5GXQB

The crystal structure of the nucleosome containing h3.6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqB00
3WTPD 3MVDC 4JJNB 4KGCA 1M1AB 4CAYB 4YM6D 5KDMA 5JRGD 2CV5D 5B32A 3AFAD 4Z66B 4QLCA 1P3MC 3AZGC 1P3OB 1BH8A 4XZQA 2F8NA 3LZ1C 4XUJA 4J8WD 5AV6B 3REJA 3RELB 5B33A 3C1BD 3MNNA 2LY8A 3A6ND 4AWLB 1KX3D 3AZNC 5BO0B 3KXBA 4WZSB 4EO5B 3X1TC 4J8UB 4WU8C 3AZFC 5G49B 4J8XC 5BNVB 5AVBB 3REKD 2YFWB 3R45A 3WTPA 3X1VB 5B24D 4J8VD 2NZDB 5E5AC 5AY8A 3V9RB 4YM6A 3NQJB 5GT0B 5GT3B 3AZEA 3AZLC 2BYMA 3AV1D 5B2IB 3WTPE 3UT9C 4H9OB 3MGSC 3B0CT 3B6FB 3VH6A 3W97D 2HIOB 3KUYB 2JSSA 1P3MD 1U35C 3AZGD 3KWQD 5B0ZB 5DNMC 1P3AA 3A6NA 4Z5TD 1P34D 4ZUXA 2F8NH 3AZID 1P3IB 5B40D 1P3GB 1ID3C 5JA4B 3LZ0A 1KX4C 3MGQD 4H9PB 3X1TD 1P3BD 5B31C 3AZFD 2IO5C 3REKA 3VH6T 3TU4B 2CWEA 3UTBD 1S32D 1HQ3D 3X1UD 5DNNB 4J8VA 1KX5B 1JFIA 1M19C 4ZBJB 1P3LC 2PYOC 4YS3D 3REHD 5B1MC 3AV1A 1P3PC 3LELB 3VH5A 3W97A 4HGAB 4Z2MH 5F99B 3MGSD 1P3MA 2AROB 3AZGA 3LJAC 3KWQA 3AN2B 3LZ1A 1M1AD 1U35D 3B0DC 1TZYC 3W98B 4NFTA 4KHAB 4Z66D 2RVQD 5B40A 3AZJC 5AV8B 3AZNA 1P3OD 3X1TA 1ZLAC 1P3BA 4WU8A 3AZFA 3RELD 3VH5T 2FJ7C 4X23C 2NQBB 1S32A 4H9RB 4E45A 3B6GB 1H3OA 5E5AA 3WKJC 4J8UD 3AZMB 1P3LD 2PYOD 4WV4B 5B1MD 3AZLA 3UT9A 2BYKA 3MGSA 5JRGC 2CV5C 3C1CB 2NZDD 4LD9B 1U35A 3AFAC 3LJAD 3WAAC 5DNMA 5GT0D 5GT3D 5CPJB 1TZYD 1P3KB 1P3FC 4J8WC 3B6FD 3AV2B 5CP6B 4G91B 2HIOD 1ID3A 3C1BC 3KUYD 1HTAA 4R8PB 1KX3C 1KX4A 4WU9B 4G92B 3AYWB 2FJ7D 3MGPB 5BO0A 1P3ID 1P3GD 5B0YB 3WA9D 3REKC 1P3LA 2PYOA 5B2JB 5GXQB 3WKJD 5GSUC 5B24C 4J8VC 5B1MA 1P3PA 5DNND 4H9NB 1KX5D 2NZDA 3AV1C 3V9RA 3LJAA 3O62B 3W97C 5GT3A 1WWSA 1TZYA 3WAAD 3LELD 3B6FA 3KWQC 3MGRB 5F99D 1P3FD 1TAFB 3AZJA 3AZHB 2YFVB 2AROD 4Z5TC 1P34C 3AN2D 4NE6A 3AZIC 1ZLAA 5B40C 3W98D 2FJ7A 5CHLB 4X23A 1EQZB 3MGQC 1P3IA 1P3BC 5JA4A 5AV8D 3WA9A 5AV9B 3UTBC 1S32C 3WKJA 1HQ3C 3X1UC 1F66B 3AZKB 2HUEC 5GSUD 1N1JB 4YS3C 3REHC 1B6WA 5JRGA 1B67A 5B1LB 2CV5A 5BS7C 3B6GD 3NQUB 5CPIB 1AOIB 5C3IB 3AFAA 3AZMD 4H9QB 3W96C 3WAAA 5FUGA 1M18B 4JJNC 5AVCB 1P3FA 1M1AC 4J8WA 5BNXB 5AV5B 1Q9CA 3C1BA 3AN2A 4KUDB 4Z66C 2RVQC 1KX3A 1BH9A 5B32G 4WNNB 4UUZA 1P3OC 5CPJD 4KGCB 3X1SB 1F1EA 3AV2D 5KDMB 5CP6D 5AV6C 1ULYA 5B32B 3RELC 2F8NG 4AWLC 4QLCB 4WU9D 4CSRB 1BH8B 4EO5C 5GSUA 5B24A 4XZQB 3AYWD 2F8NB 4XUJB 4J8UC 4H9RA 3MGPD 3REJB 5B0YD 5B33B 3MNNB 5AVBC 3AZMA 5B2JD 3X1VC 5GXQD 3KXBB 2NZDC 3W96D 4JJND 5GT0C 5GT3C 4Z2MG 5B2IC 4Z5TA 1P34A 3B6FC 3O62D 3WTPB 3AZIA 2HIOC 5CPJA 3KUYC 5AY8B 4YM6B 5B0ZC 3MGQA 3AZHD 5AV6D 3AZEB 2BYMB 5CPKB 3REIB 3UTBA 1P3IC 1P3GC 3AYWA 1HQ3A 3X1UA 5BT1C 3WA9C 1EQZD 3MGPA 3UTAB 5B0YA 3REHA 4YS3A 1P3AB 3A6NB 5BS7A 3TU4C 4ZUXB 5AVBD 5DNNC 1KX5C 3W99B 3W96A 3AZKD 3X1VD 4ZBJC 4JJNA 1A7WA 3LZ0B 1M1AA 4CAYA 4H9NA 3LELC 3O62A 5CPID 4HGAC 4Z66A 5B2ID 5F99C 1JFIB 1M18D 2AROC 3MVDB 1P3OA 5AVCD 3AN2C 1TAFA 4E44A 5AV6A 2YFVA 5B0ZD 3W98C 3RELA 3B0BA 1P3MB 5AV8C 4M6BA 3AZGB 3LZ1B 5BT1D 3X1SD 4J8UA 5G49A 5B32D 5BNVA 2NQBC 5AVBA 2F8NK 4QLCD 2YFWA 3TU4D 3AZNB 3X1VA 1N1JA 3B6GC 3KSYA 4XZQD 4XUJD 3X1TB 3AZMC 4WU8B 3NQJA 3AZFB 3REJD 4J8XB 5GT0A 5B33D 3MNND 5B2IA 4H9QA 4H9OA 1M18A 3C1CC 2HIOA 4LD9C 3KUYA 5E5AB 5BNXA 5B0ZA 5CPJC 1P3KC 3AZLB 3UT9B 2BYKB 3MGSB 3AV2C 5CP6C 4G91C 4WNNA 1P3GA 1U35B 3X1SA 5AY8D 4R8PC 5DNMB 4H9PA 4WU9C 4G92C 3AYWC 3AZED 3TU4A 5CPKD 3MGPC 2NQBD 3REID 4CSRA 5B31G 5B0YC 5DNNA 1KX5A 1ID3B 5B2JC 1KX4B 4NE5A 3UTAD 5GXQC 5B31B 1P3AD 3LELA 2IO5B 4ZUXD 5F99A 3W99D 2AROA 3C1CD 1M19B 1P3LB 2PYOB 3O62C 3LZ0D 4LD9D 5B1MB 1P3PB 3W98A 1WWIA 1P3KD 4KHAA 3MGRC 3AZHC 5AV8A 3MVDD 3LJAB 4R8PD 1TZYB 3B0DB 5CPKA 1EQZC 2NQBA 3REIA 3AZJB 3B6GA 5AV9C 2L5AA 3LZ1D 3UTAA 1ZLAB 1KU5A 4H9SC 1F66C 3AZKC 2FJ7B 4X23B 3W99A 5B1LC 3AZND 3C1CA 3WA9B 4LD9A 5CPIC 1AOIC 5C3IC 3WKJB 4WU8D 3R45B 4J8XD 1M18C 4NE3A 5AVCC 1P3KA 3AV2A 5JRGB 5CP6A 3MVDA 5AV5C 3MGRD 2CV5B 5E5AD 4KUDC 3AFAB 4R8PA 4DRAA 3WAAB 5FUGB 4WU9A 4KGCC 3AZLD 1P3FB 3X1SC 4J8WB 3UT9D 3B0CW 1R4VA 5B32C 3C1BB 4QLCC 5AV9D 1KX3B 5B2JA 1BH9B 5DNMD 5GXQA 4UUZB 4XZQC 1F66D 4XUJC 3REJC 5B33C 1ID3D 3MNNC 5B1LD 4DRBA 3REKB 1KX4D 4J8XA 1AOID 3KXBC 5GSUB 5B31D 5B24B 4J8VB 3VH6W 3MGRA 3AZHA 3AV1B 5AV5D 1M19D 4KUDD 3W97B 3WTPC 1P3PD 5AY8C 4YM6C 1EQZA 4KGCD 3KWQB 3AZEC 4Z5TB 5AV9A 5CPKC 1P34B 3REIC 3AZIB 5B40B 4H9SA 1F66A 3AZKA 2F8ND 3MGQB 3UTAC 3AZJD 1P3BB 1P3AC 5B1LA 3A6NC 3NQUA 4ZUXC 5CPIA 1AOIA 1ZLAD 3UTBB 1S32B 3W99C 1HQ3B 5B31A 3X1UB 2HUEB 3VH5W 3KXBD 4X23D 3LZ0C 5AVCA 1H3OB 1BFMA 3REHB 4YS3B 1M19A 5AV5A 4KUDA 3W96B
