4J8VA

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vA00
5AY8B 3WTPE 1P3KC 5C3IB 4X23A 3C1BA 5JRGD 5B2ID 3KWQC 1F66A 1M18A 3AZMB 4E44A 3C1CD 1M1AC 4Z5TC 3X1UD 1HQ3D 3W99D 3O62B 3AFAC 4NFTA 5BNXB 4Z66C 3KSYA 3AZKA 4YS3A 1P3IC 5B24D 5AVCD 4XZQB 5GT0D 2HIOB 3RELC 3MGRC 4KHAB 4WU9A 1WWSA 3MVDD 2HUEB 5DNNA 3LZ0B 1P3MD 4WU8C 4JJNA 4H9OA 2F8NH 3REJB 1BH8B 5FUGA 1M18D 5BO0B 3R45B 3WKJC 5B1MD 3MNNA 2AROA 3AZFC 3W97B 5CP6A 5B0YB 3AZHB 4UUZA 3AZNB 5F99C 4J8WB 3X1VA 1P3KB 2LY8A 1HTAA 5E5AC 3W97D 3B0CT 3KUYD 3X1TD 3B6GB 1P34C 3KWQB 1KX3C 4JJND 5AV8B 5GSUC 4YM6D 2NQBC 1M1AB 4Z5TB 3LZ1A 5B31D 4XUJD 4J8XA 3AFAB 4Z66B 3MGPA 1P3IB 5AV9D 1P3BB 5KDMB 4R8PA 4Z2MG 1ZLAA 1TZYB 3RELB 3W96C 5B32G 3MGRB 3X1VD 5DNMD 1U35D 4KGCA 4WU8B 5B32A 5B2JC 1S32A 3REIA 1KX5B 5GT3D 5B40A 3REKC 2FJ7D 5AVBA 3WA9C 3WKJB 3UTBC 3AZED 3AZFB 1B67A 3LJAA 1N1JB 4AWLC 1B6WA 4CSRA 5E5AB 2NZDA 1P3PC 1P3AA 1P3LD 1P34B 4M6BA 5B33A 5F99D 1P3GA 5G49B 1KX3B 3C1CC 5BT1C 5GSUB 2PYOD 2NQBB 4QLCD 5GXQB 5B40D 3X1UC 3MGSC 1HQ3C 3W99C 5CPKA 4WNNA 5B24C 3AV1B 5AVCC 5GT0C 3W96B 1AOID 5B0ZB 3AZIA 3MVDC 1P3MC 5B2JB 2NZDD 3TU4D 5BS7A 3AZJD 5B33D 1M18C 3W96D 3REKB 3WTPB 3WA9B 3UTBB 1ULYA 3AZGA 1P3FA 5B2JD 1P3OD 4AWLB 3AZLA 5AV6A 4YS3C 3UT9D 1ID3A 2F8NG 4H9PB 3LELA 3KXBA 2F8NA 5JRGB 4WU9C 5CPJA 1P3PB 3X1TC 3REHD 5DNNC 3A6NA 5JA4A 5CPIA 4JJNC 4ZUXA 3C1CB 3NQJA 4YM6C 4CAYB 1M19A 3NQUB 5B31C 1KX4A 4XUJC 3X1UB 2CV5A 1HQ3B 1P3PD 3W99B 3UTAA 3AZGD 4J8VD 3MGQA 5AV9C 5B24B 2AROC 5AVCB 5GT0B 5BT1D 2YFVB 3W98A 3X1VC 5DNMC 1U35C 4KUDA 3MVDB 3MGSD 3LELD 2YFWB 1BH9B 3AV2D 1P3MB 1JFIB 4H9QA 4LD9D 5CHLB 1M18B 5GT3C 2FJ7C 4ZUXD 2RVQD 5BNXA 3O62A 3AZEC 5B1LA 5B1MB 4XZQA 1KX4D 2HIOA 4X23D 3C1BD 4KHAA 1F66D 3LZ0A 3W98D 4WU9B 3REJA 1BH8A 3KUYB 3X1TB 1P3LC 4KUDD 3AZKD 2BYMA 3VH6W 3X1SA 4YS3D 5BO0A 3R45A 5B32C 4JJNB 2CWEA 4YM6B 2PYOC 4QLCC 4H9RB 5B31B 3AZHA 5B40C 4XUJB 4WU9D 3AZNA 3AN2A 5DNND 4J8WA 5AV9B 5B1LD 3B6FA 1P3KA 1AOIC 3X1VB 5DNMB 1U35B 3B6GA 4G91C 2NZDC 5AV8A 2AROD 3MNND 3TU4C 5CP6D 1P3AC 3AZJC 1M1AA 4Z5TA 5B33C 3X1SD 5GT3B 2FJ7B 4WV4B 4Z66A 3AZEB 1P3IA 1P3BA 5KDMA 5BNVB 1P3OC 1TZYA 3VH5W 3RELA 3AN2D 3MGRA 3UT9C 3B6FD 2IO5C 3LZ1D 4G92C 3AZIC 1P3LB 3REHC 5F99B 4J8XD 3MGPD 1KX5A 1F1EA 4WZSB 4R8PD 3WKJA 2PYOB 4H9SC 5BS7C 4QLCB 1ZLAD 2JSSA 3AZFA 5B40B 4KGCD 1N1JA 4J8UA 3AZGC 4J8VC 5B32D 1P3FC 1S32D 5E5AA 3AZLC 3REID 3V9RB 1AOIB 4H9NB 1P34A 5AVBD 3LELC 5G49A 3AV2C 4ZBJC 4LD9C 1KX3A 3WAAA 4G91B 2NZDB 5GSUA 3TU4B 2NQBA 3LJAD 3AZJB 5B33B 3A6NC 5GXQA 4ZUXC 2RVQC 1M19C 3AV1A 1P3OB 1KX4C 4X23C 3C1BC 1P3AD 4J8UD 3UTAC 3UT9B 5B0ZA 1P3GD 1F66C 1EQZA 1H3OB 5C3IC 2IO5B 3W98C 4KUDC 5AV5A 3REHB 3AZKC 5CPKD 3REKA 3WAAD 3WTPA 3UTBA 3VH6A 3AYWA 3AZID 3AZGB 4J8VB 5B1LC 4H9PA 1P3FB 1WWIA 2BYKA 5B2IA 5JRGA 1EQZD 3MGSB 3LZ0C 3LELB 3VH6T 3AV2B 1TAFB 4ZBJB 4LD9B 5AY8A 3MNNC 3C1CA 1P3FD 5CP6C 3REJC 4CAYA 3NQUA 4DRBA 3AZLD 3X1SC 5AV6D 1ID3D 3X1UA 1HQ3A 3W99A 4ZUXB 3KXBD 5B24A 3AZMA 3AYWD 2F8ND 5GT0A 1KX4B 4X23B 3C1BB 5CPJD 3AZNC 3UTAB 3AN2C 2YFVA 4J8WC 1F66B 3A6ND 3B6FC 3MVDA 5CPID 3VH5A 2YFWA 1BH9A 1P3MA 1M19D 1JFIA 3LZ1C 3W98B 4KUDB 2CV5D 3B6GC 3AZKB 4J8XC 3B0BA 3MGPC 3UTAD 4YS3B 3MGQD 4H9QB 4R8PC 5AY8D 5AV8C 1ZLAC 5B1MA 4KGCC 1BFMA 3VH5T 5DNNB 5B1LB 1P3BC 3AZMD 1S32C 4H9OB 1TZYC 3REIC 5FUGB 2L5AA 3W97A 5B0YA 3KUYA 3X1TA 5AVBC 3O62D 4E45A 5B31G 3MNNB 2AROB 4YM6A 5CP6B 4XZQD 2HIOD 3LJAC 4H9RA 4UUZB 2BYMB 5B31A 1KX5C 3X1SB 4XUJA 3LZ0D 3KWQA 5AV9A 3REJD 4J8UC 3AN2B 1P3GC 1U35A 5DNMA 3B6FB 3AFAA 3LZ1B 3AZHD 5B0YD 4NE5A 1KU5A 5CPKC 4J8XB 3AZND 3MGPB 5GT3A 4J8WD 3WAAC 2FJ7A 4R8PB 1P3KD 3AZEA 1ZLAB 5BNVA 4WU8A 5GXQC 4KGCB 3B6GD 3KWQD 3AV1C 5B32B 1S32B 5AV8D 1M1AD 3REIB 4Z5TD 5B0ZC 1EQZC 1P3LA 3B0DC 4HGAC 4EO5C 5AVBB 5F99A 3AFAD 4Z66D 1P3ID 1P3BD 2PYOA 5AV5C 3LJAB 4QLCA 1TZYD 3RELD 5AV6C 3MGRD 1ID3C 3WTPC 4CSRB 3KXBC 1A7WA 3AYWC 4WU8D 3B0CW 5CPJC 1P3AB 4J8UB 3V9RA 1P3GB 1AOIA 1KX5D 5CPIC 4H9NA 3WKJD 3AZFD 5JRGC 5B2IC 3TU4A 3AZJA 2CV5C 1Q9CA 5CPKB 3W96A 4WNNB 3MGQC 3WAAB 5AY8C 5E5AD 1P3OA 5B2JA 1R4VA 4G92B 3AZIB 4NE6A 1P34D 3UT9A 4Z2MH 1H3OA 3AZMC 1KX3D 3WA9A 5GSUD 2NQBD 5GXQD 1EQZB 3B0DB 3REHA 4HGAB 4EO5B 3O62C 3AV1D 4XZQC 4H9SA 2HIOC 5AV5B 2F8NK 3AZLB 5AV6B 1ID3B 5B0ZD 1P3PA 4NE3A 2HUEC 4J8VA 3KXBB 4DRAA 5B1MC 3AYWB 2F8NB 5CPJB 5AV5D 3A6NB 5JA4B 5CPIB 3MGSA 3REKD 3WTPD 3WA9D 3UTBD 3NQJB 3AV2A 1TAFA 1M19B 4LD9A 2BYKB 3W97C 5B2IB 5AVCA 3AZHC 5B0YC 3KUYC 2CV5B 3MGQB
