5C3IC

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 26
structure length 78
sequence length 78
chains with identical sequence G, K, O, S, W
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5c3iC00
5B31B 1H3OA 3W96A 3AZMC 3WAAA 1HQ3D 3X1VB 4EO5B 3AV1B 1KX4C 4YS3D 3RELC 5AV8D 1EQZA 5BT1C 3X1SD 4JJNA 5B0ZC 5G49A 3NQUB 1P3MC 4HGAB 5DNMB 3AZJD 4LD9D 1P3LB 4J8XC 1ZLAD 3B0DC 4YS3A 5B32B 4J8VB 1P3GC 3MGPB 5BS7C 4CSRA 3WTPE 3LELC 3V9RA 3C1CB 1M1AB 1A7WA 3AZMB 3AZHD 3KWQC 3MGQA 1KX4B 3RELB 3B6GD 2YFWB 3AZIA 5GSUA 5B0ZB 2FJ7C 4KHAB 5AVCA 3LZ0C 3O62A 1P3MB 5GT0C 5AV9C 4QLCC 1P3OD 3NQJA 4J8XB 3A6NC 1N1JA 4UUZA 3B0DB 5GT3D 1P3GB 3KXBD 3LELB 1TZYC 3AYWD 5AV5A 3LZ1A 5FUGA 3AN2D 3X1UA 3KWQB 5AY8A 2AROD 2NZDA 3WTPA 5B0YC 3C1BA 2FJ7B 3LZ0B 5GT0B 3AZGC 5AV9B 3RELD 4QLCB 3A6NB 3MNND 5JA4A 3W97D 3VH5A 1P3BA 1P3AA 5F99A 1TZYB 5CPJD 4ZUXA 3KUYA 1F1EA 2HUEC 2HIOD 2PYOD 5DNND 3X1TA 4DRAA 5JRGA 4H9NB 5B0YB 4WU9A 5B24C 4NFTA 4WZSB 3AZGB 1U35C 3WA9D 1BH8B 5CPKA 2BYMB 5B1LA 3MGSC 2CV5D 4Z66D 3AFAC 2NQBA 1M18A 2HUEB 3W98A 1S32A 5AVBD 1P3KA 5CP6D 5B1MC 5B40B 1WWSA 5B24B 3UTAA 5B2IC 3REKD 1U35B 4Z5TC 1ULYA 1KX3D 3W99C 4KGCA 3MGSB 1P3FC 3AZGD 3REHD 3AFAB 3KSYA 3B6FC 3VH6A 5BO0B 4CAYB 3REIC 1ID3C 1F66D 4KUDC 3AV2A 5B2JC 5BNVA 5B1MB 3AZLD 2BYKB 5AV6D 3AZKC 5BNXA 1P3IA 5B2IB 1AOID 4Z5TB 3W96C 3WAAC 3W99B 4YM6D 1JFIA 1M19D 1P3FB 1EQZC 3MGRD 4JJNC 4R8PA 3B6FB 5B33D 3REIB 5GXQD 1ID3B 3TU4A 4KUDB 1TAFA 4H9OA 5B2JB 4WU8D 3MVDA 4WV4B 3REJD 4J8UD 3AZKB 3AZED 1H3OB 3W96B 3WAAB 3WKJA 1P34A 5E5AD 3MGQC 3AZFD 3AZIC 1EQZB 4X23D 4JJNB 5G49B 5AVCC 3O62C 3MGPC 4Z2MG 3VH5T 2F8NA 5E5AA 1P3PD 3AZNC 4CSRB 1KX5A 3V9RB 5CPIA 5AV5C 4KUDD 3LZ1C 4XZQA 4H9SC 3LJAD 3X1UC 3MGQB 1HQ3A 5AY8C 3UTBD 3AZIB 2NZDC 3WTPC 4J8WD 3C1BC 5AVCB 5AV8A 3O62B 3X1SA 