chains in the Genus database with same CATH superfamily
3WTPD 3MVDC 4JJNB 4KGCA 1M1AB 2Y2MA 4CAYB 4YM6D 5KDMA 5JRGD 2G5HC 2CV5D 5B32A 3AFAD 4Z66B 2XD5A 4QLCA 1P3MC 2JE5A 3AZGC 1P3OB 1BH8A 4XZQA 2F8NA 3LZ1C 4XUJA 4J8WD 5AV6B 3REJA 3RELB 5B33A 3C1BD 3MNNA 2LY8A 3A6ND 4AWLB 1KX3D 3AZNC 5BO0B 3KXBA 4WZSB 4EO5B 3X1TC 4J8UB 1T3UA 4WU8C 3AZFC 2J8PA 5G49B 4J8XC 5BNVB 5AVBB 3REKD 2YFWB 3R45A 3WTPA 3X1VB 5B24D 4J8VD 2NZDB 5E5AC 5AY8A 3V9RB 4YM6A 3NQJB 3EPKA 5GT0B 5GT3B 3AZEA 2W8SA 2BYMA 3AZLC 5B2IB 3WTPE 3AV1D 3UT9C 4H9OB 3MGSC 3B0CT 3B6FB 3VH6A 3W97D 2HIOB 3KUYB 2JSSA 1P3MD 1U35C 3AZGD 3KWQD 5B0ZB 5DNMC 1P3AA 3A6NA 4Z5TD 1P34D 4ZUXA 2F8NH 3AZID 1P3IB 5B40D 1P3GB 1ID3C 5JA4B 3LZ0A 1KX4C 2Y2GA 3MGQD 4H9PB 3X1TD 1P3BD 5B31C 3AZFD 2IO5C 3REKA 3VH6T 3TU4B 2CWEA 3UTBD 1S32D 4DQYB 1HQ3D 5DNNB 3X1UD 4J8VA 1KX5B 1JFIA 1M19C 4ZBJB 1P3LC 2PYOC 4YS3D 3REHD 5B1MC 3AV1A 1P3PC 3LELB 3VH5A 2FFFB 3W97A 4HGAB 3F6TA 4Z2MH 5F99B 3MGSD 1P3MA 2AROB 3AZGA 3LJAC 3KWQA 3AN2B 3LZ1A 1M1AD 1U35D 1TZYC 3B0DC 3W98B 4NFTA 4KHAB 4Z66D 2RVQD 5B40A 4WJ3C 3A1KA 3AZJC 5AV8B 3AZNA 1P3OD 3X1TA 1ZLAC 1P3BA 4WU8A 3AZFA 3RELD 3VH5T 2FJ7C 4X23C 2NQBB 1S32A 4H9RB 3KFUG 4E45A 3B6GB 1H3OA 5E5AA 3WKJC 4J8UD 3AZMB 1P3LD 2PYOD 4WV4B 5B1MD 3AZLA 3UT9A 2BYKA 3MGSA 5JRGC 2CV5C 3C1CB 2NZDD 4LD9B 1U35A 3AFAC 3LJAD 3WAAC 5DNMA 5GT0D 5GT3D 5CPJB 1TZYD 1P3KB 1P3FC 4J8WC 3B6FD 3AV2B 5CP6B 4G91B 2HIOD 1ID3A 3C1BC 3KUYD 1HTAA 4R8PB 1KX3C 1KX4A 4WU9B 4G92B 3AYWB 2FJ7D 3MGPB 5BO0A 1P3ID 1P3GD 5B0YB 3WA9D 3REKC 1P3LA 2PYOA 5B2JB 5GXQB 3EPLA 5GSUC 3WKJD 5B24C 4J8VC 5B1MA 1P3PA 5DNND 4H9NB 1KX5D 2NZDA 3AV1C 3V9RA 3LJAA 3O62B 3W97C 5GT3A 1WWSA 1TZYA 3WAAD 3LELD 3B6FA 3KWQC 3MGRB 5F99D 1P3FD 1TAFB 3AZJA 3AZHB 2DQNC 2YFVB 2AROD 4Z5TC 3H0MC 1P34C 3AN2D 4NE6A 3AZIC 1ZLAA 5B40C 2F2AC 3W98D 2FJ7A 5CHLB 4X23A 1EQZB 3MGQC 1P3IA 1P3BC 5JA4A 5AV8D 3WA9A 5AV9B 3UTBC 1S32C 3WKJA 1HQ3C 2ZY2A 3X1UC 1F66B 3AZKB 2HUEC 5GSUD 1N1JB 1Z2CB 4YS3C 3REHC 1B6WA 5JRGA 1B67A 5B1LB 2CV5A 5BS7C 3B6GD 3NQUB 5CPIB 1AOIB 5C3IB 3AFAA 3AZMD 4H9QB 3W96C 3WAAA 5FUGA 1M18B 4JJNC 5AVCB 2Y2LA 1P3FA 1M1AC 4J8WA 5BNXB 2Y2JA 5AV5B 1Q9CA 3C1BA 3AN2A 4KUDB 4Z66C 2RVQC 1KX3A 1BH9A 5B32G 4WNNB 4UUZA 1P3OC 5CPJD 4KGCB 3X1SB 1F1EA 3AV2D 5KDMB 5CP6D 5AV6C 1ULYA 5B32B 3RELC 2F8NG 3EPHA 4AWLC 4QLCB 2XD1A 4WU9D 4CSRB 1BH8B 4EO5C 5GSUA 5B24A 4XZQB 3AYWD 2F8NB 4XUJB 4J8UC 4H9RA 3MGPD 3REJB 5B0YD 5B33B 3MNNB 5AVBC 3AZMA 2G5IC 5B2JD 2DF4C 3X1VC 5GXQD 3KXBB 2NZDC 3W96D 4UPKA 4JJND 5GT0C 5GT3C 2Y2NA 4Z2MG 5B2IC 4Z5TA 1P34A 3B6FC 3O62D 3WTPB 3AZIA 2HIOC 5CPJA 3KUYC 3A1IA 5AY8B 4YM6B 5B0ZC 3MGQA 3AZHD 5AV6D 3AZEB 2BYMB 5CPKB 3REIB 3UTBA 1P3IC 1P3GC 3AYWA 1HQ3A 3X1UA 5BT1C 3WA9C 1EQZD 3MGPA 3UTAB 5B0YA 3REHA 4YS3A 1P3AB 3A6NB 5BS7A 3TU4C 4ZUXB 5AVBD 5DNNC 1KX5C 3W99B 3AL0C 3W96A 3AZKD 3X1VD 4ZBJC 4JJNA 1A7WA 3LZ0B 1M1AA 4CAYA 4H9NA 3LELC 3O62A 5CPID 4HGAC 4Z66A 5B2ID 5F99C 1JFIB 1M18D 2AROC 3MVDB 1P3OA 5AVCD 3AN2C 1TAFA 4E44A 5AV6A 2YFVA 5B0ZD 3W98C 3RELA 3B0BA 2Y2OA 1P3MB 5AV8C 4M6BA 3AZGB 3LZ1B 5BT1D 3X1SD 4J8UA 5G49A 5B32D 5BNVA 2NQBC 2UWXA 5AVBA 2F8NK 4QLCD 2YFWA 3TU4D 3AZNB 3X1VA 1N1JA 3B6GC 3KSYA 4XZQD 1PZRA 4XUJD 3X1TB 3AZMC 4WU8B 3NQJA 3AZFB 3REJD 4J8XB 5GT0A 5B33D 3MNND 5B2IA 4H9QA 4H9OA 1M18A 3H0RC 3C1CC 2HIOA 4LD9C 3KUYA 5E5AB 5BNXA 5B0ZA 5CPJC 2ZY5A 1P3KC 3AZLB 3UT9B 2BYKB 3MGSB 3AV2C 5CP6C 4G91C 4WNNA 2ZY4A 1P3GA 1U35B 3X1SA 5AY8D 4R8PC 2Y2HA 4H9PA 5DNMB 4WU9C 4G92C 3AYWC 3AZED 3TU4A 5CPKD 3MGPC 2NQBD 3REID 4CSRA 5B31G 5B0YC 5DNNA 3EPJA 1KX5A 1ID3B 5B2JC 1KX4B 4NE5A 3UTAD 5GXQC 3EG5B 5B31B 1P3AD 3LELA 2IO5B 4ZUXD 5F99A 3W99D 2AROA 3C1CD 1M19B 1P3LB 2PYOB 3O62C 3LZ0D 4LD9D 5B1MB 1P3PB 3W98A 1WWIA 1P3KD 4KHAA 3MGRC 2JCHA 3AZHC 5AV8A 3P5JB 3MVDD 3LJAB 2ZM5A 4R8PD 1TZYB 3B0DB 5CPKA 1EQZC 2NQBA 2Y2KA 3REIA 3AZJB 3B6GA 5AV9C 2L5AA 3LZ1D 3UTAA 1ZLAB 1KU5A 4H9SC 1F66C 3AZKC 2FJ7B 4X23B 3W99A 5B1LC 3AZND 3C1CA 3WA9B 4LD9A 5CPIC 1AOIC 5C3IC 3WKJB 4WU8D 3R45B 4J8XD 2ZY3A 1M18C 4NE3A 5AVCC 1P3KA 3AV2A 5JRGB 5CP6A 3MVDA 5AV5C 3MGRD 2CV5B 5E5AD 4KUDC 2VQRA 4R8PA 3AFAB 4DRAA 3WAAB 5FUGB 4WU9A 2RIQA 4KGCC 3AZLD 1P3FB 3X1SC 4J8WB 3UT9D 3B0CW 1R4VA 5B32C 3C1BB 4QLCC 5AV9D 1KX3B 5B2JA 2BG1A 1BH9B 5DNMD 5GXQA 4UUZB 1W2EA 4XZQC 1F66D 4XUJC 3REJC 5B33C 1ID3D 3MNNC 5B1LD 4DRBA 3REKB 1KX4D 4J8XA 1AOID 2Y2QA 3KXBC 5GSUB 5B31D 5B24B 4J8VB 3VH6W 3IP4C 3MGRA 3AZHA 3AV1B 5AV5D 1M19D 4KUDD 3W97B 3WTPC 1P3PD 2Y2PA 5AY8C 4YM6C 1EQZA 4KGCD 3KWQB 3AZEC 4Z5TB 5AV9A 5CPKC 1P34B 3REIC 3AZIB 5B40B 4H9SA 1F66A 3AZKA 3FDDA 2F8ND 3H0LC 3MGQB 3UTAC 3AZJD 1P3BB 1P3AC 5B1LA 3A6NC 3NQUA 4ZUXC 5CPIA 1AOIA 1ZLAD 3UTBB 1S32B 3W99C 1HQ3B 5B31A 3X1UB 2HUEB 3VH5W 3KXBD 4X23D 3LZ0C 5AVCA 1H3OB 1BFMA 3REHB 4YS3B 1M19A 5AV5A 4KUDA 2Y2IA 3W96B
