3W99D

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99D00
3C1CD 4J8XB 1TAFB 5AV8D 2AROA 3WAAD 3MGSD 1P3MB 1P3FA 4LD9D 3REIB 3X1UB 5JRGD 3AZMC 3X1TC 3C1CB 5B1LD 3REHC 5GXQA 3W97A 3W99D 5AV8B 3WAAB 3UTAD 1TAFA 4LD9B 5JRGB 5AVBA 3X1UA 5E5AC 5B1LB 3WTPE 3C1CA 1EQZD 3O62C 3W99B 3WTPC 3UTAB 3AZJD 5AV8A 3WAAA 3MGSA 2BYKA 4LD9A 5B24C 4G92C 3LZ0D 1AOIC 5JRGA 1P3OC 5B40B 4Z66A 3MNNA 1EQZB 3KSYA 1P3PC 3AZJB 3MGPC 3W99A 1KX5C 3WKJD 3LZ0B 4HGAB 3MGRC 2F8NA 1U35B 2IO5B 4YS3C 2L5AA 5DNMD 1EQZA 3WKJB 5B1MA 3AZJA 5DNND 2NQBC 4WZSB 3LZ0A 4G91C 5AV5C 4R8PC 4JJNC 3AN2C 3B6GB 5DNMB 2PYOA 4E44A 5DNNB 3WKJA 5B31A 3UT9D 3AV2B 1P34D 3B0DC 2F8NK 1P3GC 1KX4C 3KWQC 4J8UD 1M1AD 4X23C 3UT9B 1P3IC 1P34B 5GT3D 1P3KC 1WWSA 4WNNB 4WU9C 3AFAD 3NQJB 5F99B 3B6FC 3UTBD 5GT3B 3RELC 1ZLAC 1HQ3B 5AV9C 1Q9CA 1ID3D 4J8VC 3AFAB 1S32C 4J8UA 1M1AA 3X1VD 3X1SC 1N1JB 3NQJA 4Z5TC 1P3LC 5CPID 5B32C 3LJAC 1ID3B 4EO5B 5B0YB 3X1VB 3AFAA 2RVQC 3KXBC 1N1JA 3UTBA 5CPIB 3X1TD 3KUYC 4YM6A 3REHD 1BH8B 3W96C 5AVCC 2YFVA 1ID3A 3V9RB 4H9RA 3VH6W 3X1VA 3AZMB 3X1TB 5CPIA 3REHB 3MVDC 1BH8A 3O62D 5B24D 4KHAB 3X1TA 2HIOA 5BO0A 1WWIA 4ZUXC 3O62B 1BH9B 4XZQD 1F66A 1P3PD 3MGPD 1KX5D 5B24B 5GT0D 4H9SA 1P3BC 2BYMB 3REKC 1P3OB 5BT1C 4KHAA 3MGRD 4YS3D 3LELA 1P3PB 3O62A 1BH9A 3MGPB 1KX5B 5GSUC 5B2IC 3AZLC 4KUDC 3AYWC 5AV5D 2BYMA 4R8PD 3MGRB 4JJND 3AN2D 5JA4B 3C1BC 4YS3B 3AZFC 4XZQA 2FJ7C 4Z2MG 1P3PA 3MGPA 1B67A 3WA9C 3TU4C 5BS7C 5GT0A 4G91B 5AV5B 2CWEA 4R8PB 4JJNB 3AN2B 4J8XA 5JA4A 4YS3A 1P3GD 1KX4D 3KWQD 1P3MA 3REIA 2CV5C 5CPKD 4QLCC 1P3ID 3B0DB 5AV5A 5B40D 4R8PA 1P3KD 4CAYB 1P3GB 4H9PB 1KX4B 3KWQB 1F1EA 3VH5T 5CPKB 1P3IB 3VH5A 1P3KB 5B1LA 3RELD 1U35D 5AV9D 3UTAA 3B0CW 1S32D 1KX4A 5C3IC 3KWQA 4XUJC 5CP6C 3X1SD 3B6FB 3AV1C 5CPKA 3RELB 4Z5TD 1P3LD 3B6GD 5AV9B 1P3KA 5B40A 3LJAD 3AZGC 3AZHC 1TZYC 1KX3C 1S32B 3REJC 3X1SB 1M19C 1BFMA 3KXBD 3VH6A 4Z5TB 3AV2D 5B0ZC 1P3LB 3LJAB 3KUYD 1U35A 5AV9A 1P3AC 3W97D 1S32A 3KXBB 4E45A 4ZBJC 3KUYB 4NE6A 5GXQC 5B32G 3B6GA 5DNMA 3W96B 3LJAA 3MVDD 3W97C 5F99D 5DNNA 5AVBC 3AZEC 1ULYA 3AV2A 1HQ3D 3MVDB 4ZUXD 3MGSC 3AZID 4LD9C 3UT9A 1P3BD 1P34A 3W98D 3REKD 4Z66C 3MNNC 4WNNA 4ZUXB 4KGCC 2NZDC 3MVDA 5B0YD 4DRBA 3AZIB 5F99A 5GSUD 5B2ID 3AZLD 1P3BB 3W98B 5GT3A 3REKB 4KUDD 3AYWD 1HQ3A 3C1BD 5BNXA 3AZFD 5B1MC 2FJ7D 3AZIA 5GSUB 3TU4D 5B2IB 3AZLB 3AZMD 4KUDB 3AYWB 3W98A 3REKA 3C1BB 3AZFB 2PYOC 2FJ7B 5B0YA 3TU4B 5B31C 5E5AD 4QLCD 5B2IA 2HUEC 3AZLA 3AYWA 5G49B 3B0CT 3WTPD 3C1BA 3NQUB 3AZFA 2FJ7A 3V9RA 4WU8C 3TU4A 1AOID 5E5AB 4QLCB 3AZMA 1P3OD 3REHA 3WTPB 5G49A 3NQUA 4G92B 4XUJD 5CP6D 1AOIB 5CPJC 3AV1D 5B33C 4H9QB 5E5AA 3AZGD 1TZYD 3WTPA 1KX3D 4J8UC 3REJD 1M1AC 5C3IB 4XUJB 5CP6B 1M19D 2NQBD 3AV1B 5B24A 1AOIA 1P3OA 5B0ZD 4H9QA 3AZGB 1TZYB 1KX3B 3REJB 1P3AD 4AWLC 1KX5A 1M19B 2NQBB 4XUJA 5CP6A 3UTBC 3AZNC 5BNXB 5B0ZB 3AZKC 3MGRA 4YM6C 1P3AB 1KX3A 1ID3C 4X23D 3REJA 5AVBD 2NQBA 3MGQC 4ZBJB 1A7WA 1M18C 4JJNA 3AZED 3AN2A 5GXQB 4WU9D 3W97B 5B2JC 4X23B 1P3AA 5AVBB 3B6FD 3AZEB 1ZLAD 2HIOC 4WU9B 4Z66D 3MNND 3LZ1C 4KGCD 2NZDD 4CAYA 1F66C 4J8VD 1P3GA 4H9PA 3MGSB 2BYKB 4X23A 4H9SC 1P3IA 1ZLAB 4NE3A 5B32D 4M6BA 4Z66B 5AV6C 3MNNB 3A6NC 3AZEA 4WU9A 3LELC 4J8WC 2F8ND 4KGCB 4J8VB 2NZDB 3VH6T 5B1MD 5AY8C 2RVQD 4H9NB 3B6FA 5B32B 3RELA 2F8NB 1ZLAA 5KDMB 3W96D 5AVCD 3AZHA 2AROC 4XZQC 2PYOD 4KGCA 2NZDA 5B1MB 4J8VA 1P3FC 1HTAA 3X1SA 3R45B 5B31D 4H9NA 5GT0C 4Z5TA 1P3LA 5B32A 2F8NG 5AVCB 4J8XC 5KDMA 2PYOB 4Z2MH 1P3MC 5B31B 3X1UC 3KXBA 3REIC 4WU8D 1R4VA 3R45A 5BNVB 2HUEB 3C1CC 3KUYA 3W96A 5AVCA 3WAAC 4CSRB 5AV8C 1H3OB 2LY8A 4WU8B 5JRGC 5B31G 5CPJD 5BNVA 5B1LC 5B33D 5BT1D 3W99C 3UTAC 4CSRA 1H3OA 1B6WA 5CPJB 4WU8A 5CPKC 5B33B 4UUZB 5B40C 1EQZC 4DRAA 4ZUXA 3AZJC 3B0BA 4J8UB 1M1AB 3WA9D 4WV4B 3LZ0C 4HGAC 1P3BA 5CPJA 4H9OB 3AZND 5B33A 2YFWB 3AZKD 1U35C 2IO5C 1JFIB 4YM6D 4UUZA 3WKJC 3WA9B 4AWLB 2CV5D 5GSUA 4KUDA 3VH5W 3MGQD 3UTBB 3AZNB 3AZKB 1M18D 4H9OA 4YM6B 3B6GC 5DNMC 2YFWA 1JFIA 2YFVB 5B2JD 4H9RB 5DNNC 2CV5B 3WA9A 3MGQB 5BS7A 3AV2C 1M18B 3AZNA 2HIOD 2F8NH 3AZKA 3LZ1D 5FUGB 5B2JB 4NE5A 1F66D 2CV5A 3UT9C 4QLCA 1P34C 3MGQA 2HIOB 5BO0B 1M18A 5AV6D 3LZ1B 3A6ND 3AZHD 3LELD 4J8WD 1F66B 5FUGA 5B2JA 5AY8D 5F99C 2JSSA 5GT3C 1HQ3C 5AV6B 3AZHB 3A6NB 3LELB 4J8WB 3LZ1A 2AROD 1KU5A 3AFAC 5AY8B 1P3FD 3AZIC 4NFTA 3AV1A 3W98C 5GXQD 5AV6A 3AZGA 2AROB 1TZYA 4XZQB 3A6NA 4J8WA 4J8XD 4EO5C 5B0YC 1P3FB 3X1VC 5AY8A 5CHLB 1P3MD 1M19A 3REID 3X1UD 5GT0B 5CPIC 5B0ZA
