5GXQB

The crystal structure of the nucleosome containing h3.6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqB00
4YM6C 3A6NA 4J8WA 1P3KB 5B24C 1P3BD 1P3GA 3REKC 4HGAC 5GSUB 2NZDD 4H9SC 1BFMA 4E45A 3NQJA 5E5AA 5GT3B 5DNMB 1M1AD 3NQUA 5AV8B 3TU4C 3X1VD 4AWLC 3B6GB 3MGSB 1TZYC 1P3FB 3VH5T 1EQZA 1AOIA 1M18A 3MGQA 3KWQA 3AZFD 4XUJD 3W97A 3MNND 4J8WC 2F8ND 1HTAA 3VH5A 3R45A 3KSYA 3B6FD 4CSRB 3REJB 2PYOA 4LD9C 4YS3B 5CPJB 1BH9A 5BNXA 1F66B 2HIOA 3UTBD 5B31G 5B2ID 3LJAA 5E5AC 5BNVA 3REHB 4H9QB 5B0YB 5AVBD 1U35D 1HQ3A 4KHAA 1EQZC 3AV1D 2LY8A 4ZUXD 4WZSB 1BH8B 1AOIC 3X1TB 3KUYB 1M18C 3V9RA 4Z5TD 5C3IC 3W99C 3KWQC 5B0ZB 3LZ1D 1KX3D 5DNNA 2CV5A 3WKJD 3B0DB 5AV6B 4WNNB 2PYOC 4Z66B 3AV2C 3VH6A 2HIOC 3AZKA 1TAFA 4XZQB 3LJAC 3MVDA 1ID3D 1M19A 4R8PC 5B32A 1KX5A 5JA4B 4ZBJB 5AV5B 1HQ3C 3KXBB 4H9RA 4G91B 3X1UD 5AVCD 3AZLB 3MGPB 5CHLB 4QLCB 2YFWA 3AZID 3X1SA 2F8NH 5DNNC 5AV9D 4WU9B 3LELB 2CV5C 3AZEB 3C1BB 4X23D 4WV4B 3AZGD 5GT0D 1B6WA 3AZKC 1S32A 3MGSA 1P3MA 4DRBA 5CPKA 3WAAA 5B32C 1KX5C 1ULYA 4J8UA 3AZJB 1ZLAA 1P3BB 1R4VA 4M6BA 2NZDB 5BT1D 4JJND 3X1SC 3WTPE 2AROD 5GXQB 1P34A 4J8VD 1M1AB 2HUEC 4UUZB 1H3OB 3REHA 2F8NK 1P3ID 1S32C 3MGSC 1P3MC 3WAAC 4YM6D 5CPKC 1BH8A 2JSSA 5B31A 3X1TA 5B24D 3KUYA 4J8UC 3MNNB 3REKD 2F8NB 3AZNB 1ZLAC 1P3PA 5B40B 3B6FB 5F99D 3LZ0B 3UTBB 5AV6A 3TU4D 4WNNA 5FUGB 4KGCB 1TZYD 1P34C 1U35B 3AV1B 2NQBB 5JA4A 5AV5A 5JRGC 3WTPA 4Z5TB 2IO5B 3KXBA 4J8WD 5B33C 5B31C 3X1TC 3KUYC 3MGPA 3LZ1B 5B1MB 4DRAA 4LD9D 2FJ7A 1P3PC 4NE6A 3WKJB 5F99C 5E5AD 3LELA 5B1LB 5AV6C 1ID3B 1EQZD 3AZMC 5CPIB 1AOID 1M18D 3WA9B 4ZBJC 2BYMB 3KWQD 3W99D 5AV5C 5AVCB 3WTPC 1B67A 3W97D 3AZJA 3KXBC 3A6NC 4G91C 4H9OB 3MGPC 1P3GC 5AV9B 2PYOD 3RELB 2FJ7C 3UT9B 3AV2D 3REIA 2HIOD 3LJAD 5GXQA 4J8XB 4H9PA 1A7WA 4EO5B 4R8PD 4X23B 3LELC 3AZGB 3AN2A 3MGRA 5BS7A 1HQ3D 5B2JA 3C1CB 1P3OB 3W96A 3MGQC 1N1JB 5AY8A 5CP6A 4KUDA 3MNNA 3AZJC 3W97C 3AZNA 5DNND 4E44A 4CAYB 5B40A 3AFAB 4JJNB 2CV5D 2AROB 4Z2MH 3LZ0A 3O62A 3REIC 4KGCA 5FUGA 3AZKD 5GXQC 3MVDD 1P3AB 1M19D 1P3IB 5B32D 3AN2C 1KX5D 3AYWA 3MGRC 5BS7C 4YM6B 5B2JC 2NQBA 4WU8A 1KX4A 2BYKB 5B24B 3W96C 4Z5TA 1P3KA 4HGAB 5AY8C 5CP6C 4KUDC 3X1SD 5B1MA 4G92B 3UTAB 3AZHB 3AZNC 5GSUA 5B40C 5B1LA 5GT3A 1P3LB 3O62C 5DNMA 4KGCC 5AV8A 1S32D 3MGSD 3B6GA 3W98B 1P3MD 1P3FA 4H9NB 3MVDC 5CPKD 1M19C 3WAAD 5CPIA 3AYWC 4J8UD 4J8WB 3WA9A 2NQBC 4WU8C 5BO0B 1KX4C 1ZLAD 5AVCA 1P3KC 4LD9B 4H9OA 5B1MC 4CSRA 3REJA 3RELA 5E5AB 4YS3A 5GSUC 3UT9A 5CPJA 1P34D 1F66A 3NQUB 3X1VB 4J8XA 5B1LC 5GT3C 5DNMC 4H9QA 2F8NG 1AOIB 5AV8C 5B0YA 3B6GC 5JRGD 1P3FC 3C1CA 5B33D 5B31D 5CPIC 3X1TD 1P3OA 3KWQB 3KUYD 3W99B 3AZFB 4XUJB 1N1JA 3WA9C 1P3PD 5B0ZA 3AFAA 3AV2B 5BNXB 2L5AA 5AV6D 3REJC 5B2IB 4YS3C 4R8PB 5BNVB 4Z66A 3UT9C 5CPJC 1F66C 3AZMD 4XZQA 4NE3A 5AVBB 4J8XC 1P3AA 1HQ3B 3REHC 4ZUXB 1JFIB 5B0YC 5AV5D 3WTPD 3V9RB 3KXBD 3C1CC 3A6ND 1P3OC 3B0BA 3MGPD 3AZLA 1P3GD 1KX3B 4QLCA 2FJ7D 3AZHA 5B0ZC 3UTAA 4WU9A 3AFAC 3LELD 3AZKB 3AZEA 5KDMB 3B0DC 1P3LA 3C1BA 3VH6W 4Z66C 1KX5B 4XZQC 3W98A 1WWIA 3MGQD 4H9RB 3X1UB 3AZJD 5BO0A 2YFWB 3AZIB 1P3BA 3X1SB 3AZLC 4LD9A 4QLCC 2NZDA 3REID 4G92C 3UTAC 3AZHC 1KX4B 2HUEB 2RVQC 5GXQD 4WU9C 1KU5A 1M1AA 5GT0B 3AN2D 3AZEC 3X1VA 1S32B 4UUZA 3MGRD 1H3OA 1P3MB 1P3LC 3C1BC 5CPKB 3WAAB 5B2JD 3W98C 4J8UB 3W96D 1ZLAB 3W99A 5AY8D 5CP6D 3AZFA 2CWEA 4XUJA 4KUDD 2F8NA 3AZND 1F1EA 5B40D 1P3BC 3B6FA 3AV2A 3LZ0D 1P34B 3O62D 2NZDC 4J8VB 4KGCD 3UTBA 5B2IA 4R8PA 1M1AC 3X1VC 3AYWD 5AVBA 5JRGB 1U35A 3AV1A 5B33B 4ZUXA 1JFIA 2NQBD 5B31B 4WU8D 1KX4D 2YFVB 3REKB 1P3KD 3VH6T 1P3PB 3AZFC 4XUJC 3MNNC 5B1MD 3LZ1A 5G49B 1KX3A 5F99B 5GSUD 3B6FC 3TU4B 3WKJA 4AWLB 5B1LD 5GT3D 1TZYB 5DNMD 3LZ0C 5KDMA 3UTBC 5AV8D 5B2IC 3AZMB 3B6GD 1ID3A 1P3FD 4Z2MG 5CPID 5AVBC 3WTPB 1U35C 3AV1C 4NFTA 4ZUXC 3A6NB 3WA9D 3X1UA 2BYMA 4NE5A 4Z5TC 2IO5C 1P3GB 2FJ7B 3AZIA 3B0CW 3LZ1C 1KX3C 3REJD 5AV9A 3NQJB 3RELD 5CPJD 4YS3D 3UT9D 1F66D 3WKJC 4J8XD 4X23A 3REHD 1EQZB 3AZGA 5GT0A 5B0YD 1ID3C 1M18B 1Q9CA 3MGQB 3C1CD 1P3OD 5C3IB 3W97B 3X1UC 3R45B 5AVCC 5B0ZD 3VH5W 2PYOB 4CAYA 3AFAD 1BH9B 3AZIC 3REIB 4JJNA 2AROA 2HIOB 5AV9C 3LJAB 4H9PB 3RELC 4Z66D 4J8VA 3AN2B 4XZQD 3MGRB 1P3AD 1WWSA 4EO5C 4KHAB 4X23C 5B2JB 3AZGC 5GT0C 1P3IA 5JRGA 3W96B 5B33A 4YM6A 2BYKA 5CP6B 5AY8B 2YFVA 5B24A 4KUDB 3AZLD 3REKA 4QLCD 5DNNB 4H9SA 3AZHD 5G49A 3UTAD 5B32G 2CV5B 5F99A 2RVQD 4WU9D 3O62B 5BT1C 4JJNC 3TU4A 2AROC 3AZED 1TAFB 1TZYA 3C1BD 3MVDB 1P3LD 4J8VC 1M19B 3AZMA 5B32B 3AYWB 3W98D 3B0CT 1P3AC 4H9NA 1P3IC 4WU8B