chains in the Genus database with same CATH topology
3WTPD 3MVDC 4JJNB 4KGCA 1M1AB 2Y2MA 4CAYB 4YM6D 5KDMA 5JRGD 2G5HC 2CV5D 5B32A 3AFAD 4Z66B 2XD5A 4QLCA 1P3MC 2JE5A 3AZGC 1P3OB 1BH8A 4XZQA 2F8NA 3LZ1C 4XUJA 4J8WD 5AV6B 3REJA 3RELB 5B33A 3C1BD 3MNNA 2LY8A 3A6ND 4AWLB 1KX3D 3AZNC 5BO0B 3KXBA 4WZSB 4EO5B 3X1TC 4J8UB 1T3UA 4WU8C 3AZFC 2J8PA 5G49B 4J8XC 5BNVB 5AVBB 3REKD 2YFWB 3R45A 3WTPA 3X1VB 5B24D 4J8VD 2NZDB 5E5AC 5AY8A 3V9RB 4YM6A 3NQJB 3EPKA 5GT0B 5GT3B 3AZEA 2W8SA 2BYMA 3AZLC 5B2IB 3WTPE 3AV1D 3UT9C 4H9OB 3MGSC 3B0CT 3B6FB 3VH6A 3W97D 2HIOB 3KUYB 2JSSA 1P3MD 1U35C 3AZGD 3KWQD 5B0ZB 5DNMC 1P3AA 3A6NA 4Z5TD 1P34D 4ZUXA 2F8NH 3AZID 1P3IB 5B40D 1P3GB 1ID3C 5JA4B 3LZ0A 1KX4C 2Y2GA 3MGQD 4H9PB 3X1TD 1P3BD 5B31C 3AZFD 2IO5C 3REKA 3VH6T 3TU4B 2CWEA 3UTBD 1S32D 4DQYB 1HQ3D 5DNNB 3X1UD 4J8VA 1KX5B 1JFIA 1M19C 4ZBJB 1P3LC 2PYOC 4YS3D 3REHD 5B1MC 3AV1A 1P3PC 3LELB 3VH5A 2FFFB 3W97A 4HGAB 3F6TA 4Z2MH 5F99B 3MGSD 1P3MA 2AROB 3AZGA 3LJAC 3KWQA 3AN2B 3LZ1A 1M1AD 1U35D 1TZYC 3B0DC 3W98B 4NFTA 4KHAB 4Z66D 2RVQD 5B40A 4WJ3C 3A1KA 3AZJC 5AV8B 3AZNA 1P3OD 3X1TA 1ZLAC 1P3BA 4WU8A 3AZFA 3RELD 3VH5T 2FJ7C 4X23C 2NQBB 1S32A 4H9RB 3KFUG 4E45A 3B6GB 1H3OA 5E5AA 3WKJC 4J8UD 3AZMB 1P3LD 2PYOD 4WV4B 5B1MD 3AZLA 3UT9A 2BYKA 3MGSA 5JRGC 2CV5C 3C1CB 2NZDD 4LD9B 1U35A 3AFAC 3LJAD 3WAAC 5DNMA 5GT0D 5GT3D 5CPJB 1TZYD 1P3KB 1P3FC 4J8WC 3B6FD 3AV2B 5CP6B 4G91B 2HIOD 1ID3A 3C1BC 3KUYD 1HTAA 4R8PB 1KX3C 1KX4A 4WU9B 4G92B 3AYWB 2FJ7D 3MGPB 5BO0A 1P3ID 1P3GD 5B0YB 3WA9D 3REKC 1P3LA 2PYOA 5B2JB 5GXQB 3EPLA 5GSUC 3WKJD 5B24C 4J8VC 5B1MA 1P3PA 5DNND 4H9NB 1KX5D 2NZDA 3AV1C 3V9RA 3LJAA 3O62B 3W97C 5GT3A 1WWSA 1TZYA 3WAAD 3LELD 3B6FA 3KWQC 3MGRB 5F99D 1P3FD 1TAFB 3AZJA 3AZHB 2DQNC 2YFVB 2AROD 4Z5TC 3H0MC 1P34C 3AN2D 4NE6A 3AZIC 1ZLAA 5B40C 2F2AC 3W98D 2FJ7A 5CHLB 4X23A 1EQZB 3MGQC 1P3IA 1P3BC 5JA4A 5AV8D 3WA9A 5AV9B 3UTBC 1S32C 3WKJA 1HQ3C 2ZY2A 3X1UC 1F66B 3AZKB 2HUEC 5GSUD 1N1JB 1Z2CB 4YS3C 3REHC 1B6WA 5JRGA 1B67A 5B1LB 2CV5A 5BS7C 3B6GD 3NQUB 5CPIB 1AOIB 5C3IB 3AFAA 3AZMD 4H9QB 3W96C 3WAAA 5FUGA 1M18B 4JJNC 5AVCB 2Y2LA 1P3FA 1M1AC 4J8WA 5BNXB 2Y2JA 5AV5B 1Q9CA 3C1BA 3AN2A 4KUDB 4Z66C 2RVQC 1KX3A 1BH9A 5B32G 4WNNB 4UUZA 1P3OC 5CPJD 4KGCB 3X1SB 1F1EA 3AV2D 5KDMB 5CP6D 5AV6C 1ULYA 5B32B 3RELC 2F8NG 3EPHA 4AWLC 4QLCB 2XD1A 4WU9D 4CSRB 1BH8B 4EO5C 5GSUA 5B24A 4XZQB 3AYWD 2F8NB 4XUJB 4J8UC 4H9RA 3MGPD 3REJB 5B0YD 5B33B 3MNNB 5AVBC 3AZMA 2G5IC 5B2JD 2DF4C 3X1VC 5GXQD 3KXBB 2NZDC 3W96D 4UPKA 4JJND 5GT0C 5GT3C 2Y2NA 4Z2MG 5B2IC 4Z5TA 1P34A 3B6FC 3O62D 3WTPB 3AZIA 2HIOC 5CPJA 3KUYC 3A1IA 5AY8B 4YM6B 5B0ZC 3MGQA 3AZHD 5AV6D 3AZEB 2BYMB 5CPKB 3REIB 3UTBA 1P3IC 1P3GC 3AYWA 1HQ3A 3X1UA 5BT1C 3WA9C 1EQZD 3MGPA 3UTAB 5B0YA 3REHA 4YS3A 1P3AB 3A6NB 5BS7A 3TU4C 4ZUXB 5AVBD 5DNNC 1KX5C 3W99B 3AL0C 3W96A 3AZKD 3X1VD 4ZBJC 4JJNA 1A7WA 3LZ0B 1M1AA 4CAYA 4H9NA 3LELC 3O62A 5CPID 4HGAC 4Z66A 5B2ID 5F99C 1JFIB 1M18D 2AROC 3MVDB 1P3OA 5AVCD 3AN2C 1TAFA 4E44A 5AV6A 2YFVA 5B0ZD 3W98C 3RELA 3B0BA 2Y2OA 1P3MB 5AV8C 4M6BA 3AZGB 3LZ1B 5BT1D 3X1SD 4J8UA 5G49A 5B32D 5BNVA 2NQBC 2UWXA 5AVBA 2F8NK 4QLCD 2YFWA 3TU4D 3AZNB 3X1VA 1N1JA 3B6GC 3KSYA 4XZQD 1PZRA 4XUJD 3X1TB 3AZMC 4WU8B 3NQJA 3AZFB 3REJD 4J8XB 5GT0A 5B33D 3MNND 5B2IA 4H9QA 4H9OA 1M18A 3H0RC 3C1CC 2HIOA 4LD9C 3KUYA 5E5AB 5BNXA 5B0ZA 5CPJC 2ZY5A 1P3KC 3AZLB 3UT9B 2BYKB 3MGSB 3AV2C 5CP6C 4G91C 4WNNA 2ZY4A 1P3GA 1U35B 3X1SA 5AY8D 4R8PC 2Y2HA 4H9PA 5DNMB 4WU9C 4G92C 3AYWC 3AZED 3TU4A 5CPKD 3MGPC 2NQBD 3REID 4CSRA 5B31G 5B0YC 5DNNA 3EPJA 1KX5A 1ID3B 5B2JC 1KX4B 4NE5A 3UTAD 5GXQC 3EG5B 5B31B 1P3AD 3LELA 2IO5B 4ZUXD 5F99A 3W99D 2AROA 3C1CD 1M19B 1P3LB 2PYOB 3O62C 3LZ0D 4LD9D 5B1MB 1P3PB 3W98A 1WWIA 1P3KD 4KHAA 3MGRC 2JCHA 3AZHC 5AV8A 3P5JB 3MVDD 3LJAB 2ZM5A 4R8PD 1TZYB 3B0DB 5CPKA 1EQZC 2NQBA 2Y2KA 3REIA 3AZJB 3B6GA 5AV9C 