chains in the Genus database with same CATH superfamily
5AY8B 3WTPE 1P3KC 5C3IB 4X23A 3C1BA 5JRGD 5B2ID 3AL0C 3KWQC 1F66A 1M18A 3AZMB 4E44A 3C1CD 1M1AC 4Z5TC 3X1UD 1HQ3D 3W99D 3O62B 3AFAC 4NFTA 5BNXB 4Z66C 3KSYA 3AZKA 2Y2NA 4YS3A 1P3IC 5B24D 5AVCD 4XZQB 5GT0D 2HIOB 3H0MC 3RELC 3MGRC 4KHAB 4WU9A 1WWSA 3MVDD 2HUEB 5DNNA 3LZ0B 1P3MD 4WU8C 4JJNA 4H9OA 2F8NH 3REJB 1BH8B 5FUGA 1M18D 5BO0B 3R45B 2Y2IA 3WKJC 2XD1A 3H0RC 5B1MD 2AROA 3MNNA 3AZFC 3W97B 5CP6A 5B0YB 3AZHB 2ZY4A 4UUZA 3AZNB 5F99C 4J8WB 3X1VA 2W8SA 1W2EA 2G5IC 1P3KB 2LY8A 1HTAA 5E5AC 3W97D 3B0CT 3KUYD 3X1TD 3B6GB 1P34C 3KWQB 1KX3C 4JJND 5AV8B 5GSUC 2JE5A 4YM6D 2NQBC 1M1AB 4Z5TB 3LZ1A 5B31D 4XUJD 4J8XA 3AFAB 4Z66B 3MGPA 1P3IB 5AV9D 1P3BB 5KDMB 4R8PA 4Z2MG 1ZLAA 1TZYB 3RELB 3W96C 5B32G 3MGRB 3X1VD 5DNMD 1U35D 4KGCA 5B32A 5B2JC 4WU8B 1S32A 3REIA 1KX5B 5GT3D 5B40A 3REKC 2FJ7D 2Y2PA 5AVBA 3WA9C 3UTBC 3AZED 3WKJB 2Y2HA 3AZFB 1B67A 3LJAA 1N1JB 4AWLC 1B6WA 4CSRA 2G5HC 5E5AB 2NZDA 1P3PC 1P3AA 1P3LD 1P34B 4M6BA 5B33A 5F99D 1P3GA 5G49B 1KX3B 3C1CC 5BT1C 5GSUB 2PYOD 2NQBB 4QLCD 5GXQB 2BG1A 5B40D 3X1UC 3MGSC 1HQ3C 3W99C 5CPKA 4WNNA 5B24C 3AV1B 5AVCC 5GT0C 3W96B 1AOID 5B0ZB 3AZIA 3MVDC 1P3MC 5B2JB 2NZDD 3TU4D 5BS7A 3AZJD 5B33D 1M18C 3W96D 3REKB 3WTPB 3WA9B 3UTBB 1ULYA 3AZGA 1P3FA 5B2JD 1P3OD 4AWLB 3AZLA 5AV6A 4YS3C 3UT9D 1ID3A 2F8NG 4H9PB 3LELA 3KXBA 4DQYB 2F8NA 5JRGB 4WU9C 5CPJA 1P3PB 3X1TC 3REHD 5DNNC 3A6NA 5JA4A 5CPIA 4JJNC 4ZUXA 3C1CB 3NQJA 4YM6C 4CAYB 1M19A 3NQUB 5B31C 1KX4A 4XUJC 3X1UB 2CV5A 1HQ3B 2XD5A 1P3PD 3W99B 3UTAA 3AZGD 4J8VD 3MGQA 5AV9C 5B24B 2AROC 5AVCB 5GT0B 5BT1D 2YFVB 3W98A 3X1VC 5DNMC 1U35C 4KUDA 3MVDB 3MGSD 4UPKA 3LELD 2YFWB 1BH9B 3AV2D 1P3MB 1JFIB 4H9QA 4LD9D 5CHLB 1M18B 2DF4C 5GT3C 2FJ7C 4ZUXD 2RVQD 5BNXA 3O62A 3AZEC 5B1LA 5B1MB 4XZQA 2FFFB 1KX4D 2HIOA 4X23D 3C1BD 4KHAA 1F66D 3LZ0A 3W98D 4WU9B 3REJA 1BH8A 3KUYB 3X1TB 1P3LC 4KUDD 3AZKD 2BYMA 3VH6W 3X1SA 4YS3D 5BO0A 3R45A 5B32C 4JJNB 2CWEA 4YM6B 2UWXA 2PYOC 4QLCC 2RIQA 4H9RB 5B31B 3AZHA 5B40C 4XUJB 4WU9D 3AZNA 3AN2A 5DNND 4J8WA 5AV9B 5B1LD 3B6FA 2Y2KA 1P3KA 1AOIC 3X1VB 5DNMB 1U35B 3B6GA 4G91C 2NZDC 5AV8A 2AROD 3MNND 3TU4C 5CP6D 1P3AC 3AZJC 1M1AA 4Z5TA 5B33C 4WJ3C 3X1SD 3EG5B 5GT3B 2FJ7B 4WV4B 4Z66A 3AZEB 1P3IA 1P3BA 5KDMA 5BNVB 1P3OC 1TZYA 3VH5W 3RELA 3AN2D 3MGRA 3UT9C 3B6FD 2IO5C 3EPKA 3LZ1D 4G92C 3AZIC 1P3LB 3EPLA 3REHC 5F99B 4J8XD 3MGPD 1KX5A 3KFUG 1F1EA 4WZSB 2JCHA 4R8PD 3WKJA 2PYOB 4H9SC 5BS7C 4QLCB 1ZLAD 2JSSA 3AZFA 5B40B 4KGCD 1N1JA 4J8UA 3AZGC 4J8VC 5B32D 1P3FC 1S32D 5E5AA 3AZLC 3REID 3V9RB 1AOIB 2ZY2A 4H9NB 1P34A 5AVBD 3LELC 5G49A 3AV2C 4ZBJC 4LD9C 1KX3A 3WAAA 4G91B 2NZDB 5GSUA 3TU4B 2NQBA 3LJAD 3AZJB 5B33B 3A6NC 5GXQA 1T3UA 2RVQC 4ZUXC 1M19C 2Y2JA 3AV1A 1P3OB 1KX4C 4X23C 3C1BC 1P3AD 4J8UD 3UTAC 3UT9B 5B0ZA 1P3GD 1F66C 1EQZA 1H3OB 5C3IC 2IO5B 2VQRA 3W98C 4KUDC 5AV5A 3REHB 3AZKC 5CPKD 3REKA 3A1IA 3WTPA 3WAAD 3UTBA 3VH6A 3AYWA 3AZID 3AZGB 4J8VB 5B1LC 4H9PA 1P3FB 1WWIA 2ZY5A 2BYKA 5B2IA 5JRGA 1EQZD 3MGSB 3LZ0C 3LELB 3VH6T 3AV2B 1TAFB 4ZBJB 4LD9B 5AY8A 3MNNC 3C1CA 1P3FD 5CP6C 3REJC 4CAYA 3NQUA 4DRBA 3AZLD 3X1SC 5AV6D 1ID3D 3X1UA 1HQ3A 3W99A 4ZUXB 3KXBD 5B24A 2ZM5A 3AZMA 3AYWD 2F8ND 5GT0A 1KX4B 4X23B 3C1BB 5CPJD 3AZNC 3UTAB 3AN2C 2YFVA 4J8WC 1F66B 3A6ND 3B6FC 3MVDA 5CPID 3VH5A 2YFWA 1BH9A 1P3MA 1M19D 1JFIA 3LZ1C 3W98B 4KUDB 2CV5D 3B6GC 3AZKB 4J8XC 3B0BA 3MGPC 3UTAD 4YS3B 3MGQD 4H9QB 4R8PC 5AY8D 5AV8C 1ZLAC 5B1MA 1PZRA 4KGCC 1BFMA 3VH5T 5DNNB 5B1LB 1P3BC 3AZMD 1S32C 4H9OB 1TZYC 3REIC 5FUGB 2L5AA 3W97A 5B0YA 3KUYA 3X1TA 5AVBC 3O62D 4E45A 5B31G 3MNNB 2AROB 3P5JB 3A1KA 4YM6A 2Y2GA 5CP6B 2HIOD 4XZQD 3LJAC 4H9RA 4UUZB 2BYMB 5B31A 1KX5C 3X1SB 4XUJA 3H0LC 3LZ0D 3KWQA 5AV9A 2F2AC 3REJD 4J8UC 3AN2B 1P3GC 1U35A 5DNMA 3B6FB 3AFAA 3EPHA 3FDDA 3LZ1B 3AZHD 5B0YD 4NE5A 1KU5A 5CPKC 2Y2LA 4J8XB 3MGPB 3AZND 3F6TA 5GT3A 4J8WD 3WAAC 2FJ7A 4R8PB 1P3KD 3AZEA 2ZY3A 1ZLAB 5BNVA 4WU8A 5GXQC 2J8PA 4KGCB 3B6GD 3KWQD 3IP4C 5B32B 3AV1C 1S32B 5AV8D 1M1AD 3REIB 4Z5TD 5B0ZC 1EQZC 1P3LA 3B0DC 4HGAC 4EO5C 5AVBB 5F99A 3AFAD 4Z66D 1P3ID 1P3BD 2PYOA 5AV5C 3LJAB 4QLCA 1TZYD 3RELD 5AV6C 3MGRD 1ID3C 3WTPC 4CSRB 3KXBC 1A7WA 3AYWC 4WU8D 3B0CW 5CPJC 1P3AB 4J8UB 3V9RA 1P3GB 1AOIA 1KX5D 5CPIC 4H9NA 3WKJD 2Y2MA 3AZFD 5JRGC 5B2IC 3TU4A 3AZJA 2CV5C 1Q9CA 5CPKB 3W96A 2DQNC 4WNNB 3MGQC 3WAAB 5AY8C 5E5AD 3EPJA 5B2JA 1P3OA 1R4VA 4G92B 3AZIB 4NE6A 1P34D 3UT9A 4Z2MH 1H3OA 3AZMC 1Z2CB 1KX3D 3WA9A 5GSUD 2NQBD 5GXQD 1EQZB 2Y2OA 3B0DB 3REHA 4HGAB 4EO5B 3O62C 3AV1D 4XZQC 4H9SA 2HIOC 5AV5B 2F8NK 3AZLB 5AV6B 1ID3B 5B0ZD 2Y2QA 1P3PA 4NE3A 2HUEC 4J8VA 3KXBB 4DRAA 5B1MC 3AYWB 2F8NB 5CPJB 5AV5D 3A6NB 5JA4B 5CPIB 3MGSA 3REKD 3WTPD 3WA9D 3UTBD 3NQJB 3AV2A 1TAFA 1M19B 4LD9A 2BYKB 3W97C 5B2IB 5AVCA 3AZHC 5B0YC 3KUYC 2CV5B 3MGQB