chains in the Genus database with same CATH superfamily
3H0LC 4YM6C 3A6NA 4J8WA 1P3KB 5B24C 1P3BD 1P3GA 3REKC 4HGAC 5GSUB 2NZDD 4H9SC 1BFMA 4E45A 3NQJA 5E5AA 5GT3B 5DNMB 1M1AD 3NQUA 5AV8B 3TU4C 3X1VD 4AWLC 3B6GB 3MGSB 1TZYC 1P3FB 3VH5T 1EQZA 3H0RC 1AOIA 1M18A 3MGQA 3KWQA 3AZFD 4XUJD 3W97A 3MNND 4J8WC 2F8ND 1HTAA 2XD1A 3VH5A 3R45A 2Y2KA 3KSYA 3B6FD 4CSRB 3REJB 2PYOA 4LD9C 4YS3B 5CPJB 1BH9A 5BNXA 1F66B 2HIOA 3UTBD 5B31G 5B2ID 3LJAA 3EPJA 5E5AC 5BNVA 3REHB 4H9QB 5B0YB 5AVBD 1U35D 1HQ3A 4KHAA 1EQZC 3AV1D 2LY8A 4ZUXD 4WZSB 1BH8B 1AOIC 3X1TB 3KUYB 1M18C 3V9RA 4Z5TD 5C3IC 3W99C 3KWQC 5B0ZB 3LZ1D 1KX3D 5DNNA 2CV5A 3WKJD 3B0DB 5AV6B 4UPKA 4WNNB 2PYOC 4Z66B 3AV2C 3VH6A 2HIOC 3AZKA 1TAFA 4XZQB 3LJAC 3MVDA 1ID3D 1M19A 4R8PC 5B32A 1KX5A 5JA4B 4ZBJB 5AV5B 1HQ3C 3KXBB 4G91B 4H9RA 3X1UD 5AVCD 3AZLB 3MGPB 3EPHA 5CHLB 4QLCB 2YFWA 3AZID 3X1SA 2F8NH 5DNNC 5AV9D 4WU9B 3LELB 2CV5C 3AZEB 3C1BB 4X23D 4WV4B 2JE5A 5GT0D 3AZGD 1B6WA 3AZKC 1S32A 3MGSA 1P3MA 4DRBA 5CPKA 3WAAA 5B32C 1KX5C 1ULYA 4J8UA 2J8PA 3AZJB 1ZLAA 1P3BB 1R4VA 2ZY5A 2ZY2A 2VQRA 4M6BA 2NZDB 2Y2PA 5BT1D 4JJND 3X1SC 3WTPE 2AROD 5GXQB 1P34A 4J8VD 1T3UA 1M1AB 2HUEC 4UUZB 1H3OB 3REHA 1W2EA 2F8NK 1P3ID 2JCHA 1S32C 3MGSC 1P3MC 3WAAC 4YM6D 5CPKC 1BH8A 2JSSA 5B31A 3X1TA 5B24D 3KUYA 2Y2JA 4J8UC 3H0MC 3MNNB 3REKD 2F8NB 3AZNB 1ZLAC 1P3PA 5B40B 3B6FB 5F99D 3LZ0B 3UTBB 5AV6A 3TU4D 4WNNA 5FUGB 4KGCB 1TZYD 1P34C 1U35B 3AV1B 2NQBB 5JA4A 5AV5A 5JRGC 3WTPA 4Z5TB 2IO5B 3KXBA 4J8WD 5B33C 5B31C 3X1TC 3KUYC 3MGPA 3LZ1B 5B1MB 4DRAA 4LD9D 2FJ7A 1P3PC 4NE6A 2DF4C 3WKJB 5F99C 5E5AD 3LELA 5B1LB 5AV6C 1ID3B 1EQZD 2F2AC 3AZMC 5CPIB 1AOID 1M18D 2Y2MA 3WA9B 4ZBJC 2BYMB 3KWQD 3W99D 5AV5C 5AVCB 3WTPC 1B67A 3W97D 3AZJA 3KXBC 3A6NC 4G91C 4H9OB 4WJ3C 3MGPC 1P3GC 5AV9B 2PYOD 3RELB 2FJ7C 3UT9B 3AV2D 3REIA 2HIOD 3LJAD 5GXQA 4J8XB 4H9PA 1A7WA 4EO5B 4R8PD 4X23B 3LELC 3AZGB 3AN2A 3MGRA 5BS7A 1HQ3D 5B2JA 3C1CB 2FFFB 1P3OB 3W96A 2G5IC 3MGQC 1N1JB 5AY8A 5CP6A 4KUDA 3MNNA 3AZJC 3W97C 3AZNA 5DNND 4E44A 4CAYB 5B40A 3AFAB 4JJNB 2CV5D 2AROB 2BG1A 4Z2MH 3LZ0A 3EPKA 3O62A 3REIC 3KFUG 4KGCA 5FUGA 3AZKD 5GXQC 3MVDD 1P3AB 1M19D 1P3IB 5B32D 3AN2C 1KX5D 3AYWA 3MGRC 5BS7C 4YM6B 5B2JC 2NQBA 4WU8A 1KX4A 2BYKB 5B24B 3W96C 4Z5TA 1P3KA 4HGAB 5AY8C 5CP6C 4KUDC 3X1SD 5B1MA 4G92B 3UTAB 3AZHB 3AZNC 5GSUA 2Y2GA 5B40C 5B1LA 5GT3A 1P3LB 3O62C 5DNMA 4KGCC 5AV8A 2Y2LA 3MGSD 1S32D 3B6GA 3W98B 1P3MD 1P3FA 4H9NB 3MVDC 5CPKD 1M19C 3WAAD 5CPIA 3AYWC 4J8UD 4J8WB 3IP4C 3WA9A 2NQBC 4WU8C 5BO0B 1KX4C 1ZLAD 2G5HC 5AVCA 2Y2HA 1P3KC 4LD9B 4H9OA 5B1MC 4CSRA 3REJA 3RELA 5E5AB 4YS3A 5GSUC 2DQNC 3UT9A 5CPJA 1P34D 1F66A 3NQUB 3X1VB 4J8XA 5B1LC 5GT3C 2Y2IA 5DNMC 4H9QA 2F8NG 1AOIB 5AV8C 5B0YA 3B6GC 5JRGD 2W8SA 1P3FC 3C1CA 5B33D 5B31D 5CPIC 3X1TD 1P3OA 3KWQB 3KUYD 3W99B 3AZFB 4XUJB 1N1JA 1Z2CB 3WA9C 1P3PD 5B0ZA 3AFAA 3AV2B 5BNXB 2L5AA 5AV6D 3REJC 5B2IB 4YS3C 4R8PB 5BNVB 4Z66A 3UT9C 5CPJC 1F66C 3AZMD 4XZQA 4NE3A 5AVBB 4J8XC 1P3AA 1HQ3B 3REHC 4ZUXB 1JFIB 5B0YC 5AV5D 3WTPD 3V9RB 3KXBD 3C1CC 3A6ND 2XD5A 1P3OC 3B0BA 3MGPD 3AZLA 1P3GD 1KX3B 4QLCA 2FJ7D 3AZHA 5B0ZC 3UTAA 4WU9A 3AFAC 3LELD 3P5JB 3AZKB 3AZEA 5KDMB 3B0DC 1P3LA 3C1BA 3VH6W 4Z66C 1KX5B 4XZQC 3W98A 1WWIA 3MGQD 4H9RB 3X1UB 3AZJD 5BO0A 2YFWB 3AZIB 1P3BA 3X1SB 3AZLC 4LD9A 4QLCC 2NZDA 3REID 4G92C 3UTAC 3AZHC 1KX4B 2HUEB 2RVQC 5GXQD 4WU9C 1KU5A 1M1AA 5GT0B 3AN2D 3AZEC 3X1VA 1S32B 4UUZA 3MGRD 2Y2OA 1H3OA 1P3MB 1P3LC 3C1BC 5CPKB 3WAAB 5B2JD 3W98C 4J8UB 3W96D 1ZLAB 3W99A 5AY8D 5CP6D 3AZFA 2CWEA 4XUJA 4KUDD 2UWXA 2F8NA 3FDDA 3AZND 1F1EA 5B40D 1P3BC 3B6FA 2ZM5A 3LZ0D 3AV2A 3O62D 1P34B 2NZDC 4J8VB 4KGCD 3UTBA 5B2IA 1PZRA 4R8PA 1M1AC 3X1VC 3AYWD 5AVBA 5JRGB 1U35A 3AV1A 5B33B 4ZUXA 1JFIA 2NQBD 5B31B 3AL0C 4WU8D 1KX4D 2YFVB 4DQYB 3REKB 1P3KD 3VH6T 1P3PB 3AZFC 4XUJC 3MNNC 5B1MD 3LZ1A 5G49B 1KX3A 5F99B 2RIQA 5GSUD 3B6FC 3TU4B 3WKJA 4AWLB 5B1LD 5GT3D 1TZYB 5DNMD 3LZ0C 5KDMA 3UTBC 5AV8D 5B2IC 3AZMB 3B6GD 3A1IA 1ID3A 3F6TA 1P3FD 4Z2MG 5CPID 5AVBC 3WTPB 1U35C 3AV1C 4NFTA 4ZUXC 3A6NB 3WA9D 3X1UA 2BYMA 4NE5A 4Z5TC 2IO5C 1P3GB 2ZY4A 2FJ7B 3AZIA 3B0CW 3LZ1C 1KX3C 3REJD 5AV9A 3NQJB 3RELD 5CPJD 4YS3D 3UT9D 1F66D 3WKJC 4J8XD 4X23A 3REHD 1EQZB 3AZGA 5GT0A 5B0YD 1ID3C 1M18B 1Q9CA 3MGQB 3C1CD 1P3OD 5C3IB 3A1KA 2Y2QA 3W97B 3X1UC 3R45B 5AVCC 5B0ZD 3VH5W 2PYOB 4CAYA 3AFAD 1BH9B 3AZIC 3REIB 4JJNA 2AROA 2HIOB 5AV9C 3LJAB 4H9PB 3RELC 4Z66D 4J8VA 3AN2B 4XZQD 3MGRB 1P3AD 1WWSA 4EO5C 4KHAB 4X23C 5B2JB 3AZGC 5GT0C 1P3IA 5JRGA 2Y2NA 3W96B 5B33A 4YM6A 3EPLA 2BYKA 3EG5B 5CP6B 2YFVA 5AY8B 5B24A 2ZY3A 4KUDB 3AZLD 3REKA 4QLCD 5DNNB 4H9SA 3AZHD 5G49A 3UTAD 5B32G 2CV5B 5F99A 2RVQD 4WU9D 3O62B 5BT1C 4JJNC 3TU4A 2AROC 3AZED 1TAFB 1TZYA 3C1BD 3MVDB 1P3LD 4J8VC 1M19B 3AZMA 5B32B 3AYWB 3W98D 3B0CT 1P3AC 4H9NA 1P3IC 4WU8B