3NQJB 3AZJA 4LD9A 1N1JB 4UUZB 1P3BC 1ZLAA 1P3AC 5F99C 3AZNB 4ZUXC 3UT9D 5B31D 5AV5B 3LZ1B 5FUGB 3X1VD 3X1UB 3X1TC 2IO5C 5JRGC 3AV1D 5AY8B 4G92C 2NZDB 3WTPB 3AZHA 3C1BB 3B6GA 4WU9C 5DNMD 1P3LD 4G91C 2LY8A 5JA4B 5B32D 5CPKC 1P3OA 5B1LC 4J8VD 1P3BB 1P3AB 5F99B 3MGPD 3C1CD 1M1AD 2NQBC 4ZUXB 3VH6T 5GT3A 1M18C 3KXBA 3KUYB 3AZMD 3W98C 3AYWA 3X1TB 2IO5B 5JRGB 1KX4D 1S32C 3AN2A 4G92B 1P3KC 4J8VA 2F8NG 5BT1D 5B0ZD 4XUJC 4WU9B 2AROA 3UTAC 1P3MD 4WNNA 4G91B 4J8XD 4KGCC 3RELA 5CPKB 5B1LB 1P3GD 3MNNA 3LELD 3W97A 2NQBB 1KU5A 1M18B 5B40C 5CPJA 3W98B 3KWQD 1S32B 2HIOA 3AV2C 5DNNA 1P3KB 1P3GA 2PYOA 2FJ7D 4XUJB 3UTAB 3LZ0D 1P3IC 5GT0D 4H9QA 5AV9D 4QLCD 3A6ND 3WA9A 4KGCB 1BH9A 1TZYD 2CV5A 4Z66A 3AV2B 3MVDC 5BNVB 5B0YD 5AVBA 4NE5A 1P3IB 5BNXB 5CP6A 2JSSA 1JFIB 3REKA 1B67A 1P34C 1KX3A 1BFMA 3AZGA 3REHA 1TAFB 4H9OB 3VH5W 3MVDB 1F66A 5B40D 5B24D 1KX5C 5CPIC 3AZLA 4NE3A 5AV6A 1U35D 1AOIA 4XZQC 3WKJB 1P34B 3MGSD 1HQ3C 4YM6A 1M19A 3AFAD 4YS3C 5AV8C 3MGRA 3X1SC 3R45A 4Z2MH 4LD9C 5B33A 2F8NB 5GXQA 1ZLAC 5B1MD 4WU8A 1KX5B 5B2ID 5CPIB 1R4VA 5GSUC 3REJA 4Z5TD 4J8UA 3W99D 4XZQB 3AZEA 1P3FD 1HQ3B 3AZFA 4YS3B 3AZKA 5AV8B 4X23A 3X1SB 3B6FD 3B0CT 3REID 1ID3D 4LD9B 5B2JD 1P3OC 1ZLAB 2F8NK 4H9RA 3AZKD 5GT3C 1P3PA 5GSUB 4NE6A 3KXBC 3VH6W 3W96D 3WAAD 3AYWC 4KUDA 5KDMA 1EQZD 3LJAA 4JJND 3AZHB 3UTBA 2AROC 4J8WA 3KUYC 4ZBJC 1P3OB 2CWEA 3MNNC 5C3IC 4H9PA 3W97C 2YFVA 5GT3B 3KXBB 5CPJC 3UT9A 3AYWB 5B31A 4M6BA 3MGQD 2F8NH 2HIOC 3AN2B 5DNNC 3AZID 3X1VA 2PYOC 5GSUD 3AV1A 2AROB 5CHLB 5AVCD 3O62D 4WNNB 3NQUA 5DNMA 1P3LA 3WA9C 4ZBJB 3MNNB 5C3IB 3AZND 5B32A 3W97B 5AV5D 3LZ1D 3MGPA 2CV5C 3C1CA 4Z66C 1M1AA 5CPJB 3X1UD 3AZMA 1WWIA 5AY8D 2HIOB 2PYOB 5DNNB 2NZDD 3WTPD 3C1BD 1KX4A 3AZNA 5AVBC 2YFWA 2RVQC 5CP6C 5B0ZA 4H9QB 4KHAA 1P3MA 4H9SA 3REKC 3WA9B 1KX3C 