chains in the Genus database with same CATH topology
5AY8B 3WTPE 1P3KC 5C3IB 4X23A 3C1BA 5JRGD 5B2ID 3AL0C 3KWQC 1F66A 1M18A 3AZMB 4E44A 3C1CD 1M1AC 4Z5TC 3X1UD 1HQ3D 3W99D 3O62B 3AFAC 4NFTA 5BNXB 4Z66C 3KSYA 3AZKA 2Y2NA 4YS3A 1P3IC 5B24D 5AVCD 4XZQB 5GT0D 2HIOB 3H0MC 3RELC 3MGRC 4KHAB 4WU9A 1WWSA 3MVDD 2HUEB 5DNNA 3LZ0B 1P3MD 4WU8C 4JJNA 4H9OA 2F8NH 3REJB 1BH8B 5FUGA 1M18D 5BO0B 3R45B 2Y2IA 3WKJC 2XD1A 3H0RC 5B1MD 2AROA 3MNNA 3AZFC 3W97B 5CP6A 5B0YB 3AZHB 2ZY4A 4UUZA 3AZNB 5F99C 4J8WB 3X1VA 2W8SA 1W2EA 2G5IC 1P3KB 2LY8A 1HTAA 5E5AC 3W97D 3B0CT 3KUYD 3X1TD 3B6GB 1P34C 3KWQB 1KX3C 4JJND 5AV8B 5GSUC 2JE5A 4YM6D 2NQBC 1M1AB 4Z5TB 3LZ1A 5B31D 4XUJD 4J8XA 3AFAB 4Z66B 3MGPA 1P3IB 5AV9D 1P3BB 5KDMB 4R8PA 4Z2MG 1ZLAA 1TZYB 3RELB 3W96C 5B32G 3MGRB 3X1VD 5DNMD 1U35D 4KGCA 5B32A 5B2JC 4WU8B 1S32A 3REIA 1KX5B 5GT3D 5B40A 3REKC 2FJ7D 2Y2PA 5AVBA 3WA9C 3UTBC 3AZED 3WKJB 2Y2HA 3AZFB 1B67A 3LJAA 1N1JB 4AWLC 1B6WA 4CSRA 2G5HC 5E5AB 2NZDA 1P3PC 1P3AA 1P3LD 1P34B 4M6BA 5B33A 5F99D 1P3GA 5G49B 1KX3B 3C1CC 5BT1C 5GSUB 2PYOD 2NQBB 4QLCD 5GXQB 2BG1A 5B40D 3X1UC 3MGSC 1HQ3C 3W99C 5CPKA 4WNNA 5B24C 3AV1B 5AVCC 5GT0C 3W96B 1AOID 5B0ZB 3AZIA 3MVDC 1P3MC 5B2JB 2NZDD 3TU4D 5BS7A 3AZJD 5B33D 1M18C 3W96D 3REKB 3WTPB 3WA9B 3UTBB 1ULYA 3AZGA 1P3FA 5B2JD 1P3OD 4AWLB 3AZLA 5AV6A 4YS3C 3UT9D 1ID3A 2F8NG 4H9PB 3LELA 3KXBA 4DQYB 2F8NA 5JRGB 4WU9C 5CPJA 1P3PB 3X1TC 3REHD 5DNNC 3A6NA 5JA4A 5CPIA 4JJNC 4ZUXA 3C1CB 3NQJA 4YM6C 4CAYB 1M19A 3NQUB 5B31C 1KX4A 4XUJC 3X1UB 2CV5A 1HQ3B 2XD5A 1P3PD 3W99B 3UTAA 3AZGD 4J8VD 3MGQA 5AV9C 5B24B 2AROC 5AVCB 5GT0B 5BT1D 2YFVB 3W98A 3X1VC 5DNMC 1U35C 4KUDA 3MVDB 3MGSD 4UPKA 3LELD 2YFWB 1BH9B 3AV2D 1P3MB 1JFIB 4H9QA 4LD9D 5CHLB 1M18B 2DF4C 5GT3C 2FJ7C 4ZUXD 2RVQD 5BNXA 3O62A 3AZEC 5B1LA 5B1MB 4XZQA 2FFFB 1KX4D 2HIOA 4X23D 3C1BD 4KHAA 1F66D 3LZ0A 3W98D 4WU9B 3REJA 1BH8A 3KUYB 3X1TB 1P3LC 4KUDD 3AZKD 2BYMA 3VH6W 3X1SA 4YS3D 5BO0A 3R45A 5B32C 4JJNB 2CWEA 4YM6B 2UWXA 2PYOC 4QLCC 2RIQA 4H9RB 5B31B 3AZHA 5B40C 4XUJB 4WU9D 3AZNA 3AN2A 5DNND 4J8WA 5AV9B 5B1LD 3B6FA 2Y2KA 1P3KA 1AOIC 3X1VB 5DNMB 1U35B 3B6GA 4G91C 2NZDC 5AV8A 2AROD 3MNND 3TU4C 5CP6D 1P3AC 3AZJC 1M1AA 4Z5TA 5B33C 4WJ3C 3X1SD 3EG5B 5GT3B 2FJ7B 4WV4B 4Z66A 3AZEB 1P3IA 1P3BA 5KDMA 5BNVB 1P3OC 1TZYA 3VH5W 3RELA 3AN2D 3MGRA 3UT9C 3B6FD 2IO5C 3EPKA 3LZ1D 4G92C 3AZIC 1P3LB 3EPLA 3REHC 5F99B 4J8XD 3MGPD 1KX5A 3KFUG 1F1EA 4WZSB 2JCHA 4R8PD 3WKJA 2PYOB 4H9SC 5BS7C 4QLCB 1ZLAD 2JSSA 3AZFA 5B40B 4KGCD 1N1JA 4J8UA 3AZGC 4J8VC 5B32D 1P3FC 1S32D 5E5AA 3AZLC 3REID 3V9RB 1AOIB 2ZY2A 4H9NB 1P34A 5AVBD 3LELC 5G49A 3AV2C 4ZBJC 4LD9C 1KX3A 3WAAA 4G91B 2NZDB 5GSUA 3TU4B 2NQBA 3LJAD 3AZJB 5B33B 3A6NC 5GXQA 1T3UA 2RVQC 4ZUXC 1M19C 2Y2JA 3AV1A 1P3OB 1KX4C 4X23C 3C1BC 1P3AD 4J8UD 3UTAC 3UT9B 5B0ZA 1P3GD 1F66C 1EQZA 1H3OB 5C3IC 2IO5B 2VQRA 3W98C 4KUDC 5AV5A 3REHB 3AZKC 5CPKD 3REKA 3A1IA 3WTPA 3WAAD 3UTBA 3VH6A 3AYWA 3AZID 3AZGB 4J8VB 5B1LC 4H9PA 1P3FB 1WWIA 2ZY5A 2BYKA 5B2IA 5JRGA 1EQZD 3MGSB 3LZ0C 3LELB 3VH6T 3AV2B 1TAFB 4ZBJB 4LD9B 5AY8A 3MNNC 3C1CA 1P3FD 5CP6C 3REJC 4CAYA 3NQUA 4DRBA 3AZLD 3X1SC 5AV6D 1ID3D 3X1UA 1HQ3A 3W99A 4ZUXB 3KXBD 5B24A 2ZM5A 3AZMA 3AYWD 2F8ND 5GT0A 1KX4B 4X23B 3C1BB 5CPJD 3AZNC 3UTAB 3AN2C 2YFVA 4J8WC 1F66B 3A6ND 3B6FC 3MVDA 5CPID 3VH5A 2YFWA 1BH9A 1P3MA 1M19D 1JFIA 3LZ1C 3W98B 4KUDB 2CV5D 3B6GC 3AZKB 4J8XC 3B0BA 3MGPC 3UTAD 4YS3B 3MGQD 4H9QB 4R8PC 5AY8D 5AV8C 1ZLAC 5B1MA 1PZRA 4KGCC 1BFMA 3VH5T 5DNNB 5B1LB 1P3BC 3AZMD 1S32C 4H9OB 1TZYC 3REIC 5FUGB 2L5AA 3W97A 5B0YA 3KUYA 3X1TA 5AVBC 3O62D 4E45A 5B31G 3MNNB 2AROB 3P5JB 3A1KA 4YM6A 2Y2GA 5CP6B 2HIOD 4XZQD 3LJAC 4H9RA 4UUZB 2BYMB 5B31A 1KX5C 3X1SB 4XUJA 3H0LC 3LZ0D 3KWQA 5AV9A 2F2AC 3REJD 4J8UC 3AN2B 1P3GC 1U35A 5DNMA 3B6FB 3AFAA 3EPHA 3FDDA 3LZ1B 3AZHD 5B0YD 4NE5A 1KU5A 5CPKC 2Y2LA 4J8XB 3MGPB 3AZND 3F6TA 5GT3A 4J8WD 3WAAC 2FJ7A 4R8PB 