5C3IC

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence G, K, O, S, W
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5c3iC00
3B0CW 3AZLD 1HQ3B 3AZIA 1WWIA 4XZQA 1KX4D 2AROC 4NE6A 5GT0D 5AV8B 3AZNB 5B31C 5B33D 5AVCB 5BNVA 3MGRB 3AN2C 5B2ID 3AZKC 4Z2MH 4YM6A 3AZKD 4DRAA 3MGPC 5BT1D 3AZMB 1P3LC 1P3LD 5CPIA 1ZLAB 1TAFB 4J8VA 4G91C 2NQBA 4KGCC 4KGCD 5B40C 5B40D 4WZSB 3MVDC 5AV6D 1HQ3A 4J8UC 1AOIC 1P3GC 5B1MB 1AOID 3MGQC 1P3GD 5AV8A 3AV1C 2PYOB 3AZNA 3AV1D 2YFWB 1EQZB 3MGRA 4HGAB 5AY8C 4ZBJC 3X1SB 3B0BA 3W99C 4J8WB 3VH6T 5B0ZC 3AZHD 1S32B 5CPKD 3LZ0C 1P3OB 1TAFA 2L5AA 5KDMB 5E5AB 4X23C 4G92B 3WAAD 4H9NB 4QLCB 1R4VA 1ID3B 2HUEB 5B1MA 3WKJC 4YM6D 2NZDC 2PYOA 2YFWA 1EQZA 4WU8D 3X1SA 3B6GB 4J8WA 5JRGA 1P3MD 2BYKB 1S32A 5CP6C 3C1BB 5CP6D 1P3AC 1P3OA 1U35B 1P3AD 5KDMA 3REHB 3X1UB 5E5AA 3LELA 1Q9CA 5AV8D 4H9NA 4QLCA 5AVCD 1ID3A 1F66C 1F66D 5GXQC 3W96B 3REKC 3W98B 3WA9C 3AZMD 3REKD 2CV5D 3B6GA 1ZLAD 2BYKA 2F8NG 3C1BA 5AV9B 3KUYB 3A6NC 3X1UA 3V9RA 4J8XB 3AFAC 3AZGC 3AFAD 1P34A 4CSRA 4DRBA 4R8PC 3W96A 3W97D 3W98A 2FJ7B 4JJNB 1KU5A 3C1CC 4M6BA 3C1CD 1P3IB 4LD9C 1A7WA 4Z66A 1M19B 4XUJC 3AZIB 3LJAC 4XUJD 4G91B 5AV9A 3UTBB 3LJAD 3KUYA 3AZJC 1M18C 3AZJD 1TZYC 1M18D 1TZYD 2AROA 4J8XA 1M1AC 3O62B 1M1AD 5C3IC 5B31A 3AZEC 1BH8B 3B6GD 5AVBC 2YFVB 2HIOC 3AN2A 5AVBD 4ZUXC 2FJ7A 1P3PB 3MGSB 3UT9B 5B0ZB 4H9SC 5F99C 1P3IA 5CHLB 1U35D 5F99D 1M19A 3LZ0B 3REHD 3KWQC 1KX4C 3KWQD 3UTBA 5GT0C 5B24B 1HTAA 4X23B 3UTAD 3MVDA 5B33C 3MNNB 3REIB 4WU9B 4NE5A 5B2IC 2JSSA 1P3FC 5B0YB 3O62A 1P3FD 5GSUC 1BH8A 5BT1C 5GSUD 3WTPC 5JA4B 2YFVA 3WTPD 1P3PA 3MGSA 3UT9A 3B0DC 5GT3C 5B0ZA 5GT3D 3KUYD 3RELC 3LZ0A 5AV6C 3RELD 5DNMB 4YS3D 5B24A 4X23A 2IO5C 5AV5B 3MNNA 3REIA 4WU9A 5DNNC 3LZ1C 5DNND 3LZ1D 3B6FB 3TU4C 4KUDB 5B0YA 3AV2C 3TU4D 4JJND 4WNNB 3AZHC 5JRGB 3AYWB 3NQUB 3AV2D 1P3KB 5CPKC 5JA4A 1KX5B 1M19D 4XZQC 3AZID 3AZFB 4XZQD 3WTPE 3LELB 5B2JB 3WAAC 4NE3A 5DNMA 5B32B 4NFTA 4YM6C 3O62D 3X1TB 5AV5A 4WU8C 5B1LB 1P3BB 3B6FA 4EO5B 3KXBB 5GXQA 5CPID 4KUDA 1P3MC 4J8VC 3MGSD 4WNNA 3AYWA 1H3OB 3NQUA 4J8VD 2NQBC 1P3KA 2NQBD 4Z5TB 1KX5A 1HQ3C 1HQ3D 3AZFA 3X1VB 1WWSA 5B2JA 5AV8C 2BYMB 3AZNC 3V9RB 3AZND 5AVCC 5B32A 3A6NA 3MGRC 5CPJB 2F8NB 1P34B 3MGRD 3VH5T 4CSRB 3X1TA 3B0CT 3AZMC 5B1LA 2CV5C 1P3BA 3KXBA 1ZLAC 3REJB 1H3OA 4Z66B 4R8PA 4Z5TA 1KX3B 4H9QB 3AZLB 5DNMD 3X1VA 5B1MC 4H9OB 5B1MD 3R45B 2BYMA 2PYOC 2AROB 2PYOD 1EQZC 1EQZD 4HGAC 5CPJA 2F8NA 4H9RB 3X1SC 5B31B 3X1SD 4J8WC 4J8WD 5JRGD 3AN2B 3W97C 3AZKB 1S32D 1BFMA 4Z2MG 3AZEA 3MGPB 1P3OC 1P3OD 3REJA 5BS7A 1P3LB 2HIOA 4ZUXA 5E5AC 5E5AD 3LELD 4G92C 1KX3A 4H9PB 4KGCB 4H9QA 3VH6W 4QLCC 3AZLA 5B32D 1ID3C 2HUEC 4QLCD 5B40B 3VH6A 1ID3D 4H9OA 3MVDB 3R45A 5GT0A 3X1TD 4J8UB 1AOIB 1P3GB 3MGQB 4H9RA 5B33A 3AV1B 3B6GC 3KXBD 5BO0B 4ZBJB 5AY8B 3AZKA 3W99B 3MGPA 3C1BD 1U35C 1P3LA 3REHC 3X1UC 3X1UD 4H9PA 4KGCA 3WAAB 5B40A 3UTAC 5AV6A 1P34D 4J8UA 1AOIA 3W96C 1P3GA 3W98C 3MGQA 3W96D 3W98D 3WKJB 3AV1A 2NZDB 1ULYA 4Z66D 2F8NH 5AY8A 2LY8A 5BO0A 3W99A 5AV9C 3VH5W 5AV9D 3KUYC 5CPKA 3VH5A 5CP6B 1P3AB 4YS3C 2AROD 4J8XC 4J8XD 3WAAA 5B31D 3AN2D 1F66B 2FJ7C 4JJNC 5GXQB 3WKJA 2FJ7D 2NZDA 3MGPD 4WU8A 1P3IC 3REKB 1M19C 2CV5B 1P3ID 1JFIB 3WA9B 4WV4B 3AZIC 1N1JB 1P3MA 3UTBC 3UTBD 5CP6A 1P3AA 3MVDD 3A6NB 4J8UD 4AWLC 4E45A 3MGQD 3O62C 4E44A 3NQJB 5AVCA 3AFAB 3AZGB 2RVQC 1F66A 5CPIC 2RVQD 5AY8D 1P3PC 3MGSC 3UT9C 3W99D 4KHAB 1P3PD 3UT9D 4R8PB 5B0ZD 3W97B 3AZMA 3REKA 3WA9A 2CV5A 1JFIA 3C1CB 3LZ0D 1ZLAA 5FUGB 1N1JA 4LD9B 5B24C 4UUZB 5B24D 4XUJB 4X23D 3LJAB 3MNNC 3REIC 4WU9C 4WU9D 3MNND 3REID 3AZJB 1M18B 1TZYB 5B0YC 3WKJD 5B0YD 3NQJA 2NZDD 3KSYA 3AFAA 1M1AB 3AZGA 5C3IB 3AZEB 4KHAA 5B32G 5AVBB 2HIOB 3W97A 4ZUXB 3C1CA 5FUGA 5DNMC 5F99B 4LD9A 4UUZA 3KWQB 4XUJA 1KX4B 3LJAA 5GT0B 5AV5C 5AV5D 3AZJA 3UTAB 1M18A 4CAYB 1TZYA 3B6FC 5B33B 3B6FD 4KUDC 3AYWC 5GXQD 4KUDD 5JRGC 3AYWD 1P3KC 5B2IB 1KX5C 1S32C 1P3KD 1P3FB 1M1AA 1KX5D 3WA9D 5GSUB 3WTPB 3AZFC 5AVBA 3AZFD 3LELC 5B2JC 5B2JD 3B0DB 5GT3B 4H9SA 5G49B 1U35A 5F99A 5B32C 3RELB 3A6ND 3REHA 5AV6B 3KWQA 1F1EA 1KX4A 3X1TC 4YS3B 2CWEA 5B1LC 3UTAA 1P3BC 4CAYA 5B1LD 4EO5C 3AZGD 1P3BD 3KXBC 2IO5B 5DNNB 3LZ1B 5B2IA 5BNXB 4Z5TC 4R8PD 3TU4B 1P3FA 4Z5TD 3AV2B 1BH9B 3C1BC 3AZHB 5GSUA 1B6WA 3WTPA 5CPKB 3X1VC 4LD9D 3X1VD 4XZQB 5B31G 5GT3A 5G49A 1B67A 5CPJC 3RELA 1P34C 5CPJD 2F8ND 5BNVB 4YS3A 2F8NK 4AWLB 4YM6B 3AZED 4WU8B 3REJC 5BS7C 5DNNA 3LZ1A 4Z66C 3REJD 2HIOD 5CPIB 5BNXA 3TU4A 4JJNA 4ZUXD 3AV2A 1P3MB 4J8VB 1KX3C 1BH9A 3AZHA 2NQBB 1KX3D 3AZLC