1P3BD 4J8XA 1BH9B 1P3AD 5F99D 4ZUXD 3KUYD 5BS7A 3LELA 3REHC 4Z66B 2CV5B 3X1TD 5JRGD 1F66C 3KWQA 4WU9D 5AVBB 5CP6B 2FJ7A 3AZLC 5AV6C 3LZ0A 1AOIC 5GT0A 4R8PC 5B31G 5AV9A 3REKB 1KX3B 4QLCA 5CPKD 5B1LD 3A6NA 4YM6C 3TU4C 1M19C 2NQBD 1M18D 3MGRC 1TZYA 3REHB 3W98D 4E44A 5B33C 2L5AA 1S32D 1P3KD 3WKJC 5GXQC 1F66B 4XUJD 4H9NA 4WU8C 3UTAD 5B32G 5B0YA 3AZLB 5AV6B 3REJC 4J8UC 1AOIB 3AZEC 4R8PB 4KGCD 2RVQD 4YM6B 4XUJA 3TU4B 1BH8A 5E5AC 1M19B 2BYMA 3AZFC 1HTAA 3B0BA 4X23C 3MGRB 3R45B 3B0CW 5B33B 3AV2D 5GXQB 4WU8B 1P3ID 4DRBA 5B40A 1Q9CA 5B24A 3REJB 1P3PC 4J8UB 3AZEB 1U35A 3AZJC 3LJAC 5E5AB 3MGSA 3AZFB 3UTBC 4X23B 4R8PD 3AFAA 4J8WC 3TU4D 4AWLC 3MVDD 5BO0A 4CAYA 4H9RB 5B1MA 2BYKA 3AZHC 1P3PB 3B6GC 5B2IA 3UT9C 5B31C 3WKJD 1P34D 4Z5TA 5KDMB 3W99A 3X1VC 3AZJB 3LJAB 4EO5C 3AV1C 1P3FA 3UTBB 4J8WB 4HGAC 5DNMC 3B6FA 2F8ND 4AWLB 1P3LC 4E45A 3REIA 1ID3A 5B2JA 1KX5D 5B32C 4H9PB 3AN2C 5CPID 4J8VC 2YFVB 3B6GB 3C1CC 1M1AC 1B6WA 4XZQD 3UT9B
chains in the Genus database with same CATH superfamily
5B31B 1H3OA 3W96A 3AZMC 3WAAA 1HQ3D 3X1VB 2Y2NA 4EO5B 3AV1B 1KX4C 4YS3D 3RELC 5AV8D 1EQZA 5BT1C 3X1SD 4JJNA 5B0ZC 5G49A 2G5IC 3NQUB 1P3MC 4HGAB 5DNMB 3AZJD 4LD9D 1P3LB 2ZY3A 4J8XC 1ZLAD 3B0DC 4YS3A 5B32B 4J8VB 1P3GC 3MGPB 5BS7C 4CSRA 3WTPE 3LELC 3V9RA 3C1CB 1M1AB 2DQNC 1A7WA 3AZMB 3EG5B 2XD1A 3AZHD 3KWQC 3MGQA 1KX4B 3RELB 3B6GD 2YFWB 3AZIA 5GSUA 5B0ZB 2FJ7C 4KHAB 5AVCA 3LZ0C 3O62A 1P3MB 3FDDA 3H0MC 5GT0C 5AV9C 4QLCC 1P3OD 3NQJA 4J8XB 3A6NC 1N1JA 4UUZA 3B0DB 5GT3D 1P3GB 3KXBD 3LELB 1TZYC 3AYWD 5AV5A 3LZ1A 2ZM5A 5FUGA 3AN2D 3X1UA 3KWQB 1Z2CB 5AY8A 2AROD 2NZDA 3WTPA 5B0YC 3C1BA 2FJ7B 3LZ0B 5GT0B 3AZGC 2UWXA 5AV9B 3RELD 2BG1A 4QLCB 3H0LC 3A6NB 3MNND 5JA4A 3W97D 3VH5A 1P3BA 1P3AA 5F99A 1TZYB 5CPJD 4ZUXA 3KUYA 1F1EA 2HUEC 2HIOD 2PYOD 5DNND 