1P3KD 3AZEA 2ZY3A 1ZLAB 5BNVA 4WU8A 5GXQC 2J8PA 4KGCB 3B6GD 3KWQD 3IP4C 5B32B 3AV1C 1S32B 5AV8D 1M1AD 3REIB 4Z5TD 5B0ZC 1EQZC 1P3LA 3B0DC 4HGAC 4EO5C 5AVBB 5F99A 3AFAD 4Z66D 1P3ID 1P3BD 2PYOA 5AV5C 3LJAB 4QLCA 1TZYD 3RELD 5AV6C 3MGRD 1ID3C 3WTPC 4CSRB 3KXBC 1A7WA 3AYWC 4WU8D 3B0CW 5CPJC 1P3AB 4J8UB 3V9RA 1P3GB 1AOIA 1KX5D 5CPIC 4H9NA 3WKJD 2Y2MA 3AZFD 5JRGC 5B2IC 3TU4A 3AZJA 2CV5C 1Q9CA 5CPKB 3W96A 2DQNC 4WNNB 3MGQC 3WAAB 5AY8C 5E5AD 3EPJA 5B2JA 1P3OA 1R4VA 4G92B 3AZIB 4NE6A 1P34D 3UT9A 4Z2MH 1H3OA 3AZMC 1Z2CB 1KX3D 3WA9A 5GSUD 2NQBD 5GXQD 1EQZB 2Y2OA 3B0DB 3REHA 4HGAB 4EO5B 3O62C 3AV1D 4XZQC 4H9SA 2HIOC 5AV5B 2F8NK 3AZLB 5AV6B 1ID3B 5B0ZD 2Y2QA 1P3PA 4NE3A 2HUEC 4J8VA 3KXBB 4DRAA 5B1MC 3AYWB 2F8NB 5CPJB 5AV5D 3A6NB 5JA4B 5CPIB 3MGSA 3REKD 3WTPD 3WA9D 3UTBD 3NQJB 3AV2A 1TAFA 1M19B 4LD9A 2BYKB 3W97C 5B2IB 5AVCA 3AZHC 5B0YC 3KUYC 2CV5B 3MGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 B;  3WTP E;  1P3K C;  5C3I B;  4X23 A;  3C1B A;  5JRG D;  5B2I D;  3KWQ C;  1F66 A;  1M18 A;  3AZM B;  4E44 A;  3C1C D;  1M1A C;  4Z5T C;  3X1U D;  1HQ3 D;  3W99 D;  3O62 B;  3AFA C;  4NFT A;  5BNX B;  4Z66 C;  3KSY A;  3AZK A;  4YS3 A;  1P3I C;  5B24 D;  5AVC D;  4XZQ B;  5GT0 D;  2HIO B;  3REL C;  3MGR C;  4KHA B;  4WU9 A;  1WWS A;  3MVD D;  2HUE B;  5DNN A;  3LZ0 B;  1P3M D;  4WU8 C;  4JJN A;  4H9O A;  2F8N H;  3REJ B;  1BH8 B;  5FUG A;  1M18 D;  5BO0 B;  3R45 B;  3WKJ C;  5B1M D;  3MNN A;  2ARO A;  3AZF C;  3W97 B;  5CP6 A;  5B0Y B;  3AZH B;  4UUZ A;  3AZN B;  5F99 C;  4J8W B;  3X1V A;  1P3K B;  2LY8 A;  1HTA A;  5E5A C;  3W97 D;  3B0C T;  3KUY D;  3X1T D;  3B6G B;  1P34 C;  3KWQ B;  1KX3 C;  4JJN D;  5AV8 B;  5GSU C;  4YM6 D;  2NQB C;  1M1A B;  4Z5T B;  3LZ1 A;  5B31 D;  4XUJ D;  4J8X A;  3AFA B;  4Z66 B;  3MGP A;  1P3I B;  5AV9 D;  1P3B B;  5KDM B;  4R8P A;  4Z2M G;  1ZLA A;  1TZY B;  3REL B;  3W96 C;  5B32 G;  3MGR B;  3X1V D;  5DNM D;  1U35 D;  4KGC A;  4WU8 B;  5B32 A;  5B2J C;  1S32 A;  3REI A;  1KX5 B;  5GT3 D;  5B40 A;  3REK C;  2FJ7 D;  5AVB A;  3WA9 C;  3WKJ B;  3UTB C;  3AZE D;  3AZF B;  1B67 A;  3LJA A;  1N1J B;  4AWL C;  1B6W A;  4CSR A;  5E5A B;  2NZD A;  1P3P C;  1P3A A;  1P3L D;  1P34 B;  4M6B A;  5B33 A;  5F99 D;  1P3G A;  5G49 B;  1KX3 B;  3C1C C;  5BT1 C;  5GSU B;  2PYO D;  2NQB B;  4QLC D;  5GXQ B;  5B40 D;  3X1U C;  3MGS C;  1HQ3 C;  3W99 C;  5CPK A;  4WNN A;  5B24 C;  3AV1 B;  5AVC C;  5GT0 C;  3W96 B;  1AOI D;  5B0Z B;  3AZI A;  3MVD C;  1P3M C;  5B2J B;  2NZD D;  3TU4 D;  5BS7 A;  3AZJ D;  5B33 D;  1M18 C;  3W96 D;  3REK B;  3WTP B;  3WA9 B;  3UTB B;  1ULY A;  3AZG A;  1P3F A;  5B2J D;  1P3O D;  4AWL B;  3AZL A;  5AV6 A;  4YS3 C;  3UT9 D;  1ID3 A;  2F8N G;  4H9P B;  3LEL A;  3KXB A;  2F8N A;  5JRG B;  4WU9 C;  5CPJ A;  1P3P B;  3X1T C;  3REH D;  5DNN C;  3A6N A;  5JA4 A;  5CPI A;  4JJN C;  4ZUX A;  3C1C B;  3NQJ A;  4YM6 C;  4CAY B;  1M19 A;  3NQU B;  5B31 C;  1KX4 A;  4XUJ C;  3X1U B;  2CV5 A;  1HQ3 B;  1P3P D;  3W99 B;  3UTA A;  3AZG D;  4J8V D;  3MGQ A;  5AV9 C;  5B24 B;  2ARO C;  5AVC B;  5GT0 B;  5BT1 D;  2YFV B;  3W98 A;  3X1V C;  5DNM C;  1U35 C;  4KUD A;  3MVD B;  3MGS D;  3LEL D;  2YFW B;  1BH9 B;  3AV2 D;  1P3M B;  1JFI B;  4H9Q A;  4LD9 D;  5CHL B;  1M18 B;  5GT3 C;  2FJ7 C;  4ZUX D;  2RVQ D;  5BNX A;  3O62 A;  3AZE C;  5B1L A;  5B1M B;  4XZQ A;  1KX4 D;  2HIO A;  4X23 D;  3C1B D;  4KHA A;  1F66 D;  3LZ0 A;  3W98 D;  4WU9 B;  3REJ A;  1BH8 A;  3KUY B;  3X1T B;  1P3L C;  4KUD D;  3AZK D;  2BYM A;  3VH6 W;  3X1S A;  4YS3 D;  5BO0 A;  3R45 A;  5B32 C;  4JJN B;  2CWE A;  4YM6 B;  2PYO C;  4QLC C;  4H9R B;  5B31 B;  3AZH A;  5B40 C;  4XUJ B;  4WU9 D;  3AZN A;  3AN2 A;  5DNN D;  4J8W A;  5AV9 B;  5B1L D;  3B6F A;  1P3K A;  1AOI C;  3X1V B;  5DNM B;  1U35 B;  3B6G A;  4G91 C;  2NZD C;  5AV8 A;  2ARO D;  3MNN D;  3TU4 C;  5CP6 D;  1P3A C;  3AZJ C;  1M1A A;  4Z5T A;  5B33 C;  3X1S D;  5GT3 B;  2FJ7 B;  4WV4 B;  4Z66 A;  3AZE B;  1P3I A;  1P3B A;  5KDM A;  5BNV B;  1P3O C;  1TZY A;  3VH5 W;  3REL A;  3AN2 D;  3MGR A;  3UT9 C;  3B6F D;  2IO5 C;  3LZ1 D;  4G92 C;  3AZI C;  1P3L B;  3REH C;  5F99 B;  4J8X D;  3MGP D;  1KX5 A;  1F1E A;  4WZS B;  4R8P D;  3WKJ A;  2PYO B;  4H9S C;  5BS7 C;  4QLC B;  1ZLA D;  2JSS A;  3AZF A;  5B40 B;  4KGC D;  1N1J A;  4J8U A;  3AZG C;  4J8V