4J8VA

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vA00
3X1VC 4G91C 3O62D 1P3MA 5E5AD 5B40D 1HTAA 4Z5TA 3X1SB 3B0DC 2AROD 4XZQC 4J8VA 3X1TA 4J8UD 3AZHA 3KXBC 3AZED 5AV9D 4KHAA 4H9RB 3AZLB 2HIOB 3AZKA 4YS3B 5BT1C 4WNNB 4XUJB 3LZ0D 5B31G 4J8WA 3W96B 2BYMB 5B1LB 3REJC 5AVBB 1P3AB 4H9RA 3W99B 3W97B 5B33C 1H3OB 1WWIA 2HIOA 3B0CW 1A7WA 4KUDA 1P3BD 5JRGB 3WKJB 3W96A 4XUJA 3AV2C 5GXQC 3X1SC 2BYMA 1P3KC 1KX5B 3VH6A 3W99A 5GT3A 3WTPD 3REKA 3AZLC 3KWQD 2IO5B 1P3IB 5JRGA 4YS3C 3MVDD 5GSUB 4H9SA 2CV5A 3REHD 5CPJC 3W98B 1P34A 4Z66B 4XZQD 5B32A 3AN2C 5AVBC 3KXBD 1P3AC 3LZ1D 3AZIB 3AZJC 2BYKB 4JJNB 4WU9B 3WKJC 1S32C 1KX5C 1ZLAA 3KUYB 1P3OA 1AOIA 2PYOC 5AV8D 2BYKA 5B33D 5AV5C 4JJNA 1KX4C 3MGSB 5GSUC 5AV6C 5CP6D 3LELC 4WU8C 2NZDA 4UUZA 3AV2D 5GXQD 2FJ7A 4Z66C 1P3KD 5B0ZB 3MGPA 1B6WA 3MNNB 2HUEB 1U35B 3A6NC 4WU9C 5B0YA 1N1JB 1P3PB 5CPJD 1M1AC 5B0ZA 5B24A 3AN2D 4ZUXB 3KUYC 2YFWB 5BS7A 4H9NA 1ULYA 2F8NH 5KDMA 3AZJD 1N1JA 3UTBB 1M18C 1HQ3B 5F99B 2F8NB 1S32D 4NE5A 3AZMC 2PYOD 1ID3B 1U35C 2HUEC 5AV5D 5BO0A 1KX4D 3B6FC 3UTAB 5AV6D 1TAFA 3LELD 4WU8D 1P3PC 2F8NA 3C1CD 3UT9C 4QLCB 5C3IC 5AY8B 4DRBA 1P3FC 1KU5A 3AZNB 3RELB 1R4VA 3MGRD 4H9PB 1EQZA 3REIA 3A6ND 1P3GB 3LJAA 4YM6B 1JFIA 1HQ3C 3VH5T 3X1UC 5F99C 1M1AD 3VH5W 5B1MD 3AFAB 1ID3C 5E5AA 5B2IB 4NE3A 2AROA 1M18D 1M19C 4R8PC 4EO5C 1KX3D 3AZEA 4QLCC 4J8XB 5AY8C 5CPKC 5GT0D 3MGQD 5B2JC 4M6BA 2YFVB 5B2IA 3AZMD 3AZNC 3RELC 3V9RA 3B6FD 1P3MB 2F8NG 4HGAB 4YM6C 3LZ0A 3WAAC 3UT9D 1F66C 3AZHB 4E45A 5B31C 3AFAC 1P3FD 4KHAB 1P3BA 4X23C 3AZKB 3AZGD 4KGCB 4H9OA 1TZYC 3X1UD 3WTPA 4J8XC 4J8WB 5CPIB 3MVDA 3AZFC 5DNMB 3REHA 1P3LD 4KUDB 5BNVA 2NQBD 4HGAC 4KGCA 4XZQA 1M19D 4R8PD 4Z5TC 3LZ1A 5CPIA 4J8VC 3X1TC 3AZHC 3B0CT 5DNNC 5CPKD 5GT3B 3AV1D 5B2JD 3REKB 5DNMA 5AVCD 3TU4B 3NQUA 3B0BA 2CV5B 3WAAD 1P34B 1F66D 5AV8A 5B32B 3C1BD 5FUGB 5B31D 3TU4A 2HIOC 5CP6A 4WV4B 4X23D 1B67A 3X1VD 1P3KA 3W96C 4XUJC 3B6GB 3WA9B 1TZYD 5B1LC 5FUGA 3W99C 5GT3C 3W97C 1ZLAB 3REKC 1P3OB 1AOIB 2JSSA 3WTPE 3AZFD 2F8NK 5JRGC 5CPJA 5BT1D 4H9SC 3B6GA 3WA9A 5JA4B 3AN2A 2NZDB 4UUZB 4Z5TD 2FJ7B 1P34C 3X1TD 4J8VD 3REJD 5DNND 3MGPB 2IO5C 1BH8A 1P3IC 3AYWB 5JA4A 5B0YB 3W98C 3X1SD 5B24B 2PYOA 4H9QA 1ZLAC 3AZIC 1P3OC 4H9NB 3AYWA 3AZLD 1KX4A 1F1EA 2HIOD 5KDMB 3LELA 4JJNC 4YS3D 1Q9CA 4LD9B 3C1CA 5B32G 4XUJD 3W96D 4G92B 5B1LD 5AVBD 1P3AD 3W99D 3W97D 3MGRA 3A6NA 3MGSC 4LD9A 5BO0B 5JRGD 3WKJD 1M1AA 1TAFB 5B1MA 4Z2MH 5B0ZC 3VH6T 1KX5D 5BS7C 3VH6W 3MNNC 5CHLB 1P3ID 1M18A 5GSUD 1KX3A 1WWSA 1EQZB 3REIB 3LJAB 1JFIB 3W98D 4G92C 5GT0A 3MGQA 4Z66D 4ZUXC 3AZID 3O62B 5E5AB 5B40B 4JJND 4WU9D 3UTBC 4AWLB 3UT9A 2AROB 4J8UB 3AZEB 5AV9B 2RVQC 1P3FA 3KUYD 3O62A 5B40A 3UTAC 3MGSD 3AZGA 3V9RB 4J8UA 3LZ0B 4CAYB 5AV9A 4E44A 3NQJA 5B0ZD 5BNXB 1P3LA 1BH9A 1P3BB 2NQBA 3MNND 1U35D 4R8PA 1P3GC 4AWLC 4CAYA 1P3PD 4H9OB 3AZEC 3AV1A 3WTPB 5B2JA 4ZUXD 3KWQB 5BNXA 5AVCA 4ZBJB 4Z2MG 3MVDB 5B2IC 4G91B 3REHB 3UTBD 5BNVB 3LZ0C 1HQ3D 4XZQB 4DRAA 3C1BA 5F99D 3KXBB 2F8ND 5B31A 3KWQA 3LZ1B 2RVQD 4WZSB 4X23A 3X1VA 1P3BC 1ID3D 3UTAD 1P3MC 3NQUB 1TZYA 3KXBA 4QLCD 3WTPC 5AY8D 5AV8B 5B33B 3AZFA 4CSRA 4ZBJC 3R45A 3MVDC 3AZND 5CP6B 3RELD 3REHC 3AZKC 1P3GD 4YM6D 3AV2B 5GXQB 4KGCC 5G49A 3REJA 1P3KB 5DNNA 4J8WC 5CPIC 3LZ1C 5B33A 3AFAD 5DNMC 4KUDC 5B2ID 3X1SA 3AV2A 5GXQA 5CPJB 3AN2B 4J8XD 4NFTA 3AZLA 5AV8C 3AZJB 3TU4C 4YS3A 1BH8B 4WNNA 5CP6C 1P3MD 2CV5C 1S32B 5B1LA 5AVBA 1P3AA 3W97A 5B32C 3AZHD 1H3OA 3AZJA 2PYOB 4H9QB 5AV5B 1KX4B 3WKJA 5AV6B 4WU8B 3LELB 2LY8A 3AZKD 1S32A 3C1CB 1KX5A 4KGCD 3B6GC 3WA9C 4J8WD 5CPID 1BFMA 5AV5A 1P3IA 1AOIC 5GSUA 5AV6A 3MGRB 4WU8A 5DNMD 3A6NB 4KUDD 3W98A 3VH5A 1M1AB 4Z66A 2NZDC 2FJ7C 5B1MB 3AZIA 5GT3D 3MGPC 3REKD 3AYWC 4NE6A 3TU4D 4WU9A 1M18B 1KX3B 5B0YC 3C1CC 2CV5D 3KUYA 5GT0B 5B24C 3MGQB 1P34D 5B32D 3AZMB 3MGSA 3MGRC 3B6FB 4LD9C 3UT9B 3B6GD 5C3IB 3WA9D 5B1MC 1P3FB 3AZMA 3MNNA 1U35A 1ZLAD 1P3OD 1AOID 3B6FA 2L5AA 1P3PA 2CWEA 3AZGB 1KX3C 3X1UB 2NZDD 4ZUXA 2YFWA 5GT0C 3MGQC 2FJ7D 3NQJB 3MGPD 1P3LB 1BH9B 3AYWD 3UTBA 2NQBB 1EQZC 1HQ3A 3REIC 3X1UA 4R8PB 5F99A 4EO5B 5B0YD 3LJAC 1M19B 5CPKB 3AV1B 5B24D 5B2JB 1ID3A 5AVCB 3O62C 3UTAA 5E5AC 5B40C 1M19A 3AZGC 4LD9D 2AROC 3WAAB 4QLCA 4J8UC 5AY8A 5CPKA 5AV9C 1F66B 3C1BB 5B31B 3AZNA 3RELA 4H9PA 4X23B 1P3LC 3X1VB 1P3GA 2NQBC 4YM6A 3WAAA 3B0DB 1TZYB 1F66A 3KSYA 3AFAA 3AV1C 5AVCC 3AZFB 4CSRB 3R45B 1EQZD 3REID 4J8XA 4Z5TB 3LJAD 3C1BC 5G49B 4J8VB 3REJB 3X1TB 5DNNB 3KWQC 2YFVA