2L5AA 3LZ1D 3UTAA 1ZLAB 1KU5A 4H9SC 1F66C 3AZKC 2FJ7B 4X23B 3W99A 5B1LC 3AZND 3C1CA 3WA9B 4LD9A 5CPIC 1AOIC 5C3IC 3WKJB 4WU8D 3R45B 4J8XD 2ZY3A 1M18C 4NE3A 5AVCC 1P3KA 3AV2A 5JRGB 5CP6A 3MVDA 5AV5C 3MGRD 2CV5B 5E5AD 4KUDC 2VQRA 4R8PA 3AFAB 4DRAA 3WAAB 5FUGB 4WU9A 2RIQA 4KGCC 3AZLD 1P3FB 3X1SC 4J8WB 3UT9D 3B0CW 1R4VA 5B32C 3C1BB 4QLCC 5AV9D 1KX3B 5B2JA 2BG1A 1BH9B 5DNMD 5GXQA 4UUZB 1W2EA 4XZQC 1F66D 4XUJC 3REJC 5B33C 1ID3D 3MNNC 5B1LD 4DRBA 3REKB 1KX4D 4J8XA 1AOID 2Y2QA 3KXBC 5GSUB 5B31D 5B24B 4J8VB 3VH6W 3IP4C 3MGRA 3AZHA 3AV1B 5AV5D 1M19D 4KUDD 3W97B 3WTPC 1P3PD 2Y2PA 5AY8C 4YM6C 1EQZA 4KGCD 3KWQB 3AZEC 4Z5TB 5AV9A 5CPKC 1P34B 3REIC 3AZIB 5B40B 4H9SA 1F66A 3AZKA 3FDDA 2F8ND 3H0LC 3MGQB 3UTAC 3AZJD 1P3BB 1P3AC 5B1LA 3A6NC 3NQUA 4ZUXC 5CPIA 1AOIA 1ZLAD 3UTBB 1S32B 3W99C 1HQ3B 5B31A 3X1UB 2HUEB 3VH5W 3KXBD 4X23D 3LZ0C 5AVCA 1H3OB 1BFMA 3REHB 4YS3B 1M19A 5AV5A 4KUDA 2Y2IA 3W96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTP D;  3MVD C;  4JJN B;  4KGC A;  1M1A B;  4CAY B;  4YM6 D;  5KDM A;  5JRG D;  2CV5 D;  5B32 A;  3AFA D;  4Z66 B;  4QLC A;  1P3M C;  3AZG C;  1P3O B;  1BH8 A;  4XZQ A;  2F8N A;  3LZ1 C;  4XUJ A;  4J8W D;  5AV6 B;  3REJ A;  3REL B;  5B33 A;  3C1B D;  3MNN A;  2LY8 A;  3A6N D;  4AWL B;  1KX3 D;  3AZN C;  5BO0 B;  3KXB A;  4WZS B;  4EO5 B;  3X1T C;  4J8U B;  4WU8 C;  3AZF C;  5G49 B;  4J8X C;  5BNV B;  5AVB B;  3REK D;  2YFW B;  3R45 A;  3WTP A;  3X1V B;  5B24 D;  4J8V D;  2NZD B;  5E5A C;  5AY8 A;  3V9R B;  4YM6 A;  3NQJ B;  5GT0 B;  5GT3 B;  3AZE A;  3AZL C;  2BYM A;  3AV1 D;  5B2I B;  3WTP E;  3UT9 C;  4H9O B;  3MGS C;  3B0C T;  3B6F B;  3VH6 A;  3W97 D;  2HIO B;  3KUY B;  2JSS A;  1P3M D;  1U35 C;  3AZG D;  3KWQ D;  5B0Z B;  5DNM C;  1P3A A;  3A6N A;  4Z5T D;  1P34 D;  4ZUX A;  2F8N H;  3AZI D;  1P3I B;  5B40 D;  1P3G B;  1ID3 C;  5JA4 B;  3LZ0 A;  1KX4 C;  3MGQ D;  4H9P B;  3X1T D;  1P3B D;  5B31 C;  3AZF D;  2IO5 C;  3REK A;  3VH6 T;  3TU4 B;  2CWE A;  3UTB D;  1S32 D;  1HQ3 D;  3X1U D;  5DNN B;  4J8V A;  1KX5 B;  1JFI A;  1M19 C;  4ZBJ B;  1P3L C;  2PYO C;  4YS3 D;  3REH D;  5B1M C;  3AV1 A;  1P3P C;  3LEL B;  3VH5 A;  3W97 A;  4HGA B;  4Z2M H;  5F99 B;  3MGS D;  1P3M A;  2ARO B;  3AZG A;  3LJA C;  3KWQ A;  3AN2 B;  3LZ1 A;  1M1A D;  1U35 D;  3B0D C;  1TZY C;  3W98 B;  4NFT A;  4KHA B;  4Z66 D;  2RVQ D;  5B40 A;  3AZJ C;  5AV8 B;  3AZN A;  1P3O D;  3X1T A;  1ZLA C;  1P3B A;  4WU8 A;  3AZF A;  3REL D;  3VH5 T;  2FJ7 C;  4X23 C;  2NQB B;  1S32 A;  4H9R B;  4E45 A;  3B6G B;  1H3O A;  5E5A A;  3WKJ C;  4J8U D;  3AZM B;  1P3L D;  2PYO D;  4WV4 B;  5B1M D;  3AZL A;  3UT9 A;  2BYK A;  3MGS A;  5JRG C;  2CV5 C;  3C1C B;  2NZD D;  4LD9 B;  1U35 A;  3AFA C;  3LJA D;  3WAA C;  5DNM A;  5GT0 D;  5GT3 D;  5CPJ B;  1TZY D;  1P3K B;  1P3F C;  4J8W C;  3B6F D;  3AV2 B;  5CP6 B;  4G91 B;  2HIO D;  1ID3 A;  3C1B C;  3KUY D;  1HTA A;  4R8P B;  1KX3 C;  1KX4 A;  4WU9 B;  4G92 B;  3AYW B;  2FJ7 D;  3MGP B;  5BO0 A;  1P3I D;  1P3G D;  5B0Y B;  3WA9 D;  3REK C;  1P3L A;  2PYO A;  5B2J B;  5GXQ B;  3WKJ D;  5GSU C;  5B24 C;  4J8V C;  5B1M A;  1P3P A;  5DNN D;  4H9N B;  1KX5 D;  2NZD A;  3AV1 C;  3V9R A;  3LJA A;  3O62 B;  3W97 C;  5GT3 A;  1WWS A;  1TZY A;  3WAA D;  3LEL D;  3B6F A;  3KWQ C;  3MGR B;  5F99 D;  1P3F D;  1TAF B;  3AZJ A;  3AZH B;  2YFV B;  2ARO D;  4Z5T C;  1P34 C;  3AN2 D;  4NE6 A;  3AZI C;  1ZLA A;  5B40 C;  3W98 D;  2FJ7 A;  5CHL B;  4X23 A;  1EQZ B;  3MGQ C;  1P3I A;  1P3B C;  5JA4 A;  5AV8 D;  3WA9 A;  5AV9 B;  3UTB C;  1S32 C;  3WKJ A;  1HQ3 C;  3X1U C;  1F66 B;  3AZK B;  2HUE C;  5GSU D;  1N1J B;  4YS3 C;  3REH C;  1B6W A;  5JRG A;  1B67 A;  5B1L B;  2CV5 A;  5BS7 C;  3B6G D;  3NQU B;  5CPI B;  1AOI B;  5C3I B;  3AFA A;  3AZM D;  4H9Q B;  3W96 C;  3WAA A;  5FUG A;  1M18 B;  4JJN C;  5AVC B;  1P3F A;  1M1A C;  4J8W A;  5BNX B;  5AV5 B;  1Q9C A;  3C1B A;  3AN2 A;  4KUD B;  4Z66 C;  2RVQ C;  1KX3 A;  1BH9 A;  5B32 G;  4WNN B;  4UUZ A;  1P3O C;  5CPJ D;  4KGC B;  3X1S B;  1F1E A;  3AV2 D;  5KDM B;  5CP6 D;  5AV6 C;  1ULY A;  5B32 B;  3REL C;  2F8N G;  4AWL C;  4QLC B;  4WU9 D;  4CSR B;  1BH8 B;  4EO5 C;  5GSU A;  5B24 A;  4XZQ B;  3AYW D;  2F8N B;  4XUJ B;  4J8U C;  4H9R A;  3MGP D;  3REJ B;  5B0Y D;  5B33 B;  3MNN B;  5AVB C;  3AZM A;  5B2J D;  3X1V C;  5GXQ D;  3KXB B;  2NZD