C;  5B32 D;  1P3F C;  1S32 D;  5E5A A;  3AZL C;  3REI D;  3V9R B;  1AOI B;  4H9N B;  1P34 A;  5AVB D;  3LEL C;  5G49 A;  3AV2 C;  4ZBJ C;  4LD9 C;  1KX3 A;  3WAA A;  4G91 B;  2NZD B;  5GSU A;  3TU4 B;  2NQB A;  3LJA D;  3AZJ B;  5B33 B;  3A6N C;  5GXQ A;  4ZUX C;  2RVQ C;  1M19 C;  3AV1 A;  1P3O B;  1KX4 C;  4X23 C;  3C1B C;  1P3A D;  4J8U D;  3UTA C;  3UT9 B;  5B0Z A;  1P3G D;  1F66 C;  1EQZ A;  1H3O B;  5C3I C;  2IO5 B;  3W98 C;  4KUD C;  5AV5 A;  3REH B;  3AZK C;  5CPK D;  3REK A;  3WAA D;  3WTP A;  3UTB A;  3VH6 A;  3AYW A;  3AZI D;  3AZG B;  4J8V B;  5B1L C;  4H9P A;  1P3F B;  1WWI A;  2BYK A;  5B2I A;  5JRG A;  1EQZ D;  3MGS B;  3LZ0 C;  3LEL B;  3VH6 T;  3AV2 B;  1TAF B;  4ZBJ B;  4LD9 B;  5AY8 A;  3MNN C;  3C1C A;  1P3F D;  5CP6 C;  3REJ C;  4CAY A;  3NQU A;  4DRB A;  3AZL D;  3X1S C;  5AV6 D;  1ID3 D;  3X1U A;  1HQ3 A;  3W99 A;  4ZUX B;  3KXB D;  5B24 A;  3AZM A;  3AYW D;  2F8N D;  5GT0 A;  1KX4 B;  4X23 B;  3C1B B;  5CPJ D;  3AZN C;  3UTA B;  3AN2 C;  2YFV A;  4J8W C;  1F66 B;  3A6N D;  3B6F C;  3MVD A;  5CPI D;  3VH5 A;  2YFW A;  1BH9 A;  1P3M A;  1M19 D;  1JFI A;  3LZ1 C;  3W98 B;  4KUD B;  2CV5 D;  3B6G C;  3AZK B;  4J8X C;  3B0B A;  3MGP C;  3UTA D;  4YS3 B;  3MGQ D;  4H9Q B;  4R8P C;  5AY8 D;  5AV8 C;  1ZLA C;  5B1M A;  4KGC C;  1BFM A;  3VH5 T;  5DNN B;  5B1L B;  1P3B C;  3AZM D;  1S32 C;  4H9O B;  1TZY C;  3REI C;  5FUG B;  2L5A A;  3W97 A;  5B0Y A;  3KUY A;  3X1T A;  5AVB C;  3O62 D;  4E45 A;  5B31 G;  3MNN B;  2ARO B;  4YM6 A;  5CP6 B;  4XZQ D;  2HIO D;  3LJA C;  4H9R A;  4UUZ B;  2BYM B;  5B31 A;  1KX5 C;  3X1S B;  4XUJ A;  3LZ0 D;  3KWQ A;  5AV9 A;  3REJ D;  4J8U C;  3AN2 B;  1P3G C;  1U35 A;  5DNM A;  3B6F B;  3AFA A;  3LZ1 B;  3AZH D;  5B0Y D;  4NE5 A;  1KU5 A;  5CPK C;  4J8X B;  3AZN D;  3MGP B;  5GT3 A;  4J8W D;  3WAA C;  2FJ7 A;  4R8P B;  1P3K D;  3AZE A;  1ZLA B;  5BNV A;  4WU8 A;  5GXQ C;  4KGC B;  3B6G D;  3KWQ D;  3AV1 C;  5B32 B;  1S32 B;  5AV8 D;  1M1A D;  3REI B;  4Z5T D;  5B0Z C;  1EQZ C;  1P3L A;  3B0D C;  4HGA C;  4EO5 C;  5AVB B;  5F99 A;  3AFA D;  4Z66 D;  1P3I D;  1P3B D;  2PYO A;  5AV5 C;  3LJA B;  4QLC A;  1TZY D;  3REL D;  5AV6 C;  3MGR D;  1ID3 C;  3WTP C;  4CSR B;  3KXB C;  1A7W A;  3AYW C;  4WU8 D;  3B0C W;  5CPJ C;  1P3A B;  4J8U B;  3V9R A;  1P3G B;  1AOI A;  1KX5 D;  5CPI C;  4H9N A;  3WKJ D;  3AZF D;  5JRG C;  5B2I C;  3TU4 A;  3AZJ A;  2CV5 C;  1Q9C A;  5CPK B;  3W96 A;  4WNN B;  3MGQ C;  3WAA B;  5AY8 C;  5E5A D;  1P3O A;  5B2J A;  1R4V A;  4G92 B;  3AZI B;  4NE6 A;  1P34 D;  3UT9 A;  4Z2M H;  1H3O A;  3AZM C;  1KX3 D;  3WA9 A;  5GSU D;  2NQB D;  5GXQ D;  1EQZ B;  3B0D B;  3REH A;  4HGA B;  4EO5 B;  3O62 C;  3AV1 D;  4XZQ C;  4H9S A;  2HIO C;  5AV5 B;  2F8N K;  3AZL B;  5AV6 B;  1ID3 B;  5B0Z D;  1P3P A;  4NE3 A;  2HUE C;  4J8V A;  3KXB B;  4DRA A;  5B1M C;  3AYW B;  2F8N B;  5CPJ B;  5AV5 D;  3A6N B;  5JA4 B;  5CPI B;  3MGS A;  3REK D;  3WTP D;  3WA9 D;  3UTB D;  3NQJ B;  3AV2 A;  1TAF A;  1M19 B;  4LD9 A;  2BYK B;  3W97 C;  5B2I B;  5AVC A;  3AZH C;  5B0Y C;  3KUY C;  2CV5 B;  3MGQ B; 
#chains in the Genus database with same CATH topology
 5AY8 B;  3WTP E;  1P3K C;  5C3I B;  4X23 A;  3C1B A;  5JRG D;  5B2I D;  3AL0 C;  3KWQ C;  1F66 A;  1M18 A;  3AZM B;  4E44 A;  3C1C D;  1M1A C;  4Z5T C;  3X1U D;  1HQ3 D;  3W99 D;  3O62 B;  3AFA C;  4NFT A;  5BNX B;  4Z66 C;  3KSY A;  3AZK A;  2Y2N A;  4YS3 A;  1P3I C;  5B24 D;  5AVC D;  4XZQ B;  5GT0 D;  2HIO B;  3H0M C;  3REL C;  3MGR C;  4KHA B;  4WU9 A;  1WWS A;  3MVD D;  2HUE B;  5DNN A;  3LZ0 B;  1P3M D;  4WU8 C;  4JJN A;  4H9O A;  2F8N H;  3REJ B;  1BH8 B;  5FUG A;  1M18 D;  5BO0 B;  3R45 B;  2Y2I A;  3WKJ C;  2XD1 A;  3H0R C;  5B1M D;  2ARO A;  3MNN A;  3AZF C;  3W97 B;  5CP6 A;  5B0Y B;  3AZH B;  2ZY4 A;  4UUZ A;  3AZN B;  5F99 C;  4J8W B;  3X1V A;  2W8S A;  1W2E A;  2G5I C;  1P3K B;  2LY8 A;  1HTA A;  5E5A C;  3W97 D;  3B0C T;  3KUY D;  3X1T D;  3B6G B;  1P34 C;  3KWQ B;  1KX3 C;  4JJN D;  5AV8 B;  5GSU C;  2JE5 A;  4YM6 D;  2NQB C;  1M1A B;  4Z5T B;  3LZ1 A;  5B31 D;  4XUJ D;  4J8X A;  3AFA B;  4Z66 B;  3MGP A;  1P3I B;  5AV9 D;  1P3B B;  5KDM B;  4R8P A;  4Z2M G;  1ZLA A;  1TZY B;  3REL B;  3W96 C;  5B32 G;  3MGR B;  3X1V D;  5DNM D;  1U35 D;  4KGC A;  5B32 A;  5B2J C;  4WU8 B;  1S32 A;  