4J8VA

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8vA00
4Z66A 3RELD 5E5AD 2F8NB 3AN2C 1TZYC 3W97A 3B6GC 5GXQC 3WTPE 3KWQD 4J8XB 2F8NK 2CV5D 4WU8D 5B1MB 3WTPA 3A6NA 4CAYA 5B31A 5B0YD 5CPIB 3MGSB 3AZIA 3AV2D 5AV5C 5CPKD 5GT3C 3X1TB 4XUJB 3KSYA 5KDMA 4J8XC 3B6FC 3NQJA 3VH6A 3O62D 3AZHB 4KHAB 1S32C 1P3GA 3AYWB 1ID3D 5B2JD 5AVBB 4H9QB 3TU4D 3MGSC 3AZKB 1P3AD 5BT1D 4NE6A 5CPJD 1U35B 3AZEB 1P3MD 2FJ7C 4H9OB 1P3KB 1H3OB 5DNMB 3UTBC 3AZHC 2PYOD 3VH6W 1P3BA 2AROA 1KU5A 4UUZA 5B32D 1M19C 1M18D 5AVCA 3AZNA 3X1TA 4XUJA 4ZBJB 4EO5C 3X1SB 3AFAB 2NZDC 1U35C 5B40D 5GT0C 4KHAA 3AZEC 3REJD 1B6WA 3AYWA 3WA9A 1M1AC 4H9QA 4X23D 4Z66D 1KX3B 3C1CD 3UT9B 4KUDB 1P3OC 4H9OA 3X1SC 1P3KA 3W99C 1P34D 1JFIA 5DNMA 1P3FD 4AWLB 3LELD 4LD9B 4YM6D 3AZJC 1KX4D 3MNNA 3AFAA 5CP6B 3REKC 5FUGB 3AZID 3UT9C 3X1VB 4KUDC 1WWSA 4WNNB 5AV8D 1EQZA 1KX3A 3WAAD 4LD9C 1ULYA 5BNVB 4QLCB 1P3GD 4H9NB 2IO5C 3AV1D 5CP6C 1KX5B 3X1VC 2CV5B 2HIOD 3AZGB 4J8WB 5AY8D 4G92B 5B1LB 5E5AC 5B0YB 3REHA 2NQBD 4ZUXA 1N1JB 3B0BA 5CPKB 3KUYB 3AZND 5B2IA 3LZ1B 4WNNA 1P3IA 4H9RA 2F8NH 3KWQC 1KX5C 3AZLB 2CV5C 4YS3D 4WU8C 1F66D 3B0DB 4QLCA 4G92C 5B2JB 3WA9D 5B0YC 5B0ZD 4XZQB 5JRGA 3AV2C 3MGPA 3AZGA 5CPKC 5CPJB 5GSUB 4J8WA 1P3LB 5G49A 4WU9A 4KGCA 3B0CW 3AZLC 4JJNB 3UTAB 1HQ3D 3AZFA 1AOIB 5B1LA 3O62C 4J8UB 1N1JA 3KUYA 1ID3C 3MGRA 5B2JC 2RVQD 3LZ1A 3AN2B 1TZYB 1BH8B 4XZQC 3MNND 4Z5TA 3W98D 1P3AC 5GXQB 4DRAA 5BT1C 5CPJC 1P3LC 4Z2MG 3X1UA 3REID 1P3MC 5DNND 1AOIC 3LJAA 1EQZD 1B67A 2LY8A 4X23B 3C1BA 2PYOC 5B32C 3AZMA 1M18C 5B33B 5AV5B 3UTAA 3W96A 5GT3B 4J8UA 1P3FB 3B6FB 3KXBD 3LELB 3REJC 4M6BA 3R45A 3AN2A 1TZYA 1BH8A 4E45A 4X23C 1S32B 1KX4B 3B6GA 4E44A 5AV9A 3V9RA 3C1CC 1TAFB 2BYMA 4ZUXD 3MGQD 5B33C 1P3PD 1P34C 1P3FC 2FJ7B 4Z2MH 4J8VB 3LELC 4YM6C 2F8NA 3WAAB 3UTBB 1M19B 1KX4C 3AV1B 5GT3A 5JRGD 3VH5T 3MGPD 4J8XA 1BFMA 4EO5B 2NZDB 5B24D 5AY8B 5AV8C 5B1MA 5AV6D 4WU9D 1ZLAB 5GT0B 3WKJB 3LZ0B 3MVDB 4J8VC 2NQBB 3WAAC 1TAFA 1M1AB 5CPIA 3MGSA 5F99D 1P3GC 3AV1C 4Z5TD 2HIOC 1P3OB 4YS3B 2FJ7A 3W99B 5AY8C 1ZLAC 4R8PD 3AZHA 3WKJC 4H9SC 3LJAD 3LZ0C 3MVDC 4H9PB 5B0ZB 5AVBA 2NQBC 3C1BD 3AZJB 5B32G 2NZDA 3AZMD 3AZKA 1U35A 2HUEC 3REKB 5GT0A 3W97D 1Q9CA 3AZEA 4YS3C 4WV4B 1H3OA 1M1AA 1F66C 3VH5A 2CWEA 2YFWB 3WTPD 3A6ND 5CHLB 5B0ZC 5B31D 5AV9D 1P3OA 3W98B 2IO5B 3X1SA 3W99A 5DNNB 5BNXB 1HQ3C 1WWIA 3NQUB 3AZJA 3RELB 5E5AB 3REKA 5B31G 3UT9A 4KUDA 3W98C 4WZSB 3KWQB 3REIC 5DNNC 4WU8B 2YFWA 5B1MD 1EQZC 4LD9A 2L5AA 3RELC 5CP6A 3X1VA 5FUGA 3AV2B 5CPID 1P3BD 2AROD 5AVCD 3X1TD 4XUJD 3NQUA 3KXBC 1A7WA 3O62B 5E5AA 2YFVB 5BNVA 4H9NA 3AYWD 1ID3B 5AVBD 3KWQA 3TU4B 1KX5A 3MGQC 2CV5A 5B24B 3AZKD 1P3AB 1U35D 1P3PC 4WU8A 3AZED 1P3MB 4NFTA 1P3KD 5C3IB 5B0YA 5DNMD 3AV2A 2PYOB 5CPKA 5B32B 1M18B 5JRGC 3MGPC 3TU4C 3AZLA 3AFAD 5B24C 5BS7C 3O62A 5B40B 5AV6C 5JA4B 3REJB 1ID3A 5B2JA 5C3IC 4XZQA 4Z66B 5F99C 1HTAA 1P3AA 5CPJA 5GSUA 1KX3D 3C1CB 1P3LA 1P3MA 4JJNA 1AOIA 1P34B 5B40C 4R8PC 2PYOA 3A6NB 5B32A 4YM6B 1M18A 3VH6T 5B31B 4Z66C 3REHD 5GXQA 3AZIB 5JA4A 3W97C 3REJA 5B2ID 5AV8B 5BO0B 1P3ID 3NQJB 4X23A 3WTPC 3A6NC 3C1CA 5B33A 4QLCD 5B31C 5AV5A 5AV9C 1P3GB 1P34A 1KX5D 3AZIC 1P3FA 2HIOB 3AZGD 3B6FA 4J8WD 3LELA 4YM6A 4KGCD 3AZFD 1KX4A 1S32A 5B1LD 1BH9B 1P3BB 2AROB 4UUZB 3KUYD 2HUEB 5AVCB 3MGRD 3LZ1D 5BO0A 5AV8A 3AZNB 3AZLD 4J8VA 5B1MC 1F66B 3WAAA 3X1UD 3UTBA 1M19A 3AV1A 3WA9B 5CPIC 4XZQD 2HIOA 1P3BC 2AROC 5GSUD 1P3LD 5AVCC 5AY8A 3AZNC 3X1TC 1ZLAA 4NE3A 3WKJA 4XUJC 4H9SA 4JJND 3UTAD 1HQ3B 1AOID 3W96D 3LZ0A 4DRBA 3MVDA 1JFIB 4J8UD 2NQBA 1BH9A 3AYWC 3AN2D 1TZYD 5AVBC 3WA9C 3MNNB 3B6GD 3AZKC 4YS3A 5GXQD 1R4VA 1F66A 3REIB 1P3KC 1EQZB 4H9PA 5DNMC 5B0ZA 2F8ND 2RVQC 5B33D 3VH5W 5AV5D 4ZBJC 3MNNC 3AFAC 1HQ3A 5GT3D 3B0CT 4J8XD 3B6FD 2BYKB 3KXBB 1S32D 2F8NG 2JSSA 3W98A 3REHB 1KX3C 4ZUXB 3MGSD 3MGQB 3REIA 5DNNA 5BNXA 1P3PB 5B2IB 1P3IB 4H9RB 2FJ7D 4AWLC 4J8VD 3RELA 3UTBD 3AZHD 4G91B 4CSRB 4NE5A 1M19D 4HGAB 3REHC 5JRGB 3MGPB 4ZUXC 2NZDD 2BYKA 3KXBA 5B2IC 5G49B 1P3IC 5AV6B 4WU9B 1ZLAD 5GT0D 3WKJD 4KGCB 3AZFB 3LZ0D 3MVDD 1M1AD 3MGQA 4G91C 5F99B 4QLCC 3MGRB 1P3PA 4HGAC 4Z5TB 1P3OD 3AZGC 3X1SD 4J8WC 3W99D 3X1UB 4R8PB 4WU9C 4KGCC 2YFVA 4CSRA 1F1EA 3AZFC 3LJAB 5B1LC 3C1BB 3TU4A 3AZJD 5B24A 3AZMB 5BS7A 3KUYC 3MGRC 3REKD 3LZ1C 3UT9D 5AV6A 4KUDD 3W97B 4Z5TC 3W96B 3B0DC 3X1UC 5F99A 3R45B 3WTPB 3LJAC 4LD9D 4CAYB 3C1BC 3B6GB 5AV9B 3V9RB 5GSUC 5CP6D 2BYMB 3AZMC 3X1VD 5B40A 4R8PA 4JJNC 3UTAC 3W96C 4J8UC 5KDMB
