3W99D

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99D00
3WA9B 2AROD 5AV5D 4X23D 3WTPC 4WU9A 5B32C 3KXBC 3VH5A 1ID3C 3AV2A 3MVDA 2RVQC 3WTPD 5KDMA 4H9RB 4J8XC 5B32D 3KXBD 1N1JA 1ID3D 2RVQD 1BH9A 3REJB 5AV9C 4J8XD 4ZBJB 4AWLC 3W97C 5GSUC 5AV9D 5DNNC 5B0ZB 1HQ3C 3W97D 5GSUD 3W98A 4LD9C 5DNND 3B6FA 4XZQA 1HQ3D 5B1MC 5BS7C 4LD9D 3X1UA 3NQJA 5B1MD 1P3LC 1B6WA 3MVDB 5JRGC 5KDMB 3LZ0C 1KX5B 1N1JB 2YFWA 1P3LD 3WKJA 4ZUXC 1BH8A 5JRGD 1BH9B 2NQBB 1M1AA 1KX4A 5B33A 4ZUXD 3B0DB 3AYWB 3R45B 3VH6W 5CPIB 2HIOB 4XUJA 1P3GA 2FJ7A 2CWEA 2YFVB 3B6FB 1P3BC 5BNXA 2CV5B 5GT3C 4WU9C 1P3BD 3NQJB 2PYOB 4HGAC 3LZ1A 3AV2C 1BFMA 4NFTA 5GT3D 5AVCC 4WU9D 5GXQA 3MGRC 2YFWB 3AV2D 3AFAC 3WKJB 3AZNA 5AVCD 3MGRD 3AFAD 3REKC 5AV6A 3UT9A 4J8VA 3REKD 5AY8C 1TAFA 5G49B 4KGCA 5AY8D 3X1UC 3MGSC 5CPKB 3LZ1B 5BNVA 2BYMB 3AV1A 5B0YA 3AZIC 3W96C 1M19B 3X1UD 3MGSD 3REHA 3AZNB 3AZID 3W96D 3MGQC 4R8PA 1F66C 4YM6B 5AV8A 3MGQD 3UT9B 4Z5TC 3UTAC 1F66D 3B6GC 2JSSA 3AZFC 1P3GC 1M18B 2FJ7C 3AZGA 4Z5TD 1TZYC 3UTAD 3B6GD 1P3GD 3AZFD 2FJ7D 4KGCB 5CP6B 5F99B 1TZYD 2NZDB 5BNVB 4G92C 3AV1B 4KUDA 5B0YB 2HUEC 3VH6A 3AZHC 5B2IA 3REHB 1S32B 4QLCC 3WA9A 3X1VA 3AZJA 3AZHD 4QLCD 3AN2C 4J8UB 4CAYB 4YS3C 4JJNC 5B1LC 3AN2D 4YS3D 5C3IB 5B24C 4H9OB 4JJND 5B1LD 1A7WA 3KUYB 5B24D 1P3MA 3MGPA 5B0ZA 1P3KA 5AV5B 3MNNC 4X23B 4KUDB 5B2IB 3KWQA 3X1VB 3MNND 3AZJB 4UUZB 3KXBB 3WAAC 1ZLAA 3WAAD 1KX5A 5B2JC 1U35C 4E45A 3AZMA 3LELC 5E5AC 3AZGC 4J8WC 3AZKB 2NQBA 1P3IC 5B2JD 5BT1C 1U35D 1B67A 4AWLB 3LELD 1P3MB 4WU8C 1P34A 1EQZC 5DNNB 5E5AD 4DRBA 3AZGD 4J8WD 3AYWA 3MGPB 3R45A 1P3ID 1P3KB 5BT1D 3AZLC 5CPIA 5GT0A 2HIOA 4WU8D 1EQZD 4LD9B 4G91C 3A6NC 1P3OC 2YFVA 3KWQB 3AZLD 3WA9C 4Z66C 2CV5A 3A6ND 1P3OD 1AOIB 3WA9D 2PYOA 5B40A 4Z66D 3LZ0B 1ZLAB 3AZMB 3X1SB 3REJC 3RELA 1P34B 3TU4A 3REJD 3REIA 4H9NB 5GT0B 3AZEA 1P3BB 4CSRA 1H3OB 5GT3B 5JA4B 5G49A 3X1TA 4HGAB 5AVBA 5CPKA 5B40B 1WWIA 2BYMA 3MVDC 1M19A 1KX5C 4EO5B 3MVDD 3RELB 1KX5D 4YM6A 3B0DC 3WTPE 3TU4B 3LJAA 3AYWC 2NQBD 3REIB 1M18A 5AY8B 4H9SA 3AZEB 3AYWD 3W98C 2IO5B 4CSRB 3B6FC 4XZQC 1P3AB 2HIOD 3X1TB 3W98D 3B6FD 5CPJB 5CP6A 4XZQD 5AVBB 5F99A 2NZDA 3C1CA 2F8NA 5DNMA 4Z2MH 2PYOD 1S32A 5B31B 3C1BA 1KX3A 3WKJC 3MGQB 3UTBA 1JFIA 1F66B 1M1AC 4H9PB 1KX4C 5B33C 4J8UA 3WKJD 4CAYA 3LJAB 3UTAB 3B6GB 3AZFB 1M1AD 1KX4D 5B33D 4XUJC 4WV4B 1P3FA 4H9OA 1TZYB 3KUYA 4XUJD 1P3PB 3O62B 3LZ1C 3NQUB 3AZHB 2AROA 5AV5A 3C1CB 2F8NB 4X23A 5DNMB 1M19C 4QLCB 5GXQC 4NE6A 3LZ1D 3C1BB 1KX3B 3AZNC 3UTBB 1JFIB 3WTPA 1M19D 4UUZA 5GXQD 1ULYA 5B32A 3KXBA 4JJNB 5B1LB 3AZND 3W99B 5AV6C 3UT9C 5B24B 4J8VC 1P3FB 5AV6D 3UT9D 3AZKA 4J8VD 1P3OB 4KGCC 3W97A 5GSUA 2BYKB 4WNNA 5DNNA 5CP6C 2F8NK 1WWSA 4E44A 1HQ3A 2AROB 3AV1C 4KGCD 4Z2MG 5B0YC 4LD9A 5CP6D 3REHC 5B1MA 3AV1D 5BS7A 5B0YD 3WTPB 5BO0A 4R8PC 5B32B 3REHD 1AOIA 1P3LA 1ID3B 5AV8C 5JRGA 3LZ0A 4R8PD 4J8XB 5C3IC 5AV8D 3X1SA 5AV9B 3KUYC 4WU8B 3W97B 5GSUB 4WNNB 5FUGB 3KUYD 1HQ3B 3A6NB 4H9NA 4KUDC 5B2IC 1P3BA 4Z66B 1H3OA 5B1MB 3X1VC 4KUDD 5GT3A 3AZJC 5BO0B 5JA4A 5B2ID 1P3LB 3X1VD 1Q9CA 5AVCA 5JRGB 3AZJD 4M6BA 3MGRA 3AFAA 4ZUXB 4NE3A 3V9RA 1HTAA 3AZKC 4ZBJC 1P3MC 3REKA 3AZKD 3MGPC 5B0ZC 1P3KC 1P3MD 5AY8A 3MGPD 5B0ZD 1P3KD 3KWQC 2F8NH 1P3AA 4WU9B 3MGSA 1AOIC 3KWQD 5CPJA 3AV2B 5AVCB 3AZIA 3W96A 3MGRB 1AOID 1ZLAC 3AFAB 3AZMC 5B31A 3X1SC 3LZ0D 3V9RB 3MGQA 1ZLAD 2NQBC 1F66A 4H9QA 4H9PA 3AZMD 3X1SD 3REKB 1P34C 4Z5TA 3UTAA 3B6GA 3AZFA 5CPIC 3W98B 5GT0C 2HIOC 1P34D 4XZQB 1TZYA 5CPID 5GT0D 2CV5C 3X1UB 3MGSB 5B31G 1P3PA 3O62A 2PYOC 5B40C 3AZIB 3NQUA 3AZHA 2CV5D 3W96B 3VH6T 5CHLB 4DRAA 4QLCA 4EO5C 1BH8B 5B40D 1M1AB 1KX4B 3RELC 5B33B 3AN2A 4YS3A 4H9QB 4JJNA 5B1LA 3TU4C 3W99A 4Z5TB 3RELD 4XUJB 1P3GB 3KSYA 3REIC 2FJ7B 5B24A 3AZEC 3TU4D 2IO5C 5BNXB 3REID 1P3AC 2F8NG 3VH5W 3AZED 3X1TC 2BYKA 5CPJC 5AVBC 4G92B 5CPKC 1P3AD 3MNNA 2HUEB 3X1TD 5GXQB 5CPJD 5AVBD 5CPKD 5B31C 3WAAA 3AN2B 4KHAA 4YS3B 3B0CW 5B31D 5AV6B 4YM6C 1ID3A 3VH5T 3LJAC 4J8VB 4J8XA 5B2JA 1U35A 3LELA 4YM6D 1M18C 4H9SC 5E5AA 3LJAD 4J8WA 3B0BA 5AV9A 1TAFB 1P3IA 4WZSB 4WU8A 1EQZA 1M18D 5FUGA 3O62C 1P3PC 3AZLA 5F99C 2L5AA 3MNNB 2LY8A 2NZDC 3B0CT 5B32G 3C1CC 5DNMC 3A6NA 1P3OA 1P3PD 3O62D 5F99D 1S32C 3C1BC 2NZDD 4Z66A 1KX3C 3C1CD 4R8PB 5DNMD 3UTBC 2F8ND 3WAAB 1KU5A 4KHAB 1S32D 5AV8B 3C1BD 1KX3D 4J8UC 3UTBD 3W99C 4H9RA 5B2JB 1U35B 3LELB 4J8UD 4ZUXA 3W99D 5E5AB 3AZGB 1P3FC 4J8WB 3REJA 1P3IB 1EQZB 1R4VA 1F1EA 1P3FD 4NE5A 3AZLB 2AROC 5AV5C 4G91B 4X23C