chains in the Genus database with same CATH superfamily
3X1VC 4G91C 3O62D 1P3MA 5E5AD 5B40D 1HTAA 4Z5TA 3X1SB 3B0DC 2AROD 2Y2MA 4XZQC 4J8VA 3X1TA 4J8UD 3AZHA 3KXBC 3AZED 5AV9D 4KHAA 4H9RB 3AZLB 2HIOB 3AZKA 4YS3B 5BT1C 4WNNB 4XUJB 3LZ0D 5B31G 4J8WA 3W96B 3EPHA 2BYMB 5B1LB 3REJC 5AVBB 1P3AB 4H9RA 3W99B 3W97B 5B33C 1H3OB 1WWIA 2HIOA 3B0CW 1A7WA 4KUDA 1P3BD 5JRGB 3WKJB 3W96A 4XUJA 3AV2C 5GXQC 3X1SC 2BYMA 1P3KC 1KX5B 3VH6A 3W99A 5GT3A 3WTPD 3REKA 3AZLC 3KWQD 2IO5B 1P3IB 3H0MC 5JRGA 4YS3C 3MVDD 5GSUB 4H9SA 2CV5A 3REHD 5CPJC 3W98B 1P34A 4Z66B 4XZQD 2Y2PA 5B32A 5AVBC 3KXBD 3AN2C 1P3AC 2RIQA 3LZ1D 3AZIB 3AZJC 3A1KA 2BYKB 4JJNB 4WU9B 3WKJC 1S32C 3F6TA 1KX5C 1ZLAA 3KUYB 1P3OA 1AOIA 2PYOC 5AV8D 2BYKA 5B33D 5AV5C 4JJNA 1KX4C 3MGSB 5GSUC 5AV6C 5CP6D 3LELC 4WU8C 2NZDA 4UUZA 3AV2D 5GXQD 2FJ7A 4Z66C 1P3KD 5B0ZB 3MGPA 1B6WA 4WJ3C 3MNNB 2HUEB 1U35B 3A6NC 4WU9C 5B0YA 1N1JB 1P3PB 5CPJD 1M1AC 5B0ZA 5B24A 3AN2D 4ZUXB 3KUYC 2YFWB 5BS7A 4H9NA 1ULYA 2F8NH 5KDMA 3AZJD 1N1JA 3UTBB 1M18C 1HQ3B 5F99B 2F8NB 1S32D 4NE5A 3AZMC 2PYOD 1ID3B 1U35C 2HUEC 5AV5D 5BO0A 1KX4D 3B6FC 3UTAB 5AV6D 1TAFA 3LELD 2Y2GA 4WU8D 1P3PC 2G5IC 2F8NA 3C1CD 3UT9C 4QLCB 2F2AC 5C3IC 5AY8B 4DRBA 1P3FC 3EPKA 1KU5A 3FDDA 3AZNB 3RELB 1R4VA 3MGRD 4H9PB 1EQZA 3REIA 3A6ND 1P3GB 3LJAA 4YM6B 1JFIA 1HQ3C 3VH5T 3X1UC 5F99C 1M1AD 3VH5W 5B1MD 3AFAB 1ID3C 5E5AA 5B2IB 4NE3A 2AROA 1M18D 1M19C 4R8PC 4EO5C 1KX3D 3AZEA 4QLCC 4J8XB 5AY8C 5CPKC 2FFFB 5GT0D 3MGQD 5B2JC 4M6BA 2YFVB 5B2IA 3AZMD 3AZNC 3RELC 3V9RA 3B6FD 1P3MB 2F8NG 4HGAB 4YM6C 3LZ0A 3WAAC 3UT9D 1F66C 3AZHB 4E45A 5B31C 3AFAC 1P3FD 4KHAB 1P3BA 2Y2LA 4X23C 3AZKB 3AZGD 4KGCB 4H9OA 1TZYC 3X1UD 3WTPA 4J8XC 4J8WB 5CPIB 3P5JB 3MVDA 3AZFC 5DNMB 3REHA 1P3LD 4KUDB 5BNVA 2NQBD 4HGAC 3KFUG 4KGCA 4XZQA 1M19D 4R8PD 4Z5TC 3LZ1A 5CPIA 4J8VC 3X1TC 2ZY5A 3AZHC 3B0CT 5DNNC 5CPKD 5GT3B 2Y2KA 3AV1D 5B2JD 3REKB 5DNMA 5AVCD 3TU4B 3NQUA 3B0BA 2CV5B 2Y2OA 3WAAD 3IP4C 1P34B 1F66D 5AV8A 5B32B 3C1BD 5FUGB 5B31D 3TU4A 2HIOC 5CP6A 4WV4B 4X23D 1B67A 3X1VD 1P3KA 3W96C 4XUJC 3B6GB 3WA9B 1TZYD 5B1LC 5FUGA 3W99C 5GT3C 3W97C 1ZLAB 3REKC 1P3OB 1AOIB 2JSSA 3WTPE 3AZFD 2F8NK 5JRGC 5CPJA 5BT1D 4H9SC 3B6GA 3WA9A 5JA4B 3AN2A 2NZDB 4UUZB 4Z5TD 2FJ7B 1P34C 3X1TD 4J8VD 3REJD 5DNND 3MGPB 1PZRA 2IO5C 1BH8A 1P3IC 3AYWB 5JA4A 2XD5A 5B0YB 3W98C 3X1SD 5B24B 2PYOA 4H9QA 1ZLAC 3AZIC 1P3OC 4H9NB 3AYWA 3AZLD 1KX4A 1F1EA 2HIOD 5KDMB 3LELA 4JJNC 4YS3D 1Q9CA 4LD9B 3C1CA 5B32G 4XUJD 3W96D 4G92B 5B1LD 5AVBD 1P3AD 3W99D 3W97D 3MGRA 3A6NA 3MGSC 4LD9A 5BO0B 5JRGD 3WKJD 1M1AA 1TAFB 5B1MA 4Z2MH 5B0ZC 3VH6T 1KX5D 5BS7C 3VH6W 3MNNC 5CHLB 3EPJA 1P3ID 1M18A 5GSUD 1KX3A 1WWSA 1EQZB 3REIB 3LJAB 1JFIB 3W98D 4G92C 5GT0A 3MGQA 4Z66D 4ZUXC 3AZID 3O62B 5E5AB 5B40B 4JJND 4WU9D 3UTBC 4AWLB 3UT9A 2AROB 2XD1A 4J8UB 3AZEB 5AV9B 2JCHA 2RVQC 1P3FA 3KUYD 3O62A 5B40A 3EPLA 3UTAC 3MGSD 3AZGA 3V9RB 4J8UA 3LZ0B 4CAYB 5AV9A 4E44A 2ZY2A 2ZM5A 3NQJA 5B0ZD 5BNXB 1P3LA 1BH9A 1P3BB 2NQBA 3MNND 1U35D 4R8PA 1P3GC 4AWLC 4CAYA 1P3PD 4H9OB 3AZEC 3AV1A 3WTPB 5B2JA 4ZUXD 3KWQB 5BNXA 5AVCA 4ZBJB 4Z2MG 3MVDB 5B2IC 4G91B 3REHB 3UTBD 5BNVB 3LZ0C 1HQ3D 4XZQB 4DRAA 3C1BA 5F99D 3KXBB 2F8ND 5B31A 3KWQA 3LZ1B 2RVQD 4WZSB 4X23A 3X1VA 1P3BC 1ID3D 3UTAD 1P3MC 3NQUB 1TZYA 3KXBA 4QLCD 3WTPC 5AY8D 5AV8B 2Y2HA 5B33B 2Y2JA 3AZFA 4CSRA 4ZBJC 3R45A 3MVDC 2UWXA 3AZND 5CP6B 3RELD 3REHC 3AZKC 1P3GD 4YM6D 3AV2B 5GXQB 4KGCC 2ZY3A 5G49A 3REJA 1P3KB 5DNNA 4J8WC 5CPIC 3LZ1C 5B33A 3AFAD 5DNMC 4KUDC 5B2ID 3X1SA 3AV2A 2J8PA 5GXQA 5CPJB 3AN2B 4J8XD 4NFTA 3AZLA 5AV8C 3AZJB 3TU4C 4YS3A 1BH8B 4WNNA 1T3UA 5CP6C 1P3MD 2DQNC 2CV5C 3AL0C 1S32B 5B1LA 5AVBA 1P3AA 3W97A 5B32C 3AZHD 1H3OA 3AZJA 2PYOB 4H9QB 2ZY4A 1Z2CB 5AV5B 1KX4B 3WKJA 5AV6B 4WU8B 3LELB 2LY8A 3AZKD 1S32A 3C1CB 1KX5A 4KGCD 3B6GC 3WA9C 4J8WD 5CPID 1BFMA 5AV5A 2Y2NA 1P3IA 1AOIC 5GSUA 5AV6A 3MGRB 4WU8A 5DNMD 3A6NB 4KUDD 3W98A 3VH5A 1M1AB 4Z66A 2NZDC 4DQYB 2FJ7C 2W8SA 5B1MB 3AZIA 3H0LC 5GT3D 3MGPC 3REKD 2Y2QA 3AYWC 4NE6A 3TU4D 4WU9A 1M18B 1KX3B 5B0YC 3C1CC 2CV5D 2BG1A 3KUYA 1W2EA 5GT0B 5B24C 3MGQB 1P34D 3H0RC 5B32D 3AZMB 3MGSA 3MGRC 3B6FB 4LD9C 3UT9B 4UPKA 3B6GD 5C3IB 3WA9D 5B1MC 1P3FB 3AZMA 3MNNA 1U35A 1ZLAD 1P3OD 1AOID 3B6FA 2L5AA 1P3PA 2CWEA 3AZGB 1KX3C 3X1UB 2NZDD 4ZUXA 2YFWA 5GT0C 3MGQC 2FJ7D 3NQJB 3MGPD 1P3LB 1BH9B 3AYWD 2VQRA 3UTBA 2NQBB 1EQZC 1HQ3A 3REIC 3X1UA 4R8PB 5F99A 4EO5B 5B0YD 3LJAC 1M19B 5CPKB 2JE5A 3AV1B 5B24D 5B2JB 1ID3A 5AVCB 3O62C 3UTAA 5E5AC 5B40C 1M19A 3AZGC 4LD9D 2Y2IA 2AROC 3WAAB 4QLCA 4J8UC 5AY8A 5CPKA 5AV9C 1F66B 3C1BB 5B31B 3AZNA 3RELA 4H9PA 4X23B 1P3LC 2DF4C 3X1VB 1P3GA 2NQBC 4YM6A 3EG5B 3WAAA 3B0DB 1TZYB 1F66A 3KSYA 3AFAA 3AV1C 5AVCC 3AZFB 4CSRB 3R45B 1EQZD 3REID 4J8XA 4Z5TB 3LJAD 3C1BC 5G49B 4J8VB 3REJB 3X1TB 5DNNB 2G5HC 3KWQC 2YFVA 3A1IA
