3B6FD 2LY8A 5GSUC 3AYWD 2BYKB 3UTBD 3AZEB 1KX5D 3AZGD 5B1MD 2CV5A 3H0MC 4Z5TC 5JA4B 5JRGC 3TU4D 5B1LC 4YM6B 1S32A 1P3PA 4NE6A 3W97C 2YFVA 3UTBB 3AZED 3UTAC 1BH8A 1H3OB 1P3OB 3AZLB 5CPIA 2NQBA 3AZMB 3REHA 3AN2D 4E44A 3AZMA 5B31A 1W2EA 3MGRD 1TZYC 4EO5B 3WTPC 2F8ND 3AZNB 3AV2A 5CPKC 5AVBB 1P3BB 4X23D 4J8VC 5B33D 5DNMC 3AZHC 1ZLAA 3W96C 5KDMA 3REIA 5CPJD 5GT0A 4J8XA 3AFAA 1KU5A 3C1BB 2Y2MA 5AV6A 1P3BD 5JRGB 5B32A 3C1CD 4WU8A 3KWQD 1M1AC 5B24A 4J8VD 4JJNB 5AV5C 5B40C 1M19B 3AZLD 2HIOD 3O62B 3REJB 5AV9A 3RELB 1TZYD 3IP4C 3NQUA 1ID3A 3UTAA 5CPJA 3EPLA 3RELA 3AN2C 3TU4B 3X1SC 2AROA 5BNVA 2XD5A 1JFIA 4H9RB 3UTAD 3EPHA 3B6GD 3X1VB 1P3LA 5AV8C 2Y2OA 3MNNC 2JSSA 5B1MC 5BS7C 1WWIA 4QLCA 3MGQA 3REIC 3REKA 4LD9A 5G49B 4AWLC 1EQZC 5B24D 3VH6W 5B40B 2Y2IA 5G49A 5B32C 2BYMB 1F66D 4YS3D 4WU8C 3RELC 5GT3B 5B1MA 1P3FC 1ZLAD 4Z5TB 2BG1A 5B2IA 5GT0D 3MGPB 4J8XB 4XUJD 3X1UD 4DQYB 2PYOB 3W98C 3W99C 1ULYA 5AV8B 3AV1A 3AZIA 3LJAB 3AZJB 3AN2A 3KXBB 3LZ0C 3WAAB 3REHD 2G5IC 2XD1A 5BO0B 2CV5B 5E5AC 5B2IC 2AROB 1TAFB 4E45A 3REIB 3AZNC 5CPKB 5AVCC 3AFAB 4J8UD 3W99A 1S32B 3REJA 4Z66B 3AV1C 4G91C 4J8VA 1ID3D 2F8NK 3W98D 1KX3A 4WU8B 3LZ1A 3V9RA 3A6NB 1P3PD 3VH5A 4XUJC 4J8WA 3TU4A 5BNXB 4NE3A 3C1BC 4XZQC 3KXBD 1P3IC 1WWSA 3LJAD 3AZJD 3X1TB 4H9NB 3WAAD 3AZNA 3LZ1D 4J8XC 3AV2B 5GXQB 5CHLB 4WU8D 4ZUXC 4KHAA 5GXQA 3MGPD 3KFUG 1KX3C 5AV6D 5B0YD 4WNNB 1P3BA 2FJ7D 3F6TA 5B24C 5JA4A 3AFAD 2NZDC 5AV5A 2G5HC 4NE5A 2CV5C 5E5AB 5AVCA 5JRGA 3VH6T 5CP6A 2RIQA 5B31D 1P3GB 3X1SB 5B0YB 3MVDA 1AOIC 5DNND 2FJ7B 3AV1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U B;  4CAY B;  1N1J A;  5B32 G;  3AV2 C;  5FUG B;  5CPK A;  5GXQ C;  4ZUX A;  3X1V D;  2PYO A;  3AZE A;  5GSU A;  5F99 D;  3UTA B;  5BT1 C;  5CP6 D;  3AZL C;  4J8U B;  5B0Z C;  3B0D C;  3B6F A;  3LEL B;  2NZD B;  4WU9 C;  5B0Z D;  1P3A B;  5CP6 C;  3O62 D;  2F8N G;  1M19 D;  3AV2 D;  4Z2M G;  2IO5 C;  1P3B C;  2BYK A;  3R45 A;  3W96 B;  2L5A A;  1M18 B;  3X1V A;  2PYO D;  3KWQ B;  3R45 B;  3W98 B;  5DNM D;  5B33 C;  4X23 C;  1ZLA B;  3AZI C;  5DNM A;  5CPK D;  2RVQ D;  5AY8 C;  4QLC B;  3X1S A;  2HIO A;  3MGQ B;  5CPJ B;  2ARO C;  5B2I B;  5GT3 A;  1F66 B;  4H9Q A;  2HIO B;  3MGR C;  4ZBJ B;  5AVC B;  5E5A A;  3REK B;  4LD9 B;  4H9Q B;  3AFA C;  5AV6 C;  1P3L B;  4G91 B;  3AZE C;  5FUG A;  3C1C B;  5AY8 A;  3LZ1 C;  3TU4 C;  5JRG D;  4XUJ A;  4KGC C;  3C1B D;  4YM6 C;  4WU9 A;  1P3O D;  3W97 B;  4Z2M H;  5AV9 B;  1P3P C;  1KX5 C;  5B33 A;  4ZUX B;  1N1J B;  1ID3 C;  1P3O C;  4YM6 D;  1KX3 B;  5B24 B;  3WKJ A;  4H9R A;  3AZN D;  2F8N B;  1TZY B;  3MGR A;  2NZD A;  4EO5 C;  4KGC A;  3REJ D;  3AYW B;  1P3M C;  3MGS B;  3B6F B;  3AZF C;  5B2J B;  2NQB D;  2HUE C;  3LZ0 D;  3MGS D;  3MVD C;  1AOI A;  5BS7 A;  3AZK B;  3B6G B;  