chains in the Genus database with same CATH superfamily
3WA9B 2AROD 5AV5D 4X23D 3WTPC 2Y2QA 4WU9A 5B32C 3KXBC 3VH5A 1ID3C 3AV2A 3MVDA 2RVQC 3WTPD 5KDMA 4H9RB 4J8XC 5B32D 3KXBD 1N1JA 1ID3D 2RVQD 1BH9A 3REJB 5AV9C 4J8XD 4ZBJB 3A1IA 4AWLC 3W97C 5GSUC 5AV9D 5DNNC 5B0ZB 1HQ3C 3W97D 5GSUD 3W98A 4LD9C 5DNND 3B6FA 4XZQA 1HQ3D 5B1MC 5BS7C 4LD9D 3X1UA 3NQJA 5B1MD 1P3LC 3IP4C 1B6WA 3MVDB 5JRGC 5KDMB 3LZ0C 1KX5B 1N1JB 2YFWA 1P3LD 3WKJA 4ZUXC 1BH8A 5JRGD 1BH9B 2NQBB 3EPLA 2JCHA 1M1AA 1KX4A 2Y2GA 5B33A 3EG5B 4ZUXD 3B0DB 3AYWB 3R45B 3VH6W 5CPIB 2HIOB 4XUJA 1P3GA 2FJ7A 2CWEA 2YFVB 3B6FB 1P3BC 5BNXA 2CV5B 5GT3C 4WU9C 1P3BD 3NQJB 2PYOB 3P5JB 4HGAC 3LZ1A 3AV2C 1BFMA 4NFTA 5GT3D 5AVCC 4WU9D 5GXQA 3MGRC 2YFWB 3AV2D 3AFAC 3WKJB 3AZNA 5AVCD 3MGRD 3AFAD 2DQNC 5AV6A 3REKC 3UT9A 4J8VA 3REKD 2J8PA 5AY8C 1TAFA 5G49B 4KGCA 5AY8D 3X1UC 3MGSC 5CPKB 3LZ1B 5BNVA 2BYMB 3AV1A 5B0YA 3AZIC 3W96C 1M19B 3X1UD 3MGSD 3REHA 3AZNB 3AZID 3W96D 3MGQC 4R8PA 1F66C 4YM6B 2Y2LA 5AV8A 3MGQD 2VQRA 3UT9B 4Z5TC 3UTAC 1F66D 3B6GC 2JSSA 2XD5A 3AZFC 1P3GC 1M18B 2FJ7C 3AZGA 4Z5TD 1TZYC 3UTAD 2RIQA 3B6GD 1P3GD 3AZFD 2FJ7D 4DQYB 4KGCB 5CP6B 5F99B 1TZYD 4UPKA 2NZDB 5BNVB 4G92C 3AV1B 4KUDA 5B0YB 2HUEC 3VH6A 3AZHC 5B2IA 3REHB 1S32B 4QLCC 3WA9A 3X1VA 3AZJA 3AZHD 4QLCD 3AN2C 4J8UB 2ZY2A 4CAYB 4YS3C 4JJNC 5B1LC 3AN2D 4YS3D 5C3IB 5B24C 4H9OB 4JJND 5B1LD 1A7WA 2UWXA 3EPJA 3KUYB 5B24D 1P3MA 2Y2NA 3MGPA 5B0ZA 1P3KA 5AV5B 3MNNC 4X23B 4KUDB 5B2IB 2F2AC 3KWQA 3X1VB 3MNND 3AZJB 4UUZB 3KXBB 3WAAC 1ZLAA 2Y2JA 3WAAD 1KX5A 5B2JC 1U35C 4E45A 3AZMA 3LELC 5E5AC 3AZGC 4J8WC 3AZKB 2NQBA 2G5IC 1P3IC 5B2JD 5BT1C 1U35D 1B67A 4AWLB 3LELD 1P3MB 4WU8C 1P34A 1EQZC 5DNNB 5E5AD 4DRBA 3AZGD 4J8WD 3AYWA 3MGPB 3R45A 1P3ID 1P3KB 5BT1D 3AZLC 2ZY3A 5CPIA 5GT0A 2HIOA 4WU8D 1EQZD 4LD9B 4G91C 3H0LC 3A6NC 1P3OC 2YFVA 3KWQB 3AZLD 3WA9C 4Z66C 2CV5A 2XD1A 3A6ND 1P3OD 1AOIB 3WA9D 2PYOA 5B40A 4Z66D 3LZ0B 1ZLAB 3AZMB 3X1SB 2Y2PA 3REJC 3RELA 1Z2CB 1P34B 3TU4A 3REJD 3REIA 4H9NB 5GT0B 3AZEA 1P3BB 4CSRA 1H3OB 5GT3B 5JA4B 5G49A 3X1TA 4HGAB 5AVBA 5CPKA 5B40B 2W8SA 1WWIA 2BYMA 3MVDC 1M19A 1KX5C 4EO5B 1T3UA 3MVDD 3RELB 1KX5D 4YM6A 3B0DC 3WTPE 3TU4B 3LJAA 3AYWC 2NQBD 3REIB 1M18A 5AY8B 4H9SA 3AZEB 3AYWD 3W98C 2IO5B 4CSRB 3B6FC 4XZQC 1P3AB 2HIOD 3X1TB 3W98D 3B6FD 5CPJB 5CP6A 4XZQD 3EPHA 5AVBB 5F99A 2NZDA 3C1CA 2F8NA 5DNMA 4Z2MH 2PYOD 1S32A 5B31B 3C1BA 1KX3A 3WKJC 3MGQB 3UTBA 1JFIA 1F66B 1M1AC 4H9PB 1KX4C 5B33C 4J8UA 3WKJD 4CAYA 3LJAB 3UTAB 1W2EA 3B6GB 3AZFB 1M1AD 1KX4D 5B33D 4XUJC 4WV4B 1P3FA 4H9OA 1TZYB 3KUYA 4XUJD 1P3PB 3O62B 3LZ1C 3NQUB 3AZHB 2AROA 5AV5A 3C1CB 2F8NB 4X23A 5DNMB 3KFUG 1M19C 4QLCB 5GXQC 4NE6A 3LZ1D 3C1BB 1KX3B 3AZNC 3UTBB 1JFIB 2DF4C 3WTPA 1M19D 4UUZA 5GXQD 1ULYA 5B32A 3KXBA 4JJNB 5B1LB 3AZND 3W99B 5AV6C 3UT9C 5B24B 4J8VC 1P3FB 5AV6D 2BG1A 3UT9D 3AZKA 4J8VD 1P3OB 4KGCC 3W97A 5GSUA 2BYKB 5DNNA 5CP6C 4WNNA 2F8NK 1WWSA 4E44A 1HQ3A 2AROB 3FDDA 3AV1C 4KGCD 4Z2MG 5B0YC 4LD9A 5CP6D 3REHC 5B1MA 3AV1D 4WJ3C 5BS7A 5B0YD 3WTPB 5BO0A 4R8PC 5B32B 3REHD 1AOIA 1P3LA 1ID3B 5AV8C 5JRGA 3LZ0A 4R8PD 4J8XB 5C3IC 5AV8D 3H0MC 3X1SA 5AV9B 3KUYC 4WU8B 3F6TA 3W97B 5GSUB 4WNNB 5FUGB 3KUYD 1HQ3B 3A6NB 4H9NA 4KUDC 5B2IC 1P3BA 4Z66B 1H3OA 5B1MB 3X1VC 4KUDD 5GT3A 2ZM5A 3AZJC 5BO0B 5JA4A 5B2ID 1P3LB 3X1VD 1Q9CA 5AVCA 5JRGB 3AZJD 4M6BA 3MGRA 3AFAA 4ZUXB 4NE3A 3V9RA 1HTAA 3AZKC 4ZBJC 1P3MC 3REKA 3A1KA 2Y2OA 3AZKD 3MGPC 5B0ZC 1P3KC 1P3MD 5AY8A 3MGPD 5B0ZD 1P3KD 3KWQC 2F8NH 1P3AA 4WU9B 3MGSA 1AOIC 3KWQD 2Y2IA 5CPJA 3AV2B 5AVCB 3AZIA 3W96A 3MGRB 1AOID 1ZLAC 3AFAB 3AZMC 5B31A 3EPKA 3X1SC 3LZ0D 3V9RB 2G5HC 3MGQA 1ZLAD 2NQBC 1F66A 4H9QA 4H9PA 3AZMD 3X1SD 3REKB 1P34C 2ZY5A 4Z5TA 3UTAA 3B6GA 3AZFA 5CPIC 3W98B 5GT0C 2HIOC 1P34D 4XZQB 1TZYA 5CPID 5GT0D 2CV5C 3X1UB 3MGSB 5B31G 1P3PA 3O62A 2PYOC 5B40C 3AZIB 3NQUA 3AZHA 2CV5D 3W96B 3VH6T 5CHLB 4DRAA 4QLCA 4EO5C 1BH8B 5B40D 1M1AB 1KX4B 3RELC 5B33B 3AN2A 4YS3A 4H9QB 4JJNA 5B1LA 3TU4C 3W99A 4Z5TB 3RELD 4XUJB 1P3GB 3KSYA 3REIC 2FJ7B 5B24A 3AZEC 3TU4D 2IO5C 3AL0C 5BNXB 3REID 1P3AC 2F8NG 3VH5W 3AZED 3X1TC 2BYKA 5CPJC 5AVBC 4G92B 5CPKC 1P3AD 3MNNA 2HUEB 3X1TD 5GXQB 5CPJD 5AVBD 5CPKD 5B31C 3WAAA 3AN2B 4KHAA 4YS3B 3B0CW 5B31D 5AV6B 4YM6C 1ID3A 2FFFB 3VH5T 3LJAC 4J8VB 4J8XA 5B2JA 1U35A 3LELA 4YM6D 1M18C 4H9SC 5E5AA 3LJAD 4J8WA 3B0BA 5AV9A 1TAFB 1P3IA 4WZSB 4WU8A 1EQZA 1M18D 5FUGA 3O62C 1P3PC 3AZLA 5F99C 2L5AA 3MNNB 2LY8A 2NZDC 3B0CT 5B32G 3C1CC 5DNMC 3A6NA 1P3OA 1P3PD 3O62D 2JE5A 5F99D 1S32C 3C1BC 2NZDD 4Z66A 2Y2MA 1KX3C 3C1CD 4R8PB 5DNMD 3UTBC 2F8ND 3H0RC 3WAAB 1KU5A 4KHAB 1PZRA 1S32D 5AV8B 3C1BD 1KX3D 4J8UC 3UTBD 3W99C 4H9RA 5B2JB 1U35B 3LELB 4J8UD 4ZUXA 3W99D 5E5AB 3AZGB 1P3FC 4J8WB 3REJA 2ZY4A 1P3IB 2Y2HA 1EQZB 1R4VA 1F1EA 1P3FD 4NE5A 2Y2KA 3AZLB 2AROC 5AV5C 4G91B 4X23C