chains in the Genus database with same CATH superfamily
3C1CD 4J8XB 1TAFB 5AV8D 2AROA 3WAAD 3MGSD 1P3MB 1P3FA 4LD9D 3REIB 3X1UB 5JRGD 3AZMC 3X1TC 3C1CB 5B1LD 3REHC 5GXQA 2JCHA 3W97A 3W99D 5AV8B 3WAAB 3UTAD 1TAFA 4LD9B 5JRGB 5AVBA 3X1UA 5E5AC 5B1LB 3WTPE 2W8SA 2XD1A 3C1CA 1EQZD 3O62C 3W99B 3WTPC 3UTAB 3AZJD 5AV8A 3WAAA 3MGSA 2BYKA 2ZM5A 4LD9A 5B24C 4G92C 3LZ0D 1AOIC 5JRGA 1P3OC 5B40B 4Z66A 3MNNA 1EQZB 3KSYA 1P3PC 3AZJB 3MGPC 3W99A 2XD5A 1KX5C 3WKJD 3LZ0B 4HGAB 3MGRC 2F8NA 1U35B 2IO5B 4YS3C 2L5AA 5DNMD 1EQZA 3WKJB 5B1MA 3AZJA 5DNND 2ZY3A 2NQBC 4WZSB 3LZ0A 4G91C 5AV5C 4R8PC 4JJNC 3AN2C 3B6GB 5DNMB 2PYOA 4E44A 5DNNB 3WKJA 5B31A 3UT9D 3AV2B 1P34D 3B0DC 2F8NK 1P3GC 1KX4C 3KWQC 4J8UD 2G5IC 1M1AD 4X23C 3H0RC 3UT9B 1P3IC 1P34B 5GT3D 2Y2JA 1P3KC 1WWSA 4WNNB 4WU9C 3AFAD 3NQJB 5F99B 3B6FC 3UTBD 5GT3B 3RELC 1ZLAC 1HQ3B 5AV9C 1Q9CA 2G5HC 1ID3D 4J8VC 3AFAB 1S32C 4J8UA 1M1AA 3X1VD 3X1SC 1N1JB 3NQJA 4Z5TC 1P3LC 5CPID 5B32C 2FFFB 3LJAC 1ID3B 4EO5B 5B0YB 3X1VB 3AFAA 2RVQC 3KXBC 1N1JA 3UTBA 5CPIB 3X1TD 3A1IA 3KUYC 4YM6A 3REHD 1BH8B 3W96C 2RIQA 5AVCC 2YFVA 1ID3A 3V9RB 4H9RA 2Y2OA 3VH6W 3X1VA 3EPJA 3AZMB 3X1TB 5CPIA 3REHB 3MVDC 1BH8A 3O62D 2ZY4A 5B24D 4KHAB 3X1TA 2HIOA 5BO0A 1WWIA 4ZUXC 3O62B 1BH9B 4XZQD 1F66A 1P3PD 3MGPD 1KX5D 5B24B 5GT0D 4H9SA 3FDDA 2BYMB 1P3BC 3REKC 1P3OB 5BT1C 4KHAA 3MGRD 4YS3D 3LELA 1P3PB 3O62A 1BH9A 3MGPB 1KX5B 5GSUC 5B2IC 3AZLC 4KUDC 3AYWC 5AV5D 2BYMA 4R8PD 3MGRB 4JJND 3AN2D 5JA4B 3C1BC 4YS3B 3AZFC 3EPLA 4XZQA 2FJ7C 4Z2MG 1P3PA 3MGPA 1B67A 3WA9C 3TU4C 5BS7C 5GT0A 4G91B 5AV5B 2CWEA 4R8PB 4JJNB 3AN2B 1PZRA 4J8XA 5JA4A 4YS3A 1P3GD 1KX4D 3KWQD 1P3MA 3REIA 2CV5C 5CPKD 4QLCC 1P3ID 3B0DB 5AV5A 5B40D 4R8PA 1P3KD 4CAYB 1P3GB 4H9PB 1KX4B 3KWQB 1F1EA 3VH5T 5CPKB 1P3IB 3VH5A 1P3KB 5B1LA 3RELD 1U35D 5AV9D 3UTAA 3B0CW 1S32D 1KX4A 2Y2NA 5C3IC 4XUJC 3KWQA 5CP6C 3X1SD 3B6FB 3AV1C 2VQRA 5CPKA 3A1KA 3RELB 4Z5TD 1P3LD 3B6GD 5AV9B 1P3KA 5B40A 3LJAD 3AZGC 3AZHC 1TZYC 3H0LC 3P5JB 1KX3C 1S32B 3REJC 3X1SB 1M19C 1BFMA 3KXBD 3VH6A 4Z5TB 3AV2D 5B0ZC 1P3LB 3LJAB 3KUYD 1U35A 5AV9A 1P3AC 3W97D 1S32A 3KXBB 4E45A 4ZBJC 3KUYB 4NE6A 5GXQC 5B32G 3B6GA 5DNMA 3W96B 3LJAA 3MVDD 3W97C 5F99D 5DNNA 5AVBC 3AZEC 1ULYA 3AV2A 1HQ3D 3MVDB 4ZUXD 3MGSC 3AZID 1T3UA 4LD9C 3UT9A 1P3BD 1P34A 3W98D 3REKD 4Z66C 3MNNC 4WNNA 4ZUXB 4KGCC 2NZDC 3MVDA 5B0YD 4DRBA 1Z2CB 3AZIB 5F99A 5GSUD 5B2ID 3AZLD 1P3BB 3W98B 5GT3A 3REKB 4KUDD 3AYWD 1HQ3A 2ZY5A 3C1BD 5BNXA 3AZFD 5B1MC 2FJ7D 3AZIA 5GSUB 3TU4D 5B2IB 3AZLB 3AZMD 4KUDB 3AYWB 3W98A 3H0MC 3REKA 3C1BB 3AZFB 2PYOC 2FJ7B 5B0YA 3TU4B 5B31C 5E5AD 4QLCD 5B2IA 2HUEC 3AZLA 3AYWA 5G49B 3B0CT 3WTPD 3C1BA 3NQUB 3AZFA 2FJ7A 3V9RA 4WU8C 3TU4A 1AOID 5E5AB 4QLCB 3AZMA 1P3OD 3REHA 3WTPB 5G49A 3NQUA 4G92B 4XUJD 5CP6D 1AOIB 5CPJC 3AV1D 5B33C 4H9QB 5E5AA 2Y2MA 3AZGD 1TZYD 3WTPA 1KX3D 3EPKA 4J8UC 3REJD 1M1AC 5C3IB 4XUJB 5CP6B 1M19D 2NQBD 3AV1B 5B24A 4UPKA 1AOIA 1P3OA 5B0ZD 4H9QA 3AZGB 1TZYB 1KX3B 3REJB 1P3AD 4AWLC 1KX5A 1M19B 2NQBB 4XUJA 5CP6A 3UTBC 3AZNC 5BNXB 5B0ZB 3AZKC 3MGRA 4YM6C 1P3AB 2Y2GA 1KX3A 1ID3C 4X23D 3REJA 5AVBD 2NQBA 3MGQC 4ZBJB 1A7WA 1M18C 4JJNA 3AZED 3AN2A 5GXQB 4WU9D 3W97B 5B2JC 4X23B 1P3AA 5AVBB 3B6FD 2J8PA 2Y2IA 3AZEB 1ZLAD 2HIOC 4WU9B 4Z66D 3MNND 3LZ1C 4KGCD 2NZDD 4CAYA 1F66C 4J8VD 1P3GA 4H9PA 3MGSB 2BYKB 4X23A 2Y2PA 4H9SC 1P3IA 1ZLAB 4NE3A 5B32D 4M6BA 4Z66B 5AV6C 3MNNB 3A6NC 3AZEA 4WU9A 3LELC 4J8WC 2F8ND 4KGCB 4J8VB 2NZDB 3VH6T 5B1MD 5AY8C 4DQYB 2RVQD 4H9NB 3B6FA 1W2EA 5B32B 3RELA 2F8NB 1ZLAA 5KDMB 3W96D 5AVCD 3AZHA 2AROC 4XZQC 2PYOD 4KGCA 2NZDA 5B1MB 4J8VA 1P3FC 1HTAA 3X1SA 3R45B 5B31D 4H9NA 5GT0C 4Z5TA 1P3LA 5B32A 2F8NG 5AVCB 4J8XC 5KDMA 2PYOB 4Z2MH 1P3MC 3IP4C 3EG5B 5B31B 3X1UC 3KXBA 3REIC 4WU8D 1R4VA 3R45A 5BNVB 2HUEB 3C1CC 3KUYA 3W96A 5AVCA 3WAAC 4CSRB 5AV8C 1H3OB 2LY8A 4WU8B 5JRGC 5B31G 5CPJD 5BNVA 5B1LC 5B33D 5BT1D 2DF4C 2Y2HA 2Y2QA 3W99C 3UTAC 4CSRA 1H3OA 1B6WA 5CPJB 4WU8A 5CPKC 5B33B 4UUZB 5B40C 1EQZC 4DRAA 3KFUG 4ZUXA 3AZJC 3B0BA 4J8UB 1M1AB 3WA9D 4WV4B 3LZ0C 4HGAC 1P3BA 5CPJA 2JE5A 4H9OB 3AZND 5B33A 2YFWB 3AZKD 1U35C 2IO5C 2F2AC 4YM6D 1JFIB 4UUZA 3WKJC 3WA9B 4AWLB 2ZY2A 2CV5D 5GSUA 4KUDA 3VH5W 3MGQD 3UTBB 3AZNB 3AZKB 1M18D 4H9OA 4YM6B 3B6GC 5DNMC 2YFWA 1JFIA 2YFVB 5B2JD 4H9RB 5DNNC 2CV5B 3WA9A 3MGQB 5BS7A 3AV2C 1M18B 3AZNA 2HIOD 2F8NH 3AZKA 3LZ1D 5FUGB 5B2JB 4NE5A 1F66D 2CV5A 3UT9C 4QLCA 1P34C 3MGQA 2Y2KA 2HIOB 5BO0B 1M18A 5AV6D 3LZ1B 3A6ND 3AZHD 3LELD 4J8WD 1F66B 5FUGA 3EPHA 5B2JA 5AY8D 3AL0C 5F99C 2JSSA 5GT3C 1HQ3C 2DQNC 5AV6B 3A6NB 3AZHB 3LELB 4J8WB 3LZ1A 2AROD 1KU5A 3F6TA 3AFAC 5AY8B 1P3FD 3AZIC 2BG1A 4NFTA 3AV1A 3W98C 5GXQD 2Y2LA 2UWXA 4WJ3C 5AV6A 3AZGA 2AROB 1TZYA 4XZQB 3A6NA 4J8WA 4J8XD 4EO5C 5B0YC 1P3FB 3X1VC 5AY8A 5CHLB 1P3MD 1M19A 3REID 3X1UD 5GT0B 5CPIC 5B0ZA