chains in the Genus database with same CATH superfamily
3B0CW 3AZLD 1HQ3B 3AZIA 1WWIA 4XZQA 1KX4D 2AROC 4NE6A 5GT0D 5AV8B 3AZNB 5B31C 5B33D 5AVCB 5BNVA 3MGRB 3AN2C 5B2ID 3AZKC 2VQRA 4Z2MH 4YM6A 3AZKD 4DRAA 3MGPC 5BT1D 3AZMB 1P3LC 1P3LD 5CPIA 1ZLAB 1TAFB 4J8VA 4G91C 2NQBA 4KGCC 4KGCD 5B40C 5B40D 4WZSB 3MVDC 5AV6D 1HQ3A 4WJ3C 4J8UC 1AOIC 1P3GC 5B1MB 3FDDA 1AOID 3MGQC 1P3GD 5AV8A 3AV1C 2PYOB 3AZNA 3AV1D 2YFWB 1EQZB 3MGRA 4HGAB 5AY8C 4ZBJC 3X1SB 3B0BA 3W99C 4J8WB 3VH6T 5B0ZC 2ZY3A 3AZHD 1S32B 5CPKD 3LZ0C 1P3OB 1TAFA 2L5AA 4UPKA 5KDMB 2Y2GA 5E5AB 4X23C 2ZY5A 4G92B 3WAAD 4H9NB 2Y2PA 1R4VA 4QLCB 1ID3B 2HUEB 5B1MA 3WKJC 4YM6D 2NZDC 2PYOA 2YFWA 1EQZA 4WU8D 3X1SA 3B6GB 3AL0C 4J8WA 5JRGA 1P3MD 2BYKB 1S32A 2RIQA 5CP6C 3C1BB 5CP6D 1P3AC 1P3OA 1U35B 1P3AD 5KDMA 3REHB 3X1UB 5E5AA 3LELA 1Q9CA 5AV8D 4H9NA 2J8PA 4QLCA 5AVCD 1ID3A 1F66C 1F66D 5GXQC 3W96B 3REKC 3W98B 3WA9C 3AZMD 3REKD 2CV5D 3B6GA 2Y2MA 2ZY2A 1ZLAD 3IP4C 2BYKA 2F8NG 3C1BA 5AV9B 3KUYB 3A6NC 3X1UA 3V9RA 4J8XB 3AFAC 2W8SA 3AZGC 3AFAD 1P34A 4CSRA 4DRBA 2UWXA 4R8PC 3W96A 3W97D 3W98A 2FJ7B 4JJNB 1KU5A 3C1CC 4M6BA 3C1CD 1P3IB 4LD9C 1A7WA 4Z66A 1M19B 2DQNC 4XUJC 3AZIB 3LJAC 4XUJD 4G91B 5AV9A 3UTBB 3LJAD 3KUYA 3AZJC 1M18C 3AZJD 1TZYC 1M18D 1TZYD 3A1KA 2AROA 3EPHA 4J8XA 2JCHA 1M1AC 3O62B 1M1AD 5C3IC 5B31A 3AZEC 1BH8B 3B6GD 5AVBC 2YFVB 2HIOC 3AN2A 5AVBD 4ZUXC 2FJ7A 1P3PB 3MGSB 3UT9B 5B0ZB 4H9SC 5F99C 1P3IA 5CHLB 1U35D 5F99D 1M19A 3LZ0B 3REHD 3KWQC 1KX4C 3EG5B 3KWQD 3UTBA 5GT0C 5B24B 1HTAA 4X23B 3UTAD 3MVDA 5B33C 3MNNB 3REIB 4WU9B 4NE5A 5B2IC 2JSSA 1P3FC 5B0YB 3O62A 1P3FD 5GSUC 1BH8A 5BT1C 5GSUD 3WTPC 5JA4B 2YFVA 3WTPD 1Z2CB 2Y2KA 1P3PA 3MGSA 3UT9A 3B0DC 5GT3C 5B0ZA 3EPLA 5GT3D 3KUYD 3RELC 3LZ0A 5AV6C 3RELD 5DNMB 4YS3D 5B24A 4X23A 2IO5C 5AV5B 3MNNA 3REIA 4WU9A 5DNNC 3LZ1C 5DNND 3LZ1D 3B6FB 2JE5A 3TU4C 4KUDB 5B0YA 3AV2C 3TU4D 4JJND 4WNNB 3AZHC 5JRGB 3AYWB 3NQUB 3AV2D 1P3KB 5CPKC 5JA4A 1KX5B 2ZM5A 1M19D 2BG1A 4XZQC 3AZID 3AZFB 4XZQD 3WTPE 3LELB 5B2JB 3WAAC 4NE3A 5DNMA 5B32B 4NFTA 3KFUG 4YM6C 3O62D 3X1TB 5AV5A 4WU8C 5B1LB 1P3BB 3B6FA 3F6TA 4EO5B 3KXBB 5GXQA 5CPID 2Y2LA 1P3MC 4J8VC 3MGSD 4WNNA 3AYWA 4KUDA 1H3OB 3NQUA 4J8VD 2NQBC 1P3KA 2NQBD 4Z5TB 1KX5A 2ZY4A 1HQ3C 4DQYB 1HQ3D 3AZFA 3X1VB 2Y2IA 1WWSA 5B2JA 5AV8C 2BYMB 3AZNC 3V9RB 3AZND 5AVCC 5B32A 3A6NA 3MGRC 5CPJB 2F8NB 1P34B 3MGRD 3VH5T 4CSRB 3X1TA 3B0CT 3AZMC 5B1LA 2CV5C 1P3BA 2F2AC 3KXBA 1ZLAC 3REJB 1H3OA 4Z66B 4R8PA 4Z5TA 1KX3B 4H9QB 3AZLB 5DNMD 3X1VA 5B1MC 4H9OB 5B1MD 3R45B 2BYMA 2PYOC 2AROB 2PYOD 1EQZC 1EQZD 4HGAC 5CPJA 2F8NA 4H9RB 3X1SC 5B31B 3X1SD 4J8WC 4J8WD 5JRGD 3AN2B 3W97C 3AZKB 1S32D 1BFMA 4Z2MG 3AZEA 3MGPB 1P3OC 1P3OD 3REJA 5BS7A 1P3LB 2HIOA 2Y2JA 4ZUXA 5E5AC 5E5AD 3LELD 4G92C 1KX3A 4H9PB 4KGCB 4H9QA 3VH6W 4QLCC 3AZLA 5B32D 1ID3C 2HUEC 4QLCD 5B40B 3VH6A 1ID3D 4H9OA 3MVDB 3R45A 5GT0A 3X1TD 4J8UB 1AOIB 1P3GB 3MGQB 4H9RA 5B33A 3AV1B 3B6GC 3KXBD 3H0RC 5BO0B 4ZBJB 5AY8B 3AZKA 3W99B 3H0LC 3MGPA 3C1BD 1U35C 1P3LA 3REHC 3X1UC 3X1UD 4H9PA 4KGCA 3WAAB 5B40A 3UTAC 5AV6A 1P34D 4J8UA 1AOIA 3W96C 1P3GA 3W98C 3MGQA 3W96D 3W98D 3WKJB 3AV1A 2NZDB 1ULYA 4Z66D 2F8NH 5AY8A 2LY8A 5BO0A 3W99A 5AV9C 3VH5W 5AV9D 3KUYC 5CPKA 3VH5A 2DF4C 5CP6B 1T3UA 1P3AB 4YS3C 2AROD 4J8XC 4J8XD 3WAAA 2G5IC 5B31D 3AN2D 1F66B 2FJ7C 4JJNC 5GXQB 3WKJA 2FJ7D 2NZDA 3MGPD 4WU8A 1P3IC 3REKB 1M19C 2CV5B 1P3ID 1JFIB 3WA9B 4WV4B 3AZIC 1N1JB 1P3MA 3UTBC 3UTBD 5CP6A 2Y2QA 1P3AA 3MVDD 3A6NB 4J8UD 4AWLC 4E45A 3MGQD 3O62C 4E44A 3NQJB 5AVCA 3AFAB 3AZGB 2RVQC 1F66A 5CPIC 2RVQD 5AY8D 1P3PC 3MGSC 3UT9C 3W99D 4KHAB 1P3PD 3UT9D 4R8PB 5B0ZD 3W97B 3AZMA 3REKA 3WA9A 2CV5A 1JFIA 3C1CB 3LZ0D 1ZLAA 2Y2HA 5FUGB 1N1JA 4LD9B 5B24C 4UUZB 5B24D 4XUJB 4X23D 3LJAB 3MNNC 3REIC 4WU9C 4WU9D 3MNND 3REID 3AZJB 1M18B 1TZYB 5B0YC 3H0MC 3WKJD 5B0YD 3NQJA 2NZDD 3KSYA 3AFAA 1M1AB 3AZGA 5C3IB 3AZEB 1W2EA 2G5HC 4KHAA 5B32G 5AVBB 2HIOB 3W97A 4ZUXB 3C1CA 5FUGA 5DNMC 5F99B 4LD9A 4UUZA 3KWQB 4XUJA 1KX4B 3LJAA 5GT0B 5AV5C 5AV5D 3AZJA 3UTAB 1M18A 2XD5A 1TZYA 4CAYB 3B6FC 5B33B 3B6FD 4KUDC 3AYWC 5GXQD 4KUDD 5JRGC 3AYWD 1P3KC 5B2IB 1KX5C 1S32C 1P3KD 1P3FB 1M1AA 1KX5D 3WA9D 5GSUB 3WTPB 3AZFC 5AVBA 3AZFD 3LELC 5B2JC 5B2JD 3B0DB 5GT3B 4H9SA 5G49B 1U35A 5F99A 5B32C 3RELB 3A6ND 3REHA 5AV6B 2XD1A 3KWQA 1F1EA 1KX4A 3X1TC 4YS3B 2CWEA 5B1LC 3A1IA 3UTAA 1P3BC 4CAYA 2Y2NA 5B1LD 4EO5C 3AZGD 1P3BD 3KXBC 2IO5B 2FFFB 5DNNB 3LZ1B 5B2IA 5BNXB 4Z5TC 4R8PD 3TU4B 1P3FA 4Z5TD 3AV2B 1BH9B 3C1BC 3AZHB 5GSUA 1B6WA 3WTPA 3P5JB 5CPKB 3X1VC 4LD9D 3EPKA 3X1VD 4XZQB 5B31G 5GT3A 5G49A 1B67A 5CPJC 3RELA 1P34C 5CPJD 2F8ND 5BNVB 4YS3A 2Y2OA 2F8NK 4AWLB 4YM6B 3EPJA 3AZED 1PZRA 4WU8B 5BS7C 5DNNA 3LZ1A 3REJC 4Z66C 3REJD 2HIOD 5CPIB 5BNXA 3TU4A 4JJNA 4ZUXD 3AV2A 1P3MB 4J8VB 1KX3C 1BH9A 3AZHA 2NQBB 1KX3D 3AZLC