3REI A;  1KX5 B;  5GT3 D;  5B40 A;  3REK C;  2FJ7 D;  2Y2P A;  5AVB A;  3WA9 C;  3UTB C;  3AZE D;  3WKJ B;  2Y2H A;  3AZF B;  1B67 A;  3LJA A;  1N1J B;  4AWL C;  1B6W A;  4CSR A;  2G5H C;  5E5A B;  2NZD A;  1P3P C;  1P3A A;  1P3L D;  1P34 B;  4M6B A;  5B33 A;  5F99 D;  1P3G A;  5G49 B;  1KX3 B;  3C1C C;  5BT1 C;  5GSU B;  2PYO D;  2NQB B;  4QLC D;  5GXQ B;  2BG1 A;  5B40 D;  3X1U C;  3MGS C;  1HQ3 C;  3W99 C;  5CPK A;  4WNN A;  5B24 C;  3AV1 B;  5AVC C;  5GT0 C;  3W96 B;  1AOI D;  5B0Z B;  3AZI A;  3MVD C;  1P3M C;  5B2J B;  2NZD D;  3TU4 D;  5BS7 A;  3AZJ D;  5B33 D;  1M18 C;  3W96 D;  3REK B;  3WTP B;  3WA9 B;  3UTB B;  1ULY A;  3AZG A;  1P3F A;  5B2J D;  1P3O D;  4AWL B;  3AZL A;  5AV6 A;  4YS3 C;  3UT9 D;  1ID3 A;  2F8N G;  4H9P B;  3LEL A;  3KXB A;  4DQY B;  2F8N A;  5JRG B;  4WU9 C;  5CPJ A;  1P3P B;  3X1T C;  3REH D;  5DNN C;  3A6N A;  5JA4 A;  5CPI A;  4JJN C;  4ZUX A;  3C1C B;  3NQJ A;  4YM6 C;  4CAY B;  1M19 A;  3NQU B;  5B31 C;  1KX4 A;  4XUJ C;  3X1U B;  2CV5 A;  1HQ3 B;  2XD5 A;  1P3P D;  3W99 B;  3UTA A;  3AZG D;  4J8V D;  3MGQ A;  5AV9 C;  5B24 B;  2ARO C;  5AVC B;  5GT0 B;  5BT1 D;  2YFV B;  3W98 A;  3X1V C;  5DNM C;  1U35 C;  4KUD A;  3MVD B;  3MGS D;  4UPK A;  3LEL D;  2YFW B;  1BH9 B;  3AV2 D;  1P3M B;  1JFI B;  4H9Q A;  4LD9 D;  5CHL B;  1M18 B;  2DF4 C;  5GT3 C;  2FJ7 C;  4ZUX D;  2RVQ D;  5BNX A;  3O62 A;  3AZE C;  5B1L A;  5B1M B;  4XZQ A;  2FFF B;  1KX4 D;  2HIO A;  4X23 D;  3C1B D;  4KHA A;  1F66 D;  3LZ0 A;  3W98 D;  4WU9 B;  3REJ A;  1BH8 A;  3KUY B;  3X1T B;  1P3L C;  4KUD D;  3AZK D;  2BYM A;  3VH6 W;  3X1S A;  4YS3 D;  5BO0 A;  3R45 A;  5B32 C;  4JJN B;  2CWE A;  4YM6 B;  2UWX A;  2PYO C;  4QLC C;  2RIQ A;  4H9R B;  5B31 B;  3AZH A;  5B40 C;  4XUJ B;  4WU9 D;  3AZN A;  3AN2 A;  5DNN D;  4J8W A;  5AV9 B;  5B1L D;  3B6F A;  2Y2K A;  1P3K A;  1AOI C;  3X1V B;  5DNM B;  1U35 B;  3B6G A;  4G91 C;  2NZD C;  5AV8 A;  2ARO D;  3MNN D;  3TU4 C;  5CP6 D;  1P3A C;  3AZJ C;  1M1A A;  4Z5T A;  5B33 C;  4WJ3 C;  3X1S D;  3EG5 B;  5GT3 B;  2FJ7 B;  4WV4 B;  4Z66 A;  3AZE B;  1P3I A;  1P3B A;  5KDM A;  5BNV B;  1P3O C;  1TZY A;  3VH5 W;  3REL A;  3AN2 D;  3MGR A;  3UT9 C;  3B6F D;  2IO5 C;  3EPK A;  3LZ1 D;  4G92 C;  3AZI C;  1P3L B;  3EPL A;  3REH C;  5F99 B;  4J8X D;  3MGP D;  1KX5 A;  3KFU G;  1F1E A;  4WZS B;  2JCH A;  4R8P D;  3WKJ A;  2PYO B;  4H9S C;  5BS7 C;  4QLC B;  1ZLA D;  2JSS A;  3AZF A;  5B40 B;  4KGC D;  1N1J A;  4J8U A;  3AZG C;  4J8V C;  5B32 D;  1P3F C;  1S32 D;  5E5A A;  3AZL C;  3REI D;  3V9R B;  1AOI B;  2ZY2 A;  4H9N B;  1P34 A;  5AVB D;  3LEL C;  5G49 A;  3AV2 C;  4ZBJ C;  4LD9 C;  1KX3 A;  3WAA A;  4G91 B;  2NZD B;  5GSU A;  3TU4 B;  2NQB A;  3LJA D;  3AZJ B;  5B33 B;  3A6N C;  5GXQ A;  1T3U A;  2RVQ C;  4ZUX C;  1M19 C;  2Y2J A;  3AV1 A;  1P3O B;  1KX4 C;  4X23 C;  3C1B C;  1P3A D;  4J8U D;  3UTA C;  3UT9 B;  5B0Z A;  1P3G D;  1F66 C;  1EQZ A;  1H3O B;  5C3I C;  2IO5 B;  2VQR A;  3W98 C;  4KUD C;  5AV5 A;  3REH B;  3AZK C;  5CPK D;  3REK A;  3A1I A;  3WTP A;  3WAA D;  3UTB A;  3VH6 A;  3AYW A;  3AZI D;  3AZG B;  4J8V B;  5B1L C;  4H9P A;  1P3F B;  1WWI A;  2ZY5 A;  2BYK A;  5B2I A;  5JRG A;  1EQZ D;  3MGS B;  3LZ0 C;  3LEL B;  3VH6 T;  3AV2 B;  1TAF B;  4ZBJ B;  4LD9 B;  5AY8 A;  3MNN C;  3C1C A;  1P3F D;  5CP6 C;  3REJ C;  4CAY A;  3NQU A;  4DRB A;  3AZL D;  3X1S C;  5AV6 D;  1ID3 D;  3X1U A;  1HQ3 A;  3W99 A;  4ZUX B;  3KXB D;  5B24 A;  2ZM5 A;  3AZM A;  3AYW D;  2F8N D;  5GT0 A;  1KX4 B;  4X23 B;  3C1B B;  5CPJ D;  3AZN C;  3UTA B;  3AN2 C;  2YFV A;  4J8W C;  1F66 B;  3A6N D;  3B6F C;  3MVD A;  5CPI D;  3VH5 A;  2YFW A;  1BH9 A;  1P3M A;  1M19 D;  1JFI A;  3LZ1 C;  3W98 B;  4KUD B;  2CV5 D;  3B6G C;  3AZK B;  4J8X C;  3B0B A;  3MGP C;  3UTA D;  4YS3 B;  3MGQ D;  4H9Q B;  4R8P C;  5AY8 D;  5AV8 C;  1ZLA C;  5B1M A;  1PZR A;  4KGC C;  1BFM A;  3VH5 T;  5DNN B;  5B1L B;  1P3B C;  3AZM D;  1S32 C;  4H9O B;  1TZY C;  3REI C;  5FUG B;  2L5A A;  3W97 A;  5B0Y A;  3KUY A;  3X1T A;  5AVB C;  3O62 D;  4E45 A;  5B31 G;  3MNN B;  2ARO B;  3P5J B;  3A1K A;  4YM6 A;  2Y2G A;  5CP6 B;  2HIO D;  4XZQ D;  3LJA C;  4H9R A;  4UUZ B;  2BYM B;  5B31 A;  1KX5 C;  3X1S B;  4XUJ A;  3H0L C;  3LZ0 D;  3KWQ A;  5AV9 A;  2F2A C;  3REJ D;  4J8U C;  3AN2 B;  1P3G C;  1U35 