chains in the Genus database with same CATH topology
3C1CD 4J8XB 1TAFB 5AV8D 2AROA 3WAAD 3MGSD 1P3MB 1P3FA 4LD9D 3REIB 3X1UB 5JRGD 3AZMC 3X1TC 3C1CB 5B1LD 3REHC 5GXQA 2JCHA 3W97A 3W99D 5AV8B 3WAAB 3UTAD 1TAFA 4LD9B 5JRGB 5AVBA 3X1UA 5E5AC 5B1LB 3WTPE 2W8SA 2XD1A 3C1CA 1EQZD 3O62C 3W99B 3WTPC 3UTAB 3AZJD 5AV8A 3WAAA 3MGSA 2BYKA 2ZM5A 4LD9A 5B24C 4G92C 3LZ0D 1AOIC 5JRGA 1P3OC 5B40B 4Z66A 3MNNA 1EQZB 3KSYA 1P3PC 3AZJB 3MGPC 3W99A 2XD5A 1KX5C 3WKJD 3LZ0B 4HGAB 3MGRC 2F8NA 1U35B 2IO5B 4YS3C 2L5AA 5DNMD 1EQZA 3WKJB 5B1MA 3AZJA 5DNND 2ZY3A 2NQBC 4WZSB 3LZ0A 4G91C 5AV5C 4R8PC 4JJNC 3AN2C 3B6GB 5DNMB 2PYOA 4E44A 5DNNB 3WKJA 5B31A 3UT9D 3AV2B 1P34D 3B0DC 2F8NK 1P3GC 1KX4C 3KWQC 4J8UD 2G5IC 1M1AD 4X23C 3H0RC 3UT9B 1P3IC 1P34B 5GT3D 2Y2JA 1P3KC 1WWSA 4WNNB 4WU9C 3AFAD 3NQJB 5F99B 3B6FC 3UTBD 5GT3B 3RELC 1ZLAC 1HQ3B 5AV9C 1Q9CA 2G5HC 1ID3D 4J8VC 3AFAB 1S32C 4J8UA 1M1AA 3X1VD 3X1SC 1N1JB 3NQJA 4Z5TC 1P3LC 5CPID 5B32C 2FFFB 3LJAC 1ID3B 4EO5B 5B0YB 3X1VB 3AFAA 2RVQC 3KXBC 1N1JA 3UTBA 5CPIB 3X1TD 3A1IA 3KUYC 4YM6A 3REHD 1BH8B 3W96C 2RIQA 5AVCC 2YFVA 1ID3A 3V9RB 4H9RA 2Y2OA 3VH6W 3X1VA 3EPJA 3AZMB 3X1TB 5CPIA 3REHB 3MVDC 1BH8A 3O62D 2ZY4A 5B24D 4KHAB 3X1TA 2HIOA 5BO0A 1WWIA 4ZUXC 3O62B 1BH9B 4XZQD 1F66A 1P3PD 3MGPD 1KX5D 5B24B 5GT0D 4H9SA 3FDDA 2BYMB 1P3BC 3REKC 1P3OB 5BT1C 4KHAA 3MGRD 4YS3D 3LELA 1P3PB 3O62A 1BH9A 3MGPB 1KX5B 5GSUC 5B2IC 3AZLC 4KUDC 3AYWC 5AV5D 2BYMA 4R8PD 3MGRB 4JJND 3AN2D 5JA4B 3C1BC 4YS3B 3AZFC 3EPLA 4XZQA 2FJ7C 4Z2MG 1P3PA 3MGPA 1B67A 3WA9C 3TU4C 5BS7C 5GT0A 4G91B 5AV5B 2CWEA 4R8PB 4JJNB 3AN2B 1PZRA 4J8XA 5JA4A 4YS3A 1P3GD 1KX4D 3KWQD 1P3MA 3REIA 2CV5C 5CPKD 4QLCC 1P3ID 3B0DB 5AV5A 5B40D 4R8PA 1P3KD 4CAYB 1P3GB 4H9PB 1KX4B 3KWQB 1F1EA 3VH5T 5CPKB 1P3IB 3VH5A 1P3KB 5B1LA 3RELD 1U35D 5AV9D 3UTAA 3B0CW 1S32D 1KX4A 2Y2NA 5C3IC 4XUJC 3KWQA 5CP6C 3X1SD 3B6FB 3AV1C 2VQRA 5CPKA 3A1KA 3RELB 4Z5TD 1P3LD 3B6GD 5AV9B 1P3KA 5B40A 3LJAD 3AZGC 3AZHC 1TZYC 3H0LC 3P5JB 1KX3C 1S32B 3REJC 3X1SB 1M19C 1BFMA 3KXBD 3VH6A 4Z5TB 3AV2D 5B0ZC 1P3LB 3LJAB 3KUYD 1U35A 5AV9A 1P3AC 3W97D 1S32A 3KXBB 4E45A 4ZBJC 3KUYB 4NE6A 5GXQC 5B32G 3B6GA 5DNMA 3W96B 3LJAA 3MVDD 3W97C 5F99D 5DNNA 5AVBC 3AZEC 1ULYA 3AV2A 1HQ3D 3MVDB 4ZUXD 3MGSC 3AZID 1T3UA 4LD9C 3UT9A 1P3BD 1P34A 3W98D 3REKD 4Z66C 3MNNC 4WNNA 4ZUXB 4KGCC 2NZDC 3MVDA 5B0YD 4DRBA 1Z2CB 3AZIB 5F99A 5GSUD 5B2ID 3AZLD 1P3BB 3W98B 5GT3A 3REKB 4KUDD 3AYWD 1HQ3A 2ZY5A 3C1BD 5BNXA 3AZFD 5B1MC 2FJ7D 3AZIA 5GSUB 3TU4D 5B2IB 3AZLB 3AZMD 4KUDB 3AYWB 3W98A 3H0MC 3REKA 3C1BB 3AZFB 2PYOC 2FJ7B 5B0YA 3TU4B 5B31C 5E5AD 4QLCD 5B2IA 2HUEC 3AZLA 3AYWA 5G49B 3B0CT 3WTPD 3C1BA 3NQUB 3AZFA 2FJ7A 3V9RA 4WU8C 3TU4A 1AOID 5E5AB 4QLCB 3AZMA 1P3OD 3REHA 3WTPB 5G49A 3NQUA 4G92B 4XUJD 5CP6D 1AOIB 5CPJC 3AV1D 5B33C 4H9QB 5E5AA 2Y2MA 3AZGD 1TZYD 3WTPA 1KX3D 3EPKA 4J8UC 3REJD 1M1AC 5C3IB 4XUJB 5CP6B 1M19D 2NQBD 3AV1B 5B24A 4UPKA 1AOIA 1P3OA 5B0ZD 4H9QA 3AZGB 1TZYB 1KX3B 3REJB 1P3AD 4AWLC 1KX5A 1M19B 2NQBB 4XUJA 5CP6A 3UTBC 3AZNC 5BNXB 5B0ZB 3AZKC 3MGRA 4YM6C 1P3AB 2Y2GA 1KX3A 1ID3C 4X23D 3REJA 5AVBD 2NQBA 3MGQC 4ZBJB 1A7WA 1M18C 4JJNA 3AZED 3AN2A 5GXQB 4WU9D 3W97B 5B2JC 4X23B 1P3AA 5AVBB 3B6FD 2J8PA 2Y2IA 3AZEB 1ZLAD 2HIOC 4WU9B 4Z66D 3MNND 3LZ1C 4KGCD 2NZDD 4CAYA 1F66C 4J8VD 1P3GA 4H9PA 3MGSB 2BYKB 4X23A 2Y2PA 4H9SC 1P3IA 1ZLAB 4NE3A 5B32D 4M6BA 4Z66B 5AV6C 3MNNB 3A6NC 3AZEA 4WU9A 3LELC 4J8WC 2F8ND 4KGCB 4J8VB 2NZDB 3VH6T 5B1MD 5AY8C 4DQYB 2RVQD 4H9NB 3B6FA 1W2EA 5B32B 3RELA 2F8NB 1ZLAA 5KDMB 3W96D 5AVCD 3AZHA 2AROC 4XZQC 2PYOD 4KGCA 2NZDA 5B1MB 4J8VA 1P3FC 1HTAA 3X1SA 3R45B 5B31D 4H9NA 5GT0C 4Z5TA 1P3LA 5B32A 2F8NG 5AVCB 4J8XC 5KDMA 2PYOB 4Z2MH 1P3MC 3IP4C 3EG5B 5B31B 3X1UC 3KXBA 3REIC 4WU8D 1R4VA 3R45A 5BNVB 2HUEB 3C1CC 3KUYA 3W96A 5AVCA 3WAAC 4CSRB 5AV8C 1H3OB 2LY8A 4WU8B 5JRGC 5B31G 5CPJD 5BNVA 5B1LC 5B33D 5BT1D 2DF4C 2Y2HA 2Y2QA 3W99C 