chains in the Genus database with same CATH topology
3X1VC 4G91C 3O62D 1P3MA 5E5AD 5B40D 1HTAA 4Z5TA 3X1SB 3B0DC 2AROD 2Y2MA 4XZQC 4J8VA 3X1TA 4J8UD 3AZHA 3KXBC 3AZED 5AV9D 4KHAA 4H9RB 3AZLB 2HIOB 3AZKA 4YS3B 5BT1C 4WNNB 4XUJB 3LZ0D 5B31G 4J8WA 3W96B 3EPHA 2BYMB 5B1LB 3REJC 5AVBB 1P3AB 4H9RA 3W99B 3W97B 5B33C 1H3OB 1WWIA 2HIOA 3B0CW 1A7WA 4KUDA 1P3BD 5JRGB 3WKJB 3W96A 4XUJA 3AV2C 5GXQC 3X1SC 2BYMA 1P3KC 1KX5B 3VH6A 3W99A 5GT3A 3WTPD 3REKA 3AZLC 3KWQD 2IO5B 1P3IB 3H0MC 5JRGA 4YS3C 3MVDD 5GSUB 4H9SA 2CV5A 3REHD 5CPJC 3W98B 1P34A 4Z66B 4XZQD 2Y2PA 5B32A 5AVBC 3KXBD 3AN2C 1P3AC 2RIQA 3LZ1D 3AZIB 3AZJC 3A1KA 2BYKB 4JJNB 4WU9B 3WKJC 1S32C 3F6TA 1KX5C 1ZLAA 3KUYB 1P3OA 1AOIA 2PYOC 5AV8D 2BYKA 5B33D 5AV5C 4JJNA 1KX4C 3MGSB 5GSUC 5AV6C 5CP6D 3LELC 4WU8C 2NZDA 4UUZA 3AV2D 5GXQD 2FJ7A 4Z66C 1P3KD 5B0ZB 3MGPA 1B6WA 4WJ3C 3MNNB 2HUEB 1U35B 3A6NC 4WU9C 5B0YA 1N1JB 1P3PB 5CPJD 1M1AC 5B0ZA 5B24A 3AN2D 4ZUXB 3KUYC 2YFWB 5BS7A 4H9NA 1ULYA 2F8NH 5KDMA 3AZJD 1N1JA 3UTBB 1M18C 1HQ3B 5F99B 2F8NB 1S32D 4NE5A 3AZMC 2PYOD 1ID3B 1U35C 2HUEC 5AV5D 5BO0A 1KX4D 3B6FC 3UTAB 5AV6D 1TAFA 3LELD 2Y2GA 4WU8D 1P3PC 2G5IC 2F8NA 3C1CD 3UT9C 4QLCB 2F2AC 5C3IC 5AY8B 4DRBA 1P3FC 3EPKA 1KU5A 3FDDA 3AZNB 3RELB 1R4VA 3MGRD 4H9PB 1EQZA 3REIA 3A6ND 1P3GB 3LJAA 4YM6B 1JFIA 1HQ3C 3VH5T 3X1UC 5F99C 1M1AD 3VH5W 5B1MD 3AFAB 1ID3C 5E5AA 5B2IB 4NE3A 2AROA 1M18D 1M19C 4R8PC 4EO5C 1KX3D 3AZEA 4QLCC 4J8XB 5AY8C 5CPKC 2FFFB 5GT0D 3MGQD 5B2JC 4M6BA 2YFVB 5B2IA 3AZMD 3AZNC 3RELC 3V9RA 3B6FD 1P3MB 2F8NG 4HGAB 4YM6C 3LZ0A 3WAAC 3UT9D 1F66C 3AZHB 4E45A 5B31C 3AFAC 1P3FD 4KHAB 1P3BA 2Y2LA 4X23C 3AZKB 3AZGD 4KGCB 4H9OA 1TZYC 3X1UD 3WTPA 4J8XC 4J8WB 5CPIB 3P5JB 3MVDA 3AZFC 5DNMB 3REHA 1P3LD 4KUDB 5BNVA 2NQBD 4HGAC 3KFUG 4KGCA 4XZQA 1M19D 4R8PD 4Z5TC 3LZ1A 5CPIA 4J8VC 3X1TC 2ZY5A 3AZHC 3B0CT 5DNNC 5CPKD 5GT3B 2Y2KA 3AV1D 5B2JD 3REKB 5DNMA 5AVCD 3TU4B 3NQUA 3B0BA 2CV5B 2Y2OA 3WAAD 3IP4C 1P34B 1F66D 5AV8A 5B32B 3C1BD 5FUGB 5B31D 3TU4A 2HIOC 5CP6A 4WV4B 4X23D 1B67A 3X1VD 1P3KA 3W96C 4XUJC 3B6GB 3WA9B 1TZYD 5B1LC 5FUGA 3W99C 5GT3C 3W97C 1ZLAB 3REKC 1P3OB 1AOIB 2JSSA 3WTPE 3AZFD 2F8NK 5JRGC 5CPJA 5BT1D 4H9SC 3B6GA 3WA9A 5JA4B 3AN2A 2NZDB 4UUZB 4Z5TD 2FJ7B 1P34C 3X1TD 4J8VD 3REJD 5DNND 3MGPB 1PZRA 2IO5C 1BH8A 1P3IC 3AYWB 5JA4A 2XD5A 5B0YB 3W98C 3X1SD 5B24B 2PYOA 4H9QA 1ZLAC 3AZIC 1P3OC 4H9NB 3AYWA 3AZLD 1KX4A 1F1EA 2HIOD 5KDMB 3LELA 4JJNC 4YS3D 1Q9CA 4LD9B 3C1CA 5B32G 4XUJD 3W96D 4G92B 5B1LD 5AVBD 1P3AD 3W99D 3W97D 3MGRA 3A6NA 3MGSC 4LD9A 5BO0B 5JRGD 3WKJD 1M1AA 1TAFB 5B1MA 4Z2MH 5B0ZC 3VH6T 1KX5D 5BS7C 3VH6W 3MNNC 5CHLB 3EPJA 1P3ID 1M18A 5GSUD 1KX3A 1WWSA 1EQZB 3REIB 3LJAB 1JFIB 3W98D 4G92C 5GT0A 3MGQA 4Z66D 4ZUXC 3AZID 3O62B 5E5AB 5B40B 4JJND 4WU9D 3UTBC 4AWLB 3UT9A 2AROB 2XD1A 4J8UB 3AZEB 5AV9B 2JCHA 2RVQC 1P3FA 3KUYD 3O62A 5B40A 3EPLA 3UTAC 3MGSD 3AZGA 3V9RB 4J8UA 3LZ0B 4CAYB 5AV9A 4E44A 2ZY2A 2ZM5A 3NQJA 5B0ZD 5BNXB 1P3LA 1BH9A 1P3BB 2NQBA 3MNND 1U35D 4R8PA 1P3GC 4AWLC 4CAYA 1P3PD 4H9OB 3AZEC 3AV1A 3WTPB 5B2JA 4ZUXD 3KWQB 5BNXA 5AVCA 4ZBJB 4Z2MG 3MVDB 5B2IC 4G91B 3REHB 3UTBD 5BNVB 3LZ0C 1HQ3D 4XZQB 4DRAA 3C1BA 5F99D 3KXBB 2F8ND 5B31A 3KWQA 3LZ1B 2RVQD 4WZSB 4X23A 3X1VA 1P3BC 1ID3D 3UTAD 1P3MC 3NQUB 1TZYA 3KXBA 4QLCD 3WTPC 5AY8D 5AV8B 2Y2HA 5B33B 2Y2JA 3AZFA 4CSRA 4ZBJC 3R45A 3MVDC 2UWXA 3AZND 5CP6B 3RELD 3REHC 3AZKC 1P3GD 4YM6D 3AV2B 5GXQB 4KGCC 2ZY3A 5G49A 3REJA 1P3KB 5DNNA 4J8WC 5CPIC 3LZ1C 5B33A 3AFAD 5DNMC 4KUDC 5B2ID 3X1SA 3AV2A 2J8PA 5GXQA 5CPJB 3AN2B 4J8XD 4NFTA 3AZLA 5AV8C 3AZJB 3TU4C 4YS3A 1BH8B 4WNNA 1T3UA 5CP6C 1P3MD 2DQNC 2CV5C 3AL0C 1S32B 5B1LA 5AVBA 1P3AA 3W97A 5B32C 3AZHD 1H3OA 3AZJA 2PYOB 4H9QB 2ZY4A 1Z2CB 5AV5B 1KX4B 3WKJA 5AV6B 4WU8B 3LELB 2LY8A 3AZKD 1S32A 3C1CB 1KX5A 4KGCD 3B6GC 3WA9C 4J8WD 5CPID 1BFMA 5AV5A 2Y2NA 1P3IA 1AOIC 5GSUA 5AV6A 3MGRB 4WU8A 5DNMD 3A6NB 4KUDD 3W98A 