chains in the Genus database with same CATH topology
3WA9B 2AROD 5AV5D 4X23D 3WTPC 2Y2QA 4WU9A 5B32C 3KXBC 3VH5A 1ID3C 3AV2A 3MVDA 2RVQC 3WTPD 5KDMA 4H9RB 4J8XC 5B32D 3KXBD 1N1JA 1ID3D 2RVQD 1BH9A 3REJB 5AV9C 4J8XD 4ZBJB 3A1IA 4AWLC 3W97C 5GSUC 5AV9D 5DNNC 5B0ZB 1HQ3C 3W97D 5GSUD 3W98A 4LD9C 5DNND 3B6FA 4XZQA 1HQ3D 5B1MC 5BS7C 4LD9D 3X1UA 3NQJA 5B1MD 1P3LC 3IP4C 1B6WA 3MVDB 5JRGC 5KDMB 3LZ0C 1KX5B 1N1JB 2YFWA 1P3LD 3WKJA 4ZUXC 1BH8A 5JRGD 1BH9B 2NQBB 3EPLA 2JCHA 1M1AA 1KX4A 2Y2GA 5B33A 3EG5B 4ZUXD 3B0DB 3AYWB 3R45B 3VH6W 5CPIB 2HIOB 4XUJA 1P3GA 2FJ7A 2CWEA 2YFVB 3B6FB 1P3BC 5BNXA 2CV5B 5GT3C 4WU9C 1P3BD 3NQJB 2PYOB 3P5JB 4HGAC 3LZ1A 3AV2C 1BFMA 4NFTA 5GT3D 5AVCC 4WU9D 5GXQA 3MGRC 2YFWB 3AV2D 3AFAC 3WKJB 3AZNA 5AVCD 3MGRD 3AFAD 2DQNC 5AV6A 3REKC 3UT9A 4J8VA 3REKD 2J8PA 5AY8C 1TAFA 5G49B 4KGCA 5AY8D 3X1UC 3MGSC 5CPKB 3LZ1B 5BNVA 2BYMB 3AV1A 5B0YA 3AZIC 3W96C 1M19B 3X1UD 3MGSD 3REHA 3AZNB 3AZID 3W96D 3MGQC 4R8PA 1F66C 4YM6B 2Y2LA 5AV8A 3MGQD 2VQRA 3UT9B 4Z5TC 3UTAC 1F66D 3B6GC 2JSSA 2XD5A 3AZFC 1P3GC 1M18B 2FJ7C 3AZGA 4Z5TD 1TZYC 3UTAD 2RIQA 3B6GD 1P3GD 3AZFD 2FJ7D 4DQYB 4KGCB 5CP6B 5F99B 1TZYD 4UPKA 2NZDB 5BNVB 4G92C 3AV1B 4KUDA 5B0YB 2HUEC 3VH6A 3AZHC 5B2IA 3REHB 1S32B 4QLCC 3WA9A 3X1VA 3AZJA 3AZHD 4QLCD 3AN2C 4J8UB 2ZY2A 4CAYB 4YS3C 4JJNC 5B1LC 3AN2D 4YS3D 5C3IB 5B24C 4H9OB 4JJND 5B1LD 1A7WA 2UWXA 3EPJA 3KUYB 5B24D 1P3MA 2Y2NA 3MGPA 5B0ZA 1P3KA 5AV5B 3MNNC 4X23B 4KUDB 5B2IB 2F2AC 3KWQA 3X1VB 3MNND 3AZJB 4UUZB 3KXBB 3WAAC 1ZLAA 2Y2JA 3WAAD 1KX5A 5B2JC 1U35C 4E45A 3AZMA 3LELC 5E5AC 3AZGC 4J8WC 3AZKB 2NQBA 2G5IC 1P3IC 5B2JD 5BT1C 1U35D 1B67A 4AWLB 3LELD 1P3MB 4WU8C 1P34A 1EQZC 5DNNB 5E5AD 4DRBA 3AZGD 4J8WD 3AYWA 3MGPB 3R45A 1P3ID 1P3KB 5BT1D 3AZLC 2ZY3A 5CPIA 5GT0A 2HIOA 4WU8D 1EQZD 4LD9B 4G91C 3H0LC 3A6NC 1P3OC 2YFVA 3KWQB 3AZLD 3WA9C 4Z66C 2CV5A 2XD1A 3A6ND 1P3OD 1AOIB 3WA9D 2PYOA 5B40A 4Z66D 3LZ0B 1ZLAB 3AZMB 3X1SB 2Y2PA 3REJC 3RELA 1Z2CB 1P34B 3TU4A 3REJD 3REIA 4H9NB 5GT0B 3AZEA 1P3BB 4CSRA 1H3OB 5GT3B 5JA4B 5G49A 3X1TA 4HGAB 5AVBA 5CPKA 5B40B 2W8SA 1WWIA 2BYMA 3MVDC 1M19A 1KX5C 4EO5B 1T3UA 3MVDD 3RELB 1KX5D 4YM6A 3B0DC 3WTPE 3TU4B 3LJAA 3AYWC 2NQBD 3REIB 1M18A 5AY8B 4H9SA 3AZEB 3AYWD 3W98C 2IO5B 4CSRB 3B6FC 4XZQC 1P3AB 2HIOD 3X1TB 3W98D 3B6FD 5CPJB 5CP6A 4XZQD 3EPHA 5AVBB 5F99A 2NZDA 3C1CA 2F8NA 5DNMA 4Z2MH 2PYOD 1S32A 5B31B 3C1BA 1KX3A 3WKJC 3MGQB 3UTBA 1JFIA 1F66B 1M1AC 4H9PB 1KX4C 5B33C 4J8UA 3WKJD 4CAYA 3LJAB 3UTAB 1W2EA 3B6GB 3AZFB 1M1AD 1KX4D 5B33D 4XUJC 4WV4B 1P3FA 4H9OA 1TZYB 3KUYA 4XUJD 1P3PB 3O62B 3LZ1C 3NQUB 3AZHB 2AROA 5AV5A 3C1CB 2F8NB 4X23A 5DNMB 3KFUG 1M19C 4QLCB 5GXQC 4NE6A 3LZ1D 3C1BB 1KX3B 3AZNC 3UTBB 1JFIB 2DF4C 3WTPA 1M19D 4UUZA 5GXQD 1ULYA 5B32A 3KXBA 4JJNB 5B1LB 3AZND 3W99B 5AV6C 3UT9C 5B24B 4J8VC 1P3FB 5AV6D 2BG1A 3UT9D 3AZKA 4J8VD 1P3OB 4KGCC 3W97A 5GSUA 2BYKB 5DNNA 5CP6C 4WNNA 2F8NK 1WWSA 4E44A 1HQ3A 2AROB 3FDDA 3AV1C 4KGCD 4Z2MG 5B0YC 4LD9A 5CP6D 3REHC 5B1MA 3AV1D 4WJ3C 5BS7A 5B0YD 3WTPB 5BO0A 4R8PC 5B32B 3REHD 1AOIA 1P3LA 1ID3B 5AV8C 5JRGA 3LZ0A 4R8PD 4J8XB 5C3IC 5AV8D 3H0MC 3X1SA 5AV9B 3KUYC 4WU8B 3F6TA 3W97B 5GSUB 4WNNB 5FUGB 3KUYD 1HQ3B 3A6NB 4H9NA 4KUDC 5B2IC 1P3BA 4Z66B 1H3OA 5B1MB 3X1VC 4KUDD 5GT3A 2ZM5A 3AZJC 5BO0B 5JA4A 5B2ID 1P3LB 3X1VD 1Q9CA 5AVCA 5JRGB 3AZJD 4M6BA 3MGRA 3AFAA 4ZUXB 4NE3A 3V9RA 1HTAA 3AZKC 4ZBJC 1P3MC 3REKA 3A1KA 2Y2OA 3AZKD 3MGPC 5B0ZC 1P3KC 1P3MD 5AY8A 3MGPD 5B0ZD 1P3KD 3KWQC 2F8NH 1P3AA 4WU9B 3MGSA 1AOIC 3KWQD 2Y2IA 5CPJA 3AV2B 5AVCB 3AZIA 3W96A 3MGRB 1AOID 1ZLAC 3AFAB 3AZMC 5B31A 3EPKA 3X1SC 3LZ0D 3V9RB 2G5HC 3MGQA 1ZLAD 2NQBC 1F66A 4H9QA 4H9PA 3AZMD 3X1SD 3REKB 1P34C 2ZY5A 4Z5TA 3UTAA 3B6GA 3AZFA 5CPIC 3W98B 5GT0C 2HIOC 1P34D 4XZQB 1TZYA 5CPID 5GT0D 2CV5C 3X1UB 3MGSB 5B31G 1P3PA 3O62A 2PYOC 5B40C 3AZIB 3NQUA 3AZHA 2CV5D 3W96B 3VH6T 5CHLB 4DRAA 4QLCA 4EO5C 1BH8B 5B40D 1M1AB 