3UTAC 4CSRA 1H3OA 1B6WA 5CPJB 4WU8A 5CPKC 5B33B 4UUZB 5B40C 1EQZC 4DRAA 3KFUG 4ZUXA 3AZJC 3B0BA 4J8UB 1M1AB 3WA9D 4WV4B 3LZ0C 4HGAC 1P3BA 5CPJA 2JE5A 4H9OB 3AZND 5B33A 2YFWB 3AZKD 1U35C 2IO5C 2F2AC 4YM6D 1JFIB 4UUZA 3WKJC 3WA9B 4AWLB 2ZY2A 2CV5D 5GSUA 4KUDA 3VH5W 3MGQD 3UTBB 3AZNB 3AZKB 1M18D 4H9OA 4YM6B 3B6GC 5DNMC 2YFWA 1JFIA 2YFVB 5B2JD 4H9RB 5DNNC 2CV5B 3WA9A 3MGQB 5BS7A 3AV2C 1M18B 3AZNA 2HIOD 2F8NH 3AZKA 3LZ1D 5FUGB 5B2JB 4NE5A 1F66D 2CV5A 3UT9C 4QLCA 1P34C 3MGQA 2Y2KA 2HIOB 5BO0B 1M18A 5AV6D 3LZ1B 3A6ND 3AZHD 3LELD 4J8WD 1F66B 5FUGA 3EPHA 5B2JA 5AY8D 3AL0C 5F99C 2JSSA 5GT3C 1HQ3C 2DQNC 5AV6B 3A6NB 3AZHB 3LELB 4J8WB 3LZ1A 2AROD 1KU5A 3F6TA 3AFAC 5AY8B 1P3FD 3AZIC 2BG1A 4NFTA 3AV1A 3W98C 5GXQD 2Y2LA 2UWXA 4WJ3C 5AV6A 3AZGA 2AROB 1TZYA 4XZQB 3A6NA 4J8WA 4J8XD 4EO5C 5B0YC 1P3FB 3X1VC 5AY8A 5CHLB 1P3MD 1M19A 3REID 3X1UD 5GT0B 5CPIC 5B0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C D;  4J8X B;  1TAF B;  5AV8 D;  2ARO A;  3WAA D;  3MGS D;  1P3M B;  1P3F A;  4LD9 D;  3REI B;  3X1U B;  5JRG D;  3AZM C;  3X1T C;  3C1C B;  5B1L D;  3REH C;  5GXQ A;  3W97 A;  3W99 D;  5AV8 B;  3WAA B;  3UTA D;  1TAF A;  4LD9 B;  5JRG B;  5AVB A;  3X1U A;  5E5A C;  5B1L B;  3WTP E;  3C1C A;  1EQZ D;  3O62 C;  3W99 B;  3WTP C;  3UTA B;  3AZJ D;  5AV8 A;  3WAA A;  3MGS A;  2BYK A;  4LD9 A;  5B24 C;  4G92 C;  3LZ0 D;  1AOI C;  5JRG A;  1P3O C;  5B40 B;  4Z66 A;  3MNN A;  1EQZ B;  3KSY A;  1P3P C;  3AZJ B;  3MGP C;  3W99 A;  1KX5 C;  3WKJ D;  3LZ0 B;  4HGA B;  3MGR C;  2F8N A;  1U35 B;  2IO5 B;  4YS3 C;  2L5A A;  5DNM D;  1EQZ A;  3WKJ B;  5B1M A;  3AZJ A;  5DNN D;  2NQB C;  4WZS B;  3LZ0 A;  4G91 C;  5AV5 C;  4R8P C;  4JJN C;  3AN2 C;  3B6G B;  5DNM B;  2PYO A;  4E44 A;  5DNN B;  3WKJ A;  5B31 A;  3UT9 D;  3AV2 B;  1P34 D;  3B0D C;  2F8N K;  1P3G C;  1KX4 C;  3KWQ C;  4J8U D;  1M1A D;  4X23 C;  3UT9 B;  1P3I C;  1P34 B;  5GT3 D;  1P3K C;  1WWS A;  4WNN B;  4WU9 C;  3AFA D;  3NQJ B;  5F99 B;  3B6F C;  3UTB D;  5GT3 B;  3REL C;  1ZLA C;  1HQ3 B;  5AV9 C;  1Q9C A;  1ID3 D;  4J8V C;  3AFA B;  1S32 C;  4J8U A;  1M1A A;  3X1V D;  3X1S C;  1N1J B;  3NQJ A;  4Z5T C;  1P3L C;  5CPI D;  5B32 C;  3LJA C;  1ID3 B;  4EO5 B;  5B0Y B;  3X1V B;  3AFA A;  2RVQ C;  3KXB C;  1N1J A;  3UTB A;  5CPI B;  3X1T D;  3KUY C;  4YM6 A;  3REH D;  1BH8 B;  3W96 C;  5AVC C;  2YFV A;  1ID3 A;  3V9R B;  4H9R A;  3VH6 W;  3X1V A;  3AZM B;  3X1T B;  5CPI A;  3REH B;  3MVD C;  1BH8 A;  3O62 D;  5B24 D;  4KHA B;  3X1T A;  2HIO A;  5BO0 A;  1WWI A;  4ZUX C;  3O62 B;  1BH9 B;  4XZQ D;  1F66 A;  1P3P D;  3MGP D;  1KX5 D;  5B24 B;  5GT0 D;  4H9S A;  1P3B C;  2BYM B;  3REK C;  1P3O B;  5BT1 C;  4KHA A;  3MGR D;  4YS3 D;  3LEL A;  1P3P B;  3O62 A;  1BH9 A;  3MGP B;  1KX5 B;  5GSU C;  5B2I C;  3AZL C;  4KUD C;  3AYW C;  5AV5 D;  2BYM A;  4R8P D;  3MGR B;  4JJN D;  3AN2 D;  5JA4 B;  3C1B C;  4YS3 B;  3AZF C;  4XZQ A;  2FJ7 C;  4Z2M G;  1P3P A;  3MGP A;  1B67 A;  3WA9 C;  3TU4 C;  5BS7 C;  5GT0 A;  4G91 B;  5AV5 B;  2CWE A;  4R8P B;  4JJN B;  3AN2 B;  4J8X A;  5JA4 A;  4YS3 A;  1P3G D;  1KX4 D;  3KWQ D;  1P3M A;  3REI A;  2CV5 C;  5CPK D;  4QLC C;  1P3I D;  3B0D B;  5AV5 A;  5B40 D;  4R8P A;  1P3K D;  4CAY B;  1P3G B;  4H9P B;  1KX4 B;  3KWQ B;  1F1E A;  3VH5 T;  5CPK B;  1P3I B;  3VH5 A;  1P3K B;  5B1L A;  3REL D;  1U35 D;  5AV9 D;  3UTA A;  3B0C W;  1S32 D;  1KX4 A;  5C3I C;  3KWQ A;  4XUJ C;  5CP6 C;  3X1S D;  3B6F B;  3AV1 C;  5CPK A;  3REL B;  4Z5T D;  1P3L D;  3B6G D;  5AV9 B;  1P3K A;  5B40 A;  3LJA D;  3AZG C;  3AZH C;  1TZY C;  1KX3 C;  1S32 B;  3REJ C;  3X1S B;  1M19 C;  1BFM A;  3KXB D;  3VH6 A;  4Z5T B;  3AV2 D;  5B0Z C;  1P3L B;  3LJA B;  3KUY D;  1U35 A;  5AV9 A;  1P3A C;  3W97 D;  1S32 A;  3KXB B;  4E45 A;  4ZBJ C;  3KUY B;  4NE6 A;  5GXQ C;  5B32 G;  3B6G A;  5DNM A;  3W96 B;  3LJA A;  3MVD D;  3W97 C;  5F99 D;  5DNN A;  5AVB C;  3AZE C;  1ULY A;  3AV2 A;  1HQ3 D;  3MVD B;  4ZUX D;  3MGS C;  3AZI D;  4LD9 C;  3UT9 A;  1P3B D;  1P34 A;  3W98 D;  3REK D;  4Z66 C;  3MNN C;  4WNN A;  4ZUX B;  4KGC C;  2NZD C;  3MVD A;  5B0Y D;  4DRB A;  3AZI B;  5F99 A;  5GSU D;  5B2I D;  3AZL D;  1P3B B;  3W98 B;  5GT3 A;  3REK B;  4KUD D;  3AYW D;  1HQ3 A;  3C1B D;  5BNX A;  3AZF D;  5B1M C;  2FJ7 D;  3AZI A;  5GSU B;  3TU4 D;  5B2I B;  3AZL B;  3AZM