3VH5A 1M1AB 4Z66A 2NZDC 4DQYB 2FJ7C 2W8SA 5B1MB 3AZIA 3H0LC 5GT3D 3MGPC 3REKD 2Y2QA 3AYWC 4NE6A 3TU4D 4WU9A 1M18B 1KX3B 5B0YC 3C1CC 2CV5D 2BG1A 3KUYA 1W2EA 5GT0B 5B24C 3MGQB 1P34D 3H0RC 5B32D 3AZMB 3MGSA 3MGRC 3B6FB 4LD9C 3UT9B 4UPKA 3B6GD 5C3IB 3WA9D 5B1MC 1P3FB 3AZMA 3MNNA 1U35A 1ZLAD 1P3OD 1AOID 3B6FA 2L5AA 1P3PA 2CWEA 3AZGB 1KX3C 3X1UB 2NZDD 4ZUXA 2YFWA 5GT0C 3MGQC 2FJ7D 3NQJB 3MGPD 1P3LB 1BH9B 3AYWD 2VQRA 3UTBA 2NQBB 1EQZC 1HQ3A 3REIC 3X1UA 4R8PB 5F99A 4EO5B 5B0YD 3LJAC 1M19B 5CPKB 2JE5A 3AV1B 5B24D 5B2JB 1ID3A 5AVCB 3O62C 3UTAA 5E5AC 5B40C 1M19A 3AZGC 4LD9D 2Y2IA 2AROC 3WAAB 4QLCA 4J8UC 5AY8A 5CPKA 5AV9C 1F66B 3C1BB 5B31B 3AZNA 3RELA 4H9PA 4X23B 1P3LC 2DF4C 3X1VB 1P3GA 2NQBC 4YM6A 3EG5B 3WAAA 3B0DB 1TZYB 1F66A 3KSYA 3AFAA 3AV1C 5AVCC 3AZFB 4CSRB 3R45B 1EQZD 3REID 4J8XA 4Z5TB 3LJAD 3C1BC 5G49B 4J8VB 3REJB 3X1TB 5DNNB 2G5HC 3KWQC 2YFVA 3A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V C;  4G91 C;  3O62 D;  1P3M A;  5E5A D;  5B40 D;  1HTA A;  4Z5T A;  3X1S B;  3B0D C;  2ARO D;  4XZQ C;  4J8V A;  3X1T A;  4J8U D;  3AZH A;  3KXB C;  3AZE D;  5AV9 D;  4KHA A;  4H9R B;  3AZL B;  2HIO B;  3AZK A;  4YS3 B;  5BT1 C;  4WNN B;  4XUJ B;  3LZ0 D;  5B31 G;  4J8W A;  3W96 B;  2BYM B;  5B1L B;  3REJ C;  5AVB B;  1P3A B;  4H9R A;  3W99 B;  3W97 B;  5B33 C;  1H3O B;  1WWI A;  2HIO A;  3B0C W;  1A7W A;  4KUD A;  1P3B D;  5JRG B;  3WKJ B;  3W96 A;  4XUJ A;  3AV2 C;  5GXQ C;  3X1S C;  2BYM A;  1P3K C;  1KX5 B;  3VH6 A;  3W99 A;  5GT3 A;  3WTP D;  3REK A;  3AZL C;  3KWQ D;  2IO5 B;  1P3I B;  5JRG A;  4YS3 C;  3MVD D;  5GSU B;  4H9S A;  2CV5 A;  3REH D;  5CPJ C;  3W98 B;  1P34 A;  4Z66 B;  4XZQ D;  5B32 A;  3AN2 C;  5AVB C;  3KXB D;  1P3A C;  3LZ1 D;  3AZI B;  3AZJ C;  2BYK B;  4JJN B;  4WU9 B;  3WKJ C;  1S32 C;  1KX5 C;  1ZLA A;  3KUY B;  1P3O A;  1AOI A;  2PYO C;  5AV8 D;  2BYK A;  5B33 D;  5AV5 C;  4JJN A;  1KX4 C;  3MGS B;  5GSU C;  5AV6 C;  5CP6 D;  3LEL C;  4WU8 C;  2NZD A;  4UUZ A;  3AV2 D;  5GXQ D;  2FJ7 A;  4Z66 C;  1P3K D;  5B0Z B;  3MGP A;  1B6W A;  3MNN B;  2HUE B;  1U35 B;  3A6N C;  4WU9 C;  5B0Y A;  1N1J B;  1P3P B;  5CPJ D;  1M1A C;  5B0Z A;  5B24 A;  3AN2 D;  4ZUX B;  3KUY C;  2YFW B;  5BS7 A;  4H9N A;  1ULY A;  2F8N H;  5KDM A;  3AZJ D;  1N1J A;  3UTB B;  1M18 C;  1HQ3 B;  5F99 B;  2F8N B;  1S32 D;  4NE5 A;  3AZM C;  2PYO D;  1ID3 B;  1U35 C;  2HUE C;  5AV5 D;  5BO0 A;  1KX4 D;  3B6F C;  3UTA B;  5AV6 D;  1TAF A;  3LEL D;  4WU8 D;  1P3P C;  2F8N A;  3C1C D;  3UT9 C;  4QLC B;  5C3I C;  5AY8 B;  4DRB A;  1P3F C;  1KU5 A;  3AZN B;  3REL B;  1R4V A;  3MGR D;  4H9P B;  1EQZ A;  3REI A;  3A6N D;  1P3G B;  3LJA A;  4YM6 B;  1JFI A;  1HQ3 C;  3VH5 T;  3X1U C;  5F99 C;  1M1A D;  3VH5 W;  5B1M D;  3AFA B;  1ID3 C;  5E5A A;  5B2I B;  4NE3 A;  2ARO A;  1M18 D;  1M19 C;  4R8P C;  4EO5 C;  1KX3 D;  3AZE A;  4QLC C;  4J8X B;  5AY8 C;  5CPK C;  5GT0 D;  3MGQ D;  5B2J C;  4M6B A;  2YFV B;  5B2I A;  3AZM D;  3AZN C;  3REL C;  3V9R A;  3B6F D;  1P3M B;  2F8N G;  4HGA B;  4YM6 C;  3LZ0 A;  3WAA C;  3UT9 D;  1F66 C;  3AZH B;  4E45 A;  5B31 C;  3AFA C;  1P3F D;  4KHA B;  1P3B A;  4X23 C;  3AZK B;  3AZG D;  4KGC B;  4H9O A;  1TZY C;  3X1U D;  3WTP A;  4J8X C;  4J8W B;  5CPI B;  3MVD A;  3AZF C;  5DNM B;  3REH A;  1P3L D;  4KUD B;  5BNV A;  2NQB D;  4HGA C;  4KGC A;  4XZQ A;  1M19 D;  4R8P D;  4Z5T C;  3LZ1 A;  5CPI A;  4J8V C;  3X1T C;  3AZH C;  3B0C T;  5DNN C;  5CPK D;  5GT3 B;  3AV1 D;  5B2J D;  3REK B;  5DNM A;  5AVC D;  3TU4 B;  3NQU A;  3B0B A;  2CV5 B;  3WAA D;  1P34 B;  1F66 D;  5AV8 A;  5B32 B;  3C1B D;  5FUG B;  5B31 D;  3TU4 A;  2HIO C;  5CP6 A;  4WV4 B;  4X23 D;  1B67 A;  3X1V D;  1P3K A;  3W96 C;  4XUJ C;  3B6G B;  3WA9 B;  1TZY D;  5B1L C;  5FUG A;  3W99 C;  5GT3 C;  3W97 C;  1ZLA B;  3REK C;  1P3O B;  1AOI B;  2JSS A;  3WTP E;  3AZF D;  2F8N K;  5JRG C;  5CPJ A;  5BT1 D;  4H9S C;  3B6G A;  3WA9 A;  5JA4 B;  3AN2 A;  2NZD B;  4UUZ B;  4Z5T D;  2FJ7 B;  1P34 C;  3X1T D;  4J8V D;  3REJ D;  5DNN D;  3MGP B;  2IO5 C;  1BH8 A;  1P3I C;  3AYW B;  5JA4 A;  5B0Y B;  3W98 C;  3X1S D;  5B24 B;  2PYO A;  4H9Q A;  1ZLA C;  3AZI C;  1P3O C;  4H9N B;  3AYW A;  3AZL D;  1KX4 A;  1F1E A;  2HIO D;  5KDM B;  3LEL A;  4JJN C;  4YS3 D;  1Q9C A;  4LD9 B;  3C1C A;  5B32 G;  4XUJ D;  3W96 D;  4G92 B;  5B1L D;  5AVB