C;  3W96 D;  4JJN D;  5GT0 C;  5GT3 C;  4Z2M G;  5B2I C;  4Z5T A;  1P34 A;  3B6F C;  3O62 D;  3WTP B;  3AZI A;  2HIO C;  5CPJ A;  3KUY C;  5AY8 B;  4YM6 B;  5B0Z C;  3MGQ A;  3AZH D;  5AV6 D;  3AZE B;  2BYM B;  5CPK B;  3REI B;  3UTB A;  1P3I C;  1P3G C;  3AYW A;  1HQ3 A;  3X1U A;  5BT1 C;  3WA9 C;  1EQZ D;  3MGP A;  3UTA B;  5B0Y A;  3REH A;  4YS3 A;  1P3A B;  3A6N B;  5BS7 A;  3TU4 C;  4ZUX B;  5AVB D;  5DNN C;  1KX5 C;  3W99 B;  3W96 A;  3AZK D;  3X1V D;  4ZBJ C;  4JJN A;  1A7W A;  3LZ0 B;  1M1A A;  4CAY A;  4H9N A;  3LEL C;  3O62 A;  5CPI D;  4HGA C;  4Z66 A;  5B2I D;  5F99 C;  1JFI B;  1M18 D;  2ARO C;  3MVD B;  1P3O A;  5AVC D;  3AN2 C;  1TAF A;  4E44 A;  5AV6 A;  2YFV A;  5B0Z D;  3W98 C;  3REL A;  3B0B A;  1P3M B;  5AV8 C;  4M6B A;  3AZG B;  3LZ1 B;  5BT1 D;  3X1S D;  4J8U A;  5G49 A;  5B32 D;  5BNV A;  2NQB C;  5AVB A;  2F8N K;  4QLC D;  2YFW A;  3TU4 D;  3AZN B;  3X1V A;  1N1J A;  3B6G C;  3KSY A;  4XZQ D;  4XUJ D;  3X1T B;  3AZM C;  4WU8 B;  3NQJ A;  3AZF B;  3REJ D;  4J8X B;  5GT0 A;  5B33 D;  3MNN D;  5B2I A;  4H9Q A;  4H9O A;  1M18 A;  3C1C C;  2HIO A;  4LD9 C;  3KUY A;  5E5A B;  5BNX A;  5B0Z A;  5CPJ C;  1P3K C;  3AZL B;  3UT9 B;  2BYK B;  3MGS B;  3AV2 C;  5CP6 C;  4G91 C;  4WNN A;  1P3G A;  1U35 B;  3X1S A;  5AY8 D;  4R8P C;  5DNM B;  4H9P A;  4WU9 C;  4G92 C;  3AYW C;  3AZE D;  3TU4 A;  5CPK D;  3MGP C;  2NQB D;  3REI D;  4CSR A;  5B31 G;  5B0Y C;  5DNN A;  1KX5 A;  1ID3 B;  5B2J C;  1KX4 B;  4NE5 A;  3UTA D;  5GXQ C;  5B31 B;  1P3A D;  3LEL A;  2IO5 B;  4ZUX D;  5F99 A;  3W99 D;  2ARO A;  3C1C D;  1M19 B;  1P3L B;  2PYO B;  3O62 C;  3LZ0 D;  4LD9 D;  5B1M B;  1P3P B;  3W98 A;  1WWI A;  1P3K D;  4KHA A;  3MGR C;  3AZH C;  5AV8 A;  3MVD D;  3LJA B;  4R8P D;  1TZY B;  3B0D B;  5CPK A;  1EQZ C;  2NQB A;  3REI A;  3AZJ B;  3B6G A;  5AV9 C;  2L5A A;  3LZ1 D;  3UTA A;  1ZLA B;  1KU5 A;  4H9S C;  1F66 C;  3AZK C;  2FJ7 B;  4X23 B;  3W99 A;  5B1L C;  3AZN D;  3C1C A;  3WA9 B;  4LD9 A;  5CPI C;  1AOI C;  5C3I C;  3WKJ B;  4WU8 D;  3R45 B;  4J8X D;  1M18 C;  4NE3 A;  5AVC C;  1P3K A;  3AV2 A;  5JRG B;  5CP6 A;  3MVD A;  5AV5 C;  3MGR D;  2CV5 B;  5E5A D;  4KUD C;  3AFA B;  4R8P A;  4DRA A;  3WAA B;  5FUG B;  4WU9 A;  4KGC C;  3AZL D;  1P3F B;  3X1S C;  4J8W B;  3UT9 D;  3B0C W;  1R4V A;  5B32 C;  3C1B B;  4QLC C;  5AV9 D;  1KX3 B;  5B2J A;  1BH9 B;  5DNM D;  5GXQ A;  4UUZ B;  4XZQ C;  1F66 D;  4XUJ C;  3REJ C;  5B33 C;  1ID3 D;  3MNN C;  5B1L D;  4DRB A;  3REK B;  1KX4 D;  4J8X A;  1AOI D;  3KXB C;  5GSU B;  5B31 D;  5B24 B;  4J8V B;  3VH6 W;  3MGR A;  3AZH A;  3AV1 B;  5AV5 D;  1M19 D;  4KUD D;  3W97 B;  3WTP C;  1P3P D;  5AY8 C;  4YM6 C;  1EQZ A;  4KGC D;  3KWQ B;  3AZE C;  4Z5T B;  5AV9 A;  5CPK C;  1P34 B;  3REI C;  3AZI B;  5B40 B;  4H9S A;  1F66 A;  3AZK A;  2F8N D;  3MGQ B;  3UTA C;  3AZJ D;  1P3B B;  1P3A C;  5B1L A;  3A6N C;  3NQU A;  4ZUX C;  5CPI A;  1AOI A;  1ZLA D;  3UTB B;  1S32 B;  3W99 C;  1HQ3 B;  5B31 A;  3X1U B;  2HUE B;  3VH5 W;  3KXB D;  4X23 D;  3LZ0 C;  5AVC A;  1H3O B;  1BFM A;  3REH B;  4YS3 B;  1M19 A;  5AV5 A;  4KUD A;  3W96 B; 
#chains in the Genus database with same CATH topology
 3WTP D;  3MVD C;  4JJN B;  4KGC A;  1M1A B;  2Y2M A;  4CAY B;  4YM6 D;  5KDM A;  5JRG D;  2G5H C;  2CV5 D;  5B32 A;  3AFA D;  4Z66 B;  2XD5 A;  4QLC A;  1P3M C;  2JE5 A;  3AZG C;  1P3O B;  1BH8 A;  4XZQ A;  2F8N A;  3LZ1 C;  4XUJ A;  4J8W D;  5AV6 B;  3REJ A;  3REL B;  5B33 A;  3C1B D;  3MNN A;  2LY8 A;  3A6N D;  4AWL B;  1KX3 D;  3AZN C;  5BO0 B;  3KXB A;  4WZS B;  4EO5 B;  3X1T C;  4J8U B;  1T3U A;  4WU8 C;  3AZF C;  2J8P A;  5G49 B;  4J8X C;  5BNV B;  5AVB B;  3REK D;  2YFW B;  3R45 A;  3WTP A;  3X1V B;  5B24 D;  4J8V D;  2NZD B;  5E5A C;  5AY8 A;  3V9R B;  4YM6 A;  3NQJ B;  3EPK A;  5GT0 B;  5GT3 B;  3AZE A;  2W8S A;  2BYM A;  3AZL C;  5B2I B;  3WTP E;  3AV1 D;  3UT9 C;  4H9O B;  3MGS C;  3B0C T;  3B6F B;  3VH6 A;  3W97 D;  2HIO B;  3KUY B;  2JSS A;  1P3M D;  1U35 C;  3AZG D;  3KWQ D;  5B0Z B;  5DNM C;  1P3A A;  3A6N A;  4Z5T D;  1P34 D;  4ZUX A;  2F8N H;  3AZI D;  1P3I B;  5B40 D;  1P3G B;  1ID3 C;  5JA4 B;  3LZ0 A;  1KX4 C;  2Y2G A;  3MGQ D;  4H9P B;  3X1T D;  1P3B D;  5B31 C;  3AZF D;  2IO5 C;  3REK A;  3VH6 T;  3TU4 B;  2CWE A;  3UTB D;  1S32 D;  4DQY B;  1HQ3 D;  5DNN