chains in the Genus database with same CATH superfamily
2XD5A 4Z66A 3RELD 5E5AD 2F8NB 3AN2C 1TZYC 3W97A 3B6GC 5GXQC 3WTPE 3KWQD 4J8XB 2F8NK 2CV5D 4WU8D 5B1MB 3WTPA 3A6NA 4CAYA 5B31A 5B0YD 5CPIB 3MGSB 3AZIA 3AV2D 5AV5C 5CPKD 5GT3C 3X1TB 4XUJB 3KSYA 5KDMA 4J8XC 3B6FC 3NQJA 3VH6A 3O62D 3AZHB 4KHAB 1S32C 1P3GA 3AYWB 1ID3D 5B2JD 5AVBB 3A1IA 4H9QB 3TU4D 3MGSC 3AZKB 1P3AD 5BT1D 4NE6A 5CPJD 1U35B 3P5JB 3AZEB 1P3MD 2FJ7C 4H9OB 1P3KB 2JCHA 1H3OB 5DNMB 3UTBC 3AZHC 2PYOD 3VH6W 1P3BA 2AROA 1KU5A 4UUZA 5B32D 1M19C 1M18D 5AVCA 3AZNA 3X1TA 2DF4C 4XUJA 2XD1A 4ZBJB 4EO5C 3X1SB 3AFAB 2NZDC 1U35C 3EPHA 5B40D 5GT0C 4KHAA 3AZEC 3REJD 1B6WA 3AYWA 3WA9A 1M1AC 4H9QA 4X23D 4Z66D 3EPKA 1KX3B 3C1CD 3UT9B 4KUDB 1P3OC 4H9OA 3X1SC 1P3KA 3W99C 1P34D 1JFIA 5DNMA 1P3FD 4AWLB 3LELD 4LD9B 4YM6D 3AZJC 1KX4D 3MNNA 3AFAA 5CP6B 1T3UA 3REKC 2F2AC 5FUGB 3UT9C 3AZID 3X1VB 4KUDC 1WWSA 4WNNB 5AV8D 1EQZA 3EG5B 1KX3A 3WAAD 4LD9C 2W8SA 1ULYA 5BNVB 4QLCB 1P3GD 4H9NB 2IO5C 3AV1D 5CP6C 1KX5B 2UWXA 3X1VC 2CV5B 2HIOD 3AZGB 4J8WB 2Y2NA 5AY8D 4G92B 5B1LB 5E5AC 5B0YB 3REHA 2J8PA 2NQBD 4ZUXA 1N1JB 3B0BA 5CPKB 3KUYB 3AZND 5B2IA 3LZ1B 4WNNA 1P3IA 4H9RA 2F8NH 3KWQC 1KX5C 3AZLB 2CV5C 4YS3D 4WU8C 2FFFB 1F66D 3B0DB 4QLCA 4G92C 5B2JB 3WA9D 5B0YC 5B0ZD 4XZQB 5JRGA 3AV2C 3MGPA 3AZGA 5CPKC 5CPJB 5GSUB 4J8WA 1P3LB 5G49A 4WU9A 4KGCA 3B0CW 3AZLC 4JJNB 3UTAB 1HQ3D 3AZFA 1AOIB 5B1LA 3O62C 2Y2PA 4J8UB 1N1JA 3F6TA 3FDDA 3KUYA 3MGRA 5B2JC 2RVQD 3LZ1A 1Z2CB 1TZYB 3AN2B 1ID3C 1BH8B 4XZQC 3MNND 4Z5TA 3W98D 1P3AC 5GXQB 4DRAA 5BT1C 5CPJC 1P3LC 4Z2MG 3X1UA 3REID 1P3MC 5DNND 1AOIC 3LJAA 1EQZD 1B67A 2LY8A 4X23B 3C1BA 2PYOC 3H0MC 5B32C 3AZMA 1M18C 5B33B 2ZY3A 5AV5B 3UTAA 3W96A 5GT3B 4J8UA 1P3FB 3B6FB 3KXBD 3LELB 3REJC 4M6BA 3R45A 3AN2A 1TZYA 1BH8A 3AL0C 4E45A 4X23C 1S32B 1KX4B 3B6GA 4E44A 5AV9A 3V9RA 3C1CC 1TAFB 2BYMA 4ZUXD 3MGQD 5B33C 1P3PD 1P34C 2VQRA 1P3FC 2FJ7B 4Z2MH 4J8VB 3LELC 4YM6C 2F8NA 3WAAB 3UTBB 1M19B 1KX4C 3AV1B 5GT3A 5JRGD 3VH5T 3MGPD 4J8XA 1BFMA 4EO5B 2NZDB 5B24D 5AY8B 5AV8C 5B1MA 5AV6D 4WU9D 1ZLAB 5GT0B 3WKJB 3LZ0B 3MVDB 4J8VC 2NQBB 3WAAC 1TAFA 1M1AB 5CPIA 3MGSA 5F99D 1P3GC 2BG1A 3AV1C 4Z5TD 2HIOC 1P3OB 4YS3B 2FJ7A 3W99B 5AY8C 1ZLAC 4R8PD 3AZHA 3WKJC 4H9SC 3LJAD 3LZ0C 3MVDC 4H9PB 5B0ZB 5AVBA 2NQBC 3C1BD 3AZJB 5B32G 2NZDA 3AZMD 3AZKA 1U35A 2HUEC 3REKB 2JE5A 5GT0A 3W97D 1Q9CA 3AZEA 4YS3C 4WV4B 1H3OA 1M1AA 1F66C 3VH5A 2CWEA 2YFWB 3WTPD 3A6ND 5CHLB 5B0ZC 5B31D 5AV9D 1P3OA 3W98B 2IO5B 3X1SA 3W99A 5DNNB 5BNXB 1HQ3C 2Y2KA 1WWIA 3NQUB 3AZJA 3RELB 5E5AB 3REKA 5B31G 3UT9A 4KUDA 3W98C 4WZSB 3KWQB 3REIC 5DNNC 4WU8B 2YFWA 5B1MD 1EQZC 4LD9A 2L5AA 3RELC 5CP6A 3X1VA 5FUGA 3AV2B 5CPID 3EPLA 1P3BD 2AROD 5AVCD 3X1TD 4XUJD 3NQUA 3KXBC 1A7WA 3O62B 5E5AA 2YFVB 4UPKA 5BNVA 2ZY5A 4H9NA 3AYWD 1ID3B 5AVBD 3KWQA 3TU4B 1KX5A 3MGQC 2CV5A 5B24B 3AZKD 1P3AB 1U35D 1P3PC 4WU8A 2Y2MA 3AZED 1P3MB 4NFTA 1P3KD 5C3IB 5B0YA 5DNMD 2Y2HA 3AV2A 2PYOB 5CPKA 5B32B 1M18B 5JRGC 2Y2LA 3MGPC 3TU4C 3AZLA 3AFAD 5B24C 5BS7C 3O62A 5B40B 5AV6C 5JA4B 3REJB 1ID3A 5B2JA 5C3IC 4XZQA 4Z66B 5F99C 1HTAA 1P3AA 5CPJA 5GSUA 1KX3D 3C1CB 1P3LA 3EPJA 1P3MA 4JJNA 1AOIA 1P34B 5B40C 4R8PC 2PYOA 3A6NB 5B32A 4YM6B 1M18A 3VH6T 5B31B 4Z66C 3REHD 5GXQA 3AZIB 5JA4A 3W97C 3REJA 5B2ID 2ZY2A 5AV8B 5BO0B 1P3ID 3NQJB 4X23A 3WTPC 3A6NC 3C1CA 5B33A 4QLCD 5B31C 5AV5A 2Y2OA 5AV9C 1P3GB 1P34A 1KX5D 1PZRA 3AZIC 1P3FA 2HIOB 3AZGD 3B6FA 4J8WD 3LELA 4YM6A 4KGCD 3AZFD 2Y2JA 1KX4A 1S32A 5B1LD 1BH9B 1P3BB 2AROB 4UUZB 3KUYD 2HUEB 5AVCB 3MGRD 3LZ1D 5BO0A 5AV8A 3AZNB 3AZLD 4J8VA 2DQNC 5B1MC 1F66B 3WAAA 3X1UD 3UTBA 1M19A 3AV1A 3WA9B 5CPIC 4XZQD 2HIOA 1P3BC 2AROC 5GSUD 1P3LD 5AVCC 5AY8A 3AZNC 3X1TC 1ZLAA 4NE3A 3WKJA 4XUJC 4H9SA 4JJND 3UTAD 1HQ3B 1AOID 3W96D 3LZ0A 4DRBA 1W2EA 3MVDA 1JFIB 4J8UD 2NQBA 1BH9A 2Y2QA 3H0LC 3AYWC 3AN2D 1TZYD 5AVBC 3WA9C 3MNNB 3B6GD 3AZKC 4YS3A 5GXQD 1R4VA 1F66A 3REIB 4DQYB 1P3KC 1EQZB 4H9PA 2Y2IA 5DNMC 5B0ZA 2G5HC 2F8ND 2RVQC 5B33D 3VH5W 5AV5D 4ZBJC 3MNNC 3AFAC 1HQ3A 5GT3D 3B0CT 4J8XD 3B6FD 2BYKB 3KXBB 1S32D 2F8NG 2JSSA 3W98A 3REHB 2Y2GA 1KX3C 4ZUXB 3MGSD 3MGQB 3REIA 5DNNA 5BNXA 1P3PB 5B2IB 1P3IB 4H9RB 2FJ7D 4AWLC 4J8VD 3RELA 3UTBD 3AZHD 4G91B 4CSRB 4NE5A 1M19D 4HGAB 3REHC 5JRGB 3MGPB 4ZUXC 2NZDD 2BYKA 3KXBA 5B2IC 5G49B 1P3IC 5AV6B 4WU9B 1ZLAD 5GT0D 3WKJD 4KGCB 3AZFB 3LZ0D 3MVDD 1M1AD 3MGQA 4G91C 5F99B 4QLCC 3MGRB 1P3PA 2G5IC 4HGAC 4Z5TB 1P3OD 3AZGC 3X1SD 4J8WC 3W99D 3X1UB 4R8PB 4WU9C 4KGCC 2YFVA 4CSRA 1F1EA 3AZFC 3LJAB 2ZY4A 3A1KA 5B1LC 3IP4C 3H0RC 3C1BB 3TU4A 3AZJD 5B24A 3AZMB 5BS7A 3KUYC 3MGRC 3REKD 3LZ1C 2RIQA 3UT9D 5AV6A 4KUDD 3W97B 4Z5TC 3W96B 3KFUG 3B0DC 3X1UC 5F99A 3R45B 3WTPB 3LJAC 4LD9D 4CAYB 4WJ3C 2ZM5A 3C1BC 3B6GB 5AV9B 3V9RB 5GSUC 5CP6D 2BYMB 3AZMC 3X1VD 5B40A 4R8PA 4JJNC 3UTAC 3W96C 4J8UC 5KDMB