3B0B A;  3WKJ C;  3X1U C;  3B6G A;  4YM6 A;  1P3K C;  5GT0 C;  1M18 A;  2F8N H;  4H9N A;  4DRA A;  1HQ3 C;  3AZG B;  1KX5 B;  3AZK D;  3KUY B;  1P34 B;  3W99 B;  5AV5 B;  5B0Z A;  3LZ0 B;  5AVB D;  3AZL A;  1M19 C;  2NQB B;  4WNN A;  4J8W B;  5B40 A;  3O62 C;  1Q9C A;  5C3I C;  1B6W A;  3UT9 D;  3AZF B;  3LJA A;  3AZJ A;  3AN2 B;  3WAA A;  3REK D;  4LD9 D;  1BH9 A;  5DNN A;  5B31 G;  3B6G C;  3X1V C;  5B33 B;  3WA9 A;  4CAY A;  2CWE A;  4X23 B;  1KX4 A;  5AV8 A;  5B1M B;  3MGP A;  2HIO C;  3MGR B;  4H9P A;  1P3L D;  4KUD C;  3KSY A;  3REK C;  1U35 B;  1AOI D;  1P3K A;  4LD9 C;  3O62 A;  5AV5 D;  5B31 C;  3AZM D;  4HGA C;  3VH6 A;  4UUZ B;  1M1A D;  1P34 D;  1KX4 C;  3WTP A;  3KXB A;  1P3F B;  3C1C C;  4CSR A;  2NZD D;  1HTA A;  5AVB C;  1KX3 D;  3W96 A;  3MGP C;  5DNM B;  3KWQ A;  4ZUX D;  5F99 B;  1F66 A;  4DRB A;  1JFI B;  4G92 C;  3W96 D;  1F1E A;  3W98 A;  3KXB C;  4XZQ D;  1P3I D;  1P3K D;  4M6B A;  3V9R B;  5B2J D;  3A6N A;  3C1C A;  3WTP D;  3MVD D;  3MGS C;  4H9O A;  3AV1 D;  1P3M A;  4J8U C;  3B0D B;  5DNN B;  5B31 B;  5AVC D;  1S32 C;  3W97 A;  5GSU B;  3REJ C;  4X23 A;  5B2I D;  5E5A D;  1P3M D;  1KX4 B;  3WKJ B;  5AV9 D;  3W97 D;  3X1U A;  3NQJ A;  3REH C;  5B1L B;  4XZQ A;  1P3I A;  1HQ3 B;  4NFT A;  3AZG C;  1P3G A;  3UTB C;  5CPI D;  4G92 B;  4KGC D;  5AVB A;  4R8P B;  4H9P B;  1P3G D;  4QLC C;  3MGQ C;  1M19 A;  4YS3 C;  5B32 D;  4QLC D;  3MGQ D;  4JJN A;  3LEL A;  3VH5 W;  4AWL B;  1KX5 A;  3WA9 B;  1EQZ D;  5AV6 B;  1BH8 B;  3AZH B;  5B32 B;  5CPI C;  3REI D;  2ARO D;  1BFM A;  1M18 D;  5GT3 C;  2RVQ C;  5AY8 D;  1H3O A;  3MGS A;  3AZI D;  4H9S C;  3LZ1 B;  3REH B;  3MNN D;  1TZY A;  5BNX A;  5AV8 D;  1R4V A;  5AV9 C;  3KUY A;  5B2J A;  3A6N D;  2PYO C;  4WZS B;  1BH9 B;  4KUD B;  5KDM B;  1P3A D;  5B0Z B;  3LZ0 A;  1S32 D;  3LEL D;  3X1S D;  4R8P C;  3WA9 D;  4KUD A;  4WU9 B;  4HGA B;  5CP6 B;  3AZG A;  4YS3 B;  1P3M B;  2YFV B;  3UTB A;  4WU9 D;  1P3O A;  5B40 D;  5B2J C;  4Z66 C;  5BT1 D;  1P34 A;  5CPI B;  5F99 C;  3KWQ C;  3AYW A;  4H9S A;  5GXQ D;  3C1B A;  5BO0 A;  4Z5T A;  3AZF A;  5GT0 B;  5B1L A;  4XZQ B;  1P3I B;  3MNN B;  3X1T C;  3AZI B;  5AY8 B;  5CPJ C;  3AZK A;  2F8N A;  1KX4 D;  1P3F A;  4Z66 A;  1A7W A;  1P34 C;  4ZBJ C;  3AZH D;  1EQZ B;  5DNN C;  3AZM C;  4UUZ A;  1B67 A;  1P3L C;  4KUD D;  1TAF A;  1HQ3 A;  3X1T A;  2CV5 D;  4CSR B;  3UT9 A;  3X1T D;  5B0Y C;  2FJ7 C;  4KHA B;  4KGC B;  4R8P A;  5BNV B;  1P3P B;  1U35 A;  2YFW B;  1ID3 B;  4J8X D;  2BYM A;  4Z66 D;  5B1L D;  2YFW A;  3WAA C;  4Z5T D;  3LJA C;  3AZJ C;  3WTP E;  3NQJ B;  3UT9 C;  1M1A A;  5F99 A;  5GSU D;  3AYW C;  3B6F C;  1M1A B;  4YS3 A;  4H9O B;  4JJN C;  1U35 C;  4R8P D;  2HUE B;  3WA9 C;  3LEL C;  1P3A C;  3MVD B;  3AZK C;  