1KX4B 3RELC 5B33B 3AN2A 4YS3A 4H9QB 4JJNA 5B1LA 3TU4C 3W99A 4Z5TB 3RELD 4XUJB 1P3GB 3KSYA 3REIC 2FJ7B 5B24A 3AZEC 3TU4D 2IO5C 3AL0C 5BNXB 3REID 1P3AC 2F8NG 3VH5W 3AZED 3X1TC 2BYKA 5CPJC 5AVBC 4G92B 5CPKC 1P3AD 3MNNA 2HUEB 3X1TD 5GXQB 5CPJD 5AVBD 5CPKD 5B31C 3WAAA 3AN2B 4KHAA 4YS3B 3B0CW 5B31D 5AV6B 4YM6C 1ID3A 2FFFB 3VH5T 3LJAC 4J8VB 4J8XA 5B2JA 1U35A 3LELA 4YM6D 1M18C 4H9SC 5E5AA 3LJAD 4J8WA 3B0BA 5AV9A 1TAFB 1P3IA 4WZSB 4WU8A 1EQZA 1M18D 5FUGA 3O62C 1P3PC 3AZLA 5F99C 2L5AA 3MNNB 2LY8A 2NZDC 3B0CT 5B32G 3C1CC 5DNMC 3A6NA 1P3OA 1P3PD 3O62D 2JE5A 5F99D 1S32C 3C1BC 2NZDD 4Z66A 2Y2MA 1KX3C 3C1CD 4R8PB 5DNMD 3UTBC 2F8ND 3H0RC 3WAAB 1KU5A 4KHAB 1PZRA 1S32D 5AV8B 3C1BD 1KX3D 4J8UC 3UTBD 3W99C 4H9RA 5B2JB 1U35B 3LELB 4J8UD 4ZUXA 3W99D 5E5AB 3AZGB 1P3FC 4J8WB 3REJA 2ZY4A 1P3IB 2Y2HA 1EQZB 1R4VA 1F1EA 1P3FD 4NE5A 2Y2KA 3AZLB 2AROC 5AV5C 4G91B 4X23C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 B;  2ARO D;  5AV5 D;  4X23 D;  3WTP C;  4WU9 A;  5B32 C;  3KXB C;  3VH5 A;  1ID3 C;  3AV2 A;  3MVD A;  2RVQ C;  3WTP D;  5KDM A;  4H9R B;  4J8X C;  5B32 D;  3KXB D;  1N1J A;  1ID3 D;  2RVQ D;  1BH9 A;  3REJ B;  5AV9 C;  4J8X D;  4ZBJ B;  4AWL C;  3W97 C;  5GSU C;  5AV9 D;  5DNN C;  5B0Z B;  1HQ3 C;  3W97 D;  5GSU D;  3W98 A;  4LD9 C;  5DNN D;  3B6F A;  4XZQ A;  1HQ3 D;  5B1M C;  5BS7 C;  4LD9 D;  3X1U A;  3NQJ A;  5B1M D;  1P3L C;  1B6W A;  3MVD B;  5JRG C;  5KDM B;  3LZ0 C;  1KX5 B;  1N1J B;  2YFW A;  1P3L D;  3WKJ A;  4ZUX C;  1BH8 A;  5JRG D;  1BH9 B;  2NQB B;  1M1A A;  1KX4 A;  5B33 A;  4ZUX D;  3B0D B;  3AYW B;  3R45 B;  3VH6 W;  5CPI B;  2HIO B;  4XUJ A;  1P3G A;  2FJ7 A;  2CWE A;  2YFV B;  3B6F B;  1P3B C;  5BNX A;  2CV5 B;  5GT3 C;  4WU9 C;  1P3B D;  3NQJ B;  2PYO B;  4HGA C;  3LZ1 A;  3AV2 C;  1BFM A;  4NFT A;  5GT3 D;  5AVC C;  4WU9 D;  5GXQ A;  3MGR C;  2YFW B;  3AV2 D;  3AFA C;  3WKJ B;  3AZN A;  5AVC D;  3MGR D;  3AFA D;  3REK C;  5AV6 A;  3UT9 A;  4J8V A;  3REK D;  5AY8 C;  1TAF A;  5G49 B;  4KGC A;  5AY8 D;  3X1U C;  3MGS C;  5CPK B;  3LZ1 B;  5BNV A;  2BYM B;  3AV1 A;  5B0Y A;  3AZI C;  3W96 C;  1M19 B;  3X1U D;  3MGS D;  3REH A;  3AZN B;  3AZI D;  3W96 D;  3MGQ C;  4R8P A;  1F66 C;  4YM6 B;  5AV8 A;  3MGQ D;  3UT9 B;  4Z5T C;  3UTA C;  1F66 D;  3B6G C;  2JSS A;  3AZF C;  1P3G C;  1M18 B;  2FJ7 C;  3AZG A;  4Z5T D;  1TZY C;  3UTA D;  3B6G D;  1P3G D;  3AZF D;  2FJ7 D;  4KGC B;  5CP6 B;  5F99 B;  1TZY D;  2NZD B;  5BNV B;  4G92 C;  3AV1 B;  4KUD A;  5B0Y B;  2HUE C;  3VH6 A;  3AZH C;  5B2I A;  3REH B;  1S32 B;  4QLC C;  3WA9 A;  3X1V A;  3AZJ A;  3AZH D;  4QLC D;  3AN2 C;  4J8U B;  4CAY B;  4YS3 C;  4JJN C;  5B1L C;  3AN2 D;  4YS3 D;  5C3I B;  5B24 C;  4H9O B;  4JJN D;  5B1L D;  1A7W A;  3KUY B;  5B24 D;  1P3M A;  3MGP A;  5B0Z A;  1P3K A;  5AV5 B;  3MNN C;  4X23 B;  4KUD B;  5B2I B;  3KWQ A;  3X1V B;  3MNN D;  3AZJ B;  4UUZ B;  3KXB B;  3WAA C;  1ZLA A;  3WAA D;  1KX5 A;  5B2J C;  1U35 C;  4E45 A;  3AZM A;  3LEL C;  5E5A C;  3AZG C;  4J8W C;  3AZK B;  2NQB A;  1P3I C;  5B2J D;  5BT1 C;  1U35 D;  1B67 A;  4AWL B;  3LEL D;  1P3M B;  4WU8 C;  1P34 A;  1EQZ C;  5DNN B;  5E5A D;  4DRB A;  3AZG D;  4J8W D;  3AYW A;  3MGP B;  3R45 A;  1P3I D;  1P3K B;  5BT1 D;  3AZL C;  5CPI A;  5GT0 A;  2HIO A;  4WU8 D;  1EQZ D;  4LD9 B;  4G91 C;  3A6N C;  1P3O C;  2YFV A;  3KWQ B;  3AZL D;  3WA9 C;  4Z66 C;  2CV5 A;  3A6N D;  1P3O D;  1AOI B;  3WA9 D;  2PYO A;  5B40 A;  4Z66 D;  3LZ0 B;  1ZLA B;  3AZM B;  3X1S B;  3REJ C;  3REL A;  1P34 B;  3TU4 A;  3REJ D;  3REI A;  4H9N B;  5GT0 B;  3AZE A;  1P3B B;  4CSR A;  1H3O B;  5GT3 B;  5JA4 B;  5G49 A;  3X1T A;  4HGA B;  5AVB A;  5CPK A;  5B40 B;  1WWI A;  2BYM A;  3MVD C;  1M19 A;  1KX5 C;  4EO5 B;  3MVD D;  3REL B;  1KX5 D;  4YM6 A;  3B0D C;  3WTP E;  3TU4 B;  3LJA A;  3AYW C;  2NQB D;  3REI B;  1M18 A;  5AY8 B;  4H9S A;  3AZE B;  3AYW D;  3W98 C;  2IO5 B;  4CSR B;  3B6F C;  4XZQ C;  1P3A B;  2HIO D;  3X1T B;  3W98 D;  3B6F D;  5CPJ B;  5CP6 A;  4XZQ D;  5AVB B;  5F99 A;  2NZD A;  3C1C A;  2F8N A;  5DNM A;  4Z2M H;  2PYO D;  1S32 A;  5B31 B;  3C1B A;  1KX3 A;  3WKJ C;  3MGQ B;  3UTB A;  1JFI A;  1F66 B;  1M1A C;  4H9P B;  1KX4 C;  5B33 C;  4J8U A;  3WKJ D;  4CAY A;  3LJA B;  3UTA B;  3B6G B;  3AZF B;  1M1A D;  1KX4 D;  5B33 D;  4XUJ C;  4WV4 B;  1P3F A;  4H9O