chains in the Genus database with same CATH topology
3H0LC 4YM6C 3A6NA 4J8WA 1P3KB 5B24C 1P3BD 1P3GA 3REKC 4HGAC 5GSUB 2NZDD 4H9SC 1BFMA 4E45A 3NQJA 5E5AA 5GT3B 5DNMB 1M1AD 3NQUA 5AV8B 3TU4C 3X1VD 4AWLC 3B6GB 3MGSB 1TZYC 1P3FB 3VH5T 1EQZA 3H0RC 1AOIA 1M18A 3MGQA 3KWQA 3AZFD 4XUJD 3W97A 3MNND 4J8WC 2F8ND 1HTAA 2XD1A 3VH5A 3R45A 2Y2KA 3KSYA 3B6FD 4CSRB 3REJB 2PYOA 4LD9C 4YS3B 5CPJB 1BH9A 5BNXA 1F66B 2HIOA 3UTBD 5B31G 5B2ID 3LJAA 3EPJA 5E5AC 5BNVA 3REHB 4H9QB 5B0YB 5AVBD 1U35D 1HQ3A 4KHAA 1EQZC 3AV1D 2LY8A 4ZUXD 4WZSB 1BH8B 1AOIC 3X1TB 3KUYB 1M18C 3V9RA 4Z5TD 5C3IC 3W99C 3KWQC 5B0ZB 3LZ1D 1KX3D 5DNNA 2CV5A 3WKJD 3B0DB 5AV6B 4UPKA 4WNNB 2PYOC 4Z66B 3AV2C 3VH6A 2HIOC 3AZKA 1TAFA 4XZQB 3LJAC 3MVDA 1ID3D 1M19A 4R8PC 5B32A 1KX5A 5JA4B 4ZBJB 5AV5B 1HQ3C 3KXBB 4G91B 4H9RA 3X1UD 5AVCD 3AZLB 3MGPB 3EPHA 5CHLB 4QLCB 2YFWA 3AZID 3X1SA 2F8NH 5DNNC 5AV9D 4WU9B 3LELB 2CV5C 3AZEB 3C1BB 4X23D 4WV4B 2JE5A 5GT0D 3AZGD 1B6WA 3AZKC 1S32A 3MGSA 1P3MA 4DRBA 5CPKA 3WAAA 5B32C 1KX5C 1ULYA 4J8UA 2J8PA 3AZJB 1ZLAA 1P3BB 1R4VA 2ZY5A 2ZY2A 2VQRA 4M6BA 2NZDB 2Y2PA 5BT1D 4JJND 3X1SC 3WTPE 2AROD 5GXQB 1P34A 4J8VD 1T3UA 1M1AB 2HUEC 4UUZB 1H3OB 3REHA 1W2EA 2F8NK 1P3ID 2JCHA 1S32C 3MGSC 1P3MC 3WAAC 4YM6D 5CPKC 1BH8A 2JSSA 5B31A 3X1TA 5B24D 3KUYA 2Y2JA 4J8UC 3H0MC 3MNNB 3REKD 2F8NB 3AZNB 1ZLAC 1P3PA 5B40B 3B6FB 5F99D 3LZ0B 3UTBB 5AV6A 3TU4D 4WNNA 5FUGB 4KGCB 1TZYD 1P34C 1U35B 3AV1B 2NQBB 5JA4A 5AV5A 5JRGC 3WTPA 4Z5TB 2IO5B 3KXBA 4J8WD 5B33C 5B31C 3X1TC 3KUYC 3MGPA 3LZ1B 5B1MB 4DRAA 4LD9D 2FJ7A 1P3PC 4NE6A 2DF4C 3WKJB 5F99C 5E5AD 3LELA 5B1LB 5AV6C 1ID3B 1EQZD 2F2AC 3AZMC 5CPIB 1AOID 1M18D 2Y2MA 3WA9B 4ZBJC 2BYMB 3KWQD 3W99D 5AV5C 5AVCB 3WTPC 1B67A 3W97D 3AZJA 3KXBC 3A6NC 4G91C 4H9OB 4WJ3C 3MGPC 1P3GC 5AV9B 2PYOD 3RELB 2FJ7C 3UT9B 3AV2D 3REIA 2HIOD 3LJAD 5GXQA 4J8XB 4H9PA 1A7WA 4EO5B 4R8PD 4X23B 3LELC 3AZGB 3AN2A 3MGRA 5BS7A 1HQ3D 5B2JA 3C1CB 2FFFB 1P3OB 3W96A 2G5IC 3MGQC 1N1JB 5AY8A 5CP6A 4KUDA 3MNNA 3AZJC 3W97C 3AZNA 5DNND 4E44A 4CAYB 5B40A 3AFAB 4JJNB 2CV5D 2AROB 2BG1A 4Z2MH 3LZ0A 3EPKA 3O62A 3REIC 3KFUG 4KGCA 5FUGA 3AZKD 5GXQC 3MVDD 1P3AB 1M19D 1P3IB 5B32D 3AN2C 1KX5D 3AYWA 3MGRC 5BS7C 4YM6B 5B2JC 2NQBA 4WU8A 1KX4A 2BYKB 5B24B 3W96C 4Z5TA 1P3KA 4HGAB 5AY8C 5CP6C 4KUDC 3X1SD 5B1MA 4G92B 3UTAB 3AZHB 3AZNC 5GSUA 2Y2GA 5B40C 5B1LA 5GT3A 1P3LB 3O62C 5DNMA 4KGCC 5AV8A 2Y2LA 3MGSD 1S32D 3B6GA 3W98B 1P3MD 1P3FA 4H9NB 3MVDC 5CPKD 1M19C 3WAAD 5CPIA 3AYWC 4J8UD 4J8WB 3IP4C 3WA9A 2NQBC 4WU8C 5BO0B 1KX4C 1ZLAD 2G5HC 5AVCA 2Y2HA 1P3KC 4LD9B 4H9OA 5B1MC 4CSRA 3REJA 3RELA 5E5AB 4YS3A 5GSUC 2DQNC 3UT9A 5CPJA 1P34D 1F66A 3NQUB 3X1VB 4J8XA 5B1LC 5GT3C 2Y2IA 5DNMC 4H9QA 2F8NG 1AOIB 5AV8C 5B0YA 3B6GC 5JRGD 2W8SA 1P3FC 3C1CA 5B33D 5B31D 5CPIC 3X1TD 1P3OA 3KWQB 3KUYD 3W99B 3AZFB 4XUJB 1N1JA 1Z2CB 3WA9C 1P3PD 5B0ZA 3AFAA 3AV2B 5BNXB 2L5AA 5AV6D 3REJC 5B2IB 4YS3C 4R8PB 5BNVB 4Z66A 3UT9C 5CPJC 1F66C 3AZMD 4XZQA 4NE3A 5AVBB 4J8XC 1P3AA 1HQ3B 3REHC 4ZUXB 1JFIB 5B0YC 5AV5D 3WTPD 3V9RB 3KXBD 3C1CC 3A6ND 2XD5A 1P3OC 3B0BA 3MGPD 3AZLA 1P3GD 1KX3B 4QLCA 2FJ7D 3AZHA 5B0ZC 3UTAA 4WU9A 3AFAC 3LELD 3P5JB 3AZKB 3AZEA 5KDMB 3B0DC 1P3LA 3C1BA 3VH6W 4Z66C 1KX5B 4XZQC 3W98A 1WWIA 3MGQD 4H9RB 3X1UB 3AZJD 5BO0A 2YFWB 3AZIB 1P3BA 3X1SB 3AZLC 4LD9A 4QLCC 2NZDA 3REID 4G92C 3UTAC 3AZHC 1KX4B 2HUEB 2RVQC 5GXQD 4WU9C 1KU5A 1M1AA 5GT0B 3AN2D 3AZEC 3X1VA 1S32B 4UUZA 3MGRD 2Y2OA 1H3OA 1P3MB 1P3LC 3C1BC 5CPKB 3WAAB 5B2JD 3W98C 4J8UB 3W96D 1ZLAB 3W99A 5AY8D 5CP6D 3AZFA 2CWEA 4XUJA 4KUDD 2UWXA 2F8NA 3FDDA 3AZND 1F1EA 5B40D 1P3BC 3B6FA 2ZM5A 3LZ0D 3AV2A 3O62D 1P34B 2NZDC 4J8VB 4KGCD 3UTBA 5B2IA 1PZRA 4R8PA 1M1AC 3X1VC 3AYWD 5AVBA 5JRGB 1U35A 3AV1A 5B33B 4ZUXA 1JFIA 2NQBD 5B31B 3AL0C 4WU8D 1KX4D 2YFVB 4DQYB 3REKB 1P3KD 3VH6T 1P3PB 3AZFC 4XUJC 3MNNC 5B1MD 3LZ1A 5G49B 1KX3A 5F99B 2RIQA 5GSUD 