D;  4KUD B;  3AYW B;  3W98 A;  3REK A;  3C1B B;  3AZF B;  2PYO C;  2FJ7 B;  5B0Y A;  3TU4 B;  5B31 C;  5E5A D;  4QLC D;  5B2I A;  2HUE C;  3AZL A;  3AYW A;  5G49 B;  3B0C T;  3WTP D;  3C1B A;  3NQU B;  3AZF A;  2FJ7 A;  3V9R A;  4WU8 C;  3TU4 A;  1AOI D;  5E5A B;  4QLC B;  3AZM A;  1P3O D;  3REH A;  3WTP B;  5G49 A;  3NQU A;  4G92 B;  4XUJ D;  5CP6 D;  1AOI B;  5CPJ C;  3AV1 D;  5B33 C;  4H9Q B;  5E5A A;  3AZG D;  1TZY D;  3WTP A;  1KX3 D;  4J8U C;  3REJ D;  1M1A C;  5C3I B;  4XUJ B;  5CP6 B;  1M19 D;  2NQB D;  3AV1 B;  5B24 A;  1AOI A;  1P3O A;  5B0Z D;  4H9Q A;  3AZG B;  1TZY B;  1KX3 B;  3REJ B;  1P3A D;  4AWL C;  1KX5 A;  1M19 B;  2NQB B;  4XUJ A;  5CP6 A;  3UTB C;  3AZN C;  5BNX B;  5B0Z B;  3AZK C;  3MGR A;  4YM6 C;  1P3A B;  1KX3 A;  1ID3 C;  4X23 D;  3REJ A;  5AVB D;  2NQB A;  3MGQ C;  4ZBJ B;  1A7W A;  1M18 C;  4JJN A;  3AZE D;  3AN2 A;  5GXQ B;  4WU9 D;  3W97 B;  5B2J C;  4X23 B;  1P3A A;  5AVB B;  3B6F D;  3AZE B;  1ZLA D;  2HIO C;  4WU9 B;  4Z66 D;  3MNN D;  3LZ1 C;  4KGC D;  2NZD D;  4CAY A;  1F66 C;  4J8V D;  1P3G A;  4H9P A;  3MGS B;  2BYK B;  4X23 A;  4H9S C;  1P3I A;  1ZLA B;  4NE3 A;  5B32 D;  4M6B A;  4Z66 B;  5AV6 C;  3MNN B;  3A6N C;  3AZE A;  4WU9 A;  3LEL C;  4J8W C;  2F8N D;  4KGC B;  4J8V B;  2NZD B;  3VH6 T;  5B1M D;  5AY8 C;  2RVQ D;  4H9N B;  3B6F A;  5B32 B;  3REL A;  2F8N B;  1ZLA A;  5KDM B;  3W96 D;  5AVC D;  3AZH A;  2ARO C;  4XZQ C;  2PYO D;  4KGC A;  2NZD A;  5B1M B;  4J8V A;  1P3F C;  1HTA A;  3X1S A;  3R45 B;  5B31 D;  4H9N A;  5GT0 C;  4Z5T A;  1P3L A;  5B32 A;  2F8N G;  5AVC B;  4J8X C;  5KDM A;  2PYO B;  4Z2M H;  1P3M C;  5B31 B;  3X1U C;  3KXB A;  3REI C;  4WU8 D;  1R4V A;  3R45 A;  5BNV B;  2HUE B;  3C1C C;  3KUY A;  3W96 A;  5AVC A;  3WAA C;  4CSR B;  5AV8 C;  1H3O B;  2LY8 A;  4WU8 B;  5JRG C;  5B31 G;  5CPJ D;  5BNV A;  5B1L C;  5B33 D;  5BT1 D;  3W99 C;  3UTA C;  4CSR A;  1H3O A;  1B6W A;  5CPJ B;  4WU8 A;  5CPK C;  5B33 B;  4UUZ B;  5B40 C;  1EQZ C;  4DRA A;  4ZUX A;  3AZJ C;  3B0B A;  4J8U B;  1M1A B;  3WA9 D;  4WV4 B;  3LZ0 C;  4HGA C;  1P3B A;  5CPJ A;  4H9O B;  3AZN D;  5B33 A;  2YFW B;  3AZK D;  1U35 C;  2IO5 C;  1JFI B;  4YM6 D;  4UUZ A;  3WKJ C;  3WA9 B;  4AWL B;  2CV5 D;  5GSU A;  4KUD A;  3VH5 W;  3MGQ D;  3UTB B;  3AZN B;  3AZK B;  1M18 D;  4H9O A;  4YM6 B;  3B6G C;  5DNM C;  2YFW A;  1JFI A;  2YFV B;  5B2J D;  4H9R B;  5DNN C;  2CV5 B;  3WA9 A;  3MGQ B;  5BS7 A;  3AV2 C;  1M18 B;  3AZN A;  2HIO D;  2F8N H;  3AZK A;  3LZ1 D;  5FUG B;  5B2J B;  4NE5 A;  1F66 D;  2CV5 A;  3UT9 C;  4QLC A;  1P34 C;  3MGQ A;  2HIO B;  5BO0 B;  1M18 A;  5AV6 D;  3LZ1 B;  3A6N D;  3AZH D;  3LEL D;  4J8W D;  1F66 B;  5FUG A;  5B2J A;  5AY8 D;  5F99 C;  2JSS A;  5GT3 C;  1HQ3 C;  5AV6 B;  3AZH B;  3A6N B;  3LEL B;  4J8W B;  3LZ1 A;  2ARO D;  1KU5 A;  3AFA C;  5AY8 B;  1P3F D;  3AZI C;  4NFT A;  3AV1 A;  3W98 C;  5GXQ D;  5AV6 A;  3AZG A;  2ARO B;  1TZY A;  4XZQ B;  3A6N A;  4J8W A;  4J8X D;  4EO5 C;  5B0Y C;  1P3F B;  3X1V C;  5AY8 A;  5CHL B;  1P3M D;  1M19 A;  3REI D;  3X1U D;  5GT0 B;  5CPI C;  5B0Z A; 
#chains in the Genus database with same CATH topology
 3C1C D;  4J8X B;  1TAF B;  5AV8 D;  2ARO A;  3WAA D;  3MGS D;  1P3M B;  1P3F A;  4LD9 D;  3REI B;  3X1U B;  5JRG D;  3AZM C;  3X1T C;  3C1C B;  5B1L D;  3REH C;  5GXQ A;  2JCH A;  3W97 A;  3W99 D;  5AV8 B;  3WAA B;  3UTA D;  1TAF A;  4LD9 B;  5JRG B;  5AVB A;  3X1U A;  5E5A C;  5B1L B;  3WTP E;  2W8S A;  2XD1 A;  3C1C A;  1EQZ D;  3O62 C;  3W99 B;  3WTP C;  3UTA B;  3AZJ D;  5AV8 A;  3WAA A;  3MGS A;  2BYK A;  2ZM5 A;  4LD9 A;  5B24 C;  4G92 C;  3LZ0 D;  1AOI C;  5JRG A;  1P3O C;  5B40 B;  4Z66 A;  3MNN A;  1EQZ B;  3KSY A;  1P3P C;  3AZJ B;  3MGP C;  3W99 A;  2XD5 A;  1KX5 C;  3WKJ D;  3LZ0 B;  4HGA B;  3MGR C;  2F8N A;  1U35 B;  2IO5 B;  4YS3 C;  2L5A A;  5DNM D;  1EQZ A;  3WKJ B;  5B1M A;  3AZJ A;  5DNN D;  2ZY3 A;  2NQB C;  4WZS B;  3LZ0 A;  4G91 C;  5AV5 C;  4R8P C;  4JJN C;  3AN2 C;  3B6G B;  5DNM B;  2PYO A;  4E44 A;  5DNN B;  3WKJ A;  5B31 A;  3UT9 D;  3AV2 B;  1P34 D;  3B0D C;  2F8N K;  1P3G C;  1KX4 C;  3KWQ C;  4J8U D;  2G5I C;  1M1A D;  4X23 C;  3H0R C;  3UT9 B;  1P3I C;  1P34 B;  5GT3 D;  2Y2J A;  1P3K C;  1WWS A;  4WNN B;  4WU9 C;  3AFA D;  3NQJ B;  5F99 B;  3B6F C;  3UTB D;  5GT3 B;  