chains in the Genus database with same CATH topology
2XD5A 4Z66A 3RELD 5E5AD 2F8NB 3AN2C 1TZYC 3W97A 3B6GC 5GXQC 3WTPE 3KWQD 4J8XB 2F8NK 2CV5D 4WU8D 5B1MB 3WTPA 3A6NA 4CAYA 5B31A 5B0YD 5CPIB 3MGSB 3AZIA 3AV2D 5AV5C 5CPKD 5GT3C 3X1TB 4XUJB 3KSYA 5KDMA 4J8XC 3B6FC 3NQJA 3VH6A 3O62D 3AZHB 4KHAB 1S32C 1P3GA 3AYWB 1ID3D 5B2JD 5AVBB 3A1IA 4H9QB 3TU4D 3MGSC 3AZKB 1P3AD 5BT1D 4NE6A 5CPJD 1U35B 3P5JB 3AZEB 1P3MD 2FJ7C 4H9OB 1P3KB 2JCHA 1H3OB 5DNMB 3UTBC 3AZHC 2PYOD 3VH6W 1P3BA 2AROA 1KU5A 4UUZA 5B32D 1M19C 1M18D 5AVCA 3AZNA 3X1TA 2DF4C 4XUJA 2XD1A 4ZBJB 4EO5C 3X1SB 3AFAB 2NZDC 1U35C 3EPHA 5B40D 5GT0C 4KHAA 3AZEC 3REJD 1B6WA 3AYWA 3WA9A 1M1AC 4H9QA 4X23D 4Z66D 3EPKA 1KX3B 3C1CD 3UT9B 4KUDB 1P3OC 4H9OA 3X1SC 1P3KA 3W99C 1P34D 1JFIA 5DNMA 1P3FD 4AWLB 3LELD 4LD9B 4YM6D 3AZJC 1KX4D 3MNNA 3AFAA 5CP6B 1T3UA 3REKC 2F2AC 5FUGB 3UT9C 3AZID 3X1VB 4KUDC 1WWSA 4WNNB 5AV8D 1EQZA 3EG5B 1KX3A 3WAAD 4LD9C 2W8SA 1ULYA 5BNVB 4QLCB 1P3GD 4H9NB 2IO5C 3AV1D 5CP6C 1KX5B 2UWXA 3X1VC 2CV5B 2HIOD 3AZGB 4J8WB 2Y2NA 5AY8D 4G92B 5B1LB 5E5AC 5B0YB 3REHA 2J8PA 2NQBD 4ZUXA 1N1JB 3B0BA 5CPKB 3KUYB 3AZND 5B2IA 3LZ1B 4WNNA 1P3IA 4H9RA 2F8NH 3KWQC 1KX5C 3AZLB 2CV5C 4YS3D 4WU8C 2FFFB 1F66D 3B0DB 4QLCA 4G92C 5B2JB 3WA9D 5B0YC 5B0ZD 4XZQB 5JRGA 3AV2C 3MGPA 3AZGA 5CPKC 5CPJB 5GSUB 4J8WA 1P3LB 5G49A 4WU9A 4KGCA 3B0CW 3AZLC 4JJNB 3UTAB 1HQ3D 3AZFA 1AOIB 5B1LA 3O62C 2Y2PA 4J8UB 1N1JA 3F6TA 3FDDA 3KUYA 3MGRA 5B2JC 2RVQD 3LZ1A 1Z2CB 1TZYB 3AN2B 1ID3C 1BH8B 4XZQC 3MNND 4Z5TA 3W98D 1P3AC 5GXQB 4DRAA 5BT1C 5CPJC 1P3LC 4Z2MG 3X1UA 3REID 1P3MC 5DNND 1AOIC 3LJAA 1EQZD 1B67A 2LY8A 4X23B 3C1BA 2PYOC 3H0MC 5B32C 3AZMA 1M18C 5B33B 2ZY3A 5AV5B 3UTAA 3W96A 5GT3B 4J8UA 1P3FB 3B6FB 3KXBD 3LELB 3REJC 4M6BA 3R45A 3AN2A 1TZYA 1BH8A 3AL0C 4E45A 4X23C 1S32B 1KX4B 3B6GA 4E44A 5AV9A 3V9RA 3C1CC 1TAFB 2BYMA 4ZUXD 3MGQD 5B33C 1P3PD 1P34C 2VQRA 1P3FC 2FJ7B 4Z2MH 4J8VB 3LELC 4YM6C 2F8NA 3WAAB 3UTBB 1M19B 1KX4C 3AV1B 5GT3A 5JRGD 3VH5T 3MGPD 4J8XA 1BFMA 4EO5B 2NZDB 5B24D 5AY8B 5AV8C 5B1MA 5AV6D 4WU9D 1ZLAB 5GT0B 3WKJB 3LZ0B 3MVDB 4J8VC 2NQBB 3WAAC 1TAFA 1M1AB 5CPIA 3MGSA 5F99D 1P3GC 2BG1A 3AV1C 4Z5TD 2HIOC 1P3OB 4YS3B 2FJ7A 3W99B 5AY8C 1ZLAC 4R8PD 3AZHA 3WKJC 4H9SC 3LJAD 3LZ0C 3MVDC 4H9PB 5B0ZB 5AVBA 2NQBC 3C1BD 3AZJB 5B32G 2NZDA 3AZMD 3AZKA 1U35A 2HUEC 3REKB 2JE5A 5GT0A 3W97D 1Q9CA 3AZEA 4YS3C 4WV4B 1H3OA 1M1AA 1F66C 3VH5A 2CWEA 2YFWB 3WTPD 3A6ND 5CHLB 5B0ZC 5B31D 5AV9D 1P3OA 3W98B 2IO5B 3X1SA 3W99A 5DNNB 5BNXB 1HQ3C 2Y2KA 1WWIA 3NQUB 3AZJA 3RELB 5E5AB 3REKA 5B31G 3UT9A 4KUDA 3W98C 4WZSB 3KWQB 3REIC 5DNNC 4WU8B 2YFWA 5B1MD 1EQZC 4LD9A 2L5AA 3RELC 5CP6A 3X1VA 5FUGA 3AV2B 5CPID 3EPLA 1P3BD 2AROD 5AVCD 3X1TD 4XUJD 3NQUA 3KXBC 1A7WA 3O62B 5E5AA 2YFVB 4UPKA 5BNVA 2ZY5A 4H9NA 3AYWD 1ID3B 5AVBD 3KWQA 3TU4B 1KX5A 3MGQC 2CV5A 5B24B 3AZKD 1P3AB 1U35D 1P3PC 4WU8A 2Y2MA 3AZED 1P3MB 4NFTA 1P3KD 5C3IB 5B0YA 5DNMD 2Y2HA 3AV2A 2PYOB 5CPKA 5B32B 1M18B 5JRGC 2Y2LA 3MGPC 3TU4C 3AZLA 3AFAD 5B24C 5BS7C 3O62A 5B40B 5AV6C 5JA4B 3REJB 1ID3A 5B2JA 5C3IC 4XZQA 4Z66B 5F99C 1HTAA 1P3AA 5CPJA 5GSUA 1KX3D 3C1CB 1P3LA 3EPJA 1P3MA 4JJNA 1AOIA 1P34B 5B40C 4R8PC 2PYOA 3A6NB 5B32A 4YM6B 1M18A 3VH6T 5B31B 4Z66C 3REHD 5GXQA 3AZIB 5JA4A 3W97C 3REJA 5B2ID 2ZY2A 5AV8B 5BO0B 1P3ID 3NQJB 4X23A 3WTPC 3A6NC 3C1CA 5B33A 4QLCD 5B31C 5AV5A 2Y2OA 5AV9C 1P3GB 1P34A 1KX5D 1PZRA 3AZIC 1P3FA 2HIOB 3AZGD 3B6FA 4J8WD 3LELA 4YM6A 4KGCD 3AZFD 2Y2JA 1KX4A 1S32A 5B1LD 1BH9B 1P3BB 2AROB 4UUZB 3KUYD 2HUEB 5AVCB 3MGRD 3LZ1D 5BO0A 5AV8A 3AZNB 3AZLD 4J8VA 2DQNC 5B1MC 1F66B 3WAAA 3X1UD 3UTBA 1M19A 3AV1A 3WA9B 5CPIC 4XZQD 2HIOA 1P3BC 2AROC 5GSUD 1P3LD 5AVCC 5AY8A 3AZNC 3X1TC 1ZLAA 4NE3A 3WKJA 4XUJC 4H9SA 4JJND 3UTAD 1HQ3B 1AOID 3W96D 3LZ0A 4DRBA 1W2EA 3MVDA 1JFIB 4J8UD 2NQBA 1BH9A 2Y2QA 3H0LC 3AYWC 3AN2D 1TZYD 5AVBC 3WA9C 3MNNB 3B6GD 3AZKC 4YS3A 5GXQD 1R4VA 1F66A 3REIB 