3B6FC 3TU4B 3WKJA 4AWLB 5B1LD 5GT3D 1TZYB 5DNMD 3LZ0C 5KDMA 3UTBC 5AV8D 5B2IC 3AZMB 3B6GD 3A1IA 1ID3A 3F6TA 1P3FD 4Z2MG 5CPID 5AVBC 3WTPB 1U35C 3AV1C 4NFTA 4ZUXC 3A6NB 3WA9D 3X1UA 2BYMA 4NE5A 4Z5TC 2IO5C 1P3GB 2ZY4A 2FJ7B 3AZIA 3B0CW 3LZ1C 1KX3C 3REJD 5AV9A 3NQJB 3RELD 5CPJD 4YS3D 3UT9D 1F66D 3WKJC 4J8XD 4X23A 3REHD 1EQZB 3AZGA 5GT0A 5B0YD 1ID3C 1M18B 1Q9CA 3MGQB 3C1CD 1P3OD 5C3IB 3A1KA 2Y2QA 3W97B 3X1UC 3R45B 5AVCC 5B0ZD 3VH5W 2PYOB 4CAYA 3AFAD 1BH9B 3AZIC 3REIB 4JJNA 2AROA 2HIOB 5AV9C 3LJAB 4H9PB 3RELC 4Z66D 4J8VA 3AN2B 4XZQD 3MGRB 1P3AD 1WWSA 4EO5C 4KHAB 4X23C 5B2JB 3AZGC 5GT0C 1P3IA 5JRGA 2Y2NA 3W96B 5B33A 4YM6A 3EPLA 2BYKA 3EG5B 5CP6B 2YFVA 5AY8B 5B24A 2ZY3A 4KUDB 3AZLD 3REKA 4QLCD 5DNNB 4H9SA 3AZHD 5G49A 3UTAD 5B32G 2CV5B 5F99A 2RVQD 4WU9D 3O62B 5BT1C 4JJNC 3TU4A 2AROC 3AZED 1TAFB 1TZYA 3C1BD 3MVDB 1P3LD 4J8VC 1M19B 3AZMA 5B32B 3AYWB 3W98D 3B0CT 1P3AC 4H9NA 1P3IC 4WU8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 C;  3A6N A;  4J8W A;  1P3K B;  5B24 C;  1P3B D;  1P3G A;  3REK C;  4HGA C;  5GSU B;  2NZD D;  4H9S C;  1BFM A;  4E45 A;  3NQJ A;  5E5A A;  5GT3 B;  5DNM B;  1M1A D;  3NQU A;  5AV8 B;  3TU4 C;  3X1V D;  4AWL C;  3B6G B;  3MGS B;  1TZY C;  1P3F B;  3VH5 T;  1EQZ A;  1AOI A;  1M18 A;  3MGQ A;  3KWQ A;  3AZF D;  4XUJ D;  3W97 A;  3MNN D;  4J8W C;  2F8N D;  1HTA A;  3VH5 A;  3R45 A;  3KSY A;  3B6F D;  4CSR B;  3REJ B;  2PYO A;  4LD9 C;  4YS3 B;  5CPJ B;  1BH9 A;  5BNX A;  1F66 B;  2HIO A;  3UTB D;  5B31 G;  5B2I D;  3LJA A;  5E5A C;  5BNV A;  3REH B;  4H9Q B;  5B0Y B;  5AVB D;  1U35 D;  1HQ3 A;  4KHA A;  1EQZ C;  3AV1 D;  2LY8 A;  4ZUX D;  4WZS B;  1BH8 B;  1AOI C;  3X1T B;  3KUY B;  1M18 C;  3V9R A;  4Z5T D;  5C3I C;  3W99 C;  3KWQ C;  5B0Z B;  3LZ1 D;  1KX3 D;  5DNN A;  2CV5 A;  3WKJ D;  3B0D B;  5AV6 B;  4WNN B;  2PYO C;  4Z66 B;  3AV2 C;  3VH6 A;  2HIO C;  3AZK A;  1TAF A;  4XZQ B;  3LJA C;  3MVD A;  1ID3 D;  1M19 A;  4R8P C;  5B32 A;  1KX5 A;  5JA4 B;  4ZBJ B;  5AV5 B;  1HQ3 C;  3KXB B;  4H9R A;  4G91 B;  3X1U D;  5AVC D;  3AZL B;  3MGP B;  5CHL B;  4QLC B;  2YFW A;  3AZI D;  3X1S A;  2F8N H;  5DNN C;  5AV9 D;  4WU9 B;  3LEL B;  2CV5 C;  3AZE B;  3C1B B;  4X23 D;  4WV4 B;  3AZG D;  5GT0 D;  1B6W A;  3AZK C;  1S32 A;  3MGS A;  1P3M A;  4DRB A;  5CPK A;  3WAA A;  5B32 C;  1KX5 C;  1ULY A;  4J8U A;  3AZJ B;  1ZLA A;  1P3B B;  1R4V A;  4M6B A;  2NZD B;  5BT1 D;  4JJN D;  3X1S C;  3WTP E;  2ARO D;  5GXQ B;  1P34 A;  4J8V D;  1M1A B;  2HUE C;  4UUZ B;  1H3O B;  3REH A;  2F8N K;  1P3I D;  1S32 C;  3MGS C;  1P3M C;  3WAA C;  4YM6 D;  5CPK C;  1BH8 A;  2JSS A;  5B31 A;  3X1T A;  5B24 D;  3KUY A;  4J8U C;  3MNN B;  3REK D;  2F8N B;  3AZN B;  1ZLA C;  1P3P A;  5B40 B;  3B6F B;  5F99 D;  3LZ0 B;  3UTB B;  5AV6 A;  3TU4 D;  4WNN A;  5FUG B;  4KGC B;  1TZY D;  1P34 C;  1U35 B;  3AV1 B;  2NQB B;  5JA4 A;  5AV5 A;  5JRG C;  3WTP A;  4Z5T B;  2IO5 B;  3KXB A;  4J8W D;  5B33 C;  5B31 C;  3X1T C;  3KUY C;  3MGP A;  3LZ1 B;  5B1M B;  4DRA A;  4LD9 D;  2FJ7 A;  1P3P C;  4NE6 A;  3WKJ B;  5F99 C;  5E5A D;  3LEL A;  5B1L B;  5AV6 C;  1ID3 B;  1EQZ D;  3AZM C;  5CPI B;  1AOI D;  1M18 D;  3WA9 B;  4ZBJ C;  2BYM B;  3KWQ D;  3W99 D;  5AV5 C;  5AVC B;  3WTP C;  1B67 A;  3W97 D;  3AZJ A;  3KXB C;  3A6N C;  4G91 C;  4H9O B;  3MGP C;  1P3G C;  5AV9 B;  2PYO D;  3REL B;  2FJ7 C;  3UT9 B;  3AV2 D;  3REI A;  2HIO D;  3LJA D;  5GXQ A;  4J8X B;  4H9P A;  1A7W A;  4EO5 B;  4R8P D;  4X23 B;  3LEL C;  3AZG B;  3AN2 A;  3MGR A;  5BS7 A;  1HQ3 D;  5B2J A;  3C1C B;  1P3O B;  3W96 A;  3MGQ C;  1N1J B;  5AY8 A;  5CP6 A;  4KUD A;  3MNN A;  3AZJ C;  3W97 C;  3AZN A;  5DNN D;  4E44 A;  4CAY B;  5B40 A;  3AFA B;  4JJN B;  2CV5 D;  2ARO B;  4Z2M H;  3LZ0 A;  3O62 A;  3REI C;  4KGC A;  5FUG A;  3AZK D;  5GXQ C;  3MVD D;  1P3A B;  1M19 D;  1P3I B;  5B32 D;  3AN2 C;  1KX5 D;  3AYW A;  3MGR C;  5BS7 C;  4YM6 B;  5B2J C;  2NQB A;  4WU8 A;  1KX4 A;  2BYK B;  5B24 B;  3W96 C;  4Z5T A;  1P3K A;  4HGA B;  5AY8 C;  5CP6 C;  4KUD C;  3X1S D;  5B1M A;  4G92 B;  3UTA B;  3AZH B;  3AZN C;  5GSU A;  5B40 C;  5B1L A;  5GT3 A;  1P3L B;  3O62 C;  5DNM A;  4KGC C;  5AV8 A;  1S32 D;  3MGS D;  3B6G A;  3W98 B;  1P3M D;  1P3F A;  4H9N B;  3MVD C;  5CPK D;  1M19 C;  3WAA D;  5CPI A;  3AYW C;  4J8U D;  4J8W B;  3WA9 A;  2NQB C;  4WU8 C;  5BO0 