D;  1P3A D;  3W99 D;  3W97 D;  3MGR A;  3A6N A;  3MGS C;  4LD9 A;  5BO0 B;  5JRG D;  3WKJ D;  1M1A A;  1TAF B;  5B1M A;  4Z2M H;  5B0Z C;  3VH6 T;  1KX5 D;  5BS7 C;  3VH6 W;  3MNN C;  5CHL B;  1P3I D;  1M18 A;  5GSU D;  1KX3 A;  1WWS A;  1EQZ B;  3REI B;  3LJA B;  1JFI B;  3W98 D;  4G92 C;  5GT0 A;  3MGQ A;  4Z66 D;  4ZUX C;  3AZI D;  3O62 B;  5E5A B;  5B40 B;  4JJN D;  4WU9 D;  3UTB C;  4AWL B;  3UT9 A;  2ARO B;  4J8U B;  3AZE B;  5AV9 B;  2RVQ C;  1P3F A;  3KUY D;  3O62 A;  5B40 A;  3UTA C;  3MGS D;  3AZG A;  3V9R B;  4J8U A;  3LZ0 B;  4CAY B;  5AV9 A;  4E44 A;  3NQJ A;  5B0Z D;  5BNX B;  1P3L A;  1BH9 A;  1P3B B;  2NQB A;  3MNN D;  1U35 D;  4R8P A;  1P3G C;  4AWL C;  4CAY A;  1P3P D;  4H9O B;  3AZE C;  3AV1 A;  3WTP B;  5B2J A;  4ZUX D;  3KWQ B;  5BNX A;  5AVC A;  4ZBJ B;  4Z2M G;  3MVD B;  5B2I C;  4G91 B;  3REH B;  3UTB D;  5BNV B;  3LZ0 C;  1HQ3 D;  4XZQ B;  4DRA A;  3C1B A;  5F99 D;  3KXB B;  2F8N D;  5B31 A;  3KWQ A;  3LZ1 B;  2RVQ D;  4WZS B;  4X23 A;  3X1V A;  1P3B C;  1ID3 D;  3UTA D;  1P3M C;  3NQU B;  1TZY A;  3KXB A;  4QLC D;  3WTP C;  5AY8 D;  5AV8 B;  5B33 B;  3AZF A;  4CSR A;  4ZBJ C;  3R45 A;  3MVD C;  3AZN D;  5CP6 B;  3REL D;  3REH C;  3AZK C;  1P3G D;  4YM6 D;  3AV2 B;  5GXQ B;  4KGC C;  5G49 A;  3REJ A;  1P3K B;  5DNN A;  4J8W C;  5CPI C;  3LZ1 C;  5B33 A;  3AFA D;  5DNM C;  4KUD C;  5B2I D;  3X1S A;  3AV2 A;  5GXQ A;  5CPJ B;  3AN2 B;  4J8X D;  4NFT A;  3AZL A;  5AV8 C;  3AZJ B;  3TU4 C;  4YS3 A;  1BH8 B;  4WNN A;  5CP6 C;  1P3M D;  2CV5 C;  1S32 B;  5B1L A;  5AVB A;  1P3A A;  3W97 A;  5B32 C;  3AZH D;  1H3O A;  3AZJ A;  2PYO B;  4H9Q B;  5AV5 B;  1KX4 B;  3WKJ A;  5AV6 B;  4WU8 B;  3LEL B;  2LY8 A;  3AZK D;  1S32 A;  3C1C B;  1KX5 A;  4KGC D;  3B6G C;  3WA9 C;  4J8W D;  5CPI D;  1BFM A;  5AV5 A;  1P3I A;  1AOI C;  5GSU A;  5AV6 A;  3MGR B;  4WU8 A;  5DNM D;  3A6N B;  4KUD D;  3W98 A;  3VH5 A;  1M1A B;  4Z66 A;  2NZD C;  2FJ7 C;  5B1M B;  3AZI A;  5GT3 D;  3MGP C;  3REK D;  3AYW C;  4NE6 A;  3TU4 D;  4WU9 A;  1M18 B;  1KX3 B;  5B0Y C;  3C1C C;  2CV5 D;  3KUY A;  5GT0 B;  5B24 C;  3MGQ B;  1P34 D;  5B32 D;  3AZM B;  3MGS A;  3MGR C;  3B6F B;  4LD9 C;  3UT9 B;  3B6G D;  5C3I B;  3WA9 D;  5B1M C;  1P3F B;  3AZM A;  3MNN A;  1U35 A;  1ZLA D;  1P3O D;  1AOI D;  3B6F A;  2L5A A;  1P3P A;  2CWE A;  3AZG B;  1KX3 C;  3X1U B;  2NZD D;  4ZUX A;  2YFW A;  5GT0 C;  3MGQ C;  2FJ7 D;  3NQJ B;  3MGP D;  1P3L B;  1BH9 B;  3AYW D;  3UTB A;  2NQB B;  1EQZ C;  1HQ3 A;  3REI C;  3X1U A;  4R8P B;  5F99 A;  4EO5 B;  5B0Y D;  3LJA C;  1M19 B;  5CPK B;  3AV1 B;  5B24 D;  5B2J B;  1ID3 A;  5AVC B;  3O62 C;  3UTA A;  5E5A C;  5B40 C;  1M19 A;  3AZG C;  4LD9 D;  2ARO C;  3WAA B;  4QLC A;  4J8U C;  5AY8 A;  5CPK A;  5AV9 C;  1F66 B;  3C1B B;  5B31 B;  3AZN A;  3REL A;  4H9P A;  4X23 B;  1P3L C;  3X1V B;  1P3G A;  2NQB C;  4YM6 A;  3WAA A;  3B0D B;  1TZY B;  1F66 A;  3KSY A;  3AFA A;  3AV1 C;  5AVC C;  3AZF B;  4CSR B;  3R45 B;  1EQZ D;  3REI D;  4J8X A;  4Z5T B;  3LJA D;  3C1B C;  5G49 B;  4J8V B;  3REJ B;  3X1T B;  5DNN B;  3KWQ C;  2YFV A; 
#chains in the Genus database with same CATH topology
 3X1V C;  4G91 C;  3O62 D;  1P3M A;  5E5A D;  5B40 D;  1HTA A;  4Z5T A;  3X1S B;  3B0D C;  2ARO D;  2Y2M A;  4XZQ C;  4J8V A;  3X1T A;  4J8U D;  3AZH A;  3KXB C;  3AZE D;  5AV9 D;  4KHA A;  4H9R B;  3AZL B;  2HIO B;  3AZK A;  4YS3 B;  5BT1 C;  4WNN B;  4XUJ B;  3LZ0 D;  5B31 G;  4J8W A;  3W96 B;  3EPH A;  2BYM B;  5B1L B;  3REJ C;  5AVB B;  1P3A B;  4H9R A;  3W99 B;  3W97 B;  5B33 C;  1H3O B;  1WWI A;  2HIO A;  3B0C W;  1A7W A;  4KUD A;  1P3B D;  5JRG B;  3WKJ B;  3W96 A;  4XUJ A;  3AV2 C;  5GXQ C;  3X1S C;  2BYM A;  1P3K C;  1KX5 B;  3VH6 A;  3W99 A;  5GT3 A;  3WTP D;  3REK A;  3AZL C;  3KWQ D;  2IO5 B;  1P3I B;  3H0M C;  5JRG A;  4YS3 C;  3MVD D;  5GSU B;  4H9S A;  2CV5 A;  3REH D;  5CPJ C;  3W98 B;  1P34 A;  4Z66 B;  4XZQ D;  2Y2P A;  5B32 A;  5AVB C;  3KXB D;  3AN2 C;  1P3A C;  2RIQ A;  3LZ1 D;  3AZI B;  3AZJ C;  3A1K A;  2BYK B;  4JJN B;  4WU9 B;  3WKJ C;  1S32 C;  3F6T A;  1KX5 C;  1ZLA A;  3KUY B;  1P3O A;  1AOI A;  2PYO C;  5AV8 D;  2BYK A;  5B33 D;  5AV5 C;  4JJN A;  1KX4 C;  3MGS B;  5GSU C;  5AV6 C;  5CP6 D;  3LEL C;  4WU8 C;  2NZD A;  4UUZ A;  3AV2 D;  5GXQ D;  2FJ7 A;  4Z66 C;  1P3K D;  