4DQYB 1P3KC 1EQZB 4H9PA 2Y2IA 5DNMC 5B0ZA 2G5HC 2F8ND 2RVQC 5B33D 3VH5W 5AV5D 4ZBJC 3MNNC 3AFAC 1HQ3A 5GT3D 3B0CT 4J8XD 3B6FD 2BYKB 3KXBB 1S32D 2F8NG 2JSSA 3W98A 3REHB 2Y2GA 1KX3C 4ZUXB 3MGSD 3MGQB 3REIA 5DNNA 5BNXA 1P3PB 5B2IB 1P3IB 4H9RB 2FJ7D 4AWLC 4J8VD 3RELA 3UTBD 3AZHD 4G91B 4CSRB 4NE5A 1M19D 4HGAB 3REHC 5JRGB 3MGPB 4ZUXC 2NZDD 2BYKA 3KXBA 5B2IC 5G49B 1P3IC 5AV6B 4WU9B 1ZLAD 5GT0D 3WKJD 4KGCB 3AZFB 3LZ0D 3MVDD 1M1AD 3MGQA 4G91C 5F99B 4QLCC 3MGRB 1P3PA 2G5IC 4HGAC 4Z5TB 1P3OD 3AZGC 3X1SD 4J8WC 3W99D 3X1UB 4R8PB 4WU9C 4KGCC 2YFVA 4CSRA 1F1EA 3AZFC 3LJAB 2ZY4A 3A1KA 5B1LC 3IP4C 3H0RC 3C1BB 3TU4A 3AZJD 5B24A 3AZMB 5BS7A 3KUYC 3MGRC 3REKD 3LZ1C 2RIQA 3UT9D 5AV6A 4KUDD 3W97B 4Z5TC 3W96B 3KFUG 3B0DC 3X1UC 5F99A 3R45B 3WTPB 3LJAC 4LD9D 4CAYB 4WJ3C 2ZM5A 3C1BC 3B6GB 5AV9B 3V9RB 5GSUC 5CP6D 2BYMB 3AZMC 3X1VD 5B40A 4R8PA 4JJNC 3UTAC 3W96C 4J8UC 5KDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 A;  3REL D;  5E5A D;  2F8N B;  3AN2 C;  1TZY C;  3W97 A;  3B6G C;  5GXQ C;  3WTP E;  3KWQ D;  4J8X B;  2F8N K;  2CV5 D;  4WU8 D;  5B1M B;  3WTP A;  3A6N A;  4CAY A;  5B31 A;  5B0Y D;  5CPI B;  3MGS B;  3AZI A;  3AV2 D;  5AV5 C;  5CPK D;  5GT3 C;  3X1T B;  4XUJ B;  3KSY A;  5KDM A;  4J8X C;  3B6F C;  3NQJ A;  3VH6 A;  3O62 D;  3AZH B;  4KHA B;  1S32 C;  1P3G A;  3AYW B;  1ID3 D;  5B2J D;  5AVB B;  4H9Q B;  3TU4 D;  3MGS C;  3AZK B;  1P3A D;  5BT1 D;  4NE6 A;  5CPJ D;  1U35 B;  3AZE B;  1P3M D;  2FJ7 C;  4H9O B;  1P3K B;  1H3O B;  5DNM B;  3UTB C;  3AZH C;  2PYO D;  3VH6 W;  1P3B A;  2ARO A;  1KU5 A;  4UUZ A;  5B32 D;  1M19 C;  1M18 D;  5AVC A;  3AZN A;  3X1T A;  4XUJ A;  4ZBJ B;  4EO5 C;  3X1S B;  3AFA B;  2NZD C;  1U35 C;  5B40 D;  5GT0 C;  4KHA A;  3AZE C;  3REJ D;  1B6W A;  3AYW A;  3WA9 A;  1M1A C;  4H9Q A;  4X23 D;  4Z66 D;  1KX3 B;  3C1C D;  3UT9 B;  4KUD B;  1P3O C;  4H9O A;  3X1S C;  1P3K A;  3W99 C;  1P34 D;  1JFI A;  5DNM A;  1P3F D;  4AWL B;  3LEL D;  4LD9 B;  4YM6 D;  3AZJ C;  1KX4 D;  3MNN A;  3AFA A;  5CP6 B;  3REK C;  5FUG B;  3AZI D;  3UT9 C;  3X1V B;  4KUD C;  1WWS A;  4WNN B;  5AV8 D;  1EQZ A;  1KX3 A;  3WAA D;  4LD9 C;  1ULY A;  5BNV B;  4QLC B;  1P3G D;  4H9N B;  2IO5 C;  3AV1 D;  5CP6 C;  1KX5 B;  3X1V C;  2CV5 B;  2HIO D;  3AZG B;  4J8W B;  5AY8 D;  4G92 B;  5B1L B;  5E5A C;  5B0Y B;  3REH A;  2NQB D;  4ZUX A;  1N1J B;  3B0B A;  5CPK B;  3KUY B;  3AZN D;  5B2I A;  3LZ1 B;  4WNN A;  1P3I A;  4H9R A;  2F8N H;  3KWQ C;  1KX5 C;  3AZL B;  2CV5 C;  4YS3 D;  4WU8 C;  1F66 D;  3B0D B;  4QLC A;  4G92 C;  5B2J B;  3WA9 D;  5B0Y C;  5B0Z D;  4XZQ B;  5JRG A;  3AV2 C;  3MGP A;  3AZG A;  5CPK C;  5CPJ B;  5GSU B;  4J8W A;  1P3L B;  5G49 A;  4WU9 A;  4KGC A;  3B0C W;  3AZL C;  4JJN B;  3UTA B;  1HQ3 D;  3AZF A;  1AOI B;  5B1L A;  3O62 C;  4J8U B;  1N1J A;  3KUY A;  1ID3 C;  3MGR A;  5B2J C;  2RVQ D;  3LZ1 A;  3AN2 B;  1TZY B;  1BH8 B;  4XZQ C;  3MNN D;  4Z5T A;  3W98 D;  1P3A C;  5GXQ B;  4DRA A;  5BT1 C;  5CPJ C;  1P3L C;  4Z2M G;  3X1U A;  3REI D;  1P3M C;  5DNN D;  1AOI C;  3LJA A;  1EQZ D;  1B67 A;  2LY8 A;  4X23 B;  3C1B A;  2PYO C;  5B32 C;  3AZM A;  1M18 C;  5B33 B;  5AV5 B;  3UTA A;  3W96 A;  5GT3 B;  4J8U A;  1P3F B;  3B6F B;  3KXB D;  3LEL B;  3REJ C;  4M6B A;  3R45 A;  3AN2 A;  1TZY A;  1BH8 A;  4E45 A;  4X23 C;  1S32 B;  1KX4 B;  3B6G A;  4E44 A;  5AV9 A;  3V9R A;  3C1C C;  1TAF B;  2BYM A;  4ZUX D;  3MGQ D;  5B33 C;  1P3P D;  1P34 C;  1P3F C;  2FJ7 B;  4Z2M H;  4J8V B;  3LEL C;  4YM6 C;  2F8N A;  3WAA B;  3UTB B;  1M19 B;  1KX4 C;  3AV1 B;  5GT3 A;  5JRG D;  3VH5 T;  3MGP D;  4J8X A;  1BFM A;  4EO5 B;  2NZD B;  5B24 D;  5AY8 B;  5AV8 C;  5B1M A;  5AV6 D;  4WU9 D;  1ZLA B;  5GT0 B;  3WKJ B;  3LZ0 B;  3MVD B;  4J8V C;  2NQB B;  3WAA C;  1TAF A;  1M1A B;  5CPI A;  3MGS A;  5F99 D;  1P3G C;  3AV1 C;  4Z5T D;  2HIO C;  1P3O B;  4YS3 B;  2FJ7 A;  3W99 B;  5AY8 C;  1ZLA C;  4R8P D;  3AZH A;  3WKJ C;  4H9S C;  3LJA D;  3LZ0 C;  3MVD C;  4H9P B;  5B0Z B;  5AVB A;  2NQB C;  3C1B D;  3AZJ B;  5B32 G;  2NZD A;  3AZM D;  3AZK A;  1U35 A;  2HUE C;  3REK B;  5GT0 A;  3W97 D;  1Q9C A;  3AZE A;  4YS3 C;  4WV4 B;  1H3O A;  1M1A A;  1F66 C;  3VH5 A;  2CWE A;  2YFW B;  3WTP D;  3A6N D;  5CHL B;  5B0Z C;  5B31 D;  5AV9 D;  1P3O A;  3W98 B;  2IO5 B;  3X1S A;  3W99 A;  5DNN B;  5BNX B;  1HQ3 C;  1WWI