A;  1TZY B;  3KUY A;  4XUJ D;  1P3P B;  3O62 B;  3LZ1 C;  3NQU B;  3AZH B;  2ARO A;  5AV5 A;  3C1C B;  2F8N B;  4X23 A;  5DNM B;  1M19 C;  4QLC B;  5GXQ C;  4NE6 A;  3LZ1 D;  3C1B B;  1KX3 B;  3AZN C;  3UTB B;  1JFI B;  3WTP A;  1M19 D;  4UUZ A;  5GXQ D;  1ULY A;  5B32 A;  3KXB A;  4JJN B;  5B1L B;  3AZN D;  3W99 B;  5AV6 C;  3UT9 C;  5B24 B;  4J8V C;  1P3F B;  5AV6 D;  3UT9 D;  3AZK A;  4J8V D;  1P3O B;  4KGC C;  3W97 A;  5GSU A;  2BYK B;  4WNN A;  5DNN A;  5CP6 C;  2F8N K;  1WWS A;  4E44 A;  1HQ3 A;  2ARO B;  3AV1 C;  4KGC D;  4Z2M G;  5B0Y C;  4LD9 A;  5CP6 D;  3REH C;  5B1M A;  3AV1 D;  5BS7 A;  5B0Y D;  3WTP B;  5BO0 A;  4R8P C;  5B32 B;  3REH D;  1AOI A;  1P3L A;  1ID3 B;  5AV8 C;  5JRG A;  3LZ0 A;  4R8P D;  4J8X B;  5C3I C;  5AV8 D;  3X1S A;  5AV9 B;  3KUY C;  4WU8 B;  3W97 B;  5GSU B;  4WNN B;  5FUG B;  3KUY D;  1HQ3 B;  3A6N B;  4H9N A;  4KUD C;  5B2I C;  1P3B A;  4Z66 B;  1H3O A;  5B1M B;  3X1V C;  4KUD D;  5GT3 A;  3AZJ C;  5BO0 B;  5JA4 A;  5B2I D;  1P3L B;  3X1V D;  1Q9C A;  5AVC A;  5JRG B;  3AZJ D;  4M6B A;  3MGR A;  3AFA A;  4ZUX B;  4NE3 A;  3V9R A;  1HTA A;  3AZK C;  4ZBJ C;  1P3M C;  3REK A;  3AZK D;  3MGP C;  5B0Z C;  1P3K C;  1P3M D;  5AY8 A;  3MGP D;  5B0Z D;  1P3K D;  3KWQ C;  2F8N H;  1P3A A;  4WU9 B;  3MGS A;  1AOI C;  3KWQ D;  5CPJ A;  3AV2 B;  5AVC B;  3AZI A;  3W96 A;  3MGR B;  1AOI D;  1ZLA C;  3AFA B;  3AZM C;  5B31 A;  3X1S C;  3LZ0 D;  3V9R B;  3MGQ A;  1ZLA D;  2NQB C;  1F66 A;  4H9Q A;  4H9P A;  3AZM D;  3X1S D;  3REK B;  1P34 C;  4Z5T A;  3UTA A;  3B6G A;  3AZF A;  5CPI C;  3W98 B;  5GT0 C;  2HIO C;  1P34 D;  4XZQ B;  1TZY A;  5CPI D;  5GT0 D;  2CV5 C;  3X1U B;  3MGS B;  5B31 G;  1P3P A;  3O62 A;  2PYO C;  5B40 C;  3AZI B;  3NQU A;  3AZH A;  2CV5 D;  3W96 B;  3VH6 T;  5CHL B;  4DRA A;  4QLC A;  4EO5 C;  1BH8 B;  5B40 D;  1M1A B;  1KX4 B;  3REL C;  5B33 B;  3AN2 A;  4YS3 A;  4H9Q B;  4JJN A;  5B1L A;  3TU4 C;  3W99 A;  4Z5T B;  3REL D;  4XUJ B;  1P3G B;  3KSY A;  3REI C;  2FJ7 B;  5B24 A;  3AZE C;  3TU4 D;  2IO5 C;  5BNX B;  3REI D;  1P3A C;  2F8N G;  3VH5 W;  3AZE D;  3X1T C;  2BYK A;  5CPJ C;  5AVB C;  4G92 B;  5CPK C;  1P3A D;  3MNN A;  2HUE B;  3X1T D;  5GXQ B;  5CPJ D;  5AVB D;  5CPK D;  5B31 C;  3WAA A;  3AN2 B;  4KHA A;  4YS3 B;  3B0C W;  5B31 D;  5AV6 B;  4YM6 C;  1ID3 A;  3VH5 T;  3LJA C;  4J8V B;  4J8X A;  5B2J A;  1U35 A;  3LEL A;  4YM6 D;  1M18 C;  4H9S C;  5E5A A;  3LJA D;  4J8W A;  3B0B A;  5AV9 A;  1TAF B;  1P3I A;  4WZS B;  4WU8 A;  1EQZ A;  1M18 D;  5FUG A;  3O62 C;  1P3P C;  3AZL A;  5F99 C;  2L5A A;  3MNN B;  2LY8 A;  2NZD C;  3B0C T;  5B32 G;  3C1C C;  5DNM C;  3A6N A;  1P3O A;  1P3P D;  3O62 D;  5F99 D;  1S32 C;  3C1B C;  2NZD D;  4Z66 A;  1KX3 C;  3C1C D;  4R8P B;  5DNM D;  3UTB C;  2F8N D;  3WAA B;  1KU5 A;  4KHA B;  1S32 D;  5AV8 B;  3C1B D;  1KX3 D;  4J8U C;  3UTB D;  3W99 C;  4H9R A;  5B2J B;  1U35 B;  3LEL B;  4J8U D;  4ZUX A;  3W99 D;  5E5A B;  3AZG B;  1P3F C;  4J8W B;  3REJ A;  1P3I B;  1EQZ B;  1R4V A;  1F1E A;  1P3F D;  4NE5 A;  3AZL B;  2ARO C;  5AV5 C;  4G91 B;  4X23 C; 
#chains in the Genus database with same CATH topology
 3WA9 B;  2ARO D;  5AV5 D;  4X23 D;  3WTP C;  2Y2Q A;  4WU9 A;  5B32 C;  3KXB C;  3VH5 A;  1ID3 C;  3AV2 A;  3MVD A;  2RVQ C;  3WTP D;  5KDM A;  4H9R B;  4J8X C;  5B32 D;  3KXB D;  1N1J A;  1ID3 D;  2RVQ D;  1BH9 A;  3REJ B;  5AV9 C;  4J8X D;  4ZBJ B;  3A1I A;  4AWL C;  3W97 C;  5GSU C;  5AV9 D;  5DNN C;  5B0Z B;  1HQ3 C;  3W97 D;  5GSU D;  3W98 A;  4LD9 C;  5DNN D;  3B6F A;  4XZQ A;  1HQ3 D;  5B1M C;  5BS7 C;  4LD9 D;  3X1U A;  3NQJ A;  5B1M D;  1P3L C;  3IP4 C;  1B6W A;  3MVD B;  5JRG C;  5KDM B;  3LZ0 C;  1KX5 B;  1N1J B;  2YFW A;  1P3L D;  3WKJ A;  4ZUX C;  1BH8 A;  5JRG D;  1BH9 B;  2NQB B;  3EPL A;  2JCH A;  1M1A A;  1KX4 A;  2Y2G A;  5B33 A;  3EG5 B;  4ZUX D;  3B0D B;  3AYW B;  3R45 B;  3VH6 W;  5CPI B;  2HIO B;  4XUJ A;  1P3G A;  2FJ7 A;  2CWE A;  2YFV B;  3B6F B;  1P3B C;  5BNX A;  2CV5 B;  5GT3 C;  4WU9 C;  1P3B D;  3NQJ B;  2PYO B;  3P5J B;  4HGA C;  3LZ1 A;  3AV2 C;  1BFM A;  4NFT A;  5GT3 D;  5AVC C;  4WU9 D;  5GXQ A;  3MGR C;  2YFW B;  3AV2 D;  3AFA C;  3WKJ B;  3AZN A;  5AVC D;  3MGR D;  3AFA D;  2DQN C;  5AV6 A;  3REK C;  3UT9 A;  4J8V A;  3REK D;  2J8P A;  5AY8 C;  1TAF A;  5G49 B;  