chains in the Genus database with same CATH topology
3B0CW 3AZLD 1HQ3B 3AZIA 1WWIA 4XZQA 1KX4D 2AROC 4NE6A 5GT0D 5AV8B 3AZNB 5B31C 5B33D 5AVCB 5BNVA 3MGRB 3AN2C 5B2ID 3AZKC 2VQRA 4Z2MH 4YM6A 3AZKD 4DRAA 3MGPC 5BT1D 3AZMB 1P3LC 1P3LD 5CPIA 1ZLAB 1TAFB 4J8VA 4G91C 2NQBA 4KGCC 4KGCD 5B40C 5B40D 4WZSB 3MVDC 5AV6D 1HQ3A 4WJ3C 4J8UC 1AOIC 1P3GC 5B1MB 3FDDA 1AOID 3MGQC 1P3GD 5AV8A 3AV1C 2PYOB 3AZNA 3AV1D 2YFWB 1EQZB 3MGRA 4HGAB 5AY8C 4ZBJC 3X1SB 3B0BA 3W99C 4J8WB 3VH6T 5B0ZC 2ZY3A 3AZHD 1S32B 5CPKD 3LZ0C 1P3OB 1TAFA 2L5AA 4UPKA 5KDMB 2Y2GA 5E5AB 4X23C 2ZY5A 4G92B 3WAAD 4H9NB 2Y2PA 1R4VA 4QLCB 1ID3B 2HUEB 5B1MA 3WKJC 4YM6D 2NZDC 2PYOA 2YFWA 1EQZA 4WU8D 3X1SA 3B6GB 3AL0C 4J8WA 5JRGA 1P3MD 2BYKB 1S32A 2RIQA 5CP6C 3C1BB 5CP6D 1P3AC 1P3OA 1U35B 1P3AD 5KDMA 3REHB 3X1UB 5E5AA 3LELA 1Q9CA 5AV8D 4H9NA 2J8PA 4QLCA 5AVCD 1ID3A 1F66C 1F66D 5GXQC 3W96B 3REKC 3W98B 3WA9C 3AZMD 3REKD 2CV5D 3B6GA 2Y2MA 2ZY2A 1ZLAD 3IP4C 2BYKA 2F8NG 3C1BA 5AV9B 3KUYB 3A6NC 3X1UA 3V9RA 4J8XB 3AFAC 2W8SA 3AZGC 3AFAD 1P34A 4CSRA 4DRBA 2UWXA 4R8PC 3W96A 3W97D 3W98A 2FJ7B 4JJNB 1KU5A 3C1CC 4M6BA 3C1CD 1P3IB 4LD9C 1A7WA 4Z66A 1M19B 2DQNC 4XUJC 3AZIB 3LJAC 4XUJD 4G91B 5AV9A 3UTBB 3LJAD 3KUYA 3AZJC 1M18C 3AZJD 1TZYC 1M18D 1TZYD 3A1KA 2AROA 3EPHA 4J8XA 2JCHA 1M1AC 3O62B 1M1AD 5C3IC 5B31A 3AZEC 1BH8B 3B6GD 5AVBC 2YFVB 2HIOC 3AN2A 5AVBD 4ZUXC 2FJ7A 1P3PB 3MGSB 3UT9B 5B0ZB 4H9SC 5F99C 1P3IA 5CHLB 1U35D 5F99D 1M19A 3LZ0B 3REHD 3KWQC 1KX4C 3EG5B 3KWQD 3UTBA 5GT0C 5B24B 1HTAA 4X23B 3UTAD 3MVDA 5B33C 3MNNB 3REIB 4WU9B 4NE5A 5B2IC 2JSSA 1P3FC 5B0YB 3O62A 1P3FD 5GSUC 1BH8A 5BT1C 5GSUD 3WTPC 5JA4B 2YFVA 3WTPD 1Z2CB 2Y2KA 1P3PA 3MGSA 3UT9A 3B0DC 5GT3C 5B0ZA 3EPLA 5GT3D 3KUYD 3RELC 3LZ0A 5AV6C 3RELD 5DNMB 4YS3D 5B24A 4X23A 2IO5C 5AV5B 3MNNA 3REIA 4WU9A 5DNNC 3LZ1C 5DNND 3LZ1D 3B6FB 2JE5A 3TU4C 4KUDB 5B0YA 3AV2C 3TU4D 4JJND 4WNNB 3AZHC 5JRGB 3AYWB 3NQUB 3AV2D 1P3KB 5CPKC 5JA4A 1KX5B 2ZM5A 1M19D 2BG1A 4XZQC 3AZID 3AZFB 4XZQD 3WTPE 3LELB 5B2JB 3WAAC 4NE3A 5DNMA 5B32B 4NFTA 3KFUG 4YM6C 3O62D 3X1TB 5AV5A 4WU8C 5B1LB 1P3BB 3B6FA 3F6TA 4EO5B 3KXBB 5GXQA 5CPID 2Y2LA 1P3MC 4J8VC 3MGSD 4WNNA 3AYWA 4KUDA 1H3OB 3NQUA 4J8VD 2NQBC 1P3KA 2NQBD 4Z5TB 1KX5A 2ZY4A 1HQ3C 4DQYB 1HQ3D 3AZFA 3X1VB 2Y2IA 1WWSA 5B2JA 5AV8C 2BYMB 3AZNC 3V9RB 3AZND 5AVCC 5B32A 3A6NA 3MGRC 5CPJB 2F8NB 1P34B 3MGRD 3VH5T 4CSRB 3X1TA 3B0CT 3AZMC 5B1LA 2CV5C 1P3BA 2F2AC 3KXBA 1ZLAC 3REJB 1H3OA 4Z66B 4R8PA 4Z5TA 1KX3B 4H9QB 3AZLB 5DNMD 3X1VA 5B1MC 4H9OB 5B1MD 3R45B 2BYMA 2PYOC 2AROB 2PYOD 1EQZC 1EQZD 4HGAC 5CPJA 2F8NA 4H9RB 3X1SC 5B31B 3X1SD 4J8WC 4J8WD 5JRGD 3AN2B 3W97C 3AZKB 1S32D 1BFMA 4Z2MG 3AZEA 3MGPB 1P3OC 1P3OD 3REJA 5BS7A 1P3LB 2HIOA 2Y2JA 4ZUXA 5E5AC 5E5AD 3LELD 4G92C 1KX3A 4H9PB 4KGCB 4H9QA 3VH6W 4QLCC 3AZLA 5B32D 1ID3C 2HUEC 4QLCD 5B40B 3VH6A 1ID3D 4H9OA 3MVDB 3R45A 5GT0A 3X1TD 4J8UB 1AOIB 1P3GB 3MGQB 4H9RA 5B33A 3AV1B 3B6GC 3KXBD 3H0RC 5BO0B 4ZBJB 5AY8B 3AZKA 3W99B 3H0LC 3MGPA 3C1BD 1U35C 1P3LA 3REHC 3X1UC 3X1UD 4H9PA 4KGCA 3WAAB 5B40A 3UTAC 5AV6A 1P34D 4J8UA 1AOIA 3W96C 1P3GA 3W98C 3MGQA 3W96D 3W98D 3WKJB 3AV1A 2NZDB 1ULYA 4Z66D 2F8NH 5AY8A 2LY8A 5BO0A 3W99A 5AV9C 3VH5W 5AV9D 3KUYC 5CPKA 3VH5A 2DF4C 5CP6B 1T3UA 1P3AB 4YS3C 2AROD 4J8XC 4J8XD 3WAAA 2G5IC 5B31D 3AN2D 1F66B 2FJ7C 4JJNC 5GXQB 3WKJA 2FJ7D 2NZDA 3MGPD 4WU8A 1P3IC 3REKB 1M19C 2CV5B 1P3ID 1JFIB 3WA9B 4WV4B 3AZIC 1N1JB 1P3MA 3UTBC 3UTBD 5CP6A 2Y2QA 1P3AA 3MVDD 3A6NB 4J8UD 4AWLC 4E45A 3MGQD 3O62C 4E44A 3NQJB 5AVCA 3AFAB 3AZGB 2RVQC 1F66A 5CPIC 2RVQD 5AY8D 1P3PC 3MGSC 3UT9C 3W99D 4KHAB 1P3PD 3UT9D 4R8PB 5B0ZD 3W97B 3AZMA 3REKA 3WA9A 2CV5A 1JFIA 3C1CB 3LZ0D 1ZLAA 2Y2HA 5FUGB 1N1JA 4LD9B 5B24C 4UUZB 5B24D 4XUJB 4X23D 3LJAB 3MNNC 3REIC 4WU9C 4WU9D 3MNND 3REID 3AZJB 1M18B 1TZYB 5B0YC 3H0MC 3WKJD 5B0YD 3NQJA 2NZDD 3KSYA 3AFAA 1M1AB 