A;  3NQU B;  3AZJ A;  3REL B;  5E5A B;  3REK A;  5B31 G;  3UT9 A;  4KUD A;  3W98 C;  4WZS B;  3KWQ B;  3REI C;  5DNN C;  4WU8 B;  2YFW A;  5B1M D;  1EQZ C;  4LD9 A;  2L5A A;  3REL C;  5CP6 A;  3X1V A;  5FUG A;  3AV2 B;  5CPI D;  1P3B D;  2ARO D;  5AVC D;  3X1T D;  4XUJ D;  3NQU A;  3KXB C;  1A7W A;  3O62 B;  5E5A A;  2YFV B;  5BNV A;  4H9N A;  3AYW D;  1ID3 B;  5AVB D;  3KWQ A;  3TU4 B;  1KX5 A;  3MGQ C;  2CV5 A;  5B24 B;  3AZK D;  1P3A B;  1U35 D;  1P3P C;  4WU8 A;  3AZE D;  1P3M B;  4NFT A;  1P3K D;  5C3I B;  5B0Y A;  5DNM D;  3AV2 A;  2PYO B;  5CPK A;  5B32 B;  1M18 B;  5JRG C;  3MGP C;  3TU4 C;  3AZL A;  3AFA D;  5B24 C;  5BS7 C;  3O62 A;  5B40 B;  5AV6 C;  5JA4 B;  3REJ B;  1ID3 A;  5B2J A;  5C3I C;  4XZQ A;  4Z66 B;  5F99 C;  1HTA A;  1P3A A;  5CPJ A;  5GSU A;  1KX3 D;  3C1C B;  1P3L A;  1P3M A;  4JJN A;  1AOI A;  1P34 B;  5B40 C;  4R8P C;  2PYO A;  3A6N B;  5B32 A;  4YM6 B;  1M18 A;  3VH6 T;  5B31 B;  4Z66 C;  3REH D;  5GXQ A;  3AZI B;  5JA4 A;  3W97 C;  3REJ A;  5B2I D;  5AV8 B;  5BO0 B;  1P3I D;  3NQJ B;  4X23 A;  3WTP C;  3A6N C;  3C1C A;  5B33 A;  4QLC D;  5B31 C;  5AV5 A;  5AV9 C;  1P3G B;  1P34 A;  1KX5 D;  3AZI C;  1P3F A;  2HIO B;  3AZG D;  3B6F A;  4J8W D;  3LEL A;  4YM6 A;  4KGC D;  3AZF D;  1KX4 A;  1S32 A;  5B1L D;  1BH9 B;  1P3B B;  2ARO B;  4UUZ B;  3KUY D;  2HUE B;  5AVC B;  3MGR D;  3LZ1 D;  5BO0 A;  5AV8 A;  3AZN B;  3AZL D;  4J8V A;  5B1M C;  1F66 B;  3WAA A;  3X1U D;  3UTB A;  1M19 A;  3AV1 A;  3WA9 B;  5CPI C;  4XZQ D;  2HIO A;  1P3B C;  2ARO C;  5GSU D;  1P3L D;  5AVC C;  5AY8 A;  3AZN C;  3X1T C;  1ZLA A;  4NE3 A;  3WKJ A;  4XUJ C;  4H9S A;  4JJN D;  3UTA D;  1HQ3 B;  1AOI D;  3W96 D;  3LZ0 A;  4DRB A;  3MVD A;  1JFI B;  4J8U D;  2NQB A;  1BH9 A;  3AYW C;  3AN2 D;  1TZY D;  5AVB C;  3WA9 C;  3MNN B;  3B6G D;  3AZK C;  4YS3 A;  5GXQ D;  1R4V A;  1F66 A;  3REI B;  1P3K C;  1EQZ B;  4H9P A;  5DNM C;  5B0Z A;  2F8N D;  2RVQ C;  5B33 D;  3VH5 W;  5AV5 D;  4ZBJ C;  3MNN C;  3AFA C;  1HQ3 A;  5GT3 D;  3B0C T;  4J8X D;  3B6F D;  2BYK B;  3KXB B;  1S32 D;  2F8N G;  2JSS A;  3W98 A;  3REH B;  1KX3 C;  4ZUX B;  3MGS D;  3MGQ B;  3REI A;  5DNN A;  5BNX A;  1P3P B;  5B2I B;  1P3I B;  4H9R B;  2FJ7 D;  4AWL C;  4J8V D;  3REL A;  3UTB D;  3AZH D;  4G91 B;  4CSR B;  4NE5 A;  1M19 D;  4HGA B;  3REH C;  5JRG B;  3MGP B;  4ZUX C;  2NZD D;  2BYK A;  3KXB A;  5B2I C;  5G49 B;  1P3I C;  5AV6 B;  4WU9 B;  1ZLA D;  5GT0 D;  3WKJ D;  4KGC B;  3AZF B;  3LZ0 D;  3MVD D;  1M1A D;  3MGQ A;  4G91 C;  5F99 B;  4QLC C;  3MGR B;  1P3P A;  4HGA C;  4Z5T B;  1P3O D;  3AZG C;  3X1S D;  4J8W C;  3W99 D;  3X1U B;  4R8P B;  4WU9 C;  4KGC C;  2YFV A;  4CSR A;  1F1E A;  3AZF C;  3LJA B;  5B1L C;  3C1B B;  3TU4 A;  3AZJ D;  5B24 A;  3AZM B;  5BS7 A;  3KUY C;  3MGR C;  3REK D;  3LZ1 C;  3UT9 D;  5AV6 A;  4KUD D;  3W97 B;  4Z5T C;  3W96 B;  3B0D C;  3X1U C;  5F99 A;  3R45 B;  3WTP B;  3LJA C;  4LD9 D;  4CAY B;  3C1B C;  3B6G B;  5AV9 B;  3V9R B;  5GSU C;  5CP6 D;  2BYM B;  3AZM C;  3X1V D;  5B40 A;  4R8P A;  4JJN C;  3UTA C;  3W96 C;  4J8U C;  5KDM B; 
#chains in the Genus database with same CATH topology
 2XD5 A;  4Z66 A;  3REL D;  5E5A D;  2F8N B;  3AN2 C;  1TZY C;  3W97 A;  3B6G C;  5GXQ C;  3WTP E;  3KWQ D;  4J8X B;  2F8N K;  2CV5 D;  4WU8 D;  5B1M B;  3WTP A;  3A6N A;  4CAY A;  5B31 A;  5B0Y D;  5CPI B;  3MGS B;  3AZI A;  3AV2 D;  5AV5 C;  5CPK D;  5GT3 C;  3X1T B;  4XUJ B;  3KSY A;  5KDM A;  4J8X C;  3B6F C;  3NQJ A;  3VH6 A;  3O62 D;  3AZH B;  4KHA B;  1S32 C;  1P3G A;  3AYW B;  1ID3 D;  5B2J D;  5AVB B;  3A1I A;  4H9Q B;  3TU4 D;  3MGS C;  3AZK B;  1P3A D;  5BT1 D;  4NE6 A;  5CPJ D;  1U35 B;  3P5J B;  3AZE B;  1P3M D;  2FJ7 C;  4H9O B;  1P3K B;  2JCH A;  1H3O B;  5DNM B;  3UTB C;  3AZH C;  2PYO D;  3VH6 W;  1P3B A;  2ARO A;  1KU5 A;  4UUZ A;  5B32 D;  1M19 C;  1M18 D;  5AVC A;  3AZN A;  3X1T A;  2DF4 C;  4XUJ A;  2XD1 A;  4ZBJ B;  4EO5 C;  3X1S B;  3AFA B;  2NZD C;  1U35 C;  3EPH A;  5B40 D;  5GT0 C;  4KHA A;  3AZE C;  3REJ D;  1B6W A;  3AYW A;  3WA9 A;  1M1A C;  4H9Q A;  4X23 D;  4Z66 D;  3EPK A;  1KX3 B;  3C1C D;  3UT9 B;  4KUD B;  1P3O C;  4H9O A;  3X1S C;  1P3K A;  3W99 C;  1P34 D;  1JFI A;  5DNM A;  1P3F D;  4AWL B;  3LEL D;  4LD9 B;  4YM6 D;  3AZJ C;  1KX4 D;  3MNN A;  3AFA A;  5CP6 B;  