3X1TA 4DRAA 5JRGA 4H9NB 5B0YB 2F2AC 1W2EA 4WU9A 5B24C 4NFTA 4WZSB 3AZGB 1U35C 3WA9D 4DQYB 1BH8B 5CPKA 2BYMB 5B1LA 3MGSC 2CV5D 4Z66D 2ZY5A 3AFAC 2NQBA 1M18A 2HUEB 3W98A 2Y2OA 1S32A 5AVBD 1P3KA 5CP6D 5B1MC 5B40B 1WWSA 5B24B 3UTAA 5B2IC 3REKD 1U35B 4Z5TC 1ULYA 1KX3D 3W99C 4KGCA 3MGSB 1P3FC 3AZGD 3REHD 1T3UA 3AFAB 3KSYA 3B6FC 3VH6A 5BO0B 4CAYB 3REIC 1ID3C 1F66D 4KUDC 3AV2A 5B2JC 5BNVA 5B1MB 3AZLD 2BYKB 5AV6D 3AZKC 5BNXA 1P3IA 5B2IB 1AOID 4Z5TB 3W96C 3WAAC 3W99B 3A1KA 3F6TA 4YM6D 1JFIA 1M19D 1P3FB 1EQZC 3MGRD 4JJNC 4R8PA 3B6FB 5B33D 3REIB 5GXQD 1ID3B 3TU4A 4KUDB 1TAFA 4H9OA 5B2JB 4WU8D 3MVDA 4WV4B 3REJD 4J8UD 3AZKB 3AZED 1H3OB 3W96B 3WAAB 3WKJA 1P34A 5E5AD 3MGQC 3AZFD 3AZIC 1EQZB 4X23D 4JJNB 5G49B 5AVCC 3O62C 3MGPC 4Z2MG 3VH5T 2F8NA 5E5AA 1P3PD 3AZNC 4CSRB 1KX5A 3V9RB 5CPIA 5AV5C 4KUDD 3LZ1C 4XZQA 4H9SC 3LJAD 3X1UC 3MGQB 1HQ3A 5AY8C 3UTBD 3AZIB 2NZDC 3WTPC 4J8WD 3C1BC 5AVCB 5AV8A 3O62B 3X1SA 3NQJB 3AZJA 4LD9A 1N1JB 4UUZB 2Y2IA 3EPLA 1P3BC 1ZLAA 2Y2LA 1P3AC 5F99C 2DF4C 3AZNB 4ZUXC 3UT9D 5B31D 5AV5B 3LZ1B 5FUGB 3X1VD 2W8SA 3X1UB 3X1TC 2IO5C 5JRGC 3AV1D 5AY8B 4G92C 2NZDB 3WTPB 3AZHA 3C1BB 3B6GA 4WU9C 5DNMD 1P3LD 4G91C 2LY8A 2Y2QA 5JA4B 5B32D 5CPKC 1P3OA 5B1LC 4J8VD 1P3BB 1P3AB 5F99B 3MGPD 3C1CD 1M1AD 2NQBC 4ZUXB 3VH6T 5GT3A 1M18C 3KXBA 3KUYB 3AZMD 3W98C 3AYWA 3X1TB 2IO5B 5JRGB 1KX4D 1S32C 3AN2A 4G92B 1P3KC 4J8VA 2F8NG 5BT1D 5B0ZD 4XUJC 4WU9B 2AROA 3UTAC 1P3MD 4WNNA 4G91B 4J8XD 4KGCC 3RELA 5CPKB 5B1LB 1P3GD 3MNNA 3LELD 3W97A 2NQBB 1KU5A 1M18B 5B40C 5CPJA 4WJ3C 3W98B 3KWQD 2JCHA 1S32B 2HIOA 3AV2C 5DNNA 1P3KB 1P3GA 2PYOA 2FJ7D 4XUJB 3UTAB 3LZ0D 1P3IC 5GT0D 4H9QA 5AV9D 4QLCD 3A6ND 3WA9A 4KGCB 3H0RC 1BH9A 1TZYD 2CV5A 3EPJA 4Z66A 3A1IA 3AV2B 3MVDC 5BNVB 5B0YD 5AVBA 4NE5A 1P3IB 5BNXB 5CP6A 2FFFB 2JSSA 1JFIB 3REKA 