3A6N C;  1HQ3 D;  4XUJ B;  4J8W D;  3B0C T;  1P3K B;  2IO5 B;  3W99 D;  4J8U A;  3KUY D;  5GT3 D;  1M18 C;  3WKJ D;  3NQU B;  3VH5 T;  3KUY C;  1P3A A;  3MNN A;  3B0C W;  5B0Y A;  2FJ7 A;  2NQB C;  3AZH A;  1ZLA C;  4J8W C;  3AZF D;  1P3F D;  3UT9 B;  3REL D;  5C3I B;  1F66 C;  3WTP B;  1EQZ A;  1P3G C;  1AOI B;  4WV4 B;  4J8V B;  4JJN D;  1U35 D;  3B6F D;  2LY8 A;  5GSU C;  3AYW D;  2BYK B;  3UTB D;  3AZE B;  1KX5 D;  3AZG D;  5B1M D;  2CV5 A;  4Z5T C;  5JA4 B;  5JRG C;  3TU4 D;  5B1L C;  4YM6 B;  1S32 A;  1P3P A;  4NE6 A;  3W97 C;  2YFV A;  3UTB B;  3AZE D;  3UTA C;  1BH8 A;  1H3O B;  1P3O B;  3AZL B;  5CPI A;  2NQB A;  3AZM B;  3REH A;  3AN2 D;  4E44 A;  3AZM A;  5B31 A;  3MGR D;  1TZY C;  4EO5 B;  3WTP C;  2F8N D;  3AZN B;  3AV2 A;  5CPK C;  5AVB B;  1P3B B;  4X23 D;  4J8V C;  5B33 D;  5DNM C;  3AZH C;  1ZLA A;  3W96 C;  5KDM A;  3REI A;  5CPJ D;  5GT0 A;  4J8X A;  3AFA A;  1KU5 A;  3C1B B;  5AV6 A;  1P3B D;  5JRG B;  5B32 A;  3C1C D;  4WU8 A;  3KWQ D;  1M1A C;  5B24 A;  4J8V D;  4JJN B;  5AV5 C;  5B40 C;  1M19 B;  3AZL D;  2HIO D;  3O62 B;  3REJ B;  5AV9 A;  3REL B;  1TZY D;  3NQU A;  1ID3 A;  3UTA A;  5CPJ A;  3REL A;  3AN2 C;  3TU4 B;  3X1S C;  2ARO A;  5BNV A;  1JFI A;  4H9R B;  3UTA D;  3B6G D;  3X1V B;  1P3L A;  5AV8 C;  3MNN C;  2JSS A;  5B1M C;  5BS7 C;  1WWI A;  4QLC A;  3MGQ A;  3REI C;  3REK A;  4LD9 A;  5G49 B;  4AWL C;  1EQZ C;  5B24 D;  3VH6 W;  5B40 B;  5G49 A;  5B32 C;  2BYM B;  1F66 D;  4YS3 D;  4WU8 C;  3REL C;  5GT3 B;  5B1M A;  1P3F C;  1ZLA D;  4Z5T B;  5B2I A;  5GT0 D;  3MGP B;  4J8X B;  4XUJ D;  3X1U D;  2PYO B;  3W98 C;  3W99 C;  1ULY A;  5AV8 B;  3AV1 A;  3AZI A;  3LJA B;  3AZJ B;  3AN2 A;  3KXB B;  3LZ0 C;  3WAA B;  3REH D;  5BO0 B;  2CV5 B;  5E5A C;  2ARO B;  1TAF B;  4E45 A;  5B2I C;  3REI B;  3AZN C;  5CPK B;  5AVC C;  3AFA B;  4J8U D;  3W99 A;  1S32 B;  3REJ A;  4Z66 B;  3AV1 C;  4G91 C;  4J8V A;  1ID3 D;  2F8N K;  3W98 D;  1KX3 A;  4WU8 B;  3LZ1 A;  3A6N B;  3V9R A;  1P3P D;  3VH5 A;  4XUJ C;  4J8W A;  3TU4 A;  5BNX B;  4NE3 A;  3C1B C;  4XZQ C;  3KXB D;  1P3I C;  1WWS A;  3LJA D;  3AZJ D;  3X1T B;  4H9N B;  3WAA D;  3AZN A;  3LZ1 D;  4J8X C;  3AV2 B;  5GXQ B;  5CHL B;  4WU8 D;  4ZUX C;  4KHA A;  5GXQ A;  3MGP D;  1KX3 C;  5AV6 D;  5B0Y D;  4WNN B;  1P3B A;  2FJ7 D;  5B24 C;  3AFA D;  5JA4 A;  2NZD C;  5AV5 A;  4NE5 A;  2CV5 C;  5E5A B;  5AVC A;  5JRG A;  3VH6 T;  5CP6 A;  5B31 D;  1P3G B;  3X1S B;  5B0Y B;  3MVD A;  1AOI C;  5DNN D;  2FJ7 B;  3AV1 B; 
#chains in the Genus database with same CATH topology