1T3U A;  3REK C;  2F2A C;  5FUG B;  3UT9 C;  3AZI D;  3X1V B;  4KUD C;  1WWS A;  4WNN B;  5AV8 D;  1EQZ A;  3EG5 B;  1KX3 A;  3WAA D;  4LD9 C;  2W8S A;  1ULY A;  5BNV B;  4QLC B;  1P3G D;  4H9N B;  2IO5 C;  3AV1 D;  5CP6 C;  1KX5 B;  2UWX A;  3X1V C;  2CV5 B;  2HIO D;  3AZG B;  4J8W B;  2Y2N A;  5AY8 D;  4G92 B;  5B1L B;  5E5A C;  5B0Y B;  3REH A;  2J8P A;  2NQB D;  4ZUX A;  1N1J B;  3B0B A;  5CPK B;  3KUY B;  3AZN D;  5B2I A;  3LZ1 B;  4WNN A;  1P3I A;  4H9R A;  2F8N H;  3KWQ C;  1KX5 C;  3AZL B;  2CV5 C;  4YS3 D;  4WU8 C;  2FFF B;  1F66 D;  3B0D B;  4QLC A;  4G92 C;  5B2J B;  3WA9 D;  5B0Y C;  5B0Z D;  4XZQ B;  5JRG A;  3AV2 C;  3MGP A;  3AZG A;  5CPK C;  5CPJ B;  5GSU B;  4J8W A;  1P3L B;  5G49 A;  4WU9 A;  4KGC A;  3B0C W;  3AZL C;  4JJN B;  3UTA B;  1HQ3 D;  3AZF A;  1AOI B;  5B1L A;  3O62 C;  2Y2P A;  4J8U B;  1N1J A;  3F6T A;  3FDD A;  3KUY A;  3MGR A;  5B2J C;  2RVQ D;  3LZ1 A;  1Z2C B;  1TZY B;  3AN2 B;  1ID3 C;  1BH8 B;  4XZQ C;  3MNN D;  4Z5T A;  3W98 D;  1P3A C;  5GXQ B;  4DRA A;  5BT1 C;  5CPJ C;  1P3L C;  4Z2M G;  3X1U A;  3REI D;  1P3M C;  5DNN D;  1AOI C;  3LJA A;  1EQZ D;  1B67 A;  2LY8 A;  4X23 B;  3C1B A;  2PYO C;  3H0M C;  5B32 C;  3AZM A;  1M18 C;  5B33 B;  2ZY3 A;  5AV5 B;  3UTA A;  3W96 A;  5GT3 B;  4J8U A;  1P3F B;  3B6F B;  3KXB D;  3LEL B;  3REJ C;  4M6B A;  3R45 A;  3AN2 A;  1TZY A;  1BH8 A;  3AL0 C;  4E45 A;  4X23 C;  1S32 B;  1KX4 B;  3B6G A;  4E44 A;  5AV9 A;  3V9R A;  3C1C C;  1TAF B;  2BYM A;  4ZUX D;  3MGQ D;  5B33 C;  1P3P D;  1P34 C;  2VQR A;  1P3F C;  2FJ7 B;  4Z2M H;  4J8V B;  3LEL C;  4YM6 C;  2F8N A;  3WAA B;  3UTB B;  1M19 B;  1KX4 C;  3AV1 B;  5GT3 A;  5JRG D;  3VH5 T;  3MGP D;  4J8X A;  1BFM A;  4EO5 B;  2NZD B;  5B24 D;  5AY8 B;  5AV8 C;  5B1M A;  5AV6 D;  4WU9 D;  1ZLA B;  5GT0 B;  3WKJ B;  3LZ0 B;  3MVD B;  4J8V C;  2NQB B;  3WAA C;  1TAF A;  1M1A B;  5CPI A;  3MGS A;  5F99 D;  1P3G C;  2BG1 A;  3AV1 C;  4Z5T D;  2HIO C;  1P3O B;  4YS3 B;  2FJ7 A;  3W99 B;  5AY8 C;  1ZLA C;  4R8P D;  3AZH A;  3WKJ C;  4H9S C;  3LJA D;  3LZ0 C;  3MVD C;  4H9P B;  5B0Z B;  5AVB A;  2NQB C;  3C1B D;  3AZJ B;  5B32 G;  2NZD A;  3AZM D;  3AZK A;  1U35 A;  2HUE C;  3REK B;  2JE5 A;  5GT0 A;  3W97 D;  1Q9C A;  3AZE A;  4YS3 C;  4WV4 B;  1H3O A;  1M1A A;  1F66 C;  3VH5 A;  2CWE A;  2YFW B;  3WTP D;  3A6N D;  5CHL B;  5B0Z C;  5B31 D;  5AV9 D;  1P3O A;  3W98 B;  2IO5 B;  3X1S A;  3W99 A;  5DNN B;  5BNX B;  1HQ3 C;  2Y2K A;  1WWI A;  3NQU B;  3AZJ A;  3REL B;  5E5A B;  3REK A;  5B31 G;  3UT9 A;  4KUD A;  3W98 C;  4WZS B;  3KWQ B;  3REI C;  5DNN C;  4WU8 B;  2YFW A;  5B1M D;  1EQZ C;  4LD9 A;  2L5A A;  3REL C;  5CP6 A;  3X1V A;  5FUG A;  3AV2 B;  5CPI D;  3EPL A;  1P3B D;  2ARO D;  5AVC D;  3X1T D;  4XUJ D;  3NQU A;  3KXB C;  1A7W A;  3O62 B;  5E5A A;  2YFV B;  4UPK A;  5BNV A;  2ZY5 A;  4H9N A;  3AYW D;  1ID3 B;  5AVB D;  3KWQ A;  3TU4 B;  1KX5 A;  3MGQ C;  2CV5 A;  5B24 B;  3AZK D;  1P3A B;  1U35 D;  1P3P C;  4WU8 A;  2Y2M A;  3AZE D;  1P3M B;  4NFT A;  1P3K D;  5C3I B;  5B0Y A;  5DNM D;  2Y2H A;  3AV2 A;  2PYO B;  5CPK A;  5B32 B;  1M18 B;  5JRG C;  2Y2L A;  3MGP C;  3TU4 C;  3AZL A;  3AFA D;  5B24 C;  5BS7 C;  3O62 A;  5B40 B;  5AV6 C;  5JA4 B;  3REJ B;  1ID3 A;  5B2J A;  5C3I C;  4XZQ A;  4Z66 B;  5F99 C;  1HTA A;  1P3A A;  5CPJ A;  5GSU A;  1KX3 D;  3C1C B;  1P3L A;  3EPJ A;  1P3M A;  4JJN A;  1AOI A;  1P34 B;  5B40 C;  4R8P C;  2PYO A;  3A6N B;  5B32 A;  4YM6 B;  1M18 A;  3VH6 T;  5B31 B;  4Z66 C;  3REH D;  5GXQ A;  3AZI B;  5JA4 A;  3W97 C;  3REJ A;  5B2I D;  2ZY2 A;  5AV8 B;  5BO0 B;  1P3I D;  3NQJ B;  4X23 A;  3WTP C;  3A6N C;  3C1C A;  5B33 A;  4QLC D;  5B31 C;  5AV5 A;  2Y2O A;  5AV9 C;  1P3G B;  1P34 A;  1KX5 D;  1PZR A;  3AZI C;  1P3F A;  2HIO B;  3AZG D;  3B6F A;  4J8W D;  3LEL A;  4YM6 A;  4KGC D;  3AZF D;  2Y2J A;  1KX4 A;  1S32 A;  5B1L D;  1BH9 B;  1P3B B;  2ARO B;  4UUZ B;  3KUY D;  2HUE B;  5AVC B;  3MGR D;  3LZ1 D;  5BO0 A;  5AV8 A;  3AZN B;  3AZL D;  4J8V A;  2DQN C;  5B1M C;  1F66 B;  3WAA A;  3X1U D;  3UTB A;  1M19 A;  3AV1 A;  3WA9 B;  5CPI C;  4XZQ D;  2HIO A;  1P3B C;  2ARO C;  5GSU D;  1P3L D;  5AVC C;  5AY8 A;  3AZN C;  3X1T C;  1ZLA A;  4NE3 A;  3WKJ A;  4XUJ C;  4H9S A;  4JJN D;  3UTA D;  1HQ3 B;  1AOI D;  3W96 D;  3LZ0 A;  4DRB A;  1W2E