3REL C;  1ZLA C;  1HQ3 B;  5AV9 C;  1Q9C A;  2G5H C;  1ID3 D;  4J8V C;  3AFA B;  1S32 C;  4J8U A;  1M1A A;  3X1V D;  3X1S C;  1N1J B;  3NQJ A;  4Z5T C;  1P3L C;  5CPI D;  5B32 C;  2FFF B;  3LJA C;  1ID3 B;  4EO5 B;  5B0Y B;  3X1V B;  3AFA A;  2RVQ C;  3KXB C;  1N1J A;  3UTB A;  5CPI B;  3X1T D;  3A1I A;  3KUY C;  4YM6 A;  3REH D;  1BH8 B;  3W96 C;  2RIQ A;  5AVC C;  2YFV A;  1ID3 A;  3V9R B;  4H9R A;  2Y2O A;  3VH6 W;  3X1V A;  3EPJ A;  3AZM B;  3X1T B;  5CPI A;  3REH B;  3MVD C;  1BH8 A;  3O62 D;  2ZY4 A;  5B24 D;  4KHA B;  3X1T A;  2HIO A;  5BO0 A;  1WWI A;  4ZUX C;  3O62 B;  1BH9 B;  4XZQ D;  1F66 A;  1P3P D;  3MGP D;  1KX5 D;  5B24 B;  5GT0 D;  4H9S A;  3FDD A;  2BYM B;  1P3B C;  3REK C;  1P3O B;  5BT1 C;  4KHA A;  3MGR D;  4YS3 D;  3LEL A;  1P3P B;  3O62 A;  1BH9 A;  3MGP B;  1KX5 B;  5GSU C;  5B2I C;  3AZL C;  4KUD C;  3AYW C;  5AV5 D;  2BYM A;  4R8P D;  3MGR B;  4JJN D;  3AN2 D;  5JA4 B;  3C1B C;  4YS3 B;  3AZF C;  3EPL A;  4XZQ A;  2FJ7 C;  4Z2M G;  1P3P A;  3MGP A;  1B67 A;  3WA9 C;  3TU4 C;  5BS7 C;  5GT0 A;  4G91 B;  5AV5 B;  2CWE A;  4R8P B;  4JJN B;  3AN2 B;  1PZR A;  4J8X A;  5JA4 A;  4YS3 A;  1P3G D;  1KX4 D;  3KWQ D;  1P3M A;  3REI A;  2CV5 C;  5CPK D;  4QLC C;  1P3I D;  3B0D B;  5AV5 A;  5B40 D;  4R8P A;  1P3K D;  4CAY B;  1P3G B;  4H9P B;  1KX4 B;  3KWQ B;  1F1E A;  3VH5 T;  5CPK B;  1P3I B;  3VH5 A;  1P3K B;  5B1L A;  3REL D;  1U35 D;  5AV9 D;  3UTA A;  3B0C W;  1S32 D;  1KX4 A;  2Y2N A;  5C3I C;  4XUJ C;  3KWQ A;  5CP6 C;  3X1S D;  3B6F B;  3AV1 C;  2VQR A;  5CPK A;  3A1K A;  3REL B;  4Z5T D;  1P3L D;  3B6G D;  5AV9 B;  1P3K A;  5B40 A;  3LJA D;  3AZG C;  3AZH C;  1TZY C;  3H0L C;  3P5J B;  1KX3 C;  1S32 B;  3REJ C;  3X1S B;  1M19 C;  1BFM A;  3KXB D;  3VH6 A;  4Z5T B;  3AV2 D;  5B0Z C;  1P3L B;  3LJA B;  3KUY D;  1U35 A;  5AV9 A;  1P3A C;  3W97 D;  1S32 A;  3KXB B;  4E45 A;  4ZBJ C;  3KUY B;  4NE6 A;  5GXQ C;  5B32 G;  3B6G A;  5DNM A;  3W96 B;  3LJA A;  3MVD D;  3W97 C;  5F99 D;  5DNN A;  5AVB C;  3AZE C;  1ULY A;  3AV2 A;  1HQ3 D;  3MVD B;  4ZUX D;  3MGS C;  3AZI D;  1T3U A;  4LD9 C;  3UT9 A;  1P3B D;  1P34 A;  3W98 D;  3REK D;  4Z66 C;  3MNN C;  4WNN A;  4ZUX B;  4KGC C;  2NZD C;  3MVD A;  5B0Y D;  4DRB A;  1Z2C B;  3AZI B;  5F99 A;  5GSU D;  5B2I D;  3AZL D;  1P3B B;  3W98 B;  5GT3 A;  3REK B;  4KUD D;  3AYW D;  1HQ3 A;  2ZY5 A;  3C1B D;  5BNX A;  3AZF D;  5B1M C;  2FJ7 D;  3AZI A;  5GSU B;  3TU4 D;  5B2I B;  3AZL B;  3AZM D;  4KUD B;  3AYW B;  3W98 A;  3H0M C;  3REK A;  3C1B B;  3AZF B;  2PYO C;  2FJ7 B;  5B0Y A;  3TU4 B;  5B31 C;  5E5A D;  4QLC D;  5B2I A;  2HUE C;  3AZL A;  3AYW A;  5G49 B;  3B0C T;  3WTP D;  3C1B A;  3NQU B;  3AZF A;  2FJ7 A;  3V9R A;  4WU8 C;  3TU4 A;  1AOI D;  5E5A B;  4QLC B;  3AZM A;  1P3O D;  3REH A;  3WTP B;  5G49 A;  3NQU A;  4G92 B;  4XUJ D;  5CP6 D;  1AOI B;  5CPJ C;  3AV1 D;  5B33 C;  4H9Q B;  5E5A A;  2Y2M A;  3AZG D;  1TZY D;  3WTP A;  1KX3 D;  3EPK A;  4J8U C;  3REJ D;  1M1A C;  5C3I B;  4XUJ B;  5CP6 B;  1M19 D;  2NQB D;  3AV1 B;  5B24 A;  4UPK A;  1AOI A;  1P3O A;  5B0Z D;  4H9Q A;  3AZG B;  1TZY B;  1KX3 B;  3REJ B;  1P3A D;  4AWL C;  1KX5 A;  1M19 B;  2NQB B;  4XUJ A;  5CP6 A;  3UTB C;  3AZN C;  5BNX B;  5B0Z B;  3AZK C;  3MGR A;  4YM6 C;  1P3A B;  2Y2G A;  1KX3 A;  1ID3 C;  4X23 D;  3REJ A;  5AVB D;  2NQB A;  3MGQ C;  4ZBJ B;  1A7W A;  1M18 C;  4JJN A;  3AZE D;  3AN2 A;  5GXQ B;  4WU9 D;  3W97 B;  5B2J C;  4X23 B;  1P3A A;  5AVB B;  3B6F D;  2J8P A;  2Y2I A;  3AZE B;  1ZLA D;  2HIO C;  4WU9 B;  4Z66 D;  3MNN D;  3LZ1 C;  4KGC D;  2NZD D;  4CAY A;  1F66 C;  4J8V D;  1P3G A;  4H9P A;  3MGS B;  2BYK B;  4X23 A;  2Y2P A;  4H9S C;  1P3I A;  1ZLA B;  4NE3 A;  5B32 D;  4M6B A;  4Z66 B;  5AV6 C;  3MNN B;  3A6N C;  3AZE A;  4WU9 A;  3LEL C;  4J8W C;  2F8N D;  4KGC B;  4J8V B;  2NZD B;  3VH6 T;  5B1M D;  5AY8 C;  4DQY B;  2RVQ D;  4H9N B;  3B6F A;  1W2E A;  5B32 B;  3REL A;  2F8N B;  1ZLA A;  5KDM B;  3W96 D;  5AVC D;  3AZH A;  2ARO C;  4XZQ C;  2PYO D;  4KGC A;  2NZD A;  5B1M B;  4J8V A;  1P3F C;  1HTA A;  3X1S A;  3R45 B;  5B31 D;  4H9N A;  5GT0 C;  4Z5T A;  1P3L A;  5B32 A;  2F8N G;  5AVC B;  4J8X C;  5KDM A;  2PYO B;  4Z2M H;  1P3M C;  3IP4 C;  3EG5 B;  5B31 B;  3X1U C;  3KXB A;  3REI C;  4WU8 D;  1R4V A;  3R45 A;  5BNV B;  2HUE