4KGC A;  5AY8 D;  3X1U C;  3MGS C;  5CPK B;  3LZ1 B;  5BNV A;  2BYM B;  3AV1 A;  5B0Y A;  3AZI C;  3W96 C;  1M19 B;  3X1U D;  3MGS D;  3REH A;  3AZN B;  3AZI D;  3W96 D;  3MGQ C;  4R8P A;  1F66 C;  4YM6 B;  2Y2L A;  5AV8 A;  3MGQ D;  2VQR A;  3UT9 B;  4Z5T C;  3UTA C;  1F66 D;  3B6G C;  2JSS A;  2XD5 A;  3AZF C;  1P3G C;  1M18 B;  2FJ7 C;  3AZG A;  4Z5T D;  1TZY C;  3UTA D;  2RIQ A;  3B6G D;  1P3G D;  3AZF D;  2FJ7 D;  4DQY B;  4KGC B;  5CP6 B;  5F99 B;  1TZY D;  4UPK A;  2NZD B;  5BNV B;  4G92 C;  3AV1 B;  4KUD A;  5B0Y B;  2HUE C;  3VH6 A;  3AZH C;  5B2I A;  3REH B;  1S32 B;  4QLC C;  3WA9 A;  3X1V A;  3AZJ A;  3AZH D;  4QLC D;  3AN2 C;  4J8U B;  2ZY2 A;  4CAY B;  4YS3 C;  4JJN C;  5B1L C;  3AN2 D;  4YS3 D;  5C3I B;  5B24 C;  4H9O B;  4JJN D;  5B1L D;  1A7W A;  2UWX A;  3EPJ A;  3KUY B;  5B24 D;  1P3M A;  2Y2N A;  3MGP A;  5B0Z A;  1P3K A;  5AV5 B;  3MNN C;  4X23 B;  4KUD B;  5B2I B;  2F2A C;  3KWQ A;  3X1V B;  3MNN D;  3AZJ B;  4UUZ B;  3KXB B;  3WAA C;  1ZLA A;  2Y2J A;  3WAA D;  1KX5 A;  5B2J C;  1U35 C;  4E45 A;  3AZM A;  3LEL C;  5E5A C;  3AZG C;  4J8W C;  3AZK B;  2NQB A;  2G5I C;  1P3I C;  5B2J D;  5BT1 C;  1U35 D;  1B67 A;  4AWL B;  3LEL D;  1P3M B;  4WU8 C;  1P34 A;  1EQZ C;  5DNN B;  5E5A D;  4DRB A;  3AZG D;  4J8W D;  3AYW A;  3MGP B;  3R45 A;  1P3I D;  1P3K B;  5BT1 D;  3AZL C;  2ZY3 A;  5CPI A;  5GT0 A;  2HIO A;  4WU8 D;  1EQZ D;  4LD9 B;  4G91 C;  3H0L C;  3A6N C;  1P3O C;  2YFV A;  3KWQ B;  3AZL D;  3WA9 C;  4Z66 C;  2CV5 A;  2XD1 A;  3A6N D;  1P3O D;  1AOI B;  3WA9 D;  2PYO A;  5B40 A;  4Z66 D;  3LZ0 B;  1ZLA B;  3AZM B;  3X1S B;  2Y2P A;  3REJ C;  3REL A;  1Z2C B;  1P34 B;  3TU4 A;  3REJ D;  3REI A;  4H9N B;  5GT0 B;  3AZE A;  1P3B B;  4CSR A;  1H3O B;  5GT3 B;  5JA4 B;  5G49 A;  3X1T A;  4HGA B;  5AVB A;  5CPK A;  5B40 B;  2W8S A;  1WWI A;  2BYM A;  3MVD C;  1M19 A;  1KX5 C;  4EO5 B;  1T3U A;  3MVD D;  3REL B;  1KX5 D;  4YM6 A;  3B0D C;  3WTP E;  3TU4 B;  3LJA A;  3AYW C;  2NQB D;  3REI B;  1M18 A;  5AY8 B;  4H9S A;  3AZE B;  3AYW D;  3W98 C;  2IO5 B;  4CSR B;  3B6F C;  4XZQ C;  1P3A B;  2HIO D;  3X1T B;  3W98 D;  3B6F D;  5CPJ B;  5CP6 A;  4XZQ D;  3EPH A;  5AVB B;  5F99 A;  2NZD A;  3C1C A;  2F8N A;  5DNM A;  4Z2M H;  2PYO D;  1S32 A;  5B31 B;  3C1B A;  1KX3 A;  3WKJ C;  3MGQ B;  3UTB A;  1JFI A;  1F66 B;  1M1A C;  4H9P B;  1KX4 C;  5B33 C;  4J8U A;  3WKJ D;  4CAY A;  3LJA B;  3UTA B;  1W2E A;  3B6G B;  3AZF B;  1M1A D;  1KX4 D;  5B33 D;  4XUJ C;  4WV4 B;  1P3F A;  4H9O A;  1TZY B;  3KUY A;  4XUJ D;  1P3P B;  3O62 B;  3LZ1 C;  3NQU B;  3AZH B;  2ARO A;  5AV5 A;  3C1C B;  2F8N B;  4X23 A;  5DNM B;  3KFU G;  1M19 C;  4QLC B;  5GXQ C;  4NE6 A;  3LZ1 D;  3C1B B;  1KX3 B;  3AZN C;  3UTB B;  1JFI B;  2DF4 C;  3WTP A;  1M19 D;  4UUZ A;  5GXQ D;  1ULY A;  5B32 A;  3KXB A;  4JJN B;  5B1L B;  3AZN D;  3W99 B;  5AV6 C;  3UT9 C;  5B24 B;  4J8V C;  1P3F B;  5AV6 D;  2BG1 A;  3UT9 D;  3AZK A;  4J8V D;  1P3O B;  4KGC C;  3W97 A;  5GSU A;  2BYK B;  5DNN A;  5CP6 C;  4WNN A;  2F8N K;  1WWS A;  4E44 A;  1HQ3 A;  2ARO B;  3FDD A;  3AV1 C;  4KGC D;  4Z2M G;  5B0Y C;  4LD9 A;  5CP6 D;  3REH C;  5B1M A;  3AV1 D;  4WJ3 C;  5BS7 A;  5B0Y D;  3WTP B;  5BO0 A;  4R8P C;  5B32 B;  3REH D;  1AOI A;  1P3L A;  1ID3 B;  5AV8 C;  5JRG A;  3LZ0 A;  4R8P D;  4J8X B;  5C3I C;  5AV8 D;  3H0M C;  3X1S A;  5AV9 B;  3KUY C;  4WU8 B;  3F6T A;  3W97 B;  5GSU B;  4WNN B;  5FUG B;  3KUY D;  1HQ3 B;  3A6N B;  4H9N A;  4KUD C;  5B2I C;  1P3B A;  4Z66 B;  1H3O A;  5B1M B;  3X1V C;  4KUD D;  5GT3 A;  2ZM5 A;  3AZJ C;  5BO0 B;  5JA4 A;  5B2I D;  1P3L B;  3X1V D;  1Q9C A;  5AVC A;  5JRG B;  3AZJ D;  4M6B A;  3MGR A;  3AFA A;  4ZUX B;  4NE3 A;  3V9R A;  1HTA A;  3AZK C;  4ZBJ C;  1P3M C;  3REK A;  3A1K A;  2Y2O A;  3AZK D;  3MGP C;  5B0Z C;  1P3K C;  1P3M D;  5AY8 A;  3MGP D;  5B0Z D;  1P3K D;  3KWQ C;  2F8N H;  1P3A A;  4WU9 B;  3MGS A;  1AOI C;  3KWQ D;  2Y2I A;  5CPJ A;  3AV2 B;  5AVC B;  3AZI A;  3W96 A;  3MGR B;  1AOI D;  1ZLA C;  3AFA B;  3AZM C;  5B31 A;  3EPK A;  3X1S C;  3LZ0 D;  3V9R B;  2G5H C;  3MGQ A;  1ZLA D;  2NQB C;  1F66 A;  4H9Q A;  4H9P A;  3AZM D;  3X1S D;  3REK B;  1P34 C;  2ZY5 A;  4Z5T A;  3UTA A;  3B6G A;  3AZF A;  5CPI C;  3W98 B;  5GT0 C;  2HIO C;  1P34 D;  4XZQ B;  1TZY A;  5CPI D;  5GT0 