5B0Z B;  3MGP A;  1B6W A;  4WJ3 C;  3MNN B;  2HUE B;  1U35 B;  3A6N C;  4WU9 C;  5B0Y A;  1N1J B;  1P3P B;  5CPJ D;  1M1A C;  5B0Z A;  5B24 A;  3AN2 D;  4ZUX B;  3KUY C;  2YFW B;  5BS7 A;  4H9N A;  1ULY A;  2F8N H;  5KDM A;  3AZJ D;  1N1J A;  3UTB B;  1M18 C;  1HQ3 B;  5F99 B;  2F8N B;  1S32 D;  4NE5 A;  3AZM C;  2PYO D;  1ID3 B;  1U35 C;  2HUE C;  5AV5 D;  5BO0 A;  1KX4 D;  3B6F C;  3UTA B;  5AV6 D;  1TAF A;  3LEL D;  2Y2G A;  4WU8 D;  1P3P C;  2G5I C;  2F8N A;  3C1C D;  3UT9 C;  4QLC B;  2F2A C;  5C3I C;  5AY8 B;  4DRB A;  1P3F C;  3EPK A;  1KU5 A;  3FDD A;  3AZN B;  3REL B;  1R4V A;  3MGR D;  4H9P B;  1EQZ A;  3REI A;  3A6N D;  1P3G B;  3LJA A;  4YM6 B;  1JFI A;  1HQ3 C;  3VH5 T;  3X1U C;  5F99 C;  1M1A D;  3VH5 W;  5B1M D;  3AFA B;  1ID3 C;  5E5A A;  5B2I B;  4NE3 A;  2ARO A;  1M18 D;  1M19 C;  4R8P C;  4EO5 C;  1KX3 D;  3AZE A;  4QLC C;  4J8X B;  5AY8 C;  5CPK C;  2FFF B;  5GT0 D;  3MGQ D;  5B2J C;  4M6B A;  2YFV B;  5B2I A;  3AZM D;  3AZN C;  3REL C;  3V9R A;  3B6F D;  1P3M B;  2F8N G;  4HGA B;  4YM6 C;  3LZ0 A;  3WAA C;  3UT9 D;  1F66 C;  3AZH B;  4E45 A;  5B31 C;  3AFA C;  1P3F D;  4KHA B;  1P3B A;  2Y2L A;  4X23 C;  3AZK B;  3AZG D;  4KGC B;  4H9O A;  1TZY C;  3X1U D;  3WTP A;  4J8X C;  4J8W B;  5CPI B;  3P5J B;  3MVD A;  3AZF C;  5DNM B;  3REH A;  1P3L D;  4KUD B;  5BNV A;  2NQB D;  4HGA C;  3KFU G;  4KGC A;  4XZQ A;  1M19 D;  4R8P D;  4Z5T C;  3LZ1 A;  5CPI A;  4J8V C;  3X1T C;  2ZY5 A;  3AZH C;  3B0C T;  5DNN C;  5CPK D;  5GT3 B;  2Y2K A;  3AV1 D;  5B2J D;  3REK B;  5DNM A;  5AVC D;  3TU4 B;  3NQU A;  3B0B A;  2CV5 B;  2Y2O A;  3WAA D;  3IP4 C;  1P34 B;  1F66 D;  5AV8 A;  5B32 B;  3C1B D;  5FUG B;  5B31 D;  3TU4 A;  2HIO C;  5CP6 A;  4WV4 B;  4X23 D;  1B67 A;  3X1V D;  1P3K A;  3W96 C;  4XUJ C;  3B6G B;  3WA9 B;  1TZY D;  5B1L C;  5FUG A;  3W99 C;  5GT3 C;  3W97 C;  1ZLA B;  3REK C;  1P3O B;  1AOI B;  2JSS A;  3WTP E;  3AZF D;  2F8N K;  5JRG C;  5CPJ A;  5BT1 D;  4H9S C;  3B6G A;  3WA9 A;  5JA4 B;  3AN2 A;  2NZD B;  4UUZ B;  4Z5T D;  2FJ7 B;  1P34 C;  3X1T D;  4J8V D;  3REJ D;  5DNN D;  3MGP B;  1PZR A;  2IO5 C;  1BH8 A;  1P3I C;  3AYW B;  5JA4 A;  2XD5 A;  5B0Y B;  3W98 C;  3X1S D;  5B24 B;  2PYO A;  4H9Q A;  1ZLA C;  3AZI C;  1P3O C;  4H9N B;  3AYW A;  3AZL D;  1KX4 A;  1F1E A;  2HIO D;  5KDM B;  3LEL A;  4JJN C;  4YS3 D;  1Q9C A;  4LD9 B;  3C1C A;  5B32 G;  4XUJ D;  3W96 D;  4G92 B;  5B1L D;  5AVB D;  1P3A D;  3W99 D;  3W97 D;  3MGR A;  3A6N A;  3MGS C;  4LD9 A;  5BO0 B;  5JRG D;  3WKJ D;  1M1A A;  1TAF B;  5B1M A;  4Z2M H;  5B0Z C;  3VH6 T;  1KX5 D;  5BS7 C;  3VH6 W;  3MNN C;  5CHL B;  3EPJ A;  1P3I D;  1M18 A;  5GSU D;  1KX3 A;  1WWS A;  1EQZ B;  3REI B;  3LJA B;  1JFI B;  3W98 D;  4G92 C;  5GT0 A;  3MGQ A;  4Z66 D;  4ZUX C;  3AZI D;  3O62 B;  5E5A B;  5B40 B;  4JJN D;  4WU9 D;  3UTB C;  4AWL B;  3UT9 A;  2ARO B;  2XD1 A;  4J8U B;  3AZE B;  5AV9 B;  2JCH A;  2RVQ C;  1P3F A;  3KUY D;  3O62 A;  5B40 A;  3EPL A;  3UTA C;  3MGS D;  3AZG A;  3V9R B;  4J8U A;  3LZ0 B;  4CAY B;  5AV9 A;  4E44 A;  2ZY2 A;  2ZM5 A;  3NQJ A;  5B0Z D;  5BNX B;  1P3L A;  1BH9 A;  1P3B B;  2NQB A;  3MNN D;  1U35 D;  4R8P A;  1P3G C;  4AWL C;  4CAY A;  1P3P D;  4H9O B;  3AZE C;  3AV1 A;  3WTP B;  5B2J A;  4ZUX D;  3KWQ B;  5BNX A;  5AVC A;  4ZBJ B;  4Z2M G;  3MVD B;  5B2I C;  4G91 B;  3REH B;  3UTB D;  5BNV B;  3LZ0 C;  1HQ3 D;  4XZQ B;  4DRA A;  3C1B A;  5F99 D;  3KXB B;  2F8N D;  5B31 A;  3KWQ A;  3LZ1 B;  2RVQ D;  4WZS B;  4X23 A;  3X1V A;  1P3B C;  1ID3 D;  3UTA D;  1P3M C;  3NQU B;  1TZY A;  3KXB A;  4QLC D;  3WTP C;  5AY8 D;  5AV8 B;  2Y2H A;  5B33 B;  2Y2J A;  3AZF A;  4CSR A;  4ZBJ C;  3R45 A;  3MVD C;  2UWX A;  3AZN D;  5CP6 B;  3REL D;  3REH C;  3AZK C;  1P3G D;  4YM6 D;  3AV2 B;  5GXQ B;  4KGC C;  2ZY3 A;  5G49 A;  3REJ A;  1P3K B;  5DNN A;  4J8W C;  5CPI C;  3LZ1 C;  5B33 A;  3AFA D;  5DNM C;  4KUD C;  5B2I D;  3X1S A;  3AV2 A;  2J8P A;  5GXQ A;  5CPJ B;  3AN2 B;  4J8X D;  4NFT A;  3AZL A;  5AV8 C;  3AZJ B;  3TU4 C;  4YS3 A;  1BH8 B;  4WNN A;  1T3U A;  5CP6 C;  1P3M D;  2DQN C;  2CV5 C;  3AL0 C;  1S32 B;  5B1L A;  5AVB A;  1P3A A;  3W97 A;  5B32 C;  3AZH D;  1H3O A;  3AZJ A;  2PYO B;  4H9Q B;  2ZY4 A;  1Z2C B;  5AV5 B;  1KX4 B;  3WKJ A;  5AV6 B;  4WU8 B;  3LEL B;  2LY8 A;  3AZK D;  1S32 