3AZGA 5C3IB 3AZEB 1W2EA 2G5HC 4KHAA 5B32G 5AVBB 2HIOB 3W97A 4ZUXB 3C1CA 5FUGA 5DNMC 5F99B 4LD9A 4UUZA 3KWQB 4XUJA 1KX4B 3LJAA 5GT0B 5AV5C 5AV5D 3AZJA 3UTAB 1M18A 2XD5A 1TZYA 4CAYB 3B6FC 5B33B 3B6FD 4KUDC 3AYWC 5GXQD 4KUDD 5JRGC 3AYWD 1P3KC 5B2IB 1KX5C 1S32C 1P3KD 1P3FB 1M1AA 1KX5D 3WA9D 5GSUB 3WTPB 3AZFC 5AVBA 3AZFD 3LELC 5B2JC 5B2JD 3B0DB 5GT3B 4H9SA 5G49B 1U35A 5F99A 5B32C 3RELB 3A6ND 3REHA 5AV6B 2XD1A 3KWQA 1F1EA 1KX4A 3X1TC 4YS3B 2CWEA 5B1LC 3A1IA 3UTAA 1P3BC 4CAYA 2Y2NA 5B1LD 4EO5C 3AZGD 1P3BD 3KXBC 2IO5B 2FFFB 5DNNB 3LZ1B 5B2IA 5BNXB 4Z5TC 4R8PD 3TU4B 1P3FA 4Z5TD 3AV2B 1BH9B 3C1BC 3AZHB 5GSUA 1B6WA 3WTPA 3P5JB 5CPKB 3X1VC 4LD9D 3EPKA 3X1VD 4XZQB 5B31G 5GT3A 5G49A 1B67A 5CPJC 3RELA 1P34C 5CPJD 2F8ND 5BNVB 4YS3A 2Y2OA 2F8NK 4AWLB 4YM6B 3EPJA 3AZED 1PZRA 4WU8B 5BS7C 5DNNA 3LZ1A 3REJC 4Z66C 3REJD 2HIOD 5CPIB 5BNXA 3TU4A 4JJNA 4ZUXD 3AV2A 1P3MB 4J8VB 1KX3C 1BH9A 3AZHA 2NQBB 1KX3D 3AZLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C W;  3AZL D;  1HQ3 B;  3AZI A;  1WWI A;  4XZQ A;  1KX4 D;  2ARO C;  4NE6 A;  5GT0 D;  5AV8 B;  3AZN B;  5B31 C;  5B33 D;  5AVC B;  5BNV A;  3MGR B;  3AN2 C;  5B2I D;  3AZK C;  4Z2M H;  4YM6 A;  3AZK D;  4DRA A;  3MGP C;  5BT1 D;  3AZM B;  1P3L C;  1P3L D;  5CPI A;  1ZLA B;  1TAF B;  4J8V A;  4G91 C;  2NQB A;  4KGC C;  4KGC D;  5B40 C;  5B40 D;  4WZS B;  3MVD C;  5AV6 D;  1HQ3 A;  4J8U C;  1AOI C;  1P3G C;  5B1M B;  1AOI D;  3MGQ C;  1P3G D;  5AV8 A;  3AV1 C;  2PYO B;  3AZN A;  3AV1 D;  2YFW B;  1EQZ B;  3MGR A;  4HGA B;  5AY8 C;  4ZBJ C;  3X1S B;  3B0B A;  3W99 C;  4J8W B;  3VH6 T;  5B0Z C;  3AZH D;  1S32 B;  5CPK D;  3LZ0 C;  1P3O B;  1TAF A;  2L5A A;  5KDM B;  5E5A B;  4X23 C;  4G92 B;  3WAA D;  4H9N B;  4QLC B;  1R4V A;  1ID3 B;  2HUE B;  5B1M A;  3WKJ C;  4YM6 D;  2NZD C;  2PYO A;  2YFW A;  1EQZ A;  4WU8 D;  3X1S A;  3B6G B;  4J8W A;  5JRG A;  1P3M D;  2BYK B;  1S32 A;  5CP6 C;  3C1B B;  5CP6 D;  1P3A C;  1P3O A;  1U35 B;  1P3A D;  5KDM A;  3REH B;  3X1U B;  5E5A A;  3LEL A;  1Q9C A;  5AV8 D;  4H9N A;  4QLC A;  5AVC D;  1ID3 A;  1F66 C;  1F66 D;  5GXQ C;  3W96 B;  3REK C;  3W98 B;  3WA9 C;  3AZM D;  3REK D;  2CV5 D;  3B6G A;  1ZLA D;  2BYK A;  2F8N G;  3C1B A;  5AV9 B;  3KUY B;  3A6N C;  3X1U A;  3V9R A;  4J8X B;  3AFA C;  3AZG C;  3AFA D;  1P34 A;  4CSR A;  4DRB A;  4R8P C;  3W96 A;  3W97 D;  3W98 A;  2FJ7 B;  4JJN B;  1KU5 A;  3C1C C;  4M6B A;  3C1C D;  1P3I B;  4LD9 C;  1A7W A;  4Z66 A;  1M19 B;  4XUJ C;  3AZI B;  3LJA C;  4XUJ D;  4G91 B;  5AV9 A;  3UTB B;  3LJA D;  3KUY A;  3AZJ C;  1M18 C;  3AZJ D;  1TZY C;  1M18 D;  1TZY D;  2ARO A;  4J8X A;  1M1A C;  3O62 B;  1M1A D;  5C3I C;  5B31 A;  3AZE C;  1BH8 B;  3B6G D;  5AVB C;  2YFV B;  2HIO C;  3AN2 A;  5AVB D;  4ZUX C;  2FJ7 A;  1P3P B;  3MGS B;  3UT9 B;  5B0Z B;  4H9S C;  5F99 C;  1P3I A;  5CHL B;  1U35 D;  5F99 D;  1M19 A;  3LZ0 B;  3REH D;  3KWQ C;  1KX4 C;  3KWQ D;  3UTB A;  5GT0 C;  5B24 B;  1HTA A;  4X23 B;  3UTA D;  3MVD A;  5B33 C;  3MNN B;  3REI B;  4WU9 B;  4NE5 A;  5B2I C;  2JSS A;  1P3F C;  5B0Y B;  3O62 A;  1P3F D;  5GSU C;  1BH8 A;  5BT1 C;  5GSU D;  3WTP C;  5JA4 B;  2YFV A;  3WTP D;  1P3P A;  3MGS A;  3UT9 A;  3B0D C;  5GT3 C;  5B0Z A;  5GT3 D;  3KUY D;  3REL C;  3LZ0 A;  5AV6 C;  3REL D;  5DNM B;  4YS3 D;  5B24 A;  4X23 A;  2IO5 C;  5AV5 B;  3MNN A;  3REI A;  4WU9 A;  5DNN C;  3LZ1 C;  5DNN D;  3LZ1 D;  3B6F B;  3TU4 C;  4KUD B;  5B0Y A;  3AV2 C;  3TU4 D;  4JJN D;  4WNN B;  3AZH C;  5JRG B;  3AYW B;  3NQU B;  3AV2 D;  1P3K B;  5CPK C;  5JA4 A;  1KX5 B;  1M19 D;  4XZQ C;  3AZI D;  3AZF B;  4XZQ D;  3WTP E;  3LEL B;  5B2J B;  3WAA C;  4NE3 A;  5DNM A;  5B32 B;  4NFT A;  4YM6 C;  3O62 D;  3X1T B;  5AV5 A;  4WU8 C;  5B1L B;  1P3B B;  3B6F A;  4EO5 B;  3KXB B;  5GXQ A;  5CPI D;  4KUD A;  1P3M C;  4J8V C;  3MGS D;  4WNN A;  3AYW A;  1H3O B;  3NQU A;  4J8V D;  2NQB C;  1P3K A;  2NQB D;  4Z5T B;  1KX5 A;  1HQ3 C;  1HQ3 D;  3AZF A;  3X1V B;  1WWS A;  5B2J A;  5AV8 C;  2BYM B;  3AZN C;  3V9R B;  3AZN D;  5AVC C;  5B32 A;  3A6N A;  3MGR C;  5CPJ B;  2F8N B;  1P34 B;  3MGR D;  3VH5 T;  4CSR B;  3X1T A;  3B0C T;  3AZM C;  5B1L A;  2CV5 C;  1P3B A;  3KXB A;  1ZLA C;  3REJ B;  1H3O A;  4Z66 B;  4R8P A;  4Z5T A;  1KX3 B;  4H9Q B;  3AZL B;  5DNM D;  3X1V A;  5B1M C;  4H9O B;  5B1M D;  3R45 B;  2BYM A;  