B;  3X1U D;  4J8V A;  1KX5 B;  1JFI A;  1M19 C;  4ZBJ B;  1P3L C;  2PYO C;  4YS3 D;  3REH D;  5B1M C;  3AV1 A;  1P3P C;  3LEL B;  3VH5 A;  2FFF B;  3W97 A;  4HGA B;  3F6T A;  4Z2M H;  5F99 B;  3MGS D;  1P3M A;  2ARO B;  3AZG A;  3LJA C;  3KWQ A;  3AN2 B;  3LZ1 A;  1M1A D;  1U35 D;  1TZY C;  3B0D C;  3W98 B;  4NFT A;  4KHA B;  4Z66 D;  2RVQ D;  5B40 A;  4WJ3 C;  3A1K A;  3AZJ C;  5AV8 B;  3AZN A;  1P3O D;  3X1T A;  1ZLA C;  1P3B A;  4WU8 A;  3AZF A;  3REL D;  3VH5 T;  2FJ7 C;  4X23 C;  2NQB B;  1S32 A;  4H9R B;  3KFU G;  4E45 A;  3B6G B;  1H3O A;  5E5A A;  3WKJ C;  4J8U D;  3AZM B;  1P3L D;  2PYO D;  4WV4 B;  5B1M D;  3AZL A;  3UT9 A;  2BYK A;  3MGS A;  5JRG C;  2CV5 C;  3C1C B;  2NZD D;  4LD9 B;  1U35 A;  3AFA C;  3LJA D;  3WAA C;  5DNM A;  5GT0 D;  5GT3 D;  5CPJ B;  1TZY D;  1P3K B;  1P3F C;  4J8W C;  3B6F D;  3AV2 B;  5CP6 B;  4G91 B;  2HIO D;  1ID3 A;  3C1B C;  3KUY D;  1HTA A;  4R8P B;  1KX3 C;  1KX4 A;  4WU9 B;  4G92 B;  3AYW B;  2FJ7 D;  3MGP B;  5BO0 A;  1P3I D;  1P3G D;  5B0Y B;  3WA9 D;  3REK C;  1P3L A;  2PYO A;  5B2J B;  5GXQ B;  3EPL A;  5GSU C;  3WKJ D;  5B24 C;  4J8V C;  5B1M A;  1P3P A;  5DNN D;  4H9N B;  1KX5 D;  2NZD A;  3AV1 C;  3V9R A;  3LJA A;  3O62 B;  3W97 C;  5GT3 A;  1WWS A;  1TZY A;  3WAA D;  3LEL D;  3B6F A;  3KWQ C;  3MGR B;  5F99 D;  1P3F D;  1TAF B;  3AZJ A;  3AZH B;  2DQN C;  2YFV B;  2ARO D;  4Z5T C;  3H0M C;  1P34 C;  3AN2 D;  4NE6 A;  3AZI C;  1ZLA A;  5B40 C;  2F2A C;  3W98 D;  2FJ7 A;  5CHL B;  4X23 A;  1EQZ B;  3MGQ C;  1P3I A;  1P3B C;  5JA4 A;  5AV8 D;  3WA9 A;  5AV9 B;  3UTB C;  1S32 C;  3WKJ A;  1HQ3 C;  2ZY2 A;  3X1U C;  1F66 B;  3AZK B;  2HUE C;  5GSU D;  1N1J B;  1Z2C B;  4YS3 C;  3REH C;  1B6W A;  5JRG A;  1B67 A;  5B1L B;  2CV5 A;  5BS7 C;  3B6G D;  3NQU B;  5CPI B;  1AOI B;  5C3I B;  3AFA A;  3AZM D;  4H9Q B;  3W96 C;  3WAA A;  5FUG A;  1M18 B;  4JJN C;  5AVC B;  2Y2L A;  1P3F A;  1M1A C;  4J8W A;  5BNX B;  2Y2J A;  5AV5 B;  1Q9C A;  3C1B A;  3AN2 A;  4KUD B;  4Z66 C;  2RVQ C;  1KX3 A;  1BH9 A;  5B32 G;  4WNN B;  4UUZ A;  1P3O C;  5CPJ D;  4KGC B;  3X1S B;  1F1E A;  3AV2 D;  5KDM B;  5CP6 D;  5AV6 C;  1ULY A;  5B32 B;  3REL C;  2F8N G;  3EPH A;  4AWL C;  4QLC B;  2XD1 A;  4WU9 D;  4CSR B;  1BH8 B;  4EO5 C;  5GSU A;  5B24 A;  4XZQ B;  3AYW D;  2F8N B;  4XUJ B;  4J8U C;  4H9R A;  3MGP D;  3REJ B;  5B0Y D;  5B33 B;  3MNN B;  5AVB C;  3AZM A;  2G5I C;  5B2J D;  2DF4 C;  3X1V C;  5GXQ D;  3KXB B;  2NZD C;  3W96 D;  4UPK A;  4JJN D;  5GT0 C;  5GT3 C;  2Y2N A;  4Z2M G;  5B2I C;  4Z5T A;  1P34 A;  3B6F C;  3O62 D;  3WTP B;  3AZI A;  2HIO C;  5CPJ A;  3KUY C;  3A1I A;  5AY8 B;  4YM6 B;  5B0Z C;  3MGQ A;  3AZH D;  5AV6 D;  3AZE B;  2BYM B;  5CPK B;  3REI B;  3UTB A;  1P3I C;  1P3G C;  3AYW A;  1HQ3 A;  3X1U A;  5BT1 C;  3WA9 C;  1EQZ D;  3MGP A;  3UTA B;  5B0Y A;  3REH A;  4YS3 A;  1P3A B;  3A6N B;  5BS7 A;  3TU4 C;  4ZUX B;  5AVB D;  5DNN C;  1KX5 C;  3W99 B;  3AL0 C;  3W96 A;  3AZK D;  3X1V D;  4ZBJ C;  4JJN A;  1A7W A;  3LZ0 B;  1M1A A;  4CAY A;  4H9N A;  3LEL C;  3O62 A;  5CPI D;  4HGA C;  4Z66 A;  5B2I D;  5F99 C;  1JFI B;  1M18 D;  2ARO C;  3MVD B;  1P3O A;  5AVC D;  3AN2 C;  1TAF A;  4E44 A;  5AV6 A;  2YFV A;  5B0Z D;  3W98 C;  3REL A;  3B0B A;  2Y2O A;  1P3M B;  5AV8 C;  4M6B A;  3AZG B;  3LZ1 B;  5BT1 D;  3X1S D;  4J8U A;  5G49 A;  5B32 D;  5BNV A;  2NQB C;  2UWX A;  5AVB A;  2F8N K;  4QLC D;  2YFW A;  3TU4 D;  3AZN B;  3X1V A;  1N1J A;  3B6G C;  3KSY A;  4XZQ D;  1PZR A;  4XUJ D;  3X1T B;  3AZM C;  4WU8 B;  3NQJ A;  3AZF B;  3REJ D;  4J8X B;  5GT0 A;  5B33 D;  3MNN D;  5B2I A;  4H9Q A;  4H9O A;  1M18 A;  3H0R C;  3C1C C;  2HIO A;  4LD9 C;  3KUY A;  5E5A B;  5BNX A;  5B0Z A;  5CPJ C;  2ZY5 A;  1P3K C;  3AZL B;  3UT9 B;  2BYK B;  3MGS B;  3AV2 C;  5CP6 C;  4G91 C;  4WNN A;  2ZY4 A;  1P3G A;  1U35 B;  3X1S A;  5AY8 D;  4R8P C;  2Y2H A;  4H9P A;  5DNM B;  4WU9 C;  4G92 C;  3AYW C;  3AZE D;  3TU4 A;  5CPK D;  3MGP C;  2NQB D;  3REI D;  4CSR A;  5B31 G;  5B0Y C;  5DNN A;  3EPJ A;  1KX5 A;  1ID3 B;  5B2J C;  1KX4 B;  4NE5 A;  3UTA D;  5GXQ C;  3EG5 B;  5B31 B;  1P3A D;  3LEL A;  2IO5 B;  4ZUX D;  5F99 A;  3W99 D;  2ARO A;  3C1C D;  1M19 B;  1P3L B;  2PYO B;  3O62 C;  3LZ0 D;  4LD9 D;  5B1M B;  1P3P B;  3W98 A;  1WWI A;  1P3K D;  4KHA A;  3MGR C;  2JCH A;  