B;  3C1C C;  3KUY A;  3W96 A;  5AVC A;  3WAA C;  4CSR B;  5AV8 C;  1H3O B;  2LY8 A;  4WU8 B;  5JRG C;  5B31 G;  5CPJ D;  5BNV A;  5B1L C;  5B33 D;  5BT1 D;  2DF4 C;  2Y2H A;  2Y2Q A;  3W99 C;  3UTA C;  4CSR A;  1H3O A;  1B6W A;  5CPJ B;  4WU8 A;  5CPK C;  5B33 B;  4UUZ B;  5B40 C;  1EQZ C;  4DRA A;  3KFU G;  4ZUX A;  3AZJ C;  3B0B A;  4J8U B;  1M1A B;  3WA9 D;  4WV4 B;  3LZ0 C;  4HGA C;  1P3B A;  5CPJ A;  2JE5 A;  4H9O B;  3AZN D;  5B33 A;  2YFW B;  3AZK D;  1U35 C;  2IO5 C;  2F2A C;  4YM6 D;  1JFI B;  4UUZ A;  3WKJ C;  3WA9 B;  4AWL B;  2ZY2 A;  2CV5 D;  5GSU A;  4KUD A;  3VH5 W;  3MGQ D;  3UTB B;  3AZN B;  3AZK B;  1M18 D;  4H9O A;  4YM6 B;  3B6G C;  5DNM C;  2YFW A;  1JFI A;  2YFV B;  5B2J D;  4H9R B;  5DNN C;  2CV5 B;  3WA9 A;  3MGQ B;  5BS7 A;  3AV2 C;  1M18 B;  3AZN A;  2HIO D;  2F8N H;  3AZK A;  3LZ1 D;  5FUG B;  5B2J B;  4NE5 A;  1F66 D;  2CV5 A;  3UT9 C;  4QLC A;  1P34 C;  3MGQ A;  2Y2K A;  2HIO B;  5BO0 B;  1M18 A;  5AV6 D;  3LZ1 B;  3A6N D;  3AZH D;  3LEL D;  4J8W D;  1F66 B;  5FUG A;  3EPH A;  5B2J A;  5AY8 D;  3AL0 C;  5F99 C;  2JSS A;  5GT3 C;  1HQ3 C;  2DQN C;  5AV6 B;  3A6N B;  3AZH B;  3LEL B;  4J8W B;  3LZ1 A;  2ARO D;  1KU5 A;  3F6T A;  3AFA C;  5AY8 B;  1P3F D;  3AZI C;  2BG1 A;  4NFT A;  3AV1 A;  3W98 C;  5GXQ D;  2Y2L A;  2UWX A;  4WJ3 C;  5AV6 A;  3AZG A;  2ARO B;  1TZY A;  4XZQ B;  3A6N A;  4J8W A;  4J8X D;  4EO5 C;  5B0Y C;  1P3F B;  3X1V C;  5AY8 A;  5CHL B;  1P3M D;  1M19 A;  3REI D;  3X1U D;  5GT0 B;  5CPI C;  5B0Z A; 
#chains in the Genus database with same CATH homology
 3C1C D;  4J8X B;  1TAF B;  5AV8 D;  2ARO A;  3WAA D;  3MGS D;  1P3M B;  1P3F A;  4LD9 D;  3REI B;  3X1U B;  5JRG D;  3AZM C;  3X1T C;  3C1C B;  5B1L D;  3REH C;  5GXQ A;  2JCH A;  3W97 A;  3W99 D;  5AV8 B;  3WAA B;  3UTA D;  1TAF A;  4LD9 B;  5JRG B;  5AVB A;  3X1U A;  5E5A C;  5B1L B;  3WTP E;  2W8S A;  2XD1 A;  3C1C A;  1EQZ D;  3O62 C;  3W99 B;  3WTP C;  3UTA B;  3AZJ D;  5AV8 A;  3WAA A;  3MGS A;  2BYK A;  2ZM5 A;  4LD9 A;  5B24 C;  4G92 C;  3LZ0 D;  1AOI C;  5JRG A;  1P3O C;  5B40 B;  4Z66 A;  3MNN A;  1EQZ B;  3KSY A;  1P3P C;  3AZJ B;  3MGP C;  3W99 A;  2XD5 A;  1KX5 C;  3WKJ D;  3LZ0 B;  4HGA B;  3MGR C;  2F8N A;  1U35 B;  2IO5 B;  4YS3 C;  2L5A A;  5DNM D;  1EQZ A;  3WKJ B;  5B1M A;  3AZJ A;  5DNN D;  2ZY3 A;  2NQB C;  4WZS B;  3LZ0 A;  4G91 C;  5AV5 C;  4R8P C;  4JJN C;  3AN2 C;  3B6G B;  5DNM B;  2PYO A;  4E44 A;  5DNN B;  3WKJ A;  5B31 A;  3UT9 D;  3AV2 B;  1P34 D;  3B0D C;  2F8N K;  1P3G C;  1KX4 C;  3KWQ C;  4J8U D;  2G5I C;  1M1A D;  4X23 C;  3H0R C;  3UT9 B;  1P3I C;  1P34 B;  5GT3 D;  2Y2J A;  1P3K C;  1WWS A;  4WNN B;  4WU9 C;  3AFA D;  3NQJ B;  5F99 B;  3B6F C;  3UTB D;  5GT3 B;  3REL C;  1ZLA C;  1HQ3 B;  5AV9 C;  1Q9C A;  2G5H C;  1ID3 D;  4J8V C;  3AFA B;  1S32 C;  4J8U A;  1M1A A;  3X1V D;  3X1S C;  1N1J B;  3NQJ A;  4Z5T C;  1P3L C;  5CPI D;  5B32 C;  2FFF B;  3LJA C;  1ID3 B;  4EO5 B;  5B0Y B;  3X1V B;  3AFA A;  2RVQ C;  3KXB C;  1N1J A;  3UTB A;  5CPI B;  3X1T D;  3A1I A;  3KUY C;  4YM6 A;  3REH D;  1BH8 B;  3W96 C;  2RIQ A;  5AVC C;  2YFV A;  1ID3 A;  3V9R B;  4H9R A;  2Y2O A;  3VH6 W;  3X1V A;  3EPJ A;  3AZM B;  3X1T B;  5CPI A;  3REH B;  3MVD C;  1BH8 A;  3O62 D;  2ZY4 A;  5B24 D;  4KHA B;  3X1T A;  2HIO A;  5BO0 A;  1WWI A;  4ZUX C;  3O62 B;  1BH9 B;  4XZQ D;  1F66 A;  1P3P D;  3MGP D;  1KX5 D;  5B24 B;  5GT0 D;  4H9S A;  3FDD A;  2BYM B;  1P3B C;  3REK C;  1P3O B;  5BT1 C;  4KHA A;  3MGR D;  4YS3 D;  3LEL A;  1P3P B;  3O62 A;  1BH9 A;  3MGP B;  1KX5 B;  5GSU C;  5B2I C;  3AZL C;  4KUD C;  3AYW C;  5AV5 D;  2BYM A;  4R8P D;  3MGR B;  4JJN D;  3AN2 D;  5JA4 B;  3C1B C;  4YS3 B;  3AZF C;  3EPL A;  4XZQ A;  2FJ7 C;  4Z2M G;  1P3P A;  3MGP A;  1B67 A;  3WA9 C;  3TU4 C;  5BS7 C;  5GT0 A;  4G91 B;  5AV5 B;  2CWE A;  4R8P B;  4JJN B;  3AN2 B;  1PZR A;  4J8X A;  5JA4 A;  4YS3 A;  1P3G D;  1KX4 D;  3KWQ D;  1P3M A;  3REI A;  2CV5 C;  5CPK D;  4QLC C;  1P3I D;  3B0D B;  5AV5 A;  5B40 D;  4R8P A;  1P3K D;  4CAY B;  1P3G B;  4H9P B;  1KX4 B;  3KWQ B;  1F1E A;  3VH5 T;  5CPK B;  1P3I B;  3VH5 A;  1P3K B;  5B1L A;  3REL D;  1U35 D;  5AV9 D;  3UTA A;  3B0C W;  1S32 D;  1KX4 A;  2Y2N A;  5C3I C;  4XUJ C;  3KWQ A;  5CP6 C;  3X1S D;  3B6F B;  3AV1 C;  2VQR A;  5CPK A;  3A1K A;  