A;  3MVD A;  1JFI B;  4J8U D;  2NQB A;  1BH9 A;  2Y2Q A;  3H0L C;  3AYW C;  3AN2 D;  1TZY D;  5AVB C;  3WA9 C;  3MNN B;  3B6G D;  3AZK C;  4YS3 A;  5GXQ D;  1R4V A;  1F66 A;  3REI B;  4DQY B;  1P3K C;  1EQZ B;  4H9P A;  2Y2I A;  5DNM C;  5B0Z A;  2G5H C;  2F8N D;  2RVQ C;  5B33 D;  3VH5 W;  5AV5 D;  4ZBJ C;  3MNN C;  3AFA C;  1HQ3 A;  5GT3 D;  3B0C T;  4J8X D;  3B6F D;  2BYK B;  3KXB B;  1S32 D;  2F8N G;  2JSS A;  3W98 A;  3REH B;  2Y2G A;  1KX3 C;  4ZUX B;  3MGS D;  3MGQ B;  3REI A;  5DNN A;  5BNX A;  1P3P B;  5B2I B;  1P3I B;  4H9R B;  2FJ7 D;  4AWL C;  4J8V D;  3REL A;  3UTB D;  3AZH D;  4G91 B;  4CSR B;  4NE5 A;  1M19 D;  4HGA B;  3REH C;  5JRG B;  3MGP B;  4ZUX C;  2NZD D;  2BYK A;  3KXB A;  5B2I C;  5G49 B;  1P3I C;  5AV6 B;  4WU9 B;  1ZLA D;  5GT0 D;  3WKJ D;  4KGC B;  3AZF B;  3LZ0 D;  3MVD D;  1M1A D;  3MGQ A;  4G91 C;  5F99 B;  4QLC C;  3MGR B;  1P3P A;  2G5I C;  4HGA C;  4Z5T B;  1P3O D;  3AZG C;  3X1S D;  4J8W C;  3W99 D;  3X1U B;  4R8P B;  4WU9 C;  4KGC C;  2YFV A;  4CSR A;  1F1E A;  3AZF C;  3LJA B;  2ZY4 A;  3A1K A;  5B1L C;  3IP4 C;  3H0R C;  3C1B B;  3TU4 A;  3AZJ D;  5B24 A;  3AZM B;  5BS7 A;  3KUY C;  3MGR C;  3REK D;  3LZ1 C;  2RIQ A;  3UT9 D;  5AV6 A;  4KUD D;  3W97 B;  4Z5T C;  3W96 B;  3KFU G;  3B0D C;  3X1U C;  5F99 A;  3R45 B;  3WTP B;  3LJA C;  4LD9 D;  4CAY B;  4WJ3 C;  2ZM5 A;  3C1B C;  3B6G B;  5AV9 B;  3V9R B;  5GSU C;  5CP6 D;  2BYM B;  3AZM C;  3X1V D;  5B40 A;  4R8P A;  4JJN C;  3UTA C;  3W96 C;  4J8U C;  5KDM B; 
#chains in the Genus database with same CATH homology
 2XD5 A;  4Z66 A;  3REL D;  5E5A D;  2F8N B;  3AN2 C;  1TZY C;  3W97 A;  3B6G C;  5GXQ C;  3WTP E;  3KWQ D;  4J8X B;  2F8N K;  2CV5 D;  4WU8 D;  5B1M B;  3WTP A;  3A6N A;  4CAY A;  5B31 A;  5B0Y D;  5CPI B;  3MGS B;  3AZI A;  3AV2 D;  5AV5 C;  5CPK D;  5GT3 C;  3X1T B;  4XUJ B;  3KSY A;  5KDM A;  4J8X C;  3B6F C;  3NQJ A;  3VH6 A;  3O62 D;  3AZH B;  4KHA B;  1S32 C;  1P3G A;  3AYW B;  1ID3 D;  5B2J D;  5AVB B;  3A1I A;  4H9Q B;  3TU4 D;  3MGS C;  3AZK B;  1P3A D;  5BT1 D;  4NE6 A;  5CPJ D;  1U35 B;  3P5J B;  3AZE B;  1P3M D;  2FJ7 C;  4H9O B;  1P3K B;  2JCH A;  1H3O B;  5DNM B;  3UTB C;  3AZH C;  2PYO D;  3VH6 W;  1P3B A;  2ARO A;  1KU5 A;  4UUZ A;  5B32 D;  1M19 C;  1M18 D;  5AVC A;  3AZN A;  3X1T A;  2DF4 C;  4XUJ A;  2XD1 A;  4ZBJ B;  4EO5 C;  3X1S B;  3AFA B;  2NZD C;  1U35 C;  3EPH A;  5B40 D;  5GT0 C;  4KHA A;  3AZE C;  3REJ D;  1B6W A;  3AYW A;  3WA9 A;  1M1A C;  4H9Q A;  4X23 D;  4Z66 D;  3EPK A;  1KX3 B;  3C1C D;  3UT9 B;  4KUD B;  1P3O C;  4H9O A;  3X1S C;  1P3K A;  3W99 C;  1P34 D;  1JFI A;  5DNM A;  1P3F D;  4AWL B;  3LEL D;  4LD9 B;  4YM6 D;  3AZJ C;  1KX4 D;  3MNN A;  3AFA A;  5CP6 B;  1T3U A;  3REK C;  2F2A C;  5FUG B;  3UT9 C;  3AZI D;  3X1V B;  4KUD C;  1WWS A;  4WNN B;  5AV8 D;  1EQZ A;  3EG5 B;  1KX3 A;  3WAA D;  4LD9 C;  2W8S A;  1ULY A;  5BNV B;  4QLC B;  1P3G D;  4H9N B;  2IO5 C;  3AV1 D;  5CP6 C;  1KX5 B;  2UWX A;  3X1V C;  2CV5 B;  2HIO D;  3AZG B;  4J8W B;  2Y2N A;  5AY8 D;  4G92 B;  5B1L B;  5E5A C;  5B0Y B;  3REH A;  2J8P A;  2NQB D;  4ZUX A;  1N1J B;  3B0B A;  5CPK B;  3KUY B;  3AZN D;  5B2I A;  3LZ1 B;  4WNN A;  1P3I A;  4H9R A;  2F8N H;  3KWQ C;  1KX5 C;  3AZL B;  2CV5 C;  4YS3 D;  4WU8 C;  2FFF B;  1F66 D;  3B0D B;  4QLC A;  4G92 C;  5B2J B;  3WA9 D;  5B0Y C;  5B0Z D;  4XZQ B;  5JRG A;  3AV2 C;  3MGP A;  3AZG A;  5CPK C;  5CPJ B;  5GSU B;  4J8W A;  1P3L B;  5G49 A;  4WU9 A;  4KGC A;  3B0C W;  3AZL C;  4JJN B;  3UTA B;  1HQ3 D;  3AZF A;  1AOI B;  5B1L A;  3O62 C;  2Y2P A;  4J8U B;  1N1J A;  3F6T A;  3FDD A;  3KUY A;  3MGR A;  5B2J C;  2RVQ D;  3LZ1 A;  1Z2C B;  1TZY B;  3AN2 B;  1ID3 C;  1BH8 B;  4XZQ C;  3MNN D;  4Z5T A;  3W98 D;  1P3A C;  5GXQ B;  4DRA A;  5BT1 C;  5CPJ C;  1P3L C;  4Z2M G;  3X1U A;  3REI D;  1P3M C;  5DNN D;  1AOI C;  3LJA A;  1EQZ D;  1B67 A;  2LY8 A;  4X23 B;  3C1B A;  2PYO C;  3H0M C;  5B32 C;  3AZM A;  1M18 C;  5B33 B;  2ZY3 A;  5AV5 B;  3UTA A;  3W96 A;  5GT3 B;  4J8U A;  1P3F B;  3B6F B;  3KXB D;  3LEL B;  3REJ C;  4M6B A;  3R45 A;  3AN2 A;  1TZY A;  1BH8 A;  3AL0 C;  4E45 A;  4X23 C;  1S32 B;  1KX4 B;  3B6G A;  4E44 A;  5AV9 A;  3V9R A;  3C1C C;  1TAF B;  2BYM A;  4ZUX D;  3MGQ D;  5B33 C;  1P3P D;  1P34 C;  2VQR A;  1P3F C;  2FJ7 B;  