B;  1KX4 C;  1ZLA D;  5AVC A;  1P3K C;  4LD9 B;  4H9O A;  5B1M C;  4CSR A;  3REJ A;  3REL A;  5E5A B;  4YS3 A;  5GSU C;  3UT9 A;  5CPJ A;  1P34 D;  1F66 A;  3NQU B;  3X1V B;  4J8X A;  5B1L C;  5GT3 C;  5DNM C;  4H9Q A;  2F8N G;  1AOI B;  5AV8 C;  5B0Y A;  3B6G C;  5JRG D;  1P3F C;  3C1C A;  5B33 D;  5B31 D;  5CPI C;  3X1T D;  1P3O A;  3KWQ B;  3KUY D;  3W99 B;  3AZF B;  4XUJ B;  1N1J A;  3WA9 C;  1P3P D;  5B0Z A;  3AFA A;  3AV2 B;  5BNX B;  2L5A A;  5AV6 D;  3REJ C;  5B2I B;  4YS3 C;  4R8P B;  5BNV B;  4Z66 A;  3UT9 C;  5CPJ C;  1F66 C;  3AZM D;  4XZQ A;  4NE3 A;  5AVB B;  4J8X C;  1P3A A;  1HQ3 B;  3REH C;  4ZUX B;  1JFI B;  5B0Y C;  5AV5 D;  3WTP D;  3V9R B;  3KXB D;  3C1C C;  3A6N D;  1P3O C;  3B0B A;  3MGP D;  3AZL A;  1P3G D;  1KX3 B;  4QLC A;  2FJ7 D;  3AZH A;  5B0Z C;  3UTA A;  4WU9 A;  3AFA C;  3LEL D;  3AZK B;  3AZE A;  5KDM B;  3B0D C;  1P3L A;  3C1B A;  3VH6 W;  4Z66 C;  1KX5 B;  4XZQ C;  3W98 A;  1WWI A;  3MGQ D;  4H9R B;  3X1U B;  3AZJ D;  5BO0 A;  2YFW B;  3AZI B;  1P3B A;  3X1S B;  3AZL C;  4LD9 A;  4QLC C;  2NZD A;  3REI D;  4G92 C;  3UTA C;  3AZH C;  1KX4 B;  2HUE B;  2RVQ C;  5GXQ D;  4WU9 C;  1KU5 A;  1M1A A;  5GT0 B;  3AN2 D;  3AZE C;  3X1V A;  1S32 B;  4UUZ A;  3MGR D;  1H3O A;  1P3M B;  1P3L C;  3C1B C;  5CPK B;  3WAA B;  5B2J D;  3W98 C;  4J8U B;  3W96 D;  1ZLA B;  3W99 A;  5AY8 D;  5CP6 D;  3AZF A;  2CWE A;  4XUJ A;  4KUD D;  2F8N A;  3AZN D;  1F1E A;  5B40 D;  1P3B C;  3B6F A;  3AV2 A;  3LZ0 D;  1P34 B;  3O62 D;  2NZD C;  4J8V B;  4KGC D;  3UTB A;  5B2I A;  4R8P A;  1M1A C;  3X1V C;  3AYW D;  5AVB A;  5JRG B;  1U35 A;  3AV1 A;  5B33 B;  4ZUX A;  1JFI A;  2NQB D;  5B31 B;  4WU8 D;  1KX4 D;  2YFV B;  3REK B;  1P3K D;  3VH6 T;  1P3P B;  3AZF C;  4XUJ C;  3MNN C;  5B1M D;  3LZ1 A;  5G49 B;  1KX3 A;  5F99 B;  5GSU D;  3B6F C;  3TU4 B;  3WKJ A;  4AWL B;  5B1L D;  5GT3 D;  1TZY B;  5DNM D;  3LZ0 C;  5KDM A;  3UTB C;  5AV8 D;  5B2I C;  3AZM B;  3B6G D;  1ID3 A;  1P3F D;  4Z2M G;  5CPI D;  5AVB C;  3WTP B;  1U35 C;  3AV1 C;  4NFT A;  4ZUX C;  3A6N B;  3WA9 D;  3X1U A;  2BYM A;  4NE5 A;  4Z5T C;  2IO5 C;  1P3G B;  2FJ7 B;  3AZI A;  3B0C W;  3LZ1 C;  1KX3 C;  3REJ D;  5AV9 A;  3NQJ B;  3REL D;  5CPJ D;  4YS3 D;  3UT9 D;  1F66 D;  3WKJ C;  4J8X D;  4X23 A;  3REH D;  1EQZ B;  3AZG A;  5GT0 A;  5B0Y D;  1ID3 C;  1M18 B;  1Q9C A;  3MGQ B;  3C1C D;  1P3O D;  5C3I B;  3W97 B;  3X1U C;  3R45 B;  5AVC C;  5B0Z D;  3VH5 W;  2PYO B;  4CAY A;  3AFA D;  1BH9 B;  3AZI C;  3REI B;  4JJN A;  2ARO A;  2HIO B;  5AV9 C;  3LJA B;  4H9P B;  3REL C;  4Z66 D;  4J8V A;  3AN2 B;  4XZQ D;  3MGR B;  1P3A D;  1WWS A;  4EO5 C;  4KHA B;  4X23 C;  5B2J B;  3AZG C;  5GT0 C;  1P3I A;  5JRG A;  3W96 B;  5B33 A;  4YM6 A;  2BYK A;  5CP6 B;  5AY8 B;  2YFV A;  5B24 A;  4KUD B;  3AZL D;  3REK A;  4QLC D;  5DNN B;  4H9S A;  3AZH D;  5G49 A;  3UTA D;  5B32 G;  2CV5 B;  5F99 A;  2RVQ D;  4WU9 D;  3O62 B;  5BT1 C;  4JJN C;  3TU4 A;  2ARO C;  3AZE D;  1TAF B;  1TZY A;  3C1B D;  3MVD B;  1P3L D;  4J8V C;  1M19 B;  3AZM A;  5B32 B;  3AYW B;  3W98 D;  3B0C T;  1P3A C;  4H9N A;  1P3I C;  4WU8 B; 
#chains in the Genus database with same CATH topology
 3H0L C;  4YM6 C;  3A6N A;  4J8W A;  1P3K B;  5B24 C;  1P3B D;  1P3G A;  3REK C;  4HGA C;  5GSU B;  2NZD D;  4H9S C;  1BFM A;  4E45 A;  3NQJ A;  5E5A A;  5GT3 B;  5DNM B;  1M1A D;  3NQU A;  5AV8 B;  3TU4 C;  3X1V D;  4AWL C;  3B6G B;  3MGS B;  1TZY C;  1P3F B;  3VH5 T;  1EQZ A;  3H0R C;  1AOI A;  1M18 A;  3MGQ A;  3KWQ A;  3AZF D;  4XUJ D;  3W97 A;  3MNN D;  4J8W C;  2F8N D;  1HTA A;  2XD1 A;  3VH5 A;  3R45 A;  2Y2K A;  3KSY A;  3B6F D;  4CSR B;  3REJ B;  2PYO A;  4LD9 C;  4YS3 B;  5CPJ B;  1BH9 A;  5BNX A;  1F66 B;  2HIO A;  3UTB D;  5B31 G;  5B2I D;  3LJA A;  3EPJ A;  5E5A C;  5BNV A;  3REH B;  4H9Q B;  5B0Y B;  5AVB D;  1U35 D;  1HQ3 A;  4KHA A;  1EQZ C;  3AV1 D;  2LY8 A;  4ZUX D;  4WZS B;  1BH8 B;  1AOI C;  3X1T B;  3KUY B;  1M18 C;  3V9R A;  4Z5T D;  5C3I C;  3W99 C;  3KWQ C;  5B0Z B;  3LZ1 D;  1KX3 D;  5DNN A;  2CV5 A;  3WKJ D;  3B0D B;  5AV6 B;  4UPK A;  4WNN B;  2PYO C;  4Z66 B;  3AV2 C;  3VH6 A;  2HIO C;  3AZK A;  1TAF A;  4XZQ B;  3LJA C;  3MVD A;  1ID3 D;  1M19 A;  4R8P C;  5B32 A;  1KX5 A;  5JA4 B;  4ZBJ B;  5AV5 B;  1HQ3 C;  3KXB B;  4G91 B;  4H9R A;  3X1U D;  5AVC