2PYO C;  2ARO B;  2PYO D;  1EQZ C;  1EQZ D;  4HGA C;  5CPJ A;  2F8N A;  4H9R B;  3X1S C;  5B31 B;  3X1S D;  4J8W C;  4J8W D;  5JRG D;  3AN2 B;  3W97 C;  3AZK B;  1S32 D;  1BFM A;  4Z2M G;  3AZE A;  3MGP B;  1P3O C;  1P3O D;  3REJ A;  5BS7 A;  1P3L B;  2HIO A;  4ZUX A;  5E5A C;  5E5A D;  3LEL D;  4G92 C;  1KX3 A;  4H9P B;  4KGC B;  4H9Q A;  3VH6 W;  4QLC C;  3AZL A;  5B32 D;  1ID3 C;  2HUE C;  4QLC D;  5B40 B;  3VH6 A;  1ID3 D;  4H9O A;  3MVD B;  3R45 A;  5GT0 A;  3X1T D;  4J8U B;  1AOI B;  1P3G B;  3MGQ B;  4H9R A;  5B33 A;  3AV1 B;  3B6G C;  3KXB D;  5BO0 B;  4ZBJ B;  5AY8 B;  3AZK A;  3W99 B;  3MGP A;  3C1B D;  1U35 C;  1P3L A;  3REH C;  3X1U C;  3X1U D;  4H9P A;  4KGC A;  3WAA B;  5B40 A;  3UTA C;  5AV6 A;  1P34 D;  4J8U A;  1AOI A;  3W96 C;  1P3G A;  3W98 C;  3MGQ A;  3W96 D;  3W98 D;  3WKJ B;  3AV1 A;  2NZD B;  1ULY A;  4Z66 D;  2F8N H;  5AY8 A;  2LY8 A;  5BO0 A;  3W99 A;  5AV9 C;  3VH5 W;  5AV9 D;  3KUY C;  5CPK A;  3VH5 A;  5CP6 B;  1P3A B;  4YS3 C;  2ARO D;  4J8X C;  4J8X D;  3WAA A;  5B31 D;  3AN2 D;  1F66 B;  2FJ7 C;  4JJN C;  5GXQ B;  3WKJ A;  2FJ7 D;  2NZD A;  3MGP D;  4WU8 A;  1P3I C;  3REK B;  1M19 C;  2CV5 B;  1P3I D;  1JFI B;  3WA9 B;  4WV4 B;  3AZI C;  1N1J B;  1P3M A;  3UTB C;  3UTB D;  5CP6 A;  1P3A A;  3MVD D;  3A6N B;  4J8U D;  4AWL C;  4E45 A;  3MGQ D;  3O62 C;  4E44 A;  3NQJ B;  5AVC A;  3AFA B;  3AZG B;  2RVQ C;  1F66 A;  5CPI C;  2RVQ D;  5AY8 D;  1P3P C;  3MGS C;  3UT9 C;  3W99 D;  4KHA B;  1P3P D;  3UT9 D;  4R8P B;  5B0Z D;  3W97 B;  3AZM A;  3REK A;  3WA9 A;  2CV5 A;  1JFI A;  3C1C B;  3LZ0 D;  1ZLA A;  5FUG B;  1N1J A;  4LD9 B;  5B24 C;  4UUZ B;  5B24 D;  4XUJ B;  4X23 D;  3LJA B;  3MNN C;  3REI C;  4WU9 C;  4WU9 D;  3MNN D;  3REI D;  3AZJ B;  1M18 B;  1TZY B;  5B0Y C;  3WKJ D;  5B0Y D;  3NQJ A;  2NZD D;  3KSY A;  3AFA A;  1M1A B;  3AZG A;  5C3I B;  3AZE B;  4KHA A;  5B32 G;  5AVB B;  2HIO B;  3W97 A;  4ZUX B;  3C1C A;  5FUG A;  5DNM C;  5F99 B;  4LD9 A;  4UUZ A;  3KWQ B;  4XUJ A;  1KX4 B;  3LJA A;  5GT0 B;  5AV5 C;  5AV5 D;  3AZJ A;  3UTA B;  1M18 A;  4CAY B;  1TZY A;  3B6F C;  5B33 B;  3B6F D;  4KUD C;  3AYW C;  5GXQ D;  4KUD D;  5JRG C;  3AYW D;  1P3K C;  5B2I B;  1KX5 C;  1S32 C;  1P3K D;  1P3F B;  1M1A A;  1KX5 D;  3WA9 D;  5GSU B;  3WTP B;  3AZF C;  5AVB A;  3AZF D;  3LEL C;  5B2J C;  5B2J D;  3B0D B;  5GT3 B;  4H9S A;  5G49 B;  1U35 A;  5F99 A;  5B32 C;  3REL B;  3A6N D;  3REH A;  5AV6 B;  3KWQ A;  1F1E A;  1KX4 A;  3X1T C;  4YS3 B;  2CWE A;  5B1L C;  3UTA A;  1P3B C;  4CAY A;  5B1L D;  4EO5 C;  3AZG D;  1P3B D;  3KXB C;  2IO5 B;  5DNN B;  3LZ1 B;  5B2I A;  5BNX B;  4Z5T C;  4R8P D;  3TU4 B;  1P3F A;  4Z5T D;  3AV2 B;  1BH9 B;  3C1B C;  3AZH B;  5GSU A;  1B6W A;  3WTP A;  5CPK B;  3X1V C;  4LD9 D;  3X1V D;  4XZQ B;  5B31 G;  5GT3 A;  5G49 A;  1B67 A;  5CPJ C;  3REL A;  1P34 C;  5CPJ D;  2F8N D;  5BNV B;  4YS3 A;  2F8N K;  4AWL B;  4YM6 B;  3AZE D;  4WU8 B;  3REJ C;  5BS7 C;  5DNN A;  3LZ1 A;  4Z66 C;  3REJ D;  2HIO D;  5CPI B;  5BNX A;  3TU4 A;  4JJN A;  4ZUX D;  3AV2 A;  1P3M B;  4J8V B;  1KX3 C;  1BH9 A;  3AZH A;  2NQB B;  1KX3 D;  3AZL C; 
#chains in the Genus database with same CATH topology
 3B0C W;  3AZL D;  1HQ3 B;  3AZI A;  1WWI A;  4XZQ A;  1KX4 D;  2ARO C;  4NE6 A;  5GT0 D;  5AV8 B;  3AZN B;  5B31 C;  5B33 D;  5AVC B;  5BNV A;  3MGR B;  3AN2 C;  5B2I D;  3AZK C;  2VQR A;  4Z2M H;  4YM6 A;  3AZK D;  4DRA A;  3MGP C;  5BT1 D;  3AZM B;  1P3L C;  1P3L D;  5CPI A;  1ZLA B;  1TAF B;  4J8V A;  4G91 C;  2NQB A;  4KGC C;  4KGC D;  5B40 C;  5B40 D;  4WZS B;  3MVD C;  5AV6 D;  1HQ3 A;  4WJ3 C;  4J8U C;  1AOI C;  1P3G C;  5B1M B;  3FDD A;  1AOI D;  3MGQ C;  1P3G D;  5AV8 A;  3AV1 C;  2PYO B;  3AZN A;  3AV1 D;  2YFW B;  1EQZ B;  3MGR A;  4HGA B;  5AY8 C;  4ZBJ C;  3X1S B;  3B0B A;  3W99 C;  4J8W B;  3VH6 T;  5B0Z C;  2ZY3 A;  3AZH D;  1S32 B;  5CPK D;  3LZ0 C;  1P3O B;  1TAF A;  2L5A A;  4UPK A;  5KDM B;  2Y2G A;  5E5A B;  4X23 C;  2ZY5 A;  4G92 B;  3WAA D;  4H9N B;  2Y2P A;  1R4V A;  4QLC B;  1ID3 B;  2HUE B;  5B1M A;  3WKJ C;  4YM6 D;  2NZD C;  2PYO A;  2YFW A;  1EQZ A;  4WU8 D;  3X1S A;  3B6G B;  3AL0 C;  4J8W A;  5JRG A;  1P3M D;  2BYK B;  1S32 A;  2RIQ A;  5CP6 C;  3C1B B;  5CP6 D;  1P3A C;  1P3O A;  1U35 B;  1P3A D;  5KDM A;  3REH B;  3X1U B;  5E5A A;  3LEL A;  