1B67A 1P34C 1KX3A 1BFMA 3AZGA 3REHA 1TAFB 4H9OB 3VH5W 3MVDB 1F66A 5B40D 2Y2GA 5B24D 3P5JB 1KX5C 5CPIC 3AZLA 4NE3A 5AV6A 1U35D 1AOIA 4XZQC 3WKJB 1P34B 3MGSD 1HQ3C 4YM6A 1M19A 3AFAD 4YS3C 5AV8C 3MGRA 3X1SC 3R45A 2Y2JA 4Z2MH 2Y2PA 5B33A 2F8NB 4LD9C 5GXQA 1ZLAC 5B1MD 4WU8A 1KX5B 5B2ID 5CPIB 1R4VA 5GSUC 3REJA 4Z5TD 4J8UA 3W99D 4XZQB 3AZEA 1P3FD 1HQ3B 3AZFA 4YS3B 3AZKA 5AV8B 4X23A 3X1SB 3B6FD 3B0CT 3REID 1ID3D 4LD9B 5B2JD 1P3OC 1ZLAB 2F8NK 4H9RA 3AZKD 5GT3C 1P3PA 5GSUB 4NE6A 3KXBC 3VH6W 3W96D 3WAAD 3AYWC 4KUDA 5KDMA 1EQZD 3LJAA 4JJND 3AZHB 3UTBA 2AROC 4J8WA 3KUYC 4ZBJC 1P3OB 2CWEA 2VQRA 4UPKA 3MNNC 5C3IC 4H9PA 3W97C 2Y2MA 2YFVA 5GT3B 2G5HC 3KXBB 5CPJC 3UT9A 3AYWB 5B31A 4M6BA 3MGQD 2F8NH 2HIOC 3AN2B 5DNNC 3AZID 3X1VA 2PYOC 5GSUD 3AV1A 2AROB 5CHLB 5AVCD 3O62D 4WNNB 3NQUA 5DNMA 1P3LA 3WA9C 4ZBJB 3MNNB 5C3IB 3AZND 5B32A 3W97B 5AV5D 3LZ1D 3MGPA 2CV5C 3C1CA 4Z66C 1M1AA 5CPJB 3X1UD 3AZMA 1WWIA 5AY8D 2HIOB 2PYOB 5DNNB 2NZDD 3WTPD 3C1BD 1KX4A 3AZNA 5AVBC 2YFWA 2RVQC 5CP6C 5B0ZA 4H9QB 4KHAA 1P3MA 4H9SA 3REKC 3WA9B 1KX3C 1P3BD 4J8XA 1BH9B 1P3AD 5F99D 4ZUXD 3KUYD 5BS7A 3LELA 3REHC 4Z66B 2CV5B 3AL0C 3X1TD 5JRGD 1F66C 3KWQA 3EPKA 4WU9D 5AVBB 2JE5A 5CP6B 2FJ7A 3AZLC 5AV6C 3LZ0A 1AOIC 5GT0A 4R8PC 5B31G 5AV9A 3REKB 1KX3B 4QLCA 5CPKD 5B1LD 3A6NA 4YM6C 3TU4C 1M19C 2NQBD 1M18D 3MGRC 1TZYA 3REHB 3W98D 4E44A 5B33C 2L5AA 2J8PA 1S32D 1P3KD 2ZY4A 5GXQC 1F66B 4XUJD 4H9NA 3WKJC 4WU8C 3IP4C 3UTAD 5B32G 5B0YA 3AZLB 5AV6B 3REJC 4J8UC 1AOIB 3AZEC 2Y2KA 4R8PB 4KGCD 2RVQD 4YM6B 4XUJA 3TU4B 1BH8A 5E5AC 1M19B 2BYMA 3AZFC 1HTAA 3B0BA 4X23C 3MGRB 3R45B 3EPHA 3B0CW 1PZRA 5B33B 3AV2D 5GXQB 4WU8B 1P3ID 4DRBA 5B40A 1Q9CA 5B24A 3REJB 1P3PC 4J8UB 3AZEB 1U35A 3AZJC 3LJAC 5E5AB 3MGSA 3AZFB 3UTBC 4X23B 4R8PD 3AFAA 4J8WC 3TU4D 4AWLC 3MVDD 5BO0A 