 3X1U B;  4CAY B;  1N1J A;  5B32 G;  3AV2 C;  5FUG B;  5CPK A;  5GXQ C;  4ZUX A;  3X1V D;  2PYO A;  3AZE A;  5GSU A;  5F99 D;  3UTA B;  5BT1 C;  5CP6 D;  3AZL C;  4J8U B;  5B0Z C;  3B0D C;  3B6F A;  3LEL B;  2NZD B;  4WU9 C;  5B0Z D;  1P3A B;  5CP6 C;  2Y2Q A;  3O62 D;  2F8N G;  1M19 D;  3AV2 D;  4Z2M G;  2IO5 C;  1P3B C;  2VQR A;  2BYK A;  3R45 A;  3W96 B;  2L5A A;  3H0L C;  3X1V A;  1M18 B;  2PYO D;  3KWQ B;  3R45 B;  3W98 B;  5DNM D;  5B33 C;  4X23 C;  1ZLA B;  3AL0 C;  3AZI C;  5DNM A;  5CPK D;  2RVQ D;  5AY8 C;  4QLC B;  3X1S A;  2HIO A;  3MGQ B;  5CPJ B;  2ARO C;  5B2I B;  5GT3 A;  1F66 B;  4H9Q A;  2HIO B;  3MGR C;  4ZBJ B;  5AVC B;  5E5A A;  3REK B;  4LD9 B;  4H9Q B;  3AFA C;  5AV6 C;  2ZM5 A;  1P3L B;  4G91 B;  3AZE C;  2DQN C;  5FUG A;  3C1C B;  5AY8 A;  3LZ1 C;  3TU4 C;  5JRG D;  4XUJ A;  4KGC C;  3C1B D;  4YM6 C;  2Y2G A;  4WU9 A;  1P3O D;  3W97 B;  4Z2M H;  5AV9 B;  1P3P C;  1KX5 C;  5B33 A;  4ZUX B;  1N1J B;  1ID3 C;  1P3O C;  4YM6 D;  1KX3 B;  5B24 B;  3WKJ A;  4H9R A;  3AZN D;  2F8N B;  1TZY B;  3MGR A;  2NZD A;  4EO5 C;  4KGC A;  3REJ D;  3AYW B;  1P3M C;  3MGS B;  3B6F B;  3AZF C;  5B2J B;  2NQB D;  2HUE C;  3LZ0 D;  3P5J B;  3MGS D;  3MVD C;  1AOI A;  5BS7 A;  3AZK B;  3B6G B;  3B0B A;  3WKJ C;  3X1U C;  3B6G A;  4YM6 A;  1P3K C;  5GT0 C;  2Y2P A;  2ZY4 A;  2ZY5 A;  1M18 A;  2F8N H;  4H9N A;  4DRA A;  1HQ3 C;  3AZG B;  1KX5 B;  3AZK D;  3KUY B;  1P34 B;  3W99 B;  5AV5 B;  5B0Z A;  3LZ0 B;  5AVB D;  3AZL A;  1M19 C;  2NQB B;  4WNN A;  4J8W B;  5B40 A;  3O62 C;  1Q9C A;  5C3I C;  1B6W A;  3UT9 D;  3AZF B;  3LJA A;  3AZJ A;  3AN2 B;  3WAA A;  2UWX A;  3REK D;  4LD9 D;  1BH9 A;  5DNN A;  5B31 G;  3B6G C;  1T3U A;  3X1V C;  2W8S A;  3H0R C;  5B33 B;  3WA9 A;  4CAY A;  2CWE A;  4X23 B;  1KX4 A;  5AV8 A;  5B1M B;  3MGP A;  2HIO C;  3MGR B;  4H9P A;  1P3L D;  4KUD C;  3KSY A;  3REK C;  1U35 B;  1AOI D;  1P3K A;  4LD9 C;  3O62 A;  5AV5 D;  5B31 C;  3AZM D;  4HGA C;  3VH6 A;  4UUZ B;  1M1A D;  1P34 D;  1KX4 C;  2JCH A;  3WTP A;  3KXB A;  1P3F B;  3C1C C;  4CSR A;  2NZD D;  4UPK A;  1HTA A;  5AVB C;  1KX3 D;  3W96 A;  3MGP C;  5DNM B;  3KWQ A;  4ZUX D;  5F99 B;  1F66 A;  4DRB A;  1JFI B;  4G92 C;  3W96 D;  1F1E A;  3W98 A;  3KXB C;  4XZQ D;  1P3I D;  1P3K D;  4M6B A;  3V9R B;  5B2J D;  3A6N A;  3C1C A;  3WTP D;  2Y2H A;  2Y2L A;  3MVD D;  3MGS C;  3A1K A;  4H9O A;  3AV1 D;  1P3M A;  4J8U C;  3B0D B;  5DNN B;  2FFF B;  5B31 B;  5AVC D;  1S32 C;  3W97 A;  5GSU B;  3REJ C;  4X23 A;  5B2I D;  5E5A D;  1P3M D;  1KX4 B;  3WKJ B;  5AV9 D;  3W97 D;  3X1U A;  3NQJ A;  3REH C;  5B1L B;  4XZQ A;  1P3I A;  2JE5 A;  1HQ3 B;  4NFT A;  3AZG C;  1P3G A;  3UTB C;  5CPI D;  4G92 B;  4KGC D;  5AVB A;  4R8P B;  4H9P B;  1P3G D;  4QLC C;  3MGQ C;  1M19 A;  1Z2C B;  4YS3 C;  3EG5 B;  5B32 D;  4QLC D;  3MGQ D;  4JJN A;  2J8P A;  3LEL A;  3VH5 W;  4AWL B;  1KX5 A;  3WA9 B;  1EQZ D;  5AV6 B;  1BH8 B;  3AZH B;  5B32 B;  5CPI C;  3REI D;  2ARO D;  