1Q9C A;  5AV8 D;  4H9N A;  2J8P A;  4QLC A;  5AVC D;  1ID3 A;  1F66 C;  1F66 D;  5GXQ C;  3W96 B;  3REK C;  3W98 B;  3WA9 C;  3AZM D;  3REK D;  2CV5 D;  3B6G A;  2Y2M A;  2ZY2 A;  1ZLA D;  3IP4 C;  2BYK A;  2F8N G;  3C1B A;  5AV9 B;  3KUY B;  3A6N C;  3X1U A;  3V9R A;  4J8X B;  3AFA C;  2W8S A;  3AZG C;  3AFA D;  1P34 A;  4CSR A;  4DRB A;  2UWX A;  4R8P C;  3W96 A;  3W97 D;  3W98 A;  2FJ7 B;  4JJN B;  1KU5 A;  3C1C C;  4M6B A;  3C1C D;  1P3I B;  4LD9 C;  1A7W A;  4Z66 A;  1M19 B;  2DQN C;  4XUJ C;  3AZI B;  3LJA C;  4XUJ D;  4G91 B;  5AV9 A;  3UTB B;  3LJA D;  3KUY A;  3AZJ C;  1M18 C;  3AZJ D;  1TZY C;  1M18 D;  1TZY D;  3A1K A;  2ARO A;  3EPH A;  4J8X A;  2JCH A;  1M1A C;  3O62 B;  1M1A D;  5C3I C;  5B31 A;  3AZE C;  1BH8 B;  3B6G D;  5AVB C;  2YFV B;  2HIO C;  3AN2 A;  5AVB D;  4ZUX C;  2FJ7 A;  1P3P B;  3MGS B;  3UT9 B;  5B0Z B;  4H9S C;  5F99 C;  1P3I A;  5CHL B;  1U35 D;  5F99 D;  1M19 A;  3LZ0 B;  3REH D;  3KWQ C;  1KX4 C;  3EG5 B;  3KWQ D;  3UTB A;  5GT0 C;  5B24 B;  1HTA A;  4X23 B;  3UTA D;  3MVD A;  5B33 C;  3MNN B;  3REI B;  4WU9 B;  4NE5 A;  5B2I C;  2JSS A;  1P3F C;  5B0Y B;  3O62 A;  1P3F D;  5GSU C;  1BH8 A;  5BT1 C;  5GSU D;  3WTP C;  5JA4 B;  2YFV A;  3WTP D;  1Z2C B;  2Y2K A;  1P3P A;  3MGS A;  3UT9 A;  3B0D C;  5GT3 C;  5B0Z A;  3EPL A;  5GT3 D;  3KUY D;  3REL C;  3LZ0 A;  5AV6 C;  3REL D;  5DNM B;  4YS3 D;  5B24 A;  4X23 A;  2IO5 C;  5AV5 B;  3MNN A;  3REI A;  4WU9 A;  5DNN C;  3LZ1 C;  5DNN D;  3LZ1 D;  3B6F B;  2JE5 A;  3TU4 C;  4KUD B;  5B0Y A;  3AV2 C;  3TU4 D;  4JJN D;  4WNN B;  3AZH C;  5JRG B;  3AYW B;  3NQU B;  3AV2 D;  1P3K B;  5CPK C;  5JA4 A;  1KX5 B;  2ZM5 A;  1M19 D;  2BG1 A;  4XZQ C;  3AZI D;  3AZF B;  4XZQ D;  3WTP E;  3LEL B;  5B2J B;  3WAA C;  4NE3 A;  5DNM A;  5B32 B;  4NFT A;  3KFU G;  4YM6 C;  3O62 D;  3X1T B;  5AV5 A;  4WU8 C;  5B1L B;  1P3B B;  3B6F A;  3F6T A;  4EO5 B;  3KXB B;  5GXQ A;  5CPI D;  2Y2L A;  1P3M C;  4J8V C;  3MGS D;  4WNN A;  3AYW A;  4KUD A;  1H3O B;  3NQU A;  4J8V D;  2NQB C;  1P3K A;  2NQB D;  4Z5T B;  1KX5 A;  2ZY4 A;  1HQ3 C;  4DQY B;  1HQ3 D;  3AZF A;  3X1V B;  2Y2I A;  1WWS A;  5B2J A;  5AV8 C;  2BYM B;  3AZN C;  3V9R B;  3AZN D;  5AVC C;  5B32 A;  3A6N A;  3MGR C;  5CPJ B;  2F8N B;  1P34 B;  3MGR D;  3VH5 T;  4CSR B;  3X1T A;  3B0C T;  3AZM C;  5B1L A;  2CV5 C;  1P3B A;  2F2A C;  3KXB A;  1ZLA C;  3REJ B;  1H3O A;  4Z66 B;  4R8P A;  4Z5T A;  1KX3 B;  4H9Q B;  3AZL B;  5DNM D;  3X1V A;  5B1M C;  4H9O B;  5B1M D;  3R45 B;  2BYM A;  2PYO C;  2ARO B;  2PYO D;  1EQZ C;  1EQZ D;  4HGA C;  5CPJ A;  2F8N A;  4H9R B;  3X1S C;  5B31 B;  3X1S D;  4J8W C;  4J8W D;  5JRG D;  3AN2 B;  3W97 C;  3AZK B;  1S32 D;  1BFM A;  4Z2M G;  3AZE A;  3MGP B;  1P3O C;  1P3O D;  3REJ A;  5BS7 A;  1P3L B;  2HIO A;  2Y2J A;  4ZUX A;  5E5A C;  5E5A D;  3LEL D;  4G92 C;  1KX3 A;  4H9P B;  4KGC B;  4H9Q A;  3VH6 W;  4QLC C;  3AZL A;  5B32 D;  1ID3 C;  2HUE C;  4QLC D;  5B40 B;  3VH6 A;  1ID3 D;  4H9O A;  3MVD B;  3R45 A;  5GT0 A;  3X1T D;  4J8U B;  1AOI B;  1P3G B;  3MGQ B;  4H9R A;  5B33 A;  3AV1 B;  3B6G C;  3KXB D;  3H0R C;  5BO0 B;  4ZBJ B;  5AY8 B;  3AZK A;  3W99 B;  3H0L C;  3MGP A;  3C1B D;  1U35 C;  1P3L A;  3REH C;  3X1U C;  3X1U D;  4H9P A;  4KGC A;  3WAA B;  5B40 A;  3UTA C;  5AV6 A;  1P34 D;  4J8U A;  1AOI A;  3W96 C;  1P3G A;  3W98 C;  3MGQ A;  3W96 D;  3W98 D;  3WKJ B;  3AV1 A;  2NZD B;  1ULY A;  4Z66 D;  2F8N H;  5AY8 A;  2LY8 A;  5BO0 A;  3W99 A;  5AV9 C;  3VH5 W;  5AV9 D;  3KUY C;  5CPK A;  3VH5 A;  2DF4 C;  5CP6 B;  1T3U A;  1P3A B;  4YS3 C;  2ARO D;  4J8X C;  4J8X D;  3WAA A;  2G5I C;  5B31 D;  3AN2 D;  1F66 B;  2FJ7 C;  4JJN C;  5GXQ B;  3WKJ A;  2FJ7 D;  2NZD A;  3MGP D;  4WU8 A;  1P3I C;  3REK B;  1M19 C;  2CV5 B;  1P3I D;  1JFI B;  3WA9 B;  4WV4 B;  3AZI C;  1N1J B;  1P3M A;  3UTB C;  3UTB D;  5CP6 A;  2Y2Q A;  1P3A A;  3MVD D;  3A6N B;  4J8U D;  4AWL C;  4E45 A;  3MGQ D;  3O62 C;  4E44 A;  3NQJ B;  5AVC A;  3AFA B;  3AZG B;  2RVQ C;  1F66 A;  5CPI C;  2RVQ D;  5AY8 D;  1P3P C;  3MGS C;  3UT9 C;  3W99 D;  4KHA B;  1P3P D;  3UT9 D;  4R8P B;  5B0Z D;  3W97 B;  3AZM A;  3REK A;  3WA9 A;  2CV5 A;  1JFI A;  3C1C B;  3LZ0 D;  1ZLA A;  2Y2H A;  5FUG B;  1N1J A;  4LD9 B;  5B24 C;  4UUZ B;  5B24 D;  4XUJ B;  4X23 D;  3LJA B;  3MNN C;  3REI C;  4WU9 