D;  3AZL B;  3MGP B;  3EPH A;  5CHL B;  4QLC B;  2YFW A;  3AZI D;  3X1S A;  2F8N H;  5DNN C;  5AV9 D;  4WU9 B;  3LEL B;  2CV5 C;  3AZE B;  3C1B B;  4X23 D;  4WV4 B;  2JE5 A;  5GT0 D;  3AZG D;  1B6W A;  3AZK C;  1S32 A;  3MGS A;  1P3M A;  4DRB A;  5CPK A;  3WAA A;  5B32 C;  1KX5 C;  1ULY A;  4J8U A;  2J8P A;  3AZJ B;  1ZLA A;  1P3B B;  1R4V A;  2ZY5 A;  2ZY2 A;  2VQR A;  4M6B A;  2NZD B;  2Y2P A;  5BT1 D;  4JJN D;  3X1S C;  3WTP E;  2ARO D;  5GXQ B;  1P34 A;  4J8V D;  1T3U A;  1M1A B;  2HUE C;  4UUZ B;  1H3O B;  3REH A;  1W2E A;  2F8N K;  1P3I D;  2JCH A;  1S32 C;  3MGS C;  1P3M C;  3WAA C;  4YM6 D;  5CPK C;  1BH8 A;  2JSS A;  5B31 A;  3X1T A;  5B24 D;  3KUY A;  2Y2J A;  4J8U C;  3H0M C;  3MNN B;  3REK D;  2F8N B;  3AZN B;  1ZLA C;  1P3P A;  5B40 B;  3B6F B;  5F99 D;  3LZ0 B;  3UTB B;  5AV6 A;  3TU4 D;  4WNN A;  5FUG B;  4KGC B;  1TZY D;  1P34 C;  1U35 B;  3AV1 B;  2NQB B;  5JA4 A;  5AV5 A;  5JRG C;  3WTP A;  4Z5T B;  2IO5 B;  3KXB A;  4J8W D;  5B33 C;  5B31 C;  3X1T C;  3KUY C;  3MGP A;  3LZ1 B;  5B1M B;  4DRA A;  4LD9 D;  2FJ7 A;  1P3P C;  4NE6 A;  2DF4 C;  3WKJ B;  5F99 C;  5E5A D;  3LEL A;  5B1L B;  5AV6 C;  1ID3 B;  1EQZ D;  2F2A C;  3AZM C;  5CPI B;  1AOI D;  1M18 D;  2Y2M A;  3WA9 B;  4ZBJ C;  2BYM B;  3KWQ D;  3W99 D;  5AV5 C;  5AVC B;  3WTP C;  1B67 A;  3W97 D;  3AZJ A;  3KXB C;  3A6N C;  4G91 C;  4H9O B;  4WJ3 C;  3MGP C;  1P3G C;  5AV9 B;  2PYO D;  3REL B;  2FJ7 C;  3UT9 B;  3AV2 D;  3REI A;  2HIO D;  3LJA D;  5GXQ A;  4J8X B;  4H9P A;  1A7W A;  4EO5 B;  4R8P D;  4X23 B;  3LEL C;  3AZG B;  3AN2 A;  3MGR A;  5BS7 A;  1HQ3 D;  5B2J A;  3C1C B;  2FFF B;  1P3O B;  3W96 A;  2G5I C;  3MGQ C;  1N1J B;  5AY8 A;  5CP6 A;  4KUD A;  3MNN A;  3AZJ C;  3W97 C;  3AZN A;  5DNN D;  4E44 A;  4CAY B;  5B40 A;  3AFA B;  4JJN B;  2CV5 D;  2ARO B;  2BG1 A;  4Z2M H;  3LZ0 A;  3EPK A;  3O62 A;  3REI C;  3KFU G;  4KGC A;  5FUG A;  3AZK D;  5GXQ C;  3MVD D;  1P3A B;  1M19 D;  1P3I B;  5B32 D;  3AN2 C;  1KX5 D;  3AYW A;  3MGR C;  5BS7 C;  4YM6 B;  5B2J C;  2NQB A;  4WU8 A;  1KX4 A;  2BYK B;  5B24 B;  3W96 C;  4Z5T A;  1P3K A;  4HGA B;  5AY8 C;  5CP6 C;  4KUD C;  3X1S D;  5B1M A;  4G92 B;  3UTA B;  3AZH B;  3AZN C;  5GSU A;  2Y2G A;  5B40 C;  5B1L A;  5GT3 A;  1P3L B;  3O62 C;  5DNM A;  4KGC C;  5AV8 A;  2Y2L A;  3MGS D;  1S32 D;  3B6G A;  3W98 B;  1P3M D;  1P3F A;  4H9N B;  3MVD C;  5CPK D;  1M19 C;  3WAA D;  5CPI A;  3AYW C;  4J8U D;  4J8W B;  3IP4 C;  3WA9 A;  2NQB C;  4WU8 C;  5BO0 B;  1KX4 C;  1ZLA D;  2G5H C;  5AVC A;  2Y2H A;  1P3K C;  4LD9 B;  4H9O A;  5B1M C;  4CSR A;  3REJ A;  3REL A;  5E5A B;  4YS3 A;  5GSU C;  2DQN C;  3UT9 A;  5CPJ A;  1P34 D;  1F66 A;  3NQU B;  3X1V B;  4J8X A;  5B1L C;  5GT3 C;  2Y2I A;  5DNM C;  4H9Q A;  2F8N G;  1AOI B;  5AV8 C;  5B0Y A;  3B6G C;  5JRG D;  2W8S A;  1P3F C;  3C1C A;  5B33 D;  5B31 D;  5CPI C;  3X1T D;  1P3O A;  3KWQ B;  3KUY D;  3W99 B;  3AZF B;  4XUJ B;  1N1J A;  1Z2C B;  3WA9 C;  1P3P D;  5B0Z A;  3AFA A;  3AV2 B;  5BNX B;  2L5A A;  5AV6 D;  3REJ C;  5B2I B;  4YS3 C;  4R8P B;  5BNV B;  4Z66 A;  3UT9 C;  5CPJ C;  1F66 C;  3AZM D;  4XZQ A;  4NE3 A;  5AVB B;  4J8X C;  1P3A A;  1HQ3 B;  3REH C;  4ZUX B;  1JFI B;  5B0Y C;  5AV5 D;  3WTP D;  3V9R B;  3KXB D;  3C1C C;  3A6N D;  2XD5 A;  1P3O C;  3B0B A;  3MGP D;  3AZL A;  1P3G D;  1KX3 B;  4QLC A;  2FJ7 D;  3AZH A;  5B0Z C;  3UTA A;  4WU9 A;  3AFA C;  3LEL D;  3P5J B;  3AZK B;  3AZE A;  5KDM B;  3B0D C;  1P3L A;  3C1B A;  3VH6 W;  4Z66 C;  1KX5 B;  4XZQ C;  3W98 A;  1WWI A;  3MGQ D;  4H9R B;  3X1U B;  3AZJ D;  5BO0 A;  2YFW B;  3AZI B;  1P3B A;  3X1S B;  3AZL C;  4LD9 A;  4QLC C;  2NZD A;  3REI D;  4G92 C;  3UTA C;  3AZH C;  1KX4 B;  2HUE B;  2RVQ C;  5GXQ D;  4WU9 C;  1KU5 A;  1M1A A;  5GT0 B;  3AN2 D;  3AZE C;  3X1V A;  1S32 B;  4UUZ A;  3MGR D;  2Y2O A;  1H3O A;  1P3M B;  1P3L C;  3C1B C;  5CPK B;  3WAA B;  5B2J D;  3W98 C;  4J8U B;  3W96 D;  1ZLA B;  3W99 A;  5AY8 D;  5CP6 D;  3AZF A;  2CWE A;  4XUJ A;  4KUD D;  2UWX A;  2F8N A;  3FDD A;  3AZN D;  1F1E A;  5B40 D;  1P3B C;  3B6F A;  2ZM5 A;  3LZ0 D;  3AV2 A;  3O62 D;  1P34 B;  2NZD C;  4J8V B;  4KGC D;  3UTB A;  5B2I A;  1PZR A;  4R8P A;  1M1A C;  3X1V C;  3AYW D;  5AVB A;  5JRG B;  1U35 A;  3AV1 A;  5B33 B;  4ZUX A;  1JFI A;  2NQB D;  5B31 B;  3AL0 C;  4WU8 D;  