A;  5DNM A;  3B6F B;  3AFA A;  3EPH A;  3FDD A;  3LZ1 B;  3AZH D;  5B0Y D;  4NE5 A;  1KU5 A;  5CPK C;  2Y2L A;  4J8X B;  3MGP B;  3AZN D;  3F6T A;  5GT3 A;  4J8W D;  3WAA C;  2FJ7 A;  4R8P B;  1P3K D;  3AZE A;  2ZY3 A;  1ZLA B;  5BNV A;  4WU8 A;  5GXQ C;  2J8P A;  4KGC B;  3B6G D;  3KWQ D;  3IP4 C;  5B32 B;  3AV1 C;  1S32 B;  5AV8 D;  1M1A D;  3REI B;  4Z5T D;  5B0Z C;  1EQZ C;  1P3L A;  3B0D C;  4HGA C;  4EO5 C;  5AVB B;  5F99 A;  3AFA D;  4Z66 D;  1P3I D;  1P3B D;  2PYO A;  5AV5 C;  3LJA B;  4QLC A;  1TZY D;  3REL D;  5AV6 C;  3MGR D;  1ID3 C;  3WTP C;  4CSR B;  3KXB C;  1A7W A;  3AYW C;  4WU8 D;  3B0C W;  5CPJ C;  1P3A B;  4J8U B;  3V9R A;  1P3G B;  1AOI A;  1KX5 D;  5CPI C;  4H9N A;  3WKJ D;  2Y2M A;  3AZF D;  5JRG C;  5B2I C;  3TU4 A;  3AZJ A;  2CV5 C;  1Q9C A;  5CPK B;  3W96 A;  2DQN C;  4WNN B;  3MGQ C;  3WAA B;  5AY8 C;  5E5A D;  3EPJ A;  5B2J A;  1P3O A;  1R4V A;  4G92 B;  3AZI B;  4NE6 A;  1P34 D;  3UT9 A;  4Z2M H;  1H3O A;  3AZM C;  1Z2C B;  1KX3 D;  3WA9 A;  5GSU D;  2NQB D;  5GXQ D;  1EQZ B;  2Y2O A;  3B0D B;  3REH A;  4HGA B;  4EO5 B;  3O62 C;  3AV1 D;  4XZQ C;  4H9S A;  2HIO C;  5AV5 B;  2F8N K;  3AZL B;  5AV6 B;  1ID3 B;  5B0Z D;  2Y2Q A;  1P3P A;  4NE3 A;  2HUE C;  4J8V A;  3KXB B;  4DRA A;  5B1M C;  3AYW B;  2F8N B;  5CPJ B;  5AV5 D;  3A6N B;  5JA4 B;  5CPI B;  3MGS A;  3REK D;  3WTP D;  3WA9 D;  3UTB D;  3NQJ B;  3AV2 A;  1TAF A;  1M19 B;  4LD9 A;  2BYK B;  3W97 C;  5B2I B;  5AVC A;  3AZH C;  5B0Y C;  3KUY C;  2CV5 B;  3MGQ B; 
#chains in the Genus database with same CATH homology
 5AY8 B;  3WTP E;  1P3K C;  5C3I B;  4X23 A;  3C1B A;  5JRG D;  5B2I D;  3AL0 C;  3KWQ C;  1F66 A;  1M18 A;  3AZM B;  4E44 A;  3C1C D;  1M1A C;  4Z5T C;  3X1U D;  1HQ3 D;  3W99 D;  3O62 B;  3AFA C;  4NFT A;  5BNX B;  4Z66 C;  3KSY A;  3AZK A;  2Y2N A;  4YS3 A;  1P3I C;  5B24 D;  5AVC D;  4XZQ B;  5GT0 D;  2HIO B;  3H0M C;  3REL C;  3MGR C;  4KHA B;  4WU9 A;  1WWS A;  3MVD D;  2HUE B;  5DNN A;  3LZ0 B;  1P3M D;  4WU8 C;  4JJN A;  4H9O A;  2F8N H;  3REJ B;  1BH8 B;  5FUG A;  1M18 D;  5BO0 B;  3R45 B;  2Y2I A;  3WKJ C;  2XD1 A;  3H0R C;  5B1M D;  2ARO A;  3MNN A;  3AZF C;  3W97 B;  5CP6 A;  5B0Y B;  3AZH B;  2ZY4 A;  4UUZ A;  3AZN B;  5F99 C;  4J8W B;  3X1V A;  2W8S A;  1W2E A;  2G5I C;  1P3K B;  2LY8 A;  1HTA A;  5E5A C;  3W97 D;  3B0C T;  3KUY D;  3X1T D;  3B6G B;  1P34 C;  3KWQ B;  1KX3 C;  4JJN D;  5AV8 B;  5GSU C;  2JE5 A;  4YM6 D;  2NQB C;  1M1A B;  4Z5T B;  3LZ1 A;  5B31 D;  4XUJ D;  4J8X A;  3AFA B;  4Z66 B;  3MGP A;  1P3I B;  5AV9 D;  1P3B B;  5KDM B;  4R8P A;  4Z2M G;  1ZLA A;  1TZY B;  3REL B;  3W96 C;  5B32 G;  3MGR B;  3X1V D;  5DNM D;  1U35 D;  4KGC A;  5B32 A;  5B2J C;  4WU8 B;  1S32 A;  3REI A;  1KX5 B;  5GT3 D;  5B40 A;  3REK C;  2FJ7 D;  2Y2P A;  5AVB A;  3WA9 C;  3UTB C;  3AZE D;  3WKJ B;  2Y2H A;  3AZF B;  1B67 A;  3LJA A;  1N1J B;  4AWL C;  1B6W A;  4CSR A;  2G5H C;  5E5A B;  2NZD A;  1P3P C;  1P3A A;  1P3L D;  1P34 B;  4M6B A;  5B33 A;  5F99 D;  1P3G A;  5G49 B;  1KX3 B;  3C1C C;  5BT1 C;  5GSU B;  2PYO D;  2NQB B;  4QLC D;  5GXQ B;  2BG1 A;  5B40 D;  3X1U C;  3MGS C;  1HQ3 C;  3W99 C;  5CPK A;  4WNN A;  5B24 C;  3AV1 B;  5AVC C;  5GT0 C;  3W96 B;  1AOI D;  5B0Z B;  3AZI A;  3MVD C;  1P3M C;  5B2J B;  2NZD D;  3TU4 D;  5BS7 A;  3AZJ D;  5B33 D;  1M18 C;  3W96 D;  3REK B;  3WTP B;  3WA9 B;  3UTB B;  1ULY A;  3AZG A;  1P3F A;  5B2J D;  1P3O D;  4AWL B;  3AZL A;  5AV6 A;  4YS3 C;  3UT9 D;  1ID3 A;  2F8N G;  4H9P B;  3LEL A;  3KXB A;  4DQY B;  2F8N A;  5JRG B;  4WU9 C;  5CPJ A;  1P3P B;  3X1T C;  3REH D;  5DNN C;  3A6N A;  5JA4 A;  5CPI A;  4JJN C;  4ZUX A;  3C1C B;  3NQJ A;  4YM6 C;  4CAY B;  1M19 A;  3NQU B;  5B31 C;  1KX4 A;  4XUJ C;  3X1U B;  2CV5 A;  1HQ3 B;  2XD5 A;  1P3P D;  3W99 B;  3UTA A;  3AZG D;  4J8V D;  3MGQ A;  5AV9 C;  5B24 B;  2ARO C;  5AVC B;  5GT0 B;  5BT1 D;  2YFV B;  3W98 A;  3X1V C;  5DNM C;  1U35 C;  4KUD A;  3MVD B;  3MGS D;  4UPK A;  3LEL D;  2YFW B;  1BH9 B;  3AV2 D;  1P3M B;  1JFI B;  4H9Q A;  4LD9 D;  5CHL B;  1M18 B;  2DF4 C;  5GT3 C;  2FJ7 C;  4ZUX D;  2RVQ D;  5BNX A;  3O62 A;  3AZE C;  5B1L A;  5B1M B;  4XZQ A;  2FFF B;  1KX4 D;  2HIO A;  4X23 D;  3C1B D;  4KHA A;  1F66 D;  3LZ0 A;  3W98 D;  4WU9 B;  3REJ A;  1BH8 A;  3KUY B;  3X1T B;  1P3L C;  