C;  4WU9 D;  3MNN D;  3REI D;  3AZJ B;  1M18 B;  1TZY B;  5B0Y C;  3H0M C;  3WKJ D;  5B0Y D;  3NQJ A;  2NZD D;  3KSY A;  3AFA A;  1M1A B;  3AZG A;  5C3I B;  3AZE B;  1W2E A;  2G5H C;  4KHA A;  5B32 G;  5AVB B;  2HIO B;  3W97 A;  4ZUX B;  3C1C A;  5FUG A;  5DNM C;  5F99 B;  4LD9 A;  4UUZ A;  3KWQ B;  4XUJ A;  1KX4 B;  3LJA A;  5GT0 B;  5AV5 C;  5AV5 D;  3AZJ A;  3UTA B;  1M18 A;  2XD5 A;  1TZY A;  4CAY B;  3B6F C;  5B33 B;  3B6F D;  4KUD C;  3AYW C;  5GXQ D;  4KUD D;  5JRG C;  3AYW D;  1P3K C;  5B2I B;  1KX5 C;  1S32 C;  1P3K D;  1P3F B;  1M1A A;  1KX5 D;  3WA9 D;  5GSU B;  3WTP B;  3AZF C;  5AVB A;  3AZF D;  3LEL C;  5B2J C;  5B2J D;  3B0D B;  5GT3 B;  4H9S A;  5G49 B;  1U35 A;  5F99 A;  5B32 C;  3REL B;  3A6N D;  3REH A;  5AV6 B;  2XD1 A;  3KWQ A;  1F1E A;  1KX4 A;  3X1T C;  4YS3 B;  2CWE A;  5B1L C;  3A1I A;  3UTA A;  1P3B C;  4CAY A;  2Y2N A;  5B1L D;  4EO5 C;  3AZG D;  1P3B D;  3KXB C;  2IO5 B;  2FFF B;  5DNN B;  3LZ1 B;  5B2I A;  5BNX B;  4Z5T C;  4R8P D;  3TU4 B;  1P3F A;  4Z5T D;  3AV2 B;  1BH9 B;  3C1B C;  3AZH B;  5GSU A;  1B6W A;  3WTP A;  3P5J B;  5CPK B;  3X1V C;  4LD9 D;  3EPK A;  3X1V D;  4XZQ B;  5B31 G;  5GT3 A;  5G49 A;  1B67 A;  5CPJ C;  3REL A;  1P34 C;  5CPJ D;  2F8N D;  5BNV B;  4YS3 A;  2Y2O A;  2F8N K;  4AWL B;  4YM6 B;  3EPJ A;  3AZE D;  1PZR A;  4WU8 B;  5BS7 C;  5DNN A;  3LZ1 A;  3REJ C;  4Z66 C;  3REJ D;  2HIO D;  5CPI B;  5BNX A;  3TU4 A;  4JJN A;  4ZUX D;  3AV2 A;  1P3M B;  4J8V B;  1KX3 C;  1BH9 A;  3AZH A;  2NQB B;  1KX3 D;  3AZL C; 
#chains in the Genus database with same CATH homology
 3B0C W;  3AZL D;  1HQ3 B;  3AZI A;  1WWI A;  4XZQ A;  1KX4 D;  2ARO C;  4NE6 A;  5GT0 D;  5AV8 B;  3AZN B;  5B31 C;  5B33 D;  5AVC B;  5BNV A;  3MGR B;  3AN2 C;  5B2I D;  3AZK C;  2VQR A;  4Z2M H;  4YM6 A;  3AZK D;  4DRA A;  3MGP C;  5BT1 D;  3AZM B;  1P3L C;  1P3L D;  5CPI A;  1ZLA B;  1TAF B;  4J8V A;  4G91 C;  2NQB A;  4KGC C;  4KGC D;  5B40 C;  5B40 D;  4WZS B;  3MVD C;  5AV6 D;  1HQ3 A;  4WJ3 C;  4J8U C;  1AOI C;  1P3G C;  5B1M B;  3FDD A;  1AOI D;  3MGQ C;  1P3G D;  5AV8 A;  3AV1 C;  2PYO B;  3AZN A;  3AV1 D;  2YFW B;  1EQZ B;  3MGR A;  4HGA B;  5AY8 C;  4ZBJ C;  3X1S B;  3B0B A;  3W99 C;  4J8W B;  3VH6 T;  5B0Z C;  2ZY3 A;  3AZH D;  1S32 B;  5CPK D;  3LZ0 C;  1P3O B;  1TAF A;  2L5A A;  4UPK A;  5KDM B;  2Y2G A;  5E5A B;  4X23 C;  2ZY5 A;  4G92 B;  3WAA D;  4H9N B;  2Y2P A;  1R4V A;  4QLC B;  1ID3 B;  2HUE B;  5B1M A;  3WKJ C;  4YM6 D;  2NZD C;  2PYO A;  2YFW A;  1EQZ A;  4WU8 D;  3X1S A;  3B6G B;  3AL0 C;  4J8W A;  5JRG A;  1P3M D;  2BYK B;  1S32 A;  2RIQ A;  5CP6 C;  3C1B B;  5CP6 D;  1P3A C;  1P3O A;  1U35 B;  1P3A D;  5KDM A;  3REH B;  3X1U B;  5E5A A;  3LEL A;  1Q9C A;  5AV8 D;  4H9N A;  2J8P A;  4QLC A;  5AVC D;  1ID3 A;  1F66 C;  1F66 D;  5GXQ C;  3W96 B;  3REK C;  3W98 B;  3WA9 C;  3AZM D;  3REK D;  2CV5 D;  3B6G A;  2Y2M A;  2ZY2 A;  1ZLA D;  3IP4 C;  2BYK A;  2F8N G;  3C1B A;  5AV9 B;  3KUY B;  3A6N C;  3X1U A;  3V9R A;  4J8X B;  3AFA C;  2W8S A;  3AZG C;  3AFA D;  1P34 A;  4CSR A;  4DRB A;  2UWX A;  4R8P C;  3W96 A;  3W97 D;  3W98 A;  2FJ7 B;  4JJN B;  1KU5 A;  3C1C C;  4M6B A;  3C1C D;  1P3I B;  4LD9 C;  1A7W A;  4Z66 A;  1M19 B;  2DQN C;  4XUJ C;  3AZI B;  3LJA C;  4XUJ D;  4G91 B;  5AV9 A;  3UTB B;  3LJA D;  3KUY A;  3AZJ C;  1M18 C;  3AZJ D;  1TZY C;  1M18 D;  1TZY D;  3A1K A;  2ARO A;  3EPH A;  4J8X A;  2JCH A;  1M1A C;  3O62 B;  1M1A D;  5C3I C;  5B31 A;  3AZE C;  1BH8 B;  3B6G D;  5AVB C;  2YFV B;  2HIO C;  3AN2 A;  5AVB D;  4ZUX C;  2FJ7 A;  1P3P B;  3MGS B;  3UT9 B;  5B0Z B;  4H9S C;  5F99 C;  1P3I A;  5CHL B;  1U35 D;  5F99 D;  1M19 A;  3LZ0 B;  3REH D;  3KWQ C;  1KX4 C;  3EG5 B;  3KWQ D;  3UTB A;  5GT0 C;  5B24 B;  1HTA A;  4X23 B;  3UTA D;  3MVD A;  5B33 C;  3MNN B;  3REI B;  4WU9 B;  4NE5 A;  5B2I C;  2JSS A;  1P3F C;  5B0Y B;  3O62 A;  1P3F D;  5GSU C;  1BH8 A;  5BT1 C;  5GSU D;  3WTP C;  5JA4 B;  2YFV A;  3WTP D;  1Z2C B;  2Y2K A;  1P3P A;  3MGS A;  3UT9 A;  3B0D C;  5GT3 C;  5B0Z A;  3EPL A;  5GT3 D;  3KUY D;  3REL C;  3LZ0 A;  5AV6 C;  3REL D;  5DNM B;  4YS3 D;  5B24 A;  4X23 A;  2IO5 C;  5AV5 B;  3MNN A;  3REI A;  4WU9 A;  5DNN C;  3LZ1 C;  5DNN D;  3LZ1 D;  3B6F B;  2JE5 A;  3TU4 C;  4KUD B;  5B0Y A;  3AV2 C;  3TU4 D;  4JJN D;  4WNN B;  3AZH C;  