A;  3C1C B;  1KX5 A;  4KGC D;  3B6G C;  3WA9 C;  4J8W D;  5CPI D;  1BFM A;  5AV5 A;  2Y2N A;  1P3I A;  1AOI C;  5GSU A;  5AV6 A;  3MGR B;  4WU8 A;  5DNM D;  3A6N B;  4KUD D;  3W98 A;  3VH5 A;  1M1A B;  4Z66 A;  2NZD C;  4DQY B;  2FJ7 C;  2W8S A;  5B1M B;  3AZI A;  3H0L C;  5GT3 D;  3MGP C;  3REK D;  2Y2Q A;  3AYW C;  4NE6 A;  3TU4 D;  4WU9 A;  1M18 B;  1KX3 B;  5B0Y C;  3C1C C;  2CV5 D;  2BG1 A;  3KUY A;  1W2E A;  5GT0 B;  5B24 C;  3MGQ B;  1P34 D;  3H0R C;  5B32 D;  3AZM B;  3MGS A;  3MGR C;  3B6F B;  4LD9 C;  3UT9 B;  4UPK A;  3B6G D;  5C3I B;  3WA9 D;  5B1M C;  1P3F B;  3AZM A;  3MNN A;  1U35 A;  1ZLA D;  1P3O D;  1AOI D;  3B6F A;  2L5A A;  1P3P A;  2CWE A;  3AZG B;  1KX3 C;  3X1U B;  2NZD D;  4ZUX A;  2YFW A;  5GT0 C;  3MGQ C;  2FJ7 D;  3NQJ B;  3MGP D;  1P3L B;  1BH9 B;  3AYW D;  2VQR A;  3UTB A;  2NQB B;  1EQZ C;  1HQ3 A;  3REI C;  3X1U A;  4R8P B;  5F99 A;  4EO5 B;  5B0Y D;  3LJA C;  1M19 B;  5CPK B;  2JE5 A;  3AV1 B;  5B24 D;  5B2J B;  1ID3 A;  5AVC B;  3O62 C;  3UTA A;  5E5A C;  5B40 C;  1M19 A;  3AZG C;  4LD9 D;  2Y2I A;  2ARO C;  3WAA B;  4QLC A;  4J8U C;  5AY8 A;  5CPK A;  5AV9 C;  1F66 B;  3C1B B;  5B31 B;  3AZN A;  3REL A;  4H9P A;  4X23 B;  1P3L C;  2DF4 C;  3X1V B;  1P3G A;  2NQB C;  4YM6 A;  3EG5 B;  3WAA A;  3B0D B;  1TZY B;  1F66 A;  3KSY A;  3AFA A;  3AV1 C;  5AVC C;  3AZF B;  4CSR B;  3R45 B;  1EQZ D;  3REI D;  4J8X A;  4Z5T B;  3LJA D;  3C1B C;  5G49 B;  4J8V B;  3REJ B;  3X1T B;  5DNN B;  2G5H C;  3KWQ C;  2YFV A;  3A1I A; 
#chains in the Genus database with same CATH homology
 3X1V C;  4G91 C;  3O62 D;  1P3M A;  5E5A D;  5B40 D;  1HTA A;  4Z5T A;  3X1S B;  3B0D C;  2ARO D;  2Y2M A;  4XZQ C;  4J8V A;  3X1T A;  4J8U D;  3AZH A;  3KXB C;  3AZE D;  5AV9 D;  4KHA A;  4H9R B;  3AZL B;  2HIO B;  3AZK A;  4YS3 B;  5BT1 C;  4WNN B;  4XUJ B;  3LZ0 D;  5B31 G;  4J8W A;  3W96 B;  3EPH A;  2BYM B;  5B1L B;  3REJ C;  5AVB B;  1P3A B;  4H9R A;  3W99 B;  3W97 B;  5B33 C;  1H3O B;  1WWI A;  2HIO A;  3B0C W;  1A7W A;  4KUD A;  1P3B D;  5JRG B;  3WKJ B;  3W96 A;  4XUJ A;  3AV2 C;  5GXQ C;  3X1S C;  2BYM A;  1P3K C;  1KX5 B;  3VH6 A;  3W99 A;  5GT3 A;  3WTP D;  3REK A;  3AZL C;  3KWQ D;  2IO5 B;  1P3I B;  3H0M C;  5JRG A;  4YS3 C;  3MVD D;  5GSU B;  4H9S A;  2CV5 A;  3REH D;  5CPJ C;  3W98 B;  1P34 A;  4Z66 B;  4XZQ D;  2Y2P A;  5B32 A;  5AVB C;  3KXB D;  3AN2 C;  1P3A C;  2RIQ A;  3LZ1 D;  3AZI B;  3AZJ C;  3A1K A;  2BYK B;  4JJN B;  4WU9 B;  3WKJ C;  1S32 C;  3F6T A;  1KX5 C;  1ZLA A;  3KUY B;  1P3O A;  1AOI A;  2PYO C;  5AV8 D;  2BYK A;  5B33 D;  5AV5 C;  4JJN A;  1KX4 C;  3MGS B;  5GSU C;  5AV6 C;  5CP6 D;  3LEL C;  4WU8 C;  2NZD A;  4UUZ A;  3AV2 D;  5GXQ D;  2FJ7 A;  4Z66 C;  1P3K D;  5B0Z B;  3MGP A;  1B6W A;  4WJ3 C;  3MNN B;  2HUE B;  1U35 B;  3A6N C;  4WU9 C;  5B0Y A;  1N1J B;  1P3P B;  5CPJ D;  1M1A C;  5B0Z A;  5B24 A;  3AN2 D;  4ZUX B;  3KUY C;  2YFW B;  5BS7 A;  4H9N A;  1ULY A;  2F8N H;  5KDM A;  3AZJ D;  1N1J A;  3UTB B;  1M18 C;  1HQ3 B;  5F99 B;  2F8N B;  1S32 D;  4NE5 A;  3AZM C;  2PYO D;  1ID3 B;  1U35 C;  2HUE C;  5AV5 D;  5BO0 A;  1KX4 D;  3B6F C;  3UTA B;  5AV6 D;  1TAF A;  3LEL D;  2Y2G A;  4WU8 D;  1P3P C;  2G5I C;  2F8N A;  3C1C D;  3UT9 C;  4QLC B;  2F2A C;  5C3I C;  5AY8 B;  4DRB A;  1P3F C;  3EPK A;  1KU5 A;  3FDD A;  3AZN B;  3REL B;  1R4V A;  3MGR D;  4H9P B;  1EQZ A;  3REI A;  3A6N D;  1P3G B;  3LJA A;  4YM6 B;  1JFI A;  1HQ3 C;  3VH5 T;  3X1U C;  5F99 C;  1M1A D;  3VH5 W;  5B1M D;  3AFA B;  1ID3 C;  5E5A A;  5B2I B;  4NE3 A;  2ARO A;  1M18 D;  1M19 C;  4R8P C;  4EO5 C;  1KX3 D;  3AZE A;  4QLC C;  4J8X B;  5AY8 C;  5CPK C;  2FFF B;  5GT0 D;  3MGQ D;  5B2J C;  4M6B A;  2YFV B;  5B2I A;  3AZM D;  3AZN C;  3REL C;  3V9R A;  3B6F D;  1P3M B;  2F8N G;  4HGA B;  4YM6 C;  3LZ0 A;  3WAA C;  3UT9 D;  1F66 C;  3AZH B;  4E45 A;  5B31 C;  3AFA C;  1P3F D;  4KHA B;  1P3B A;  2Y2L A;  4X23 C;  3AZK B;  3AZG D;  4KGC B;  4H9O A;  1TZY C;  3X1U D;  3WTP A;  4J8X C;  4J8W B;  5CPI B;  3P5J B;  3MVD A;  3AZF C;  5DNM B;  3REH A;  1P3L D;  4KUD B;  5BNV A;  2NQB D;  4HGA C;  3KFU G;  4KGC A;  4XZQ A;  1M19 D;  4R8P D;  4Z5T C;  3LZ1 A;  5CPI A;  4J8V C;  3X1T C;  2ZY5 A;  3AZH C;  3B0C T;  5DNN C;  5CPK D;  5GT3 B;  2Y2K A;  3AV1 D;  5B2J D;  3REK B;  5DNM A;  5AVC D;  