3REL B;  4Z5T D;  1P3L D;  3B6G D;  5AV9 B;  1P3K A;  5B40 A;  3LJA D;  3AZG C;  3AZH C;  1TZY C;  3H0L C;  3P5J B;  1KX3 C;  1S32 B;  3REJ C;  3X1S B;  1M19 C;  1BFM A;  3KXB D;  3VH6 A;  4Z5T B;  3AV2 D;  5B0Z C;  1P3L B;  3LJA B;  3KUY D;  1U35 A;  5AV9 A;  1P3A C;  3W97 D;  1S32 A;  3KXB B;  4E45 A;  4ZBJ C;  3KUY B;  4NE6 A;  5GXQ C;  5B32 G;  3B6G A;  5DNM A;  3W96 B;  3LJA A;  3MVD D;  3W97 C;  5F99 D;  5DNN A;  5AVB C;  3AZE C;  1ULY A;  3AV2 A;  1HQ3 D;  3MVD B;  4ZUX D;  3MGS C;  3AZI D;  1T3U A;  4LD9 C;  3UT9 A;  1P3B D;  1P34 A;  3W98 D;  3REK D;  4Z66 C;  3MNN C;  4WNN A;  4ZUX B;  4KGC C;  2NZD C;  3MVD A;  5B0Y D;  4DRB A;  1Z2C B;  3AZI B;  5F99 A;  5GSU D;  5B2I D;  3AZL D;  1P3B B;  3W98 B;  5GT3 A;  3REK B;  4KUD D;  3AYW D;  1HQ3 A;  2ZY5 A;  3C1B D;  5BNX A;  3AZF D;  5B1M C;  2FJ7 D;  3AZI A;  5GSU B;  3TU4 D;  5B2I B;  3AZL B;  3AZM D;  4KUD B;  3AYW B;  3W98 A;  3H0M C;  3REK A;  3C1B B;  3AZF B;  2PYO C;  2FJ7 B;  5B0Y A;  3TU4 B;  5B31 C;  5E5A D;  4QLC D;  5B2I A;  2HUE C;  3AZL A;  3AYW A;  5G49 B;  3B0C T;  3WTP D;  3C1B A;  3NQU B;  3AZF A;  2FJ7 A;  3V9R A;  4WU8 C;  3TU4 A;  1AOI D;  5E5A B;  4QLC B;  3AZM A;  1P3O D;  3REH A;  3WTP B;  5G49 A;  3NQU A;  4G92 B;  4XUJ D;  5CP6 D;  1AOI B;  5CPJ C;  3AV1 D;  5B33 C;  4H9Q B;  5E5A A;  2Y2M A;  3AZG D;  1TZY D;  3WTP A;  1KX3 D;  3EPK A;  4J8U C;  3REJ D;  1M1A C;  5C3I B;  4XUJ B;  5CP6 B;  1M19 D;  2NQB D;  3AV1 B;  5B24 A;  4UPK A;  1AOI A;  1P3O A;  5B0Z D;  4H9Q A;  3AZG B;  1TZY B;  1KX3 B;  3REJ B;  1P3A D;  4AWL C;  1KX5 A;  1M19 B;  2NQB B;  4XUJ A;  5CP6 A;  3UTB C;  3AZN C;  5BNX B;  5B0Z B;  3AZK C;  3MGR A;  4YM6 C;  1P3A B;  2Y2G A;  1KX3 A;  1ID3 C;  4X23 D;  3REJ A;  5AVB D;  2NQB A;  3MGQ C;  4ZBJ B;  1A7W A;  1M18 C;  4JJN A;  3AZE D;  3AN2 A;  5GXQ B;  4WU9 D;  3W97 B;  5B2J C;  4X23 B;  1P3A A;  5AVB B;  3B6F D;  2J8P A;  2Y2I A;  3AZE B;  1ZLA D;  2HIO C;  4WU9 B;  4Z66 D;  3MNN D;  3LZ1 C;  4KGC D;  2NZD D;  4CAY A;  1F66 C;  4J8V D;  1P3G A;  4H9P A;  3MGS B;  2BYK B;  4X23 A;  2Y2P A;  4H9S C;  1P3I A;  1ZLA B;  4NE3 A;  5B32 D;  4M6B A;  4Z66 B;  5AV6 C;  3MNN B;  3A6N C;  3AZE A;  4WU9 A;  3LEL C;  4J8W C;  2F8N D;  4KGC B;  4J8V B;  2NZD B;  3VH6 T;  5B1M D;  5AY8 C;  4DQY B;  2RVQ D;  4H9N B;  3B6F A;  1W2E A;  5B32 B;  3REL A;  2F8N B;  1ZLA A;  5KDM B;  3W96 D;  5AVC D;  3AZH A;  2ARO C;  4XZQ C;  2PYO D;  4KGC A;  2NZD A;  5B1M B;  4J8V A;  1P3F C;  1HTA A;  3X1S A;  3R45 B;  5B31 D;  4H9N A;  5GT0 C;  4Z5T A;  1P3L A;  5B32 A;  2F8N G;  5AVC B;  4J8X C;  5KDM A;  2PYO B;  4Z2M H;  1P3M C;  3IP4 C;  3EG5 B;  5B31 B;  3X1U C;  3KXB A;  3REI C;  4WU8 D;  1R4V A;  3R45 A;  5BNV B;  2HUE B;  3C1C C;  3KUY A;  3W96 A;  5AVC A;  3WAA C;  4CSR B;  5AV8 C;  1H3O B;  2LY8 A;  4WU8 B;  5JRG C;  5B31 G;  5CPJ D;  5BNV A;  5B1L C;  5B33 D;  5BT1 D;  2DF4 C;  2Y2H A;  2Y2Q A;  3W99 C;  3UTA C;  4CSR A;  1H3O A;  1B6W A;  5CPJ B;  4WU8 A;  5CPK C;  5B33 B;  4UUZ B;  5B40 C;  1EQZ C;  4DRA A;  3KFU G;  4ZUX A;  3AZJ C;  3B0B A;  4J8U B;  1M1A B;  3WA9 D;  4WV4 B;  3LZ0 C;  4HGA C;  1P3B A;  5CPJ A;  2JE5 A;  4H9O B;  3AZN D;  5B33 A;  2YFW B;  3AZK D;  1U35 C;  2IO5 C;  2F2A C;  4YM6 D;  1JFI B;  4UUZ A;  3WKJ C;  3WA9 B;  4AWL B;  2ZY2 A;  2CV5 D;  5GSU A;  4KUD A;  3VH5 W;  3MGQ D;  3UTB B;  3AZN B;  3AZK B;  1M18 D;  4H9O A;  4YM6 B;  3B6G C;  5DNM C;  2YFW A;  1JFI A;  2YFV B;  5B2J D;  4H9R B;  5DNN C;  2CV5 B;  3WA9 A;  3MGQ B;  5BS7 A;  3AV2 C;  1M18 B;  3AZN A;  2HIO D;  2F8N H;  3AZK A;  3LZ1 D;  5FUG B;  5B2J B;  4NE5 A;  1F66 D;  2CV5 A;  3UT9 C;  4QLC A;  1P34 C;  3MGQ A;  2Y2K A;  2HIO B;  5BO0 B;  1M18 A;  5AV6 D;  3LZ1 B;  3A6N D;  3AZH D;  3LEL D;  4J8W D;  1F66 B;  5FUG A;  3EPH A;  5B2J A;  5AY8 D;  3AL0 C;  5F99 C;  2JSS A;  5GT3 C;  1HQ3 C;  2DQN C;  5AV6 B;  3A6N B;  3AZH B;  3LEL B;  4J8W B;  3LZ1 A;  2ARO D;  1KU5 A;  3F6T A;  3AFA C;  5AY8 B;  1P3F D;  3AZI C;  2BG1 A;  4NFT A;  3AV1 A;  3W98 C;  5GXQ D;  2Y2L A;  2UWX A;  4WJ3 C;  5AV6 A;  3AZG A;  2ARO B;  1TZY A;  4XZQ B;  3A6N A;  4J8W A;  4J8X D;  4EO5 C;  5B0Y C;  1P3F B;  3X1V C;  5AY8 A;  5CHL B;  1P3M D;  1M19 A;  3REI D;  3X1U D;  5GT0 B;  5CPI C;  5B0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...