3AZH C;  5AV8 A;  3P5J B;  3MVD D;  3LJA B;  2ZM5 A;  4R8P D;  1TZY B;  3B0D B;  5CPK A;  1EQZ C;  2NQB A;  2Y2K A;  3REI A;  3AZJ B;  3B6G A;  5AV9 C;  2L5A A;  3LZ1 D;  3UTA A;  1ZLA B;  1KU5 A;  4H9S C;  1F66 C;  3AZK C;  2FJ7 B;  4X23 B;  3W99 A;  5B1L C;  3AZN D;  3C1C A;  3WA9 B;  4LD9 A;  5CPI C;  1AOI C;  5C3I C;  3WKJ B;  4WU8 D;  3R45 B;  4J8X D;  2ZY3 A;  1M18 C;  4NE3 A;  5AVC C;  1P3K A;  3AV2 A;  5JRG B;  5CP6 A;  3MVD A;  5AV5 C;  3MGR D;  2CV5 B;  5E5A D;  4KUD C;  2VQR A;  4R8P A;  3AFA B;  4DRA A;  3WAA B;  5FUG B;  4WU9 A;  2RIQ A;  4KGC C;  3AZL D;  1P3F B;  3X1S C;  4J8W B;  3UT9 D;  3B0C W;  1R4V A;  5B32 C;  3C1B B;  4QLC C;  5AV9 D;  1KX3 B;  5B2J A;  2BG1 A;  1BH9 B;  5DNM D;  5GXQ A;  4UUZ B;  1W2E A;  4XZQ C;  1F66 D;  4XUJ C;  3REJ C;  5B33 C;  1ID3 D;  3MNN C;  5B1L D;  4DRB A;  3REK B;  1KX4 D;  4J8X A;  1AOI D;  2Y2Q A;  3KXB C;  5GSU B;  5B31 D;  5B24 B;  4J8V B;  3VH6 W;  3IP4 C;  3MGR A;  3AZH A;  3AV1 B;  5AV5 D;  1M19 D;  4KUD D;  3W97 B;  3WTP C;  1P3P D;  2Y2P A;  5AY8 C;  4YM6 C;  1EQZ A;  4KGC D;  3KWQ B;  3AZE C;  4Z5T B;  5AV9 A;  5CPK C;  1P34 B;  3REI C;  3AZI B;  5B40 B;  4H9S A;  1F66 A;  3AZK A;  3FDD A;  2F8N D;  3H0L C;  3MGQ B;  3UTA C;  3AZJ D;  1P3B B;  1P3A C;  5B1L A;  3A6N C;  3NQU A;  4ZUX C;  5CPI A;  1AOI A;  1ZLA D;  3UTB B;  1S32 B;  3W99 C;  1HQ3 B;  5B31 A;  3X1U B;  2HUE B;  3VH5 W;  3KXB D;  4X23 D;  3LZ0 C;  5AVC A;  1H3O B;  1BFM A;  3REH B;  4YS3 B;  1M19 A;  5AV5 A;  4KUD A;  2Y2I A;  3W96 B; 
#chains in the Genus database with same CATH homology
 3WTP D;  3MVD C;  4JJN B;  4KGC A;  1M1A B;  2Y2M A;  4CAY B;  4YM6 D;  5KDM A;  5JRG D;  2G5H C;  2CV5 D;  5B32 A;  3AFA D;  4Z66 B;  2XD5 A;  4QLC A;  1P3M C;  2JE5 A;  3AZG C;  1P3O B;  1BH8 A;  4XZQ A;  2F8N A;  3LZ1 C;  4XUJ A;  4J8W D;  5AV6 B;  3REJ A;  3REL B;  5B33 A;  3C1B D;  3MNN A;  2LY8 A;  3A6N D;  4AWL B;  1KX3 D;  3AZN C;  5BO0 B;  3KXB A;  4WZS B;  4EO5 B;  3X1T C;  4J8U B;  1T3U A;  4WU8 C;  3AZF C;  2J8P A;  5G49 B;  4J8X C;  5BNV B;  5AVB B;  3REK D;  2YFW B;  3R45 A;  3WTP A;  3X1V B;  5B24 D;  4J8V D;  2NZD B;  5E5A C;  5AY8 A;  3V9R B;  4YM6 A;  3NQJ B;  3EPK A;  5GT0 B;  5GT3 B;  3AZE A;  2W8S A;  2BYM A;  3AZL C;  5B2I B;  3WTP E;  3AV1 D;  3UT9 C;  4H9O B;  3MGS C;  3B0C T;  3B6F B;  3VH6 A;  3W97 D;  2HIO B;  3KUY B;  2JSS A;  1P3M D;  1U35 C;  3AZG D;  3KWQ D;  5B0Z B;  5DNM C;  1P3A A;  3A6N A;  4Z5T D;  1P34 D;  4ZUX A;  2F8N H;  3AZI D;  1P3I B;  5B40 D;  1P3G B;  1ID3 C;  5JA4 B;  3LZ0 A;  1KX4 C;  2Y2G A;  3MGQ D;  4H9P B;  3X1T D;  1P3B D;  5B31 C;  3AZF D;  2IO5 C;  3REK A;  3VH6 T;  3TU4 B;  2CWE A;  3UTB D;  1S32 D;  4DQY B;  1HQ3 D;  5DNN B;  3X1U D;  4J8V A;  1KX5 B;  1JFI A;  1M19 C;  4ZBJ B;  1P3L C;  2PYO C;  4YS3 D;  3REH D;  5B1M C;  3AV1 A;  1P3P C;  3LEL B;  3VH5 A;  2FFF B;  3W97 A;  4HGA B;  3F6T A;  4Z2M H;  5F99 B;  3MGS D;  1P3M A;  2ARO B;  3AZG A;  3LJA C;  3KWQ A;  3AN2 B;  3LZ1 A;  1M1A D;  1U35 D;  1TZY C;  3B0D C;  3W98 B;  4NFT A;  4KHA B;  4Z66 D;  2RVQ D;  5B40 A;  4WJ3 C;  3A1K A;  3AZJ C;  5AV8 B;  3AZN A;  1P3O D;  3X1T A;  1ZLA C;  1P3B A;  4WU8 A;  3AZF A;  3REL D;  3VH5 T;  2FJ7 C;  4X23 C;  2NQB B;  1S32 A;  4H9R B;  3KFU G;  4E45 A;  3B6G B;  1H3O A;  5E5A A;  3WKJ C;  4J8U D;  3AZM B;  1P3L D;  2PYO D;  4WV4 B;  5B1M D;  3AZL A;  3UT9 A;  2BYK A;  3MGS A;  5JRG C;  2CV5 C;  3C1C B;  2NZD D;  4LD9 B;  1U35 A;  3AFA C;  3LJA D;  3WAA C;  5DNM A;  5GT0 D;  5GT3 D;  5CPJ B;  1TZY D;  1P3K B;  1P3F C;  4J8W C;  3B6F D;  3AV2 B;  5CP6 B;  4G91 B;  2HIO D;  1ID3 A;  3C1B C;  3KUY D;  1HTA A;  4R8P B;  1KX3 C;  1KX4 A;  4WU9 B;  4G92 B;  3AYW B;  2FJ7 D;  3MGP B;  5BO0 A;  1P3I D;  1P3G D;  5B0Y B;  3WA9 D;  3REK C;  1P3L A;  2PYO A;  5B2J B;  5GXQ B;  3EPL A;  5GSU C;  3WKJ D;  5B24 C;  4J8V C;  5B1M A;  1P3P A;  5DNN D;  4H9N B;  1KX5 D;  2NZD A;  3AV1 C;  3V9R A;  3LJA A;  3O62 B;  3W97 C;  5GT3 A;  1WWS A;  1TZY A;  3WAA D;  3LEL D;  3B6F A;  3KWQ C;  3MGR B;  5F99 D;  1P3F D;  1TAF B;  3AZJ A;  3AZH B;  2DQN C;  2YFV B;  2ARO D;  4Z5T C;  3H0M C;  1P34 C;  3AN2 D;  4NE6 A;  3AZI C;  1ZLA A;  5B40 C;  2F2A C;  3W98 D;  2FJ7 A;  5CHL B;  4X23 A;  1EQZ B;  3MGQ C;  1P3I A;  1P3B C;  5JA4 A;  5AV8 D;  3WA9 A;  5AV9 B;  