4CAYA 4H9RB 2ZY2A 5B1MA 2BYKA 3AZHC 2XD5A 1P3PB 3B6GC 5B2IA 2Y2HA 3UT9C 5B31C 3WKJD 1P34D 4Z5TA 5KDMB 3W99A 3X1VC 3AZJB 3LJAB 4EO5C 3AV1C 1P3FA 3UTBB 4J8WB 4HGAC 5DNMC 3B6FA 2F8ND 4AWLB 1P3LC 4E45A 3REIA 1ID3A 5B2JA 1KX5D 5B32C 2RIQA 4H9PB 3AN2C 4J8VC 5CPID 2YFVB 3KFUG 3B6GB 3C1CC 1M1AC 1B6WA 4XZQD 3UT9B
chains in the Genus database with same CATH topology
5B31B 1H3OA 3W96A 3AZMC 3WAAA 1HQ3D 3X1VB 2Y2NA 4EO5B 3AV1B 1KX4C 4YS3D 3RELC 5AV8D 1EQZA 5BT1C 3X1SD 4JJNA 5B0ZC 5G49A 2G5IC 3NQUB 1P3MC 4HGAB 5DNMB 3AZJD 4LD9D 1P3LB 2ZY3A 4J8XC 1ZLAD 3B0DC 4YS3A 5B32B 4J8VB 1P3GC 3MGPB 5BS7C 4CSRA 3WTPE 3LELC 3V9RA 3C1CB 1M1AB 2DQNC 1A7WA 3AZMB 3EG5B 2XD1A 3AZHD 3KWQC 3MGQA 1KX4B 3RELB 3B6GD 2YFWB 3AZIA 5GSUA 5B0ZB 2FJ7C 4KHAB 5AVCA 3LZ0C 3O62A 1P3MB 3FDDA 3H0MC 5GT0C 5AV9C 4QLCC 1P3OD 3NQJA 4J8XB 3A6NC 1N1JA 4UUZA 3B0DB 5GT3D 1P3GB 3KXBD 3LELB 1TZYC 3AYWD 5AV5A 3LZ1A 2ZM5A 5FUGA 3AN2D 3X1UA 3KWQB 1Z2CB 5AY8A 2AROD 2NZDA 3WTPA 5B0YC 3C1BA 2FJ7B 3LZ0B 5GT0B 3AZGC 2UWXA 5AV9B 3RELD 2BG1A 4QLCB 3H0LC 3A6NB 3MNND 5JA4A 3W97D 3VH5A 1P3BA 1P3AA 5F99A 1TZYB 5CPJD 4ZUXA 3KUYA 1F1EA 2HUEC 2HIOD 2PYOD 5DNND 3X1TA 4DRAA 5JRGA 4H9NB 5B0YB 2F2AC 1W2EA 4WU9A 5B24C 4NFTA 4WZSB 3AZGB 1U35C 3WA9D 4DQYB 1BH8B 5CPKA 2BYMB 5B1LA 3MGSC 2CV5D 4Z66D 2ZY5A 3AFAC 2NQBA 1M18A 2HUEB 3W98A 2Y2OA 1S32A 5AVBD 1P3KA 5CP6D 5B1MC 5B40B 1WWSA 5B24B 3UTAA 5B2IC 3REKD 1U35B 4Z5TC 1ULYA 1KX3D 3W99C 4KGCA 3MGSB 1P3FC 3AZGD 3REHD 1T3UA 3AFAB 3KSYA 3B6FC 3VH6A 5BO0B 4CAYB 3REIC 1ID3C 1F66D 4KUDC 3AV2A 5B2JC 5BNVA 5B1MB 3AZLD 2BYKB 5AV6D 3AZKC 5BNXA 1P3IA 5B2IB 1AOID 4Z5TB 3W96C 3WAAC 3W99B 3A1KA 3F6TA 4YM6D 1JFIA 1M19D 1P3FB 1EQZC 3MGRD 4JJNC 4R8PA 3B6FB 5B33D 3REIB 5GXQD 1ID3B 3TU4A 4KUDB 1TAFA 4H9OA 5B2JB 4WU8D 3MVDA 4WV4B 3REJD 4J8UD 3AZKB 3AZED 