1BFM A;  1M18 D;  5GT3 C;  2RVQ C;  5AY8 D;  1H3O A;  3MGS A;  3AZI D;  4H9S C;  3LZ1 B;  3REH B;  3MNN D;  1TZY A;  5BNX A;  5AV8 D;  2Y2K A;  1R4V A;  5AV9 C;  3KUY A;  5B2J A;  3A6N D;  2PYO C;  4WZS B;  1BH9 B;  4KUD B;  5KDM B;  1P3A D;  5B0Z B;  3LZ0 A;  1S32 D;  3LEL D;  3X1S D;  4R8P C;  3WA9 D;  4KUD A;  4WU9 B;  4HGA B;  5CP6 B;  3AZG A;  4YS3 B;  1P3M B;  2YFV B;  3UTB A;  4WU9 D;  1P3O A;  5B40 D;  5B2J C;  2ZY3 A;  4Z66 C;  5BT1 D;  1P34 A;  5CPI B;  5F99 C;  3KWQ C;  3AYW A;  4H9S A;  5GXQ D;  3C1B A;  5BO0 A;  4Z5T A;  3AZF A;  5GT0 B;  5B1L A;  4XZQ B;  1P3I B;  3MNN B;  3X1T C;  3AZI B;  5AY8 B;  5CPJ C;  3AZK A;  2F8N A;  1KX4 D;  3A1I A;  1P3F A;  4Z66 A;  1A7W A;  1P34 C;  4ZBJ C;  3AZH D;  1EQZ B;  5DNN C;  3AZM C;  4UUZ A;  1B67 A;  1P3L C;  4KUD D;  1TAF A;  1HQ3 A;  3X1T A;  2CV5 D;  4CSR B;  3UT9 A;  3X1T D;  5B0Y C;  2FJ7 C;  4KHA B;  4KGC B;  4R8P A;  5BNV B;  1P3P B;  1U35 A;  2YFW B;  1ID3 B;  2Y2N A;  2BYM A;  4Z66 D;  5B1L D;  3EPJ A;  2YFW A;  4J8X D;  3WAA C;  4Z5T D;  3LJA C;  3AZJ C;  3WTP E;  3NQJ B;  3UT9 C;  1M1A A;  5F99 A;  5GSU D;  1PZR A;  2F2A C;  3AYW C;  3B6F C;  1M1A B;  4YS3 A;  4H9O B;  4JJN C;  1U35 C;  2DF4 C;  2HUE B;  4R8P D;  3WA9 C;  3LEL C;  1P3A C;  3MVD B;  3AZK C;  3A6N C;  1HQ3 D;  4XUJ B;  4J8W D;  3B0C T;  1P3K B;  2IO5 B;  3EPK A;  3W99 D;  4J8U A;  3KUY D;  5GT3 D;  1M18 C;  3WKJ D;  3NQU B;  3VH5 T;  3KUY C;  1P3A A;  3MNN A;  2Y2J A;  3B0C W;  5B0Y A;  2FJ7 A;  2NQB C;  2ZY2 A;  3AZH A;  1ZLA C;  4J8W C;  3FDD A;  3AZF D;  1P3F D;  3UT9 B;  3REL D;  5C3I B;  1F66 C;  3WTP B;  1EQZ A;  1P3G C;  4WJ3 C;  1AOI B;  4WV4 B;  4J8V B;  4JJN D;  1U35 D;  3B6F D;  2LY8 A;  5GSU C;  3AYW D;  2BYK B;  3UTB D;  3AZE B;  1KX5 D;  3AZG D;  5B1M D;  2CV5 A;  3H0M C;  4Z5T C;  5JA4 B;  5JRG C;  3TU4 D;  5B1L C;  4YM6 B;  1S32 A;  1P3P A;  4NE6 A;  3W97 C;  2YFV A;  3UTB B;  3AZE D;  3UTA C;  1BH8 A;  1H3O B;  1P3O B;  3AZL B;  5CPI A;  2NQB A;  3AZM B;  3REH A;  3AN2 D;  4E44 A;  3AZM A;  5B31 A;  1W2E A;  3MGR D;  1TZY C;  4EO5 B;  3WTP C;  2F8N D;  3AZN B;  3AV2 A;  5CPK C;  5AVB B;  1P3B B;  4X23 D;  4J8V C;  5B33 D;  5DNM C;  3AZH C;  1ZLA A;  3W96 C;  5KDM A;  3REI A;  5CPJ D;  5GT0 A;  4J8X A;  3AFA A;  1KU5 A;  3C1B B;  2Y2M A;  5AV6 A;  1P3B D;  5JRG B;  5B32 A;  3C1C D;  4WU8 A;  3KWQ D;  1M1A C;  5B24 A;  4J8V D;  4JJN B;  5AV5 C;  5B40 C;  1M19 B;  3AZL D;  2HIO D;  3O62 B;  3REJ B;  5AV9 A;  3REL B;  1TZY D;  3IP4 C;  3NQU A;  1ID3 A;  3UTA A;  5CPJ A;  3EPL A;  3REL A;  3AN2 C;  3TU4 B;  3X1S C;  2ARO A;  5BNV A;  2XD5 A;  1JFI A;  4H9R B;  3UTA D;  3EPH A;  3B6G D;  3X1V B;  1P3L A;  5AV8 C;  2Y2O A;  3MNN C;  2JSS A;  5B1M C;  5BS7 C;  1WWI A;  4QLC A;  3MGQ A;  3REI C;  