3UTB C;  1S32 C;  3WKJ A;  1HQ3 C;  2ZY2 A;  3X1U C;  1F66 B;  3AZK B;  2HUE C;  5GSU D;  1N1J B;  1Z2C B;  4YS3 C;  3REH C;  1B6W A;  5JRG A;  1B67 A;  5B1L B;  2CV5 A;  5BS7 C;  3B6G D;  3NQU B;  5CPI B;  1AOI B;  5C3I B;  3AFA A;  3AZM D;  4H9Q B;  3W96 C;  3WAA A;  5FUG A;  1M18 B;  4JJN C;  5AVC B;  2Y2L A;  1P3F A;  1M1A C;  4J8W A;  5BNX B;  2Y2J A;  5AV5 B;  1Q9C A;  3C1B A;  3AN2 A;  4KUD B;  4Z66 C;  2RVQ C;  1KX3 A;  1BH9 A;  5B32 G;  4WNN B;  4UUZ A;  1P3O C;  5CPJ D;  4KGC B;  3X1S B;  1F1E A;  3AV2 D;  5KDM B;  5CP6 D;  5AV6 C;  1ULY A;  5B32 B;  3REL C;  2F8N G;  3EPH A;  4AWL C;  4QLC B;  2XD1 A;  4WU9 D;  4CSR B;  1BH8 B;  4EO5 C;  5GSU A;  5B24 A;  4XZQ B;  3AYW D;  2F8N B;  4XUJ B;  4J8U C;  4H9R A;  3MGP D;  3REJ B;  5B0Y D;  5B33 B;  3MNN B;  5AVB C;  3AZM A;  2G5I C;  5B2J D;  2DF4 C;  3X1V C;  5GXQ D;  3KXB B;  2NZD C;  3W96 D;  4UPK A;  4JJN D;  5GT0 C;  5GT3 C;  2Y2N A;  4Z2M G;  5B2I C;  4Z5T A;  1P34 A;  3B6F C;  3O62 D;  3WTP B;  3AZI A;  2HIO C;  5CPJ A;  3KUY C;  3A1I A;  5AY8 B;  4YM6 B;  5B0Z C;  3MGQ A;  3AZH D;  5AV6 D;  3AZE B;  2BYM B;  5CPK B;  3REI B;  3UTB A;  1P3I C;  1P3G C;  3AYW A;  1HQ3 A;  3X1U A;  5BT1 C;  3WA9 C;  1EQZ D;  3MGP A;  3UTA B;  5B0Y A;  3REH A;  4YS3 A;  1P3A B;  3A6N B;  5BS7 A;  3TU4 C;  4ZUX B;  5AVB D;  5DNN C;  1KX5 C;  3W99 B;  3AL0 C;  3W96 A;  3AZK D;  3X1V D;  4ZBJ C;  4JJN A;  1A7W A;  3LZ0 B;  1M1A A;  4CAY A;  4H9N A;  3LEL C;  3O62 A;  5CPI D;  4HGA C;  4Z66 A;  5B2I D;  5F99 C;  1JFI B;  1M18 D;  2ARO C;  3MVD B;  1P3O A;  5AVC D;  3AN2 C;  1TAF A;  4E44 A;  5AV6 A;  2YFV A;  5B0Z D;  3W98 C;  3REL A;  3B0B A;  2Y2O A;  1P3M B;  5AV8 C;  4M6B A;  3AZG B;  3LZ1 B;  5BT1 D;  3X1S D;  4J8U A;  5G49 A;  5B32 D;  5BNV A;  2NQB C;  2UWX A;  5AVB A;  2F8N K;  4QLC D;  2YFW A;  3TU4 D;  3AZN B;  3X1V A;  1N1J A;  3B6G C;  3KSY A;  4XZQ D;  1PZR A;  4XUJ D;  3X1T B;  3AZM C;  4WU8 B;  3NQJ A;  3AZF B;  3REJ D;  4J8X B;  5GT0 A;  5B33 D;  3MNN D;  5B2I A;  4H9Q A;  4H9O A;  1M18 A;  3H0R C;  3C1C C;  2HIO A;  4LD9 C;  3KUY A;  5E5A B;  5BNX A;  5B0Z A;  5CPJ C;  2ZY5 A;  1P3K C;  3AZL B;  3UT9 B;  2BYK B;  3MGS B;  3AV2 C;  5CP6 C;  4G91 C;  4WNN A;  2ZY4 A;  1P3G A;  1U35 B;  3X1S A;  5AY8 D;  4R8P C;  2Y2H A;  4H9P A;  5DNM B;  4WU9 C;  4G92 C;  3AYW C;  3AZE D;  3TU4 A;  5CPK D;  3MGP C;  2NQB D;  3REI D;  4CSR A;  5B31 G;  5B0Y C;  5DNN A;  3EPJ A;  1KX5 A;  1ID3 B;  5B2J C;  1KX4 B;  4NE5 A;  3UTA D;  5GXQ C;  3EG5 B;  5B31 B;  1P3A D;  3LEL A;  2IO5 B;  4ZUX D;  5F99 A;  3W99 D;  2ARO A;  3C1C D;  1M19 B;  1P3L B;  2PYO B;  3O62 C;  3LZ0 D;  4LD9 D;  5B1M B;  1P3P B;  3W98 A;  1WWI A;  1P3K D;  4KHA A;  3MGR C;  2JCH A;  3AZH C;  5AV8 A;  3P5J B;  3MVD D;  3LJA B;  2ZM5 A;  4R8P D;  1TZY B;  3B0D B;  5CPK A;  1EQZ C;  2NQB A;  2Y2K A;  3REI A;  3AZJ B;  3B6G A;  5AV9 C;  2L5A A;  3LZ1 D;  3UTA A;  1ZLA B;  1KU5 A;  4H9S C;  1F66 C;  3AZK C;  2FJ7 B;  4X23 B;  3W99 A;  5B1L C;  3AZN D;  3C1C A;  3WA9 B;  4LD9 A;  5CPI C;  1AOI C;  5C3I C;  3WKJ B;  4WU8 D;  3R45 B;  4J8X D;  2ZY3 A;  1M18 C;  4NE3 A;  5AVC C;  1P3K A;  3AV2 A;  5JRG B;  5CP6 A;  3MVD A;  5AV5 C;  3MGR D;  2CV5 B;  5E5A D;  4KUD C;  2VQR A;  4R8P A;  3AFA B;  4DRA A;  3WAA B;  5FUG B;  4WU9 A;  2RIQ A;  4KGC C;  3AZL D;  1P3F B;  3X1S C;  4J8W B;  3UT9 D;  3B0C W;  1R4V A;  5B32 C;  3C1B B;  4QLC C;  5AV9 D;  1KX3 B;  5B2J A;  2BG1 A;  1BH9 B;  5DNM D;  5GXQ A;  4UUZ B;  1W2E A;  4XZQ C;  1F66 D;  4XUJ C;  3REJ C;  5B33 C;  1ID3 D;  3MNN C;  5B1L D;  4DRB A;  3REK B;  1KX4 D;  4J8X A;  1AOI D;  2Y2Q A;  3KXB C;  5GSU B;  5B31 D;  5B24 B;  4J8V B;  3VH6 W;  3IP4 C;  3MGR A;  3AZH A;  3AV1 B;  5AV5 D;  1M19 D;  4KUD D;  3W97 B;  3WTP C;  1P3P D;  2Y2P A;  5AY8 C;  4YM6 C;  1EQZ A;  4KGC D;  3KWQ B;  3AZE C;  4Z5T B;  5AV9 A;  5CPK C;  1P34 B;  3REI C;  3AZI B;  5B40 B;  4H9S A;  1F66 A;  3AZK A;  3FDD A;  2F8N D;  3H0L C;  3MGQ B;  3UTA C;  3AZJ D;  1P3B B;  1P3A C;  5B1L A;  3A6N C;  3NQU A;  4ZUX C;  5CPI A;  1AOI A;  1ZLA D;  3UTB B;  1S32 B;  3W99 C;  1HQ3 B;  5B31 A;  3X1U B;  2HUE B;  3VH5 W;  3KXB D;  4X23 D;  3LZ0 C;  5AVC A;  1H3O B;  1BFM A;  3REH B;  4YS3 B;  1M19 A;  5AV5 A;  4KUD A;  2Y2I A;  3W96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...