D;  2CV5 C;  3X1U B;  3MGS B;  5B31 G;  1P3P A;  3O62 A;  2PYO C;  5B40 C;  3AZI B;  3NQU A;  3AZH A;  2CV5 D;  3W96 B;  3VH6 T;  5CHL B;  4DRA A;  4QLC A;  4EO5 C;  1BH8 B;  5B40 D;  1M1A B;  1KX4 B;  3REL C;  5B33 B;  3AN2 A;  4YS3 A;  4H9Q B;  4JJN A;  5B1L A;  3TU4 C;  3W99 A;  4Z5T B;  3REL D;  4XUJ B;  1P3G B;  3KSY A;  3REI C;  2FJ7 B;  5B24 A;  3AZE C;  3TU4 D;  2IO5 C;  3AL0 C;  5BNX B;  3REI D;  1P3A C;  2F8N G;  3VH5 W;  3AZE D;  3X1T C;  2BYK A;  5CPJ C;  5AVB C;  4G92 B;  5CPK C;  1P3A D;  3MNN A;  2HUE B;  3X1T D;  5GXQ B;  5CPJ D;  5AVB D;  5CPK D;  5B31 C;  3WAA A;  3AN2 B;  4KHA A;  4YS3 B;  3B0C W;  5B31 D;  5AV6 B;  4YM6 C;  1ID3 A;  2FFF B;  3VH5 T;  3LJA C;  4J8V B;  4J8X A;  5B2J A;  1U35 A;  3LEL A;  4YM6 D;  1M18 C;  4H9S C;  5E5A A;  3LJA D;  4J8W A;  3B0B A;  5AV9 A;  1TAF B;  1P3I A;  4WZS B;  4WU8 A;  1EQZ A;  1M18 D;  5FUG A;  3O62 C;  1P3P C;  3AZL A;  5F99 C;  2L5A A;  3MNN B;  2LY8 A;  2NZD C;  3B0C T;  5B32 G;  3C1C C;  5DNM C;  3A6N A;  1P3O A;  1P3P D;  3O62 D;  2JE5 A;  5F99 D;  1S32 C;  3C1B C;  2NZD D;  4Z66 A;  2Y2M A;  1KX3 C;  3C1C D;  4R8P B;  5DNM D;  3UTB C;  2F8N D;  3H0R C;  3WAA B;  1KU5 A;  4KHA B;  1PZR A;  1S32 D;  5AV8 B;  3C1B D;  1KX3 D;  4J8U C;  3UTB D;  3W99 C;  4H9R A;  5B2J B;  1U35 B;  3LEL B;  4J8U D;  4ZUX A;  3W99 D;  5E5A B;  3AZG B;  1P3F C;  4J8W B;  3REJ A;  2ZY4 A;  1P3I B;  2Y2H A;  1EQZ B;  1R4V A;  1F1E A;  1P3F D;  4NE5 A;  2Y2K A;  3AZL B;  2ARO C;  5AV5 C;  4G91 B;  4X23 C; 
#chains in the Genus database with same CATH homology
 3WA9 B;  2ARO D;  5AV5 D;  4X23 D;  3WTP C;  2Y2Q A;  4WU9 A;  5B32 C;  3KXB C;  3VH5 A;  1ID3 C;  3AV2 A;  3MVD A;  2RVQ C;  3WTP D;  5KDM A;  4H9R B;  4J8X C;  5B32 D;  3KXB D;  1N1J A;  1ID3 D;  2RVQ D;  1BH9 A;  3REJ B;  5AV9 C;  4J8X D;  4ZBJ B;  3A1I A;  4AWL C;  3W97 C;  5GSU C;  5AV9 D;  5DNN C;  5B0Z B;  1HQ3 C;  3W97 D;  5GSU D;  3W98 A;  4LD9 C;  5DNN D;  3B6F A;  4XZQ A;  1HQ3 D;  5B1M C;  5BS7 C;  4LD9 D;  3X1U A;  3NQJ A;  5B1M D;  1P3L C;  3IP4 C;  1B6W A;  3MVD B;  5JRG C;  5KDM B;  3LZ0 C;  1KX5 B;  1N1J B;  2YFW A;  1P3L D;  3WKJ A;  4ZUX C;  1BH8 A;  5JRG D;  1BH9 B;  2NQB B;  3EPL A;  2JCH A;  1M1A A;  1KX4 A;  2Y2G A;  5B33 A;  3EG5 B;  4ZUX D;  3B0D B;  3AYW B;  3R45 B;  3VH6 W;  5CPI B;  2HIO B;  4XUJ A;  1P3G A;  2FJ7 A;  2CWE A;  2YFV B;  3B6F B;  1P3B C;  5BNX A;  2CV5 B;  5GT3 C;  4WU9 C;  1P3B D;  3NQJ B;  2PYO B;  3P5J B;  4HGA C;  3LZ1 A;  3AV2 C;  1BFM A;  4NFT A;  5GT3 D;  5AVC C;  4WU9 D;  5GXQ A;  3MGR C;  2YFW B;  3AV2 D;  3AFA C;  3WKJ B;  3AZN A;  5AVC D;  3MGR D;  3AFA D;  2DQN C;  5AV6 A;  3REK C;  3UT9 A;  4J8V A;  3REK D;  2J8P A;  5AY8 C;  1TAF A;  5G49 B;  4KGC A;  5AY8 D;  3X1U C;  3MGS C;  5CPK B;  3LZ1 B;  5BNV A;  2BYM B;  3AV1 A;  5B0Y A;  3AZI C;  3W96 C;  1M19 B;  3X1U D;  3MGS D;  3REH A;  3AZN B;  3AZI D;  3W96 D;  3MGQ C;  4R8P A;  1F66 C;  4YM6 B;  2Y2L A;  5AV8 A;  3MGQ D;  2VQR A;  3UT9 B;  4Z5T C;  3UTA C;  1F66 D;  3B6G C;  2JSS A;  2XD5 A;  3AZF C;  1P3G C;  1M18 B;  2FJ7 C;  3AZG A;  4Z5T D;  1TZY C;  3UTA D;  2RIQ A;  3B6G D;  1P3G D;  3AZF D;  2FJ7 D;  4DQY B;  4KGC B;  5CP6 B;  5F99 B;  1TZY D;  4UPK A;  2NZD B;  5BNV B;  4G92 C;  3AV1 B;  4KUD A;  5B0Y B;  2HUE C;  3VH6 A;  3AZH C;  5B2I A;  3REH B;  1S32 B;  4QLC C;  3WA9 A;  3X1V A;  3AZJ A;  3AZH D;  4QLC D;  3AN2 C;  4J8U B;  2ZY2 A;  4CAY B;  4YS3 C;  4JJN C;  5B1L C;  3AN2 D;  4YS3 D;  5C3I B;  5B24 C;  4H9O B;  4JJN D;  5B1L D;  1A7W A;  2UWX A;  3EPJ A;  3KUY B;  5B24 D;  1P3M A;  2Y2N A;  3MGP A;  5B0Z A;  1P3K A;  5AV5 B;  3MNN C;  4X23 B;  4KUD B;  5B2I B;  2F2A C;  3KWQ A;  3X1V B;  3MNN D;  3AZJ B;  4UUZ B;  3KXB B;  3WAA C;  1ZLA A;  2Y2J A;  3WAA D;  1KX5 A;  5B2J C;  1U35 C;  4E45 A;  3AZM A;  3LEL C;  5E5A C;  3AZG C;  4J8W C;  3AZK B;  2NQB A;  2G5I C;  1P3I C;  5B2J D;  5BT1 C;  1U35 D;  1B67 A;  4AWL B;  3LEL D;  1P3M B;  4WU8 C;  1P34 A;  1EQZ C;  5DNN B;  5E5A D;  4DRB A;  3AZG D;  4J8W D;  3AYW A;  3MGP B;  3R45 A;  1P3I D;  1P3K B;  5BT1 D;  3AZL C;  2ZY3 A;  5CPI A;  5GT0 A;  2HIO A;  4WU8 D;  1EQZ D;  4LD9 B;  4G91 C;  3H0L C;  3A6N C;  1P3O C;  2YFV A;  3KWQ B;  3AZL D;  3WA9 C;  4Z66 C;  2CV5 A;  2XD1 A;  3A6N D;  1P3O D;  1AOI B;  3WA9 D;  2PYO A;  