1H3OB 3W96B 3WAAB 3WKJA 1P34A 5E5AD 3MGQC 3AZFD 3AZIC 1EQZB 4X23D 4JJNB 5G49B 5AVCC 3O62C 3MGPC 4Z2MG 3VH5T 2F8NA 5E5AA 1P3PD 3AZNC 4CSRB 1KX5A 3V9RB 5CPIA 5AV5C 4KUDD 3LZ1C 4XZQA 4H9SC 3LJAD 3X1UC 3MGQB 1HQ3A 5AY8C 3UTBD 3AZIB 2NZDC 3WTPC 4J8WD 3C1BC 5AVCB 5AV8A 3O62B 3X1SA 3NQJB 3AZJA 4LD9A 1N1JB 4UUZB 2Y2IA 3EPLA 1P3BC 1ZLAA 2Y2LA 1P3AC 5F99C 2DF4C 3AZNB 4ZUXC 3UT9D 5B31D 5AV5B 3LZ1B 5FUGB 3X1VD 2W8SA 3X1UB 3X1TC 2IO5C 5JRGC 3AV1D 5AY8B 4G92C 2NZDB 3WTPB 3AZHA 3C1BB 3B6GA 4WU9C 5DNMD 1P3LD 4G91C 2LY8A 2Y2QA 5JA4B 5B32D 5CPKC 1P3OA 5B1LC 4J8VD 1P3BB 1P3AB 5F99B 3MGPD 3C1CD 1M1AD 2NQBC 4ZUXB 3VH6T 5GT3A 1M18C 3KXBA 3KUYB 3AZMD 3W98C 3AYWA 3X1TB 2IO5B 5JRGB 1KX4D 1S32C 3AN2A 4G92B 1P3KC 4J8VA 2F8NG 5BT1D 5B0ZD 4XUJC 4WU9B 2AROA 3UTAC 1P3MD 4WNNA 4G91B 4J8XD 4KGCC 3RELA 5CPKB 5B1LB 1P3GD 3MNNA 3LELD 3W97A 2NQBB 1KU5A 1M18B 5B40C 5CPJA 4WJ3C 3W98B 3KWQD 2JCHA 1S32B 2HIOA 3AV2C 5DNNA 1P3KB 1P3GA 2PYOA 2FJ7D 4XUJB 3UTAB 3LZ0D 1P3IC 5GT0D 4H9QA 5AV9D 4QLCD 3A6ND 3WA9A 4KGCB 3H0RC 1BH9A 1TZYD 2CV5A 3EPJA 4Z66A 3A1IA 3AV2B 3MVDC 5BNVB 5B0YD 5AVBA 4NE5A 1P3IB 5BNXB 5CP6A 2FFFB 2JSSA 1JFIB 3REKA 1B67A 1P34C 1KX3A 1BFMA 3AZGA 3REHA 1TAFB 4H9OB 3VH5W 3MVDB 1F66A 5B40D 2Y2GA 5B24D 3P5JB 1KX5C 5CPIC 3AZLA 4NE3A 5AV6A 1U35D 1AOIA 4XZQC 3WKJB 1P34B 3MGSD 1HQ3C 4YM6A 1M19A 3AFAD 4YS3C 5AV8C 3MGRA 3X1SC 3R45A 2Y2JA 4Z2MH 2Y2PA 5B33A 2F8NB 4LD9C 5GXQA 1ZLAC 5B1MD 4WU8A 1KX5B 5B2ID 5CPIB 1R4VA 5GSUC 3REJA 4Z5TD 4J8UA 3W99D 4XZQB 3AZEA 1P3FD 1HQ3B 3AZFA 4YS3B 3AZKA 5AV8B 4X23A 3X1SB 3B6FD 3B0CT 3REID 1ID3D 4LD9B 5B2JD 1P3OC 1ZLAB 2F8NK 4H9RA 3AZKD 5GT3C 1P3PA 5GSUB 4NE6A 3KXBC 3VH6W 3W96D 3WAAD 3AYWC 4KUDA 5KDMA 1EQZD 3LJAA 4JJND 3AZHB 3UTBA 2AROC 4J8WA 3KUYC 4ZBJC 1P3OB 2CWEA 2VQRA 4UPKA 3MNNC 5C3IC 4H9PA 3W97C 2Y2MA