4KUD D;  3AZK D;  2BYM A;  3VH6 W;  3X1S A;  4YS3 D;  5BO0 A;  3R45 A;  5B32 C;  4JJN B;  2CWE A;  4YM6 B;  2UWX A;  2PYO C;  4QLC C;  2RIQ A;  4H9R B;  5B31 B;  3AZH A;  5B40 C;  4XUJ B;  4WU9 D;  3AZN A;  3AN2 A;  5DNN D;  4J8W A;  5AV9 B;  5B1L D;  3B6F A;  2Y2K A;  1P3K A;  1AOI C;  3X1V B;  5DNM B;  1U35 B;  3B6G A;  4G91 C;  2NZD C;  5AV8 A;  2ARO D;  3MNN D;  3TU4 C;  5CP6 D;  1P3A C;  3AZJ C;  1M1A A;  4Z5T A;  5B33 C;  4WJ3 C;  3X1S D;  3EG5 B;  5GT3 B;  2FJ7 B;  4WV4 B;  4Z66 A;  3AZE B;  1P3I A;  1P3B A;  5KDM A;  5BNV B;  1P3O C;  1TZY A;  3VH5 W;  3REL A;  3AN2 D;  3MGR A;  3UT9 C;  3B6F D;  2IO5 C;  3EPK A;  3LZ1 D;  4G92 C;  3AZI C;  1P3L B;  3EPL A;  3REH C;  5F99 B;  4J8X D;  3MGP D;  1KX5 A;  3KFU G;  1F1E A;  4WZS B;  2JCH A;  4R8P D;  3WKJ A;  2PYO B;  4H9S C;  5BS7 C;  4QLC B;  1ZLA D;  2JSS A;  3AZF A;  5B40 B;  4KGC D;  1N1J A;  4J8U A;  3AZG C;  4J8V C;  5B32 D;  1P3F C;  1S32 D;  5E5A A;  3AZL C;  3REI D;  3V9R B;  1AOI B;  2ZY2 A;  4H9N B;  1P34 A;  5AVB D;  3LEL C;  5G49 A;  3AV2 C;  4ZBJ C;  4LD9 C;  1KX3 A;  3WAA A;  4G91 B;  2NZD B;  5GSU A;  3TU4 B;  2NQB A;  3LJA D;  3AZJ B;  5B33 B;  3A6N C;  5GXQ A;  1T3U A;  2RVQ C;  4ZUX C;  1M19 C;  2Y2J A;  3AV1 A;  1P3O B;  1KX4 C;  4X23 C;  3C1B C;  1P3A D;  4J8U D;  3UTA C;  3UT9 B;  5B0Z A;  1P3G D;  1F66 C;  1EQZ A;  1H3O B;  5C3I C;  2IO5 B;  2VQR A;  3W98 C;  4KUD C;  5AV5 A;  3REH B;  3AZK C;  5CPK D;  3REK A;  3A1I A;  3WTP A;  3WAA D;  3UTB A;  3VH6 A;  3AYW A;  3AZI D;  3AZG B;  4J8V B;  5B1L C;  4H9P A;  1P3F B;  1WWI A;  2ZY5 A;  2BYK A;  5B2I A;  5JRG A;  1EQZ D;  3MGS B;  3LZ0 C;  3LEL B;  3VH6 T;  3AV2 B;  1TAF B;  4ZBJ B;  4LD9 B;  5AY8 A;  3MNN C;  3C1C A;  1P3F D;  5CP6 C;  3REJ C;  4CAY A;  3NQU A;  4DRB A;  3AZL D;  3X1S C;  5AV6 D;  1ID3 D;  3X1U A;  1HQ3 A;  3W99 A;  4ZUX B;  3KXB D;  5B24 A;  2ZM5 A;  3AZM A;  3AYW D;  2F8N D;  5GT0 A;  1KX4 B;  4X23 B;  3C1B B;  5CPJ D;  3AZN C;  3UTA B;  3AN2 C;  2YFV A;  4J8W C;  1F66 B;  3A6N D;  3B6F C;  3MVD A;  5CPI D;  3VH5 A;  2YFW A;  1BH9 A;  1P3M A;  1M19 D;  1JFI A;  3LZ1 C;  3W98 B;  4KUD B;  2CV5 D;  3B6G C;  3AZK B;  4J8X C;  3B0B A;  3MGP C;  3UTA D;  4YS3 B;  3MGQ D;  4H9Q B;  4R8P C;  5AY8 D;  5AV8 C;  1ZLA C;  5B1M A;  1PZR A;  4KGC C;  1BFM A;  3VH5 T;  5DNN B;  5B1L B;  1P3B C;  3AZM D;  1S32 C;  4H9O B;  1TZY C;  3REI C;  5FUG B;  2L5A A;  3W97 A;  5B0Y A;  3KUY A;  3X1T A;  5AVB C;  3O62 D;  4E45 A;  5B31 G;  3MNN B;  2ARO B;  3P5J B;  3A1K A;  4YM6 A;  2Y2G A;  5CP6 B;  2HIO D;  4XZQ D;  3LJA C;  4H9R A;  4UUZ B;  2BYM B;  5B31 A;  1KX5 C;  3X1S B;  4XUJ A;  3H0L C;  3LZ0 D;  3KWQ A;  5AV9 A;  2F2A C;  3REJ D;  4J8U C;  3AN2 B;  1P3G C;  1U35 A;  5DNM A;  3B6F B;  3AFA A;  3EPH A;  3FDD A;  3LZ1 B;  3AZH D;  5B0Y D;  4NE5 A;  1KU5 A;  5CPK C;  2Y2L A;  4J8X B;  3MGP B;  3AZN D;  3F6T A;  5GT3 A;  4J8W D;  3WAA C;  2FJ7 A;  4R8P B;  1P3K D;  3AZE A;  2ZY3 A;  1ZLA B;  5BNV A;  4WU8 A;  5GXQ C;  2J8P A;  4KGC B;  3B6G D;  3KWQ D;  3IP4 C;  5B32 B;  3AV1 C;  1S32 B;  5AV8 D;  1M1A D;  3REI B;  4Z5T D;  5B0Z C;  1EQZ C;  1P3L A;  3B0D C;  4HGA C;  4EO5 C;  5AVB B;  5F99 A;  3AFA D;  4Z66 D;  1P3I D;  1P3B D;  2PYO A;  5AV5 C;  3LJA B;  4QLC A;  1TZY D;  3REL D;  5AV6 C;  3MGR D;  1ID3 C;  3WTP C;  4CSR B;  3KXB C;  1A7W A;  3AYW C;  4WU8 D;  3B0C W;  5CPJ C;  1P3A B;  4J8U B;  3V9R A;  1P3G B;  1AOI A;  1KX5 D;  5CPI C;  4H9N A;  3WKJ D;  2Y2M A;  3AZF D;  5JRG C;  5B2I C;  3TU4 A;  3AZJ A;  2CV5 C;  1Q9C A;  5CPK B;  3W96 A;  2DQN C;  4WNN B;  3MGQ C;  3WAA B;  5AY8 C;  5E5A D;  3EPJ A;  5B2J A;  1P3O A;  1R4V A;  4G92 B;  3AZI B;  4NE6 A;  1P34 D;  3UT9 A;  4Z2M H;  1H3O A;  3AZM C;  1Z2C B;  1KX3 D;  3WA9 A;  5GSU D;  2NQB D;  5GXQ D;  1EQZ B;  2Y2O A;  3B0D B;  3REH A;  4HGA B;  4EO5 B;  3O62 C;  3AV1 D;  4XZQ C;  4H9S A;  2HIO C;  5AV5 B;  2F8N K;  3AZL B;  5AV6 B;  1ID3 B;  5B0Z D;  2Y2Q A;  1P3P A;  4NE3 A;  2HUE C;  4J8V A;  3KXB B;  4DRA A;  5B1M C;  3AYW B;  2F8N B;  5CPJ B;  5AV5 D;  3A6N B;  5JA4 B;  5CPI B;  3MGS A;  3REK D;  3WTP D;  3WA9 D;  3UTB D;  3NQJ B;  3AV2 A;  1TAF A;  1M19 B;  4LD9 A;  2BYK B;  3W97 C;  5B2I B;  5AVC A;  3AZH C;  5B0Y C;  3KUY C;  2CV5 B;  3MGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...