5B40 A;  4Z66 D;  3LZ0 B;  1ZLA B;  3AZM B;  3X1S B;  2Y2P A;  3REJ C;  3REL A;  1Z2C B;  1P34 B;  3TU4 A;  3REJ D;  3REI A;  4H9N B;  5GT0 B;  3AZE A;  1P3B B;  4CSR A;  1H3O B;  5GT3 B;  5JA4 B;  5G49 A;  3X1T A;  4HGA B;  5AVB A;  5CPK A;  5B40 B;  2W8S A;  1WWI A;  2BYM A;  3MVD C;  1M19 A;  1KX5 C;  4EO5 B;  1T3U A;  3MVD D;  3REL B;  1KX5 D;  4YM6 A;  3B0D C;  3WTP E;  3TU4 B;  3LJA A;  3AYW C;  2NQB D;  3REI B;  1M18 A;  5AY8 B;  4H9S A;  3AZE B;  3AYW D;  3W98 C;  2IO5 B;  4CSR B;  3B6F C;  4XZQ C;  1P3A B;  2HIO D;  3X1T B;  3W98 D;  3B6F D;  5CPJ B;  5CP6 A;  4XZQ D;  3EPH A;  5AVB B;  5F99 A;  2NZD A;  3C1C A;  2F8N A;  5DNM A;  4Z2M H;  2PYO D;  1S32 A;  5B31 B;  3C1B A;  1KX3 A;  3WKJ C;  3MGQ B;  3UTB A;  1JFI A;  1F66 B;  1M1A C;  4H9P B;  1KX4 C;  5B33 C;  4J8U A;  3WKJ D;  4CAY A;  3LJA B;  3UTA B;  1W2E A;  3B6G B;  3AZF B;  1M1A D;  1KX4 D;  5B33 D;  4XUJ C;  4WV4 B;  1P3F A;  4H9O A;  1TZY B;  3KUY A;  4XUJ D;  1P3P B;  3O62 B;  3LZ1 C;  3NQU B;  3AZH B;  2ARO A;  5AV5 A;  3C1C B;  2F8N B;  4X23 A;  5DNM B;  3KFU G;  1M19 C;  4QLC B;  5GXQ C;  4NE6 A;  3LZ1 D;  3C1B B;  1KX3 B;  3AZN C;  3UTB B;  1JFI B;  2DF4 C;  3WTP A;  1M19 D;  4UUZ A;  5GXQ D;  1ULY A;  5B32 A;  3KXB A;  4JJN B;  5B1L B;  3AZN D;  3W99 B;  5AV6 C;  3UT9 C;  5B24 B;  4J8V C;  1P3F B;  5AV6 D;  2BG1 A;  3UT9 D;  3AZK A;  4J8V D;  1P3O B;  4KGC C;  3W97 A;  5GSU A;  2BYK B;  5DNN A;  5CP6 C;  4WNN A;  2F8N K;  1WWS A;  4E44 A;  1HQ3 A;  2ARO B;  3FDD A;  3AV1 C;  4KGC D;  4Z2M G;  5B0Y C;  4LD9 A;  5CP6 D;  3REH C;  5B1M A;  3AV1 D;  4WJ3 C;  5BS7 A;  5B0Y D;  3WTP B;  5BO0 A;  4R8P C;  5B32 B;  3REH D;  1AOI A;  1P3L A;  1ID3 B;  5AV8 C;  5JRG A;  3LZ0 A;  4R8P D;  4J8X B;  5C3I C;  5AV8 D;  3H0M C;  3X1S A;  5AV9 B;  3KUY C;  4WU8 B;  3F6T A;  3W97 B;  5GSU B;  4WNN B;  5FUG B;  3KUY D;  1HQ3 B;  3A6N B;  4H9N A;  4KUD C;  5B2I C;  1P3B A;  4Z66 B;  1H3O A;  5B1M B;  3X1V C;  4KUD D;  5GT3 A;  2ZM5 A;  3AZJ C;  5BO0 B;  5JA4 A;  5B2I D;  1P3L B;  3X1V D;  1Q9C A;  5AVC A;  5JRG B;  3AZJ D;  4M6B A;  3MGR A;  3AFA A;  4ZUX B;  4NE3 A;  3V9R A;  1HTA A;  3AZK C;  4ZBJ C;  1P3M C;  3REK A;  3A1K A;  2Y2O A;  3AZK D;  3MGP C;  5B0Z C;  1P3K C;  1P3M D;  5AY8 A;  3MGP D;  5B0Z D;  1P3K D;  3KWQ C;  2F8N H;  1P3A A;  4WU9 B;  3MGS A;  1AOI C;  3KWQ D;  2Y2I A;  5CPJ A;  3AV2 B;  5AVC B;  3AZI A;  3W96 A;  3MGR B;  1AOI D;  1ZLA C;  3AFA B;  3AZM C;  5B31 A;  3EPK A;  3X1S C;  3LZ0 D;  3V9R B;  2G5H C;  3MGQ A;  1ZLA D;  2NQB C;  1F66 A;  4H9Q A;  4H9P A;  3AZM D;  3X1S D;  3REK B;  1P34 C;  2ZY5 A;  4Z5T A;  3UTA A;  3B6G A;  3AZF A;  5CPI C;  3W98 B;  5GT0 C;  2HIO C;  1P34 D;  4XZQ B;  1TZY A;  5CPI D;  5GT0 D;  2CV5 C;  3X1U B;  3MGS B;  5B31 G;  1P3P A;  3O62 A;  2PYO C;  5B40 C;  3AZI B;  3NQU A;  3AZH A;  2CV5 D;  3W96 B;  3VH6 T;  5CHL B;  4DRA A;  4QLC A;  4EO5 C;  1BH8 B;  5B40 D;  1M1A B;  1KX4 B;  3REL C;  5B33 B;  3AN2 A;  4YS3 A;  4H9Q B;  4JJN A;  5B1L A;  3TU4 C;  3W99 A;  4Z5T B;  3REL D;  4XUJ B;  1P3G B;  3KSY A;  3REI C;  2FJ7 B;  5B24 A;  3AZE C;  3TU4 D;  2IO5 C;  3AL0 C;  5BNX B;  3REI D;  1P3A C;  2F8N G;  3VH5 W;  3AZE D;  3X1T C;  2BYK A;  5CPJ C;  5AVB C;  4G92 B;  5CPK C;  1P3A D;  3MNN A;  2HUE B;  3X1T D;  5GXQ B;  5CPJ D;  5AVB D;  5CPK D;  5B31 C;  3WAA A;  3AN2 B;  4KHA A;  4YS3 B;  3B0C W;  5B31 D;  5AV6 B;  4YM6 C;  1ID3 A;  2FFF B;  3VH5 T;  3LJA C;  4J8V B;  4J8X A;  5B2J A;  1U35 A;  3LEL A;  4YM6 D;  1M18 C;  4H9S C;  5E5A A;  3LJA D;  4J8W A;  3B0B A;  5AV9 A;  1TAF B;  1P3I A;  4WZS B;  4WU8 A;  1EQZ A;  1M18 D;  5FUG A;  3O62 C;  1P3P C;  3AZL A;  5F99 C;  2L5A A;  3MNN B;  2LY8 A;  2NZD C;  3B0C T;  5B32 G;  3C1C C;  5DNM C;  3A6N A;  1P3O A;  1P3P D;  3O62 D;  2JE5 A;  5F99 D;  1S32 C;  3C1B C;  2NZD D;  4Z66 A;  2Y2M A;  1KX3 C;  3C1C D;  4R8P B;  5DNM D;  3UTB C;  2F8N D;  3H0R C;  3WAA B;  1KU5 A;  4KHA B;  1PZR A;  1S32 D;  5AV8 B;  3C1B D;  1KX3 D;  4J8U C;  3UTB D;  3W99 C;  4H9R A;  5B2J B;  1U35 B;  3LEL B;  4J8U D;  4ZUX A;  3W99 D;  5E5A B;  3AZG B;  1P3F C;  4J8W B;  3REJ A;  2ZY4 A;  1P3I B;  2Y2H A;  1EQZ B;  1R4V A;  1F1E A;  1P3F D;  4NE5 A;  2Y2K A;  3AZL B;  2ARO C;  5AV5 C;  4G91 B;  4X23 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...