3REK A;  4LD9 A;  5G49 B;  4AWL C;  1EQZ C;  5B24 D;  3VH6 W;  5B40 B;  2Y2I A;  5G49 A;  5B32 C;  2BYM B;  1F66 D;  4YS3 D;  4WU8 C;  3REL C;  5GT3 B;  5B1M A;  1P3F C;  1ZLA D;  4Z5T B;  2BG1 A;  5B2I A;  5GT0 D;  3MGP B;  4J8X B;  4XUJ D;  3X1U D;  4DQY B;  2PYO B;  3W98 C;  3W99 C;  1ULY A;  5AV8 B;  3AV1 A;  3AZI A;  3LJA B;  3AZJ B;  3AN2 A;  3KXB B;  3LZ0 C;  3WAA B;  3REH D;  2G5I C;  2XD1 A;  5BO0 B;  2CV5 B;  5E5A C;  5B2I C;  2ARO B;  1TAF B;  4E45 A;  3REI B;  3AZN C;  5CPK B;  5AVC C;  3AFA B;  4J8U D;  3W99 A;  1S32 B;  3REJ A;  4Z66 B;  3AV1 C;  4G91 C;  4J8V A;  1ID3 D;  2F8N K;  3W98 D;  1KX3 A;  4WU8 B;  3LZ1 A;  3V9R A;  3A6N B;  1P3P D;  3VH5 A;  4XUJ C;  4J8W A;  3TU4 A;  5BNX B;  4NE3 A;  3C1B C;  4XZQ C;  3KXB D;  1P3I C;  1WWS A;  3LJA D;  3AZJ D;  3X1T B;  4H9N B;  3WAA D;  3AZN A;  3LZ1 D;  4J8X C;  3AV2 B;  5GXQ B;  5CHL B;  4WU8 D;  4ZUX C;  4KHA A;  5GXQ A;  3MGP D;  3KFU G;  1KX3 C;  5AV6 D;  5B0Y D;  4WNN B;  1P3B A;  2FJ7 D;  3F6T A;  5B24 C;  5JA4 A;  3AFA D;  2NZD C;  5AV5 A;  2G5H C;  4NE5 A;  2CV5 C;  5E5A B;  5AVC A;  5JRG A;  3VH6 T;  5CP6 A;  2RIQ A;  5B31 D;  1P3G B;  3X1S B;  5B0Y B;  3MVD A;  1AOI C;  5DNN D;  2FJ7 B;  3AV1 B; 
#chains in the Genus database with same CATH homology
 3X1U B;  4CAY B;  1N1J A;  5B32 G;  3AV2 C;  5FUG B;  5CPK A;  5GXQ C;  4ZUX A;  3X1V D;  2PYO A;  3AZE A;  5GSU A;  5F99 D;  3UTA B;  5BT1 C;  5CP6 D;  3AZL C;  4J8U B;  5B0Z C;  3B0D C;  3B6F A;  3LEL B;  2NZD B;  4WU9 C;  5B0Z D;  1P3A B;  5CP6 C;  2Y2Q A;  3O62 D;  2F8N G;  1M19 D;  3AV2 D;  4Z2M G;  2IO5 C;  1P3B C;  2VQR A;  2BYK A;  3R45 A;  3W96 B;  2L5A A;  3H0L C;  3X1V A;  1M18 B;  2PYO D;  3KWQ B;  3R45 B;  3W98 B;  5DNM D;  5B33 C;  4X23 C;  1ZLA B;  3AL0 C;  3AZI C;  5DNM A;  5CPK D;  2RVQ D;  5AY8 C;  4QLC B;  3X1S A;  2HIO A;  3MGQ B;  5CPJ B;  2ARO C;  5B2I B;  5GT3 A;  1F66 B;  4H9Q A;  2HIO B;  3MGR C;  4ZBJ B;  5AVC B;  5E5A A;  3REK B;  4LD9 B;  4H9Q B;  3AFA C;  5AV6 C;  2ZM5 A;  1P3L B;  4G91 B;  3AZE C;  2DQN C;  5FUG A;  3C1C B;  5AY8 A;  3LZ1 C;  3TU4 C;  5JRG D;  4XUJ A;  4KGC C;  3C1B D;  4YM6 C;  2Y2G A;  4WU9 A;  1P3O D;  3W97 B;  4Z2M H;  5AV9 B;  1P3P C;  1KX5 C;  5B33 A;  4ZUX B;  1N1J B;  1ID3 C;  1P3O C;  4YM6 D;  1KX3 B;  5B24 B;  3WKJ A;  4H9R A;  3AZN D;  2F8N B;  1TZY B;  3MGR A;  2NZD A;  4EO5 C;  4KGC A;  3REJ D;  3AYW B;  1P3M C;  3MGS B;  3B6F B;  3AZF C;  5B2J B;  2NQB D;  2HUE C;  3LZ0 D;  3P5J B;  3MGS D;  3MVD C;  1AOI A;  5BS7 A;  3AZK B;  3B6G B;  3B0B A;  3WKJ C;  3X1U C;  3B6G A;  4YM6 A;  1P3K C;  5GT0 C;  2Y2P A;  2ZY4 A;  2ZY5 A;  1M18 A;  2F8N H;  4H9N A;  4DRA A;  1HQ3 C;  3AZG B;  1KX5 B;  3AZK D;  3KUY B;  1P34 B;  3W99 B;  5AV5 B;  5B0Z A;  3LZ0 B;  5AVB