4Z2M H;  4J8V B;  3LEL C;  4YM6 C;  2F8N A;  3WAA B;  3UTB B;  1M19 B;  1KX4 C;  3AV1 B;  5GT3 A;  5JRG D;  3VH5 T;  3MGP D;  4J8X A;  1BFM A;  4EO5 B;  2NZD B;  5B24 D;  5AY8 B;  5AV8 C;  5B1M A;  5AV6 D;  4WU9 D;  1ZLA B;  5GT0 B;  3WKJ B;  3LZ0 B;  3MVD B;  4J8V C;  2NQB B;  3WAA C;  1TAF A;  1M1A B;  5CPI A;  3MGS A;  5F99 D;  1P3G C;  2BG1 A;  3AV1 C;  4Z5T D;  2HIO C;  1P3O B;  4YS3 B;  2FJ7 A;  3W99 B;  5AY8 C;  1ZLA C;  4R8P D;  3AZH A;  3WKJ C;  4H9S C;  3LJA D;  3LZ0 C;  3MVD C;  4H9P B;  5B0Z B;  5AVB A;  2NQB C;  3C1B D;  3AZJ B;  5B32 G;  2NZD A;  3AZM D;  3AZK A;  1U35 A;  2HUE C;  3REK B;  2JE5 A;  5GT0 A;  3W97 D;  1Q9C A;  3AZE A;  4YS3 C;  4WV4 B;  1H3O A;  1M1A A;  1F66 C;  3VH5 A;  2CWE A;  2YFW B;  3WTP D;  3A6N D;  5CHL B;  5B0Z C;  5B31 D;  5AV9 D;  1P3O A;  3W98 B;  2IO5 B;  3X1S A;  3W99 A;  5DNN B;  5BNX B;  1HQ3 C;  2Y2K A;  1WWI A;  3NQU B;  3AZJ A;  3REL B;  5E5A B;  3REK A;  5B31 G;  3UT9 A;  4KUD A;  3W98 C;  4WZS B;  3KWQ B;  3REI C;  5DNN C;  4WU8 B;  2YFW A;  5B1M D;  1EQZ C;  4LD9 A;  2L5A A;  3REL C;  5CP6 A;  3X1V A;  5FUG A;  3AV2 B;  5CPI D;  3EPL A;  1P3B D;  2ARO D;  5AVC D;  3X1T D;  4XUJ D;  3NQU A;  3KXB C;  1A7W A;  3O62 B;  5E5A A;  2YFV B;  4UPK A;  5BNV A;  2ZY5 A;  4H9N A;  3AYW D;  1ID3 B;  5AVB D;  3KWQ A;  3TU4 B;  1KX5 A;  3MGQ C;  2CV5 A;  5B24 B;  3AZK D;  1P3A B;  1U35 D;  1P3P C;  4WU8 A;  2Y2M A;  3AZE D;  1P3M B;  4NFT A;  1P3K D;  5C3I B;  5B0Y A;  5DNM D;  2Y2H A;  3AV2 A;  2PYO B;  5CPK A;  5B32 B;  1M18 B;  5JRG C;  2Y2L A;  3MGP C;  3TU4 C;  3AZL A;  3AFA D;  5B24 C;  5BS7 C;  3O62 A;  5B40 B;  5AV6 C;  5JA4 B;  3REJ B;  1ID3 A;  5B2J A;  5C3I C;  4XZQ A;  4Z66 B;  5F99 C;  1HTA A;  1P3A A;  5CPJ A;  5GSU A;  1KX3 D;  3C1C B;  1P3L A;  3EPJ A;  1P3M A;  4JJN A;  1AOI A;  1P34 B;  5B40 C;  4R8P C;  2PYO A;  3A6N B;  5B32 A;  4YM6 B;  1M18 A;  3VH6 T;  5B31 B;  4Z66 C;  3REH D;  5GXQ A;  3AZI B;  5JA4 A;  3W97 C;  3REJ A;  5B2I D;  2ZY2 A;  5AV8 B;  5BO0 B;  1P3I D;  3NQJ B;  4X23 A;  3WTP C;  3A6N C;  3C1C A;  5B33 A;  4QLC D;  5B31 C;  5AV5 A;  2Y2O A;  5AV9 C;  1P3G B;  1P34 A;  1KX5 D;  1PZR A;  3AZI C;  1P3F A;  2HIO B;  3AZG D;  3B6F A;  4J8W D;  3LEL A;  4YM6 A;  4KGC D;  3AZF D;  2Y2J A;  1KX4 A;  1S32 A;  5B1L D;  1BH9 B;  1P3B B;  2ARO B;  4UUZ B;  3KUY D;  2HUE B;  5AVC B;  3MGR D;  3LZ1 D;  5BO0 A;  5AV8 A;  3AZN B;  3AZL D;  4J8V A;  2DQN C;  5B1M C;  1F66 B;  3WAA A;  3X1U D;  3UTB A;  1M19 A;  3AV1 A;  3WA9 B;  5CPI C;  4XZQ D;  2HIO A;  1P3B C;  2ARO C;  5GSU D;  1P3L D;  5AVC C;  5AY8 A;  3AZN C;  3X1T C;  1ZLA A;  4NE3 A;  3WKJ A;  4XUJ C;  4H9S A;  4JJN D;  3UTA D;  1HQ3 B;  1AOI D;  3W96 D;  3LZ0 A;  4DRB A;  1W2E A;  3MVD A;  1JFI B;  4J8U D;  2NQB A;  1BH9 A;  2Y2Q A;  3H0L C;  3AYW C;  3AN2 D;  1TZY D;  5AVB C;  3WA9 C;  3MNN B;  3B6G D;  3AZK C;  4YS3 A;  5GXQ D;  1R4V A;  1F66 A;  3REI B;  4DQY B;  1P3K C;  1EQZ B;  4H9P A;  2Y2I A;  5DNM C;  5B0Z A;  2G5H C;  2F8N D;  2RVQ C;  5B33 D;  3VH5 W;  5AV5 D;  4ZBJ C;  3MNN C;  3AFA C;  1HQ3 A;  5GT3 D;  3B0C T;  4J8X D;  3B6F D;  2BYK B;  3KXB B;  1S32 D;  2F8N G;  2JSS A;  3W98 A;  3REH B;  2Y2G A;  1KX3 C;  4ZUX B;  3MGS D;  3MGQ B;  3REI A;  5DNN A;  5BNX A;  1P3P B;  5B2I B;  1P3I B;  4H9R B;  2FJ7 D;  4AWL C;  4J8V D;  3REL A;  3UTB D;  3AZH D;  4G91 B;  4CSR B;  4NE5 A;  1M19 D;  4HGA B;  3REH C;  5JRG B;  3MGP B;  4ZUX C;  2NZD D;  2BYK A;  3KXB A;  5B2I C;  5G49 B;  1P3I C;  5AV6 B;  4WU9 B;  1ZLA D;  5GT0 D;  3WKJ D;  4KGC B;  3AZF B;  3LZ0 D;  3MVD D;  1M1A D;  3MGQ A;  4G91 C;  5F99 B;  4QLC C;  3MGR B;  1P3P A;  2G5I C;  4HGA C;  4Z5T B;  1P3O D;  3AZG C;  3X1S D;  4J8W C;  3W99 D;  3X1U B;  4R8P B;  4WU9 C;  4KGC C;  2YFV A;  4CSR A;  1F1E A;  3AZF C;  3LJA B;  2ZY4 A;  3A1K A;  5B1L C;  3IP4 C;  3H0R C;  3C1B B;  3TU4 A;  3AZJ D;  5B24 A;  3AZM B;  5BS7 A;  3KUY C;  3MGR C;  3REK D;  3LZ1 C;  2RIQ A;  3UT9 D;  5AV6 A;  4KUD D;  3W97 B;  4Z5T C;  3W96 B;  3KFU G;  3B0D C;  3X1U C;  5F99 A;  3R45 B;  3WTP B;  3LJA C;  4LD9 D;  4CAY B;  4WJ3 C;  2ZM5 A;  3C1B C;  3B6G B;  5AV9 B;  3V9R B;  5GSU C;  5CP6 D;  2BYM B;  3AZM C;  3X1V D;  5B40 A;  4R8P A;  4JJN C;  3UTA C;  3W96 C;  4J8U C;  5KDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...