1KX4 D;  2YFV B;  4DQY B;  3REK B;  1P3K D;  3VH6 T;  1P3P B;  3AZF C;  4XUJ C;  3MNN C;  5B1M D;  3LZ1 A;  5G49 B;  1KX3 A;  5F99 B;  2RIQ A;  5GSU D;  3B6F C;  3TU4 B;  3WKJ A;  4AWL B;  5B1L D;  5GT3 D;  1TZY B;  5DNM D;  3LZ0 C;  5KDM A;  3UTB C;  5AV8 D;  5B2I C;  3AZM B;  3B6G D;  3A1I A;  1ID3 A;  3F6T A;  1P3F D;  4Z2M G;  5CPI D;  5AVB C;  3WTP B;  1U35 C;  3AV1 C;  4NFT A;  4ZUX C;  3A6N B;  3WA9 D;  3X1U A;  2BYM A;  4NE5 A;  4Z5T C;  2IO5 C;  1P3G B;  2ZY4 A;  2FJ7 B;  3AZI A;  3B0C W;  3LZ1 C;  1KX3 C;  3REJ D;  5AV9 A;  3NQJ B;  3REL D;  5CPJ D;  4YS3 D;  3UT9 D;  1F66 D;  3WKJ C;  4J8X D;  4X23 A;  3REH D;  1EQZ B;  3AZG A;  5GT0 A;  5B0Y D;  1ID3 C;  1M18 B;  1Q9C A;  3MGQ B;  3C1C D;  1P3O D;  5C3I B;  3A1K A;  2Y2Q A;  3W97 B;  3X1U C;  3R45 B;  5AVC C;  5B0Z D;  3VH5 W;  2PYO B;  4CAY A;  3AFA D;  1BH9 B;  3AZI C;  3REI B;  4JJN A;  2ARO A;  2HIO B;  5AV9 C;  3LJA B;  4H9P B;  3REL C;  4Z66 D;  4J8V A;  3AN2 B;  4XZQ D;  3MGR B;  1P3A D;  1WWS A;  4EO5 C;  4KHA B;  4X23 C;  5B2J B;  3AZG C;  5GT0 C;  1P3I A;  5JRG A;  2Y2N A;  3W96 B;  5B33 A;  4YM6 A;  3EPL A;  2BYK A;  3EG5 B;  5CP6 B;  2YFV A;  5AY8 B;  5B24 A;  2ZY3 A;  4KUD B;  3AZL D;  3REK A;  4QLC D;  5DNN B;  4H9S A;  3AZH D;  5G49 A;  3UTA D;  5B32 G;  2CV5 B;  5F99 A;  2RVQ D;  4WU9 D;  3O62 B;  5BT1 C;  4JJN C;  3TU4 A;  2ARO C;  3AZE D;  1TAF B;  1TZY A;  3C1B D;  3MVD B;  1P3L D;  4J8V C;  1M19 B;  3AZM A;  5B32 B;  3AYW B;  3W98 D;  3B0C T;  1P3A C;  4H9N A;  1P3I C;  4WU8 B; 
#chains in the Genus database with same CATH homology
 3H0L C;  4YM6 C;  3A6N A;  4J8W A;  1P3K B;  5B24 C;  1P3B D;  1P3G A;  3REK C;  4HGA C;  5GSU B;  2NZD D;  4H9S C;  1BFM A;  4E45 A;  3NQJ A;  5E5A A;  5GT3 B;  5DNM B;  1M1A D;  3NQU A;  5AV8 B;  3TU4 C;  3X1V D;  4AWL C;  3B6G B;  3MGS B;  1TZY C;  1P3F B;  3VH5 T;  1EQZ A;  3H0R C;  1AOI A;  1M18 A;  3MGQ A;  3KWQ A;  3AZF D;  4XUJ D;  3W97 A;  3MNN D;  4J8W C;  2F8N D;  1HTA A;  2XD1 A;  3VH5 A;  3R45 A;  2Y2K A;  3KSY A;  3B6F D;  4CSR B;  3REJ B;  2PYO A;  4LD9 C;  4YS3 B;  5CPJ B;  1BH9 A;  5BNX A;  1F66 B;  2HIO A;  3UTB D;  5B31 G;  5B2I D;  3LJA A;  3EPJ A;  5E5A C;  5BNV A;  3REH B;  4H9Q B;  5B0Y B;  5AVB D;  1U35 D;  1HQ3 A;  4KHA A;  1EQZ C;  3AV1 D;  2LY8 A;  4ZUX D;  4WZS B;  1BH8 B;  1AOI C;  3X1T B;  3KUY B;  1M18 C;  3V9R A;  4Z5T D;  5C3I C;  3W99 C;  3KWQ C;  5B0Z B;  3LZ1 D;  1KX3 D;  5DNN A;  2CV5 A;  3WKJ D;  3B0D B;  5AV6 B;  4UPK A;  4WNN B;  2PYO C;  4Z66 B;  3AV2 C;  3VH6 A;  2HIO C;  3AZK A;  1TAF A;  4XZQ B;  3LJA C;  3MVD A;  1ID3 D;  1M19 A;  4R8P C;  5B32 A;  1KX5 A;  5JA4 B;  4ZBJ B;  5AV5 B;  1HQ3 C;  3KXB B;  4G91 B;  4H9R A;  3X1U D;  5AVC D;  3AZL B;  3MGP B;  3EPH A;  5CHL B;  4QLC B;  2YFW A;  3AZI D;  3X1S A;  2F8N H;  5DNN C;  5AV9 D;  4WU9 B;  3LEL B;  2CV5 C;  3AZE B;  3C1B B;  4X23 D;  4WV4 B;  2JE5 A;  5GT0 D;  3AZG D;  1B6W A;  3AZK C;  1S32 A;  3MGS A;  1P3M A;  4DRB A;  5CPK A;  3WAA A;  5B32 C;  1KX5 C;  1ULY A;  4J8U A;  2J8P A;  3AZJ B;  1ZLA A;  1P3B B;  1R4V A;  2ZY5 A;  2ZY2 A;  2VQR A;  4M6B A;  2NZD B;  2Y2P A;  5BT1 D;  4JJN D;  3X1S C;  3WTP E;  2ARO D;  5GXQ B;  1P34 A;  4J8V D;  1T3U A;  1M1A B;  2HUE C;  4UUZ B;  1H3O B;  3REH A;  1W2E A;  2F8N K;  1P3I D;  2JCH A;  1S32 C;  3MGS C;  1P3M C;  3WAA C;  4YM6 D;  5CPK C;  1BH8 A;  2JSS A;  5B31 A;  3X1T A;  5B24 D;  3KUY A;  2Y2J A;  4J8U C;  3H0M C;  3MNN B;  3REK D;  2F8N B;  3AZN B;  1ZLA C;  1P3P A;  5B40 B;  3B6F B;  5F99 D;  3LZ0 B;  3UTB B;  5AV6 A;  3TU4 D;  4WNN A;  5FUG B;  4KGC B;  1TZY D;  1P34 C;  1U35 B;  3AV1 B;  2NQB B;  5JA4 A;  5AV5 A;  5JRG C;  3WTP A;  4Z5T B;  2IO5 B;  3KXB A;  4J8W D;  5B33 C;  5B31 C;  3X1T C;  3KUY C;  3MGP A;  3LZ1 B;  5B1M B;  4DRA A;  4LD9 D;  2FJ7 A;  1P3P C;  4NE6 A;  2DF4 C;  3WKJ B;  5F99 C;  5E5A D;  3LEL A;  5B1L B;  5AV6 C;  1ID3 B;  1EQZ D;  2F2A C;  3AZM C;  5CPI B;  1AOI D;  1M18 D;  2Y2M A;  3WA9 B;  4ZBJ C;  2BYM B;  3KWQ D;  3W99 D;  5AV5 C;  5AVC B;  3WTP C;  1B67 A;  3W97 D;  3AZJ A;  3KXB C;  3A6N C;  4G91 C;  4H9O B;  4WJ3 C;  3MGP C;  1P3G C;  5AV9 B;  2PYO D;  3REL B;  2FJ7 C;  3UT9 B;  3AV2 D;  3REI A;  2HIO D;  3LJA D;  5GXQ A;  4J8X B;  4H9P A;  1A7W A;  4EO5 B;  4R8P D;  4X23 B;  3LEL C;  3AZG B;  3AN2 A;  3MGR