5JRG B;  3AYW B;  3NQU B;  3AV2 D;  1P3K B;  5CPK C;  5JA4 A;  1KX5 B;  2ZM5 A;  1M19 D;  2BG1 A;  4XZQ C;  3AZI D;  3AZF B;  4XZQ D;  3WTP E;  3LEL B;  5B2J B;  3WAA C;  4NE3 A;  5DNM A;  5B32 B;  4NFT A;  3KFU G;  4YM6 C;  3O62 D;  3X1T B;  5AV5 A;  4WU8 C;  5B1L B;  1P3B B;  3B6F A;  3F6T A;  4EO5 B;  3KXB B;  5GXQ A;  5CPI D;  2Y2L A;  1P3M C;  4J8V C;  3MGS D;  4WNN A;  3AYW A;  4KUD A;  1H3O B;  3NQU A;  4J8V D;  2NQB C;  1P3K A;  2NQB D;  4Z5T B;  1KX5 A;  2ZY4 A;  1HQ3 C;  4DQY B;  1HQ3 D;  3AZF A;  3X1V B;  2Y2I A;  1WWS A;  5B2J A;  5AV8 C;  2BYM B;  3AZN C;  3V9R B;  3AZN D;  5AVC C;  5B32 A;  3A6N A;  3MGR C;  5CPJ B;  2F8N B;  1P34 B;  3MGR D;  3VH5 T;  4CSR B;  3X1T A;  3B0C T;  3AZM C;  5B1L A;  2CV5 C;  1P3B A;  2F2A C;  3KXB A;  1ZLA C;  3REJ B;  1H3O A;  4Z66 B;  4R8P A;  4Z5T A;  1KX3 B;  4H9Q B;  3AZL B;  5DNM D;  3X1V A;  5B1M C;  4H9O B;  5B1M D;  3R45 B;  2BYM A;  2PYO C;  2ARO B;  2PYO D;  1EQZ C;  1EQZ D;  4HGA C;  5CPJ A;  2F8N A;  4H9R B;  3X1S C;  5B31 B;  3X1S D;  4J8W C;  4J8W D;  5JRG D;  3AN2 B;  3W97 C;  3AZK B;  1S32 D;  1BFM A;  4Z2M G;  3AZE A;  3MGP B;  1P3O C;  1P3O D;  3REJ A;  5BS7 A;  1P3L B;  2HIO A;  2Y2J A;  4ZUX A;  5E5A C;  5E5A D;  3LEL D;  4G92 C;  1KX3 A;  4H9P B;  4KGC B;  4H9Q A;  3VH6 W;  4QLC C;  3AZL A;  5B32 D;  1ID3 C;  2HUE C;  4QLC D;  5B40 B;  3VH6 A;  1ID3 D;  4H9O A;  3MVD B;  3R45 A;  5GT0 A;  3X1T D;  4J8U B;  1AOI B;  1P3G B;  3MGQ B;  4H9R A;  5B33 A;  3AV1 B;  3B6G C;  3KXB D;  3H0R C;  5BO0 B;  4ZBJ B;  5AY8 B;  3AZK A;  3W99 B;  3H0L C;  3MGP A;  3C1B D;  1U35 C;  1P3L A;  3REH C;  3X1U C;  3X1U D;  4H9P A;  4KGC A;  3WAA B;  5B40 A;  3UTA C;  5AV6 A;  1P34 D;  4J8U A;  1AOI A;  3W96 C;  1P3G A;  3W98 C;  3MGQ A;  3W96 D;  3W98 D;  3WKJ B;  3AV1 A;  2NZD B;  1ULY A;  4Z66 D;  2F8N H;  5AY8 A;  2LY8 A;  5BO0 A;  3W99 A;  5AV9 C;  3VH5 W;  5AV9 D;  3KUY C;  5CPK A;  3VH5 A;  2DF4 C;  5CP6 B;  1T3U A;  1P3A B;  4YS3 C;  2ARO D;  4J8X C;  4J8X D;  3WAA A;  2G5I C;  5B31 D;  3AN2 D;  1F66 B;  2FJ7 C;  4JJN C;  5GXQ B;  3WKJ A;  2FJ7 D;  2NZD A;  3MGP D;  4WU8 A;  1P3I C;  3REK B;  1M19 C;  2CV5 B;  1P3I D;  1JFI B;  3WA9 B;  4WV4 B;  3AZI C;  1N1J B;  1P3M A;  3UTB C;  3UTB D;  5CP6 A;  2Y2Q A;  1P3A A;  3MVD D;  3A6N B;  4J8U D;  4AWL C;  4E45 A;  3MGQ D;  3O62 C;  4E44 A;  3NQJ B;  5AVC A;  3AFA B;  3AZG B;  2RVQ C;  1F66 A;  5CPI C;  2RVQ D;  5AY8 D;  1P3P C;  3MGS C;  3UT9 C;  3W99 D;  4KHA B;  1P3P D;  3UT9 D;  4R8P B;  5B0Z D;  3W97 B;  3AZM A;  3REK A;  3WA9 A;  2CV5 A;  1JFI A;  3C1C B;  3LZ0 D;  1ZLA A;  2Y2H A;  5FUG B;  1N1J A;  4LD9 B;  5B24 C;  4UUZ B;  5B24 D;  4XUJ B;  4X23 D;  3LJA B;  3MNN C;  3REI C;  4WU9 C;  4WU9 D;  3MNN D;  3REI D;  3AZJ B;  1M18 B;  1TZY B;  5B0Y C;  3H0M C;  3WKJ D;  5B0Y D;  3NQJ A;  2NZD D;  3KSY A;  3AFA A;  1M1A B;  3AZG A;  5C3I B;  3AZE B;  1W2E A;  2G5H C;  4KHA A;  5B32 G;  5AVB B;  2HIO B;  3W97 A;  4ZUX B;  3C1C A;  5FUG A;  5DNM C;  5F99 B;  4LD9 A;  4UUZ A;  3KWQ B;  4XUJ A;  1KX4 B;  3LJA A;  5GT0 B;  5AV5 C;  5AV5 D;  3AZJ A;  3UTA B;  1M18 A;  2XD5 A;  1TZY A;  4CAY B;  3B6F C;  5B33 B;  3B6F D;  4KUD C;  3AYW C;  5GXQ D;  4KUD D;  5JRG C;  3AYW D;  1P3K C;  5B2I B;  1KX5 C;  1S32 C;  1P3K D;  1P3F B;  1M1A A;  1KX5 D;  3WA9 D;  5GSU B;  3WTP B;  3AZF C;  5AVB A;  3AZF D;  3LEL C;  5B2J C;  5B2J D;  3B0D B;  5GT3 B;  4H9S A;  5G49 B;  1U35 A;  5F99 A;  5B32 C;  3REL B;  3A6N D;  3REH A;  5AV6 B;  2XD1 A;  3KWQ A;  1F1E A;  1KX4 A;  3X1T C;  4YS3 B;  2CWE A;  5B1L C;  3A1I A;  3UTA A;  1P3B C;  4CAY A;  2Y2N A;  5B1L D;  4EO5 C;  3AZG D;  1P3B D;  3KXB C;  2IO5 B;  2FFF B;  5DNN B;  3LZ1 B;  5B2I A;  5BNX B;  4Z5T C;  4R8P D;  3TU4 B;  1P3F A;  4Z5T D;  3AV2 B;  1BH9 B;  3C1B C;  3AZH B;  5GSU A;  1B6W A;  3WTP A;  3P5J B;  5CPK B;  3X1V C;  4LD9 D;  3EPK A;  3X1V D;  4XZQ B;  5B31 G;  5GT3 A;  5G49 A;  1B67 A;  5CPJ C;  3REL A;  1P34 C;  5CPJ D;  2F8N D;  5BNV B;  4YS3 A;  2Y2O A;  2F8N K;  4AWL B;  4YM6 B;  3EPJ A;  3AZE D;  1PZR A;  4WU8 B;  5BS7 C;  5DNN A;  3LZ1 A;  3REJ C;  4Z66 C;  3REJ D;  2HIO D;  5CPI B;  5BNX A;  3TU4 A;  4JJN A;  4ZUX D;  3AV2 A;  1P3M B;  4J8V B;  1KX3 C;  1BH9 A;  3AZH A;  2NQB B;  1KX3 D;  3AZL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...