D;  3AZL A;  1M19 C;  2NQB B;  4WNN A;  4J8W B;  5B40 A;  3O62 C;  1Q9C A;  5C3I C;  1B6W A;  3UT9 D;  3AZF B;  3LJA A;  3AZJ A;  3AN2 B;  3WAA A;  2UWX A;  3REK D;  4LD9 D;  1BH9 A;  5DNN A;  5B31 G;  3B6G C;  1T3U A;  3X1V C;  2W8S A;  3H0R C;  5B33 B;  3WA9 A;  4CAY A;  2CWE A;  4X23 B;  1KX4 A;  5AV8 A;  5B1M B;  3MGP A;  2HIO C;  3MGR B;  4H9P A;  1P3L D;  4KUD C;  3KSY A;  3REK C;  1U35 B;  1AOI D;  1P3K A;  4LD9 C;  3O62 A;  5AV5 D;  5B31 C;  3AZM D;  4HGA C;  3VH6 A;  4UUZ B;  1M1A D;  1P34 D;  1KX4 C;  2JCH A;  3WTP A;  3KXB A;  1P3F B;  3C1C C;  4CSR A;  2NZD D;  4UPK A;  1HTA A;  5AVB C;  1KX3 D;  3W96 A;  3MGP C;  5DNM B;  3KWQ A;  4ZUX D;  5F99 B;  1F66 A;  4DRB A;  1JFI B;  4G92 C;  3W96 D;  1F1E A;  3W98 A;  3KXB C;  4XZQ D;  1P3I D;  1P3K D;  4M6B A;  3V9R B;  5B2J D;  3A6N A;  3C1C A;  3WTP D;  2Y2H A;  2Y2L A;  3MVD D;  3MGS C;  3A1K A;  4H9O A;  3AV1 D;  1P3M A;  4J8U C;  3B0D B;  5DNN B;  2FFF B;  5B31 B;  5AVC D;  1S32 C;  3W97 A;  5GSU B;  3REJ C;  4X23 A;  5B2I D;  5E5A D;  1P3M D;  1KX4 B;  3WKJ B;  5AV9 D;  3W97 D;  3X1U A;  3NQJ A;  3REH C;  5B1L B;  4XZQ A;  1P3I A;  2JE5 A;  1HQ3 B;  4NFT A;  3AZG C;  1P3G A;  3UTB C;  5CPI D;  4G92 B;  4KGC D;  5AVB A;  4R8P B;  4H9P B;  1P3G D;  4QLC C;  3MGQ C;  1M19 A;  1Z2C B;  4YS3 C;  3EG5 B;  5B32 D;  4QLC D;  3MGQ D;  4JJN A;  2J8P A;  3LEL A;  3VH5 W;  4AWL B;  1KX5 A;  3WA9 B;  1EQZ D;  5AV6 B;  1BH8 B;  3AZH B;  5B32 B;  5CPI C;  3REI D;  2ARO D;  1BFM A;  1M18 D;  5GT3 C;  2RVQ C;  5AY8 D;  1H3O A;  3MGS A;  3AZI D;  4H9S C;  3LZ1 B;  3REH B;  3MNN D;  1TZY A;  5BNX A;  5AV8 D;  2Y2K A;  1R4V A;  5AV9 C;  3KUY A;  5B2J A;  3A6N D;  2PYO C;  4WZS B;  1BH9 B;  4KUD B;  5KDM B;  1P3A D;  5B0Z B;  3LZ0 A;  1S32 D;  3LEL D;  3X1S D;  4R8P C;  3WA9 D;  4KUD A;  4WU9 B;  4HGA B;  5CP6 B;  3AZG A;  4YS3 B;  1P3M B;  2YFV B;  3UTB A;  4WU9 D;  1P3O A;  5B40 D;  5B2J C;  2ZY3 A;  4Z66 C;  5BT1 D;  1P34 A;  5CPI B;  5F99 C;  3KWQ C;  3AYW A;  4H9S A;  5GXQ D;  3C1B A;  5BO0 A;  4Z5T A;  3AZF A;  5GT0 B;  5B1L A;  4XZQ B;  1P3I B;  3MNN B;  3X1T C;  3AZI B;  5AY8 B;  5CPJ C;  3AZK A;  2F8N A;  1KX4 D;  3A1I A;  1P3F A;  4Z66 A;  1A7W A;  1P34 C;  4ZBJ C;  3AZH D;  1EQZ B;  5DNN C;  3AZM C;  4UUZ A;  1B67 A;  1P3L C;  4KUD D;  1TAF A;  1HQ3 A;  3X1T A;  2CV5 D;  4CSR B;  3UT9 A;  3X1T D;  5B0Y C;  2FJ7 C;  4KHA B;  4KGC B;  4R8P A;  5BNV B;  1P3P B;  1U35 A;  2YFW B;  1ID3 B;  2Y2N A;  2BYM A;  4Z66 D;  5B1L D;  3EPJ A;  2YFW A;  4J8X D;  3WAA C;  4Z5T D;  3LJA C;  3AZJ C;  3WTP E;  3NQJ B;  3UT9 C;  1M1A A;  5F99 A;  5GSU D;  1PZR A;  2F2A C;  3AYW C;  3B6F C;  1M1A B;  4YS3 A;  4H9O B;  4JJN C;  1U35 C;  2DF4 C;  2HUE B;  4R8P D;  3WA9 C;  3LEL C;  1P3A C;  3MVD B;  3AZK