A;  5BS7 A;  1HQ3 D;  5B2J A;  3C1C B;  2FFF B;  1P3O B;  3W96 A;  2G5I C;  3MGQ C;  1N1J B;  5AY8 A;  5CP6 A;  4KUD A;  3MNN A;  3AZJ C;  3W97 C;  3AZN A;  5DNN D;  4E44 A;  4CAY B;  5B40 A;  3AFA B;  4JJN B;  2CV5 D;  2ARO B;  2BG1 A;  4Z2M H;  3LZ0 A;  3EPK A;  3O62 A;  3REI C;  3KFU G;  4KGC A;  5FUG A;  3AZK D;  5GXQ C;  3MVD D;  1P3A B;  1M19 D;  1P3I B;  5B32 D;  3AN2 C;  1KX5 D;  3AYW A;  3MGR C;  5BS7 C;  4YM6 B;  5B2J C;  2NQB A;  4WU8 A;  1KX4 A;  2BYK B;  5B24 B;  3W96 C;  4Z5T A;  1P3K A;  4HGA B;  5AY8 C;  5CP6 C;  4KUD C;  3X1S D;  5B1M A;  4G92 B;  3UTA B;  3AZH B;  3AZN C;  5GSU A;  2Y2G A;  5B40 C;  5B1L A;  5GT3 A;  1P3L B;  3O62 C;  5DNM A;  4KGC C;  5AV8 A;  2Y2L A;  3MGS D;  1S32 D;  3B6G A;  3W98 B;  1P3M D;  1P3F A;  4H9N B;  3MVD C;  5CPK D;  1M19 C;  3WAA D;  5CPI A;  3AYW C;  4J8U D;  4J8W B;  3IP4 C;  3WA9 A;  2NQB C;  4WU8 C;  5BO0 B;  1KX4 C;  1ZLA D;  2G5H C;  5AVC A;  2Y2H A;  1P3K C;  4LD9 B;  4H9O A;  5B1M C;  4CSR A;  3REJ A;  3REL A;  5E5A B;  4YS3 A;  5GSU C;  2DQN C;  3UT9 A;  5CPJ A;  1P34 D;  1F66 A;  3NQU B;  3X1V B;  4J8X A;  5B1L C;  5GT3 C;  2Y2I A;  5DNM C;  4H9Q A;  2F8N G;  1AOI B;  5AV8 C;  5B0Y A;  3B6G C;  5JRG D;  2W8S A;  1P3F C;  3C1C A;  5B33 D;  5B31 D;  5CPI C;  3X1T D;  1P3O A;  3KWQ B;  3KUY D;  3W99 B;  3AZF B;  4XUJ B;  1N1J A;  1Z2C B;  3WA9 C;  1P3P D;  5B0Z A;  3AFA A;  3AV2 B;  5BNX B;  2L5A A;  5AV6 D;  3REJ C;  5B2I B;  4YS3 C;  4R8P B;  5BNV B;  4Z66 A;  3UT9 C;  5CPJ C;  1F66 C;  3AZM D;  4XZQ A;  4NE3 A;  5AVB B;  4J8X C;  1P3A A;  1HQ3 B;  3REH C;  4ZUX B;  1JFI B;  5B0Y C;  5AV5 D;  3WTP D;  3V9R B;  3KXB D;  3C1C C;  3A6N D;  2XD5 A;  1P3O C;  3B0B A;  3MGP D;  3AZL A;  1P3G D;  1KX3 B;  4QLC A;  2FJ7 D;  3AZH A;  5B0Z C;  3UTA A;  4WU9 A;  3AFA C;  3LEL D;  3P5J B;  3AZK B;  3AZE A;  5KDM B;  3B0D C;  1P3L A;  3C1B A;  3VH6 W;  4Z66 C;  1KX5 B;  4XZQ C;  3W98 A;  1WWI A;  3MGQ D;  4H9R B;  3X1U B;  3AZJ D;  5BO0 A;  2YFW B;  3AZI B;  1P3B A;  3X1S B;  3AZL C;  4LD9 A;  4QLC C;  2NZD A;  3REI D;  4G92 C;  3UTA C;  3AZH C;  1KX4 B;  2HUE B;  2RVQ C;  5GXQ D;  4WU9 C;  1KU5 A;  1M1A A;  5GT0 B;  3AN2 D;  3AZE C;  3X1V A;  1S32 B;  4UUZ A;  3MGR D;  2Y2O A;  1H3O A;  1P3M B;  1P3L C;  3C1B C;  5CPK B;  3WAA B;  5B2J D;  3W98 C;  4J8U B;  3W96 D;  1ZLA B;  3W99 A;  5AY8 D;  5CP6 D;  3AZF A;  2CWE A;  4XUJ A;  4KUD D;  2UWX A;  2F8N A;  3FDD A;  3AZN D;  1F1E A;  5B40 D;  1P3B C;  3B6F A;  2ZM5 A;  3LZ0 D;  3AV2 A;  3O62 D;  1P34 B;  2NZD C;  4J8V B;  4KGC D;  3UTB A;  5B2I A;  1PZR A;  4R8P A;  1M1A C;  3X1V C;  3AYW D;  5AVB A;  5JRG B;  1U35 A;  3AV1 A;  5B33 B;  4ZUX A;  1JFI A;  2NQB D;  5B31 B;  3AL0 C;  4WU8 D;  1KX4 D;  2YFV B;  4DQY B;  3REK B;  1P3K D;  3VH6 T;  1P3P B;  3AZF C;  4XUJ C;  3MNN C;  5B1M D;  3LZ1 A;  5G49 B;  1KX3 A;  5F99 B;  2RIQ A;  5GSU D;  3B6F C;  3TU4 B;  3WKJ A;  4AWL B;  5B1L D;  5GT3 D;  1TZY B;  5DNM D;  3LZ0 C;  5KDM A;  3UTB C;  5AV8 D;  5B2I C;  3AZM B;  3B6G D;  3A1I A;  1ID3 A;  3F6T A;  1P3F D;  4Z2M G;  5CPI D;  5AVB C;  3WTP B;  1U35 C;  3AV1 C;  4NFT A;  4ZUX C;  3A6N B;  3WA9 D;  3X1U A;  2BYM A;  4NE5 A;  4Z5T C;  2IO5 C;  1P3G B;  2ZY4 A;  2FJ7 B;  3AZI A;  3B0C W;  3LZ1 C;  1KX3 C;  3REJ D;  5AV9 A;  3NQJ B;  3REL D;  5CPJ D;  4YS3 D;  3UT9 D;  1F66 D;  3WKJ C;  4J8X D;  4X23 A;  3REH D;  1EQZ B;  3AZG A;  5GT0 A;  5B0Y D;  1ID3 C;  1M18 B;  1Q9C A;  3MGQ B;  3C1C D;  1P3O D;  5C3I B;  3A1K A;  2Y2Q A;  3W97 B;  3X1U C;  3R45 B;  5AVC C;  5B0Z D;  3VH5 W;  2PYO B;  4CAY A;  3AFA D;  1BH9 B;  3AZI C;  3REI B;  4JJN A;  2ARO A;  2HIO B;  5AV9 C;  3LJA B;  4H9P B;  3REL C;  4Z66 D;  4J8V A;  3AN2 B;  4XZQ D;  3MGR B;  1P3A D;  1WWS A;  4EO5 C;  4KHA B;  4X23 C;  5B2J B;  3AZG C;  5GT0 C;  1P3I A;  5JRG A;  2Y2N A;  3W96 B;  5B33 A;  4YM6 A;  3EPL A;  2BYK A;  3EG5 B;  5CP6 B;  2YFV A;  5AY8 B;  5B24 A;  2ZY3 A;  4KUD B;  3AZL D;  3REK A;  4QLC D;  5DNN B;  4H9S A;  3AZH D;  5G49 A;  3UTA D;  5B32 G;  2CV5 B;  5F99 A;  2RVQ D;  4WU9 D;  3O62 B;  5BT1 C;  4JJN C;  3TU4 A;  2ARO C;  3AZE D;  1TAF B;  1TZY A;  3C1B D;  3MVD B;  1P3L D;  4J8V C;  1M19 B;  3AZM A;  5B32 B;  3AYW B;  3W98 D;  3B0C T;  1P3A C;  4H9N A;  1P3I C;  4WU8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...