3TU4 B;  3NQU A;  3B0B A;  2CV5 B;  2Y2O A;  3WAA D;  3IP4 C;  1P34 B;  1F66 D;  5AV8 A;  5B32 B;  3C1B D;  5FUG B;  5B31 D;  3TU4 A;  2HIO C;  5CP6 A;  4WV4 B;  4X23 D;  1B67 A;  3X1V D;  1P3K A;  3W96 C;  4XUJ C;  3B6G B;  3WA9 B;  1TZY D;  5B1L C;  5FUG A;  3W99 C;  5GT3 C;  3W97 C;  1ZLA B;  3REK C;  1P3O B;  1AOI B;  2JSS A;  3WTP E;  3AZF D;  2F8N K;  5JRG C;  5CPJ A;  5BT1 D;  4H9S C;  3B6G A;  3WA9 A;  5JA4 B;  3AN2 A;  2NZD B;  4UUZ B;  4Z5T D;  2FJ7 B;  1P34 C;  3X1T D;  4J8V D;  3REJ D;  5DNN D;  3MGP B;  1PZR A;  2IO5 C;  1BH8 A;  1P3I C;  3AYW B;  5JA4 A;  2XD5 A;  5B0Y B;  3W98 C;  3X1S D;  5B24 B;  2PYO A;  4H9Q A;  1ZLA C;  3AZI C;  1P3O C;  4H9N B;  3AYW A;  3AZL D;  1KX4 A;  1F1E A;  2HIO D;  5KDM B;  3LEL A;  4JJN C;  4YS3 D;  1Q9C A;  4LD9 B;  3C1C A;  5B32 G;  4XUJ D;  3W96 D;  4G92 B;  5B1L D;  5AVB D;  1P3A D;  3W99 D;  3W97 D;  3MGR A;  3A6N A;  3MGS C;  4LD9 A;  5BO0 B;  5JRG D;  3WKJ D;  1M1A A;  1TAF B;  5B1M A;  4Z2M H;  5B0Z C;  3VH6 T;  1KX5 D;  5BS7 C;  3VH6 W;  3MNN C;  5CHL B;  3EPJ A;  1P3I D;  1M18 A;  5GSU D;  1KX3 A;  1WWS A;  1EQZ B;  3REI B;  3LJA B;  1JFI B;  3W98 D;  4G92 C;  5GT0 A;  3MGQ A;  4Z66 D;  4ZUX C;  3AZI D;  3O62 B;  5E5A B;  5B40 B;  4JJN D;  4WU9 D;  3UTB C;  4AWL B;  3UT9 A;  2ARO B;  2XD1 A;  4J8U B;  3AZE B;  5AV9 B;  2JCH A;  2RVQ C;  1P3F A;  3KUY D;  3O62 A;  5B40 A;  3EPL A;  3UTA C;  3MGS D;  3AZG A;  3V9R B;  4J8U A;  3LZ0 B;  4CAY B;  5AV9 A;  4E44 A;  2ZY2 A;  2ZM5 A;  3NQJ A;  5B0Z D;  5BNX B;  1P3L A;  1BH9 A;  1P3B B;  2NQB A;  3MNN D;  1U35 D;  4R8P A;  1P3G C;  4AWL C;  4CAY A;  1P3P D;  4H9O B;  3AZE C;  3AV1 A;  3WTP B;  5B2J A;  4ZUX D;  3KWQ B;  5BNX A;  5AVC A;  4ZBJ B;  4Z2M G;  3MVD B;  5B2I C;  4G91 B;  3REH B;  3UTB D;  5BNV B;  3LZ0 C;  1HQ3 D;  4XZQ B;  4DRA A;  3C1B A;  5F99 D;  3KXB B;  2F8N D;  5B31 A;  3KWQ A;  3LZ1 B;  2RVQ D;  4WZS B;  4X23 A;  3X1V A;  1P3B C;  1ID3 D;  3UTA D;  1P3M C;  3NQU B;  1TZY A;  3KXB A;  4QLC D;  3WTP C;  5AY8 D;  5AV8 B;  2Y2H A;  5B33 B;  2Y2J A;  3AZF A;  4CSR A;  4ZBJ C;  3R45 A;  3MVD C;  2UWX A;  3AZN D;  5CP6 B;  3REL D;  3REH C;  3AZK C;  1P3G D;  4YM6 D;  3AV2 B;  5GXQ B;  4KGC C;  2ZY3 A;  5G49 A;  3REJ A;  1P3K B;  5DNN A;  4J8W C;  5CPI C;  3LZ1 C;  5B33 A;  3AFA D;  5DNM C;  4KUD C;  5B2I D;  3X1S A;  3AV2 A;  2J8P A;  5GXQ A;  5CPJ B;  3AN2 B;  4J8X D;  4NFT A;  3AZL A;  5AV8 C;  3AZJ B;  3TU4 C;  4YS3 A;  1BH8 B;  4WNN A;  1T3U A;  5CP6 C;  1P3M D;  2DQN C;  2CV5 C;  3AL0 C;  1S32 B;  5B1L A;  5AVB A;  1P3A A;  3W97 A;  5B32 C;  3AZH D;  1H3O A;  3AZJ A;  2PYO B;  4H9Q B;  2ZY4 A;  1Z2C B;  5AV5 B;  1KX4 B;  3WKJ A;  5AV6 B;  4WU8 B;  3LEL B;  2LY8 A;  3AZK D;  1S32 A;  3C1C B;  1KX5 A;  4KGC D;  3B6G C;  3WA9 C;  4J8W D;  5CPI D;  1BFM A;  5AV5 A;  2Y2N A;  1P3I A;  1AOI C;  5GSU A;  5AV6 A;  3MGR B;  4WU8 A;  5DNM D;  3A6N B;  4KUD D;  3W98 A;  3VH5 A;  1M1A B;  4Z66 A;  2NZD C;  4DQY B;  2FJ7 C;  2W8S A;  5B1M B;  3AZI A;  3H0L C;  5GT3 D;  3MGP C;  3REK D;  2Y2Q A;  3AYW C;  4NE6 A;  3TU4 D;  4WU9 A;  1M18 B;  1KX3 B;  5B0Y C;  3C1C C;  2CV5 D;  2BG1 A;  3KUY A;  1W2E A;  5GT0 B;  5B24 C;  3MGQ B;  1P34 D;  3H0R C;  5B32 D;  3AZM B;  3MGS A;  3MGR C;  3B6F B;  4LD9 C;  3UT9 B;  4UPK A;  3B6G D;  5C3I B;  3WA9 D;  5B1M C;  1P3F B;  3AZM A;  3MNN A;  1U35 A;  1ZLA D;  1P3O D;  1AOI D;  3B6F A;  2L5A A;  1P3P A;  2CWE A;  3AZG B;  1KX3 C;  3X1U B;  2NZD D;  4ZUX A;  2YFW A;  5GT0 C;  3MGQ C;  2FJ7 D;  3NQJ B;  3MGP D;  1P3L B;  1BH9 B;  3AYW D;  2VQR A;  3UTB A;  2NQB B;  1EQZ C;  1HQ3 A;  3REI C;  3X1U A;  4R8P B;  5F99 A;  4EO5 B;  5B0Y D;  3LJA C;  1M19 B;  5CPK B;  2JE5 A;  3AV1 B;  5B24 D;  5B2J B;  1ID3 A;  5AVC B;  3O62 C;  3UTA A;  5E5A C;  5B40 C;  1M19 A;  3AZG C;  4LD9 D;  2Y2I A;  2ARO C;  3WAA B;  4QLC A;  4J8U C;  5AY8 A;  5CPK A;  5AV9 C;  1F66 B;  3C1B B;  5B31 B;  3AZN A;  3REL A;  4H9P A;  4X23 B;  1P3L C;  2DF4 C;  3X1V B;  1P3G A;  2NQB C;  4YM6 A;  3EG5 B;  3WAA A;  3B0D B;  1TZY B;  1F66 A;  3KSY A;  3AFA A;  3AV1 C;  5AVC C;  3AZF B;  4CSR B;  3R45 B;  1EQZ D;  3REI D;  4J8X A;  4Z5T B;  3LJA D;  3C1B C;  5G49 B;  4J8V B;  3REJ B;  3X1T B;  5DNN B;  2G5H C;  3KWQ C;  2YFV A;  3A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...