C;  3A6N C;  1HQ3 D;  4XUJ B;  4J8W D;  3B0C T;  1P3K B;  2IO5 B;  3EPK A;  3W99 D;  4J8U A;  3KUY D;  5GT3 D;  1M18 C;  3WKJ D;  3NQU B;  3VH5 T;  3KUY C;  1P3A A;  3MNN A;  2Y2J A;  3B0C W;  5B0Y A;  2FJ7 A;  2NQB C;  2ZY2 A;  3AZH A;  1ZLA C;  4J8W C;  3FDD A;  3AZF D;  1P3F D;  3UT9 B;  3REL D;  5C3I B;  1F66 C;  3WTP B;  1EQZ A;  1P3G C;  4WJ3 C;  1AOI B;  4WV4 B;  4J8V B;  4JJN D;  1U35 D;  3B6F D;  2LY8 A;  5GSU C;  3AYW D;  2BYK B;  3UTB D;  3AZE B;  1KX5 D;  3AZG D;  5B1M D;  2CV5 A;  3H0M C;  4Z5T C;  5JA4 B;  5JRG C;  3TU4 D;  5B1L C;  4YM6 B;  1S32 A;  1P3P A;  4NE6 A;  3W97 C;  2YFV A;  3UTB B;  3AZE D;  3UTA C;  1BH8 A;  1H3O B;  1P3O B;  3AZL B;  5CPI A;  2NQB A;  3AZM B;  3REH A;  3AN2 D;  4E44 A;  3AZM A;  5B31 A;  1W2E A;  3MGR D;  1TZY C;  4EO5 B;  3WTP C;  2F8N D;  3AZN B;  3AV2 A;  5CPK C;  5AVB B;  1P3B B;  4X23 D;  4J8V C;  5B33 D;  5DNM C;  3AZH C;  1ZLA A;  3W96 C;  5KDM A;  3REI A;  5CPJ D;  5GT0 A;  4J8X A;  3AFA A;  1KU5 A;  3C1B B;  2Y2M A;  5AV6 A;  1P3B D;  5JRG B;  5B32 A;  3C1C D;  4WU8 A;  3KWQ D;  1M1A C;  5B24 A;  4J8V D;  4JJN B;  5AV5 C;  5B40 C;  1M19 B;  3AZL D;  2HIO D;  3O62 B;  3REJ B;  5AV9 A;  3REL B;  1TZY D;  3IP4 C;  3NQU A;  1ID3 A;  3UTA A;  5CPJ A;  3EPL A;  3REL A;  3AN2 C;  3TU4 B;  3X1S C;  2ARO A;  5BNV A;  2XD5 A;  1JFI A;  4H9R B;  3UTA D;  3EPH A;  3B6G D;  3X1V B;  1P3L A;  5AV8 C;  2Y2O A;  3MNN C;  2JSS A;  5B1M C;  5BS7 C;  1WWI A;  4QLC A;  3MGQ A;  3REI C;  3REK A;  4LD9 A;  5G49 B;  4AWL C;  1EQZ C;  5B24 D;  3VH6 W;  5B40 B;  2Y2I A;  5G49 A;  5B32 C;  2BYM B;  1F66 D;  4YS3 D;  4WU8 C;  3REL C;  5GT3 B;  5B1M A;  1P3F C;  1ZLA D;  4Z5T B;  2BG1 A;  5B2I A;  5GT0 D;  3MGP B;  4J8X B;  4XUJ D;  3X1U D;  4DQY B;  2PYO B;  3W98 C;  3W99 C;  1ULY A;  5AV8 B;  3AV1 A;  3AZI A;  3LJA B;  3AZJ B;  3AN2 A;  3KXB B;  3LZ0 C;  3WAA B;  3REH D;  2G5I C;  2XD1 A;  5BO0 B;  2CV5 B;  5E5A C;  5B2I C;  2ARO B;  1TAF B;  4E45 A;  3REI B;  3AZN C;  5CPK B;  5AVC C;  3AFA B;  4J8U D;  3W99 A;  1S32 B;  3REJ A;  4Z66 B;  3AV1 C;  4G91 C;  4J8V A;  1ID3 D;  2F8N K;  3W98 D;  1KX3 A;  4WU8 B;  3LZ1 A;  3V9R A;  3A6N B;  1P3P D;  3VH5 A;  4XUJ C;  4J8W A;  3TU4 A;  5BNX B;  4NE3 A;  3C1B C;  4XZQ C;  3KXB D;  1P3I C;  1WWS A;  3LJA D;  3AZJ D;  3X1T B;  4H9N B;  3WAA D;  3AZN A;  3LZ1 D;  4J8X C;  3AV2 B;  5GXQ B;  5CHL B;  4WU8 D;  4ZUX C;  4KHA A;  5GXQ A;  3MGP D;  3KFU G;  1KX3 C;  5AV6 D;  5B0Y D;  4WNN B;  1P3B A;  2FJ7 D;  3F6T A;  5B24 C;  5JA4 A;  3AFA D;  2NZD C;  5AV5 A;  2G5H C;  4NE5 A;  2CV5 C;  5E5A B;  5AVC A;  5JRG A;  3VH6 T;  5CP6 A;  2RIQ A;  5B31 D;  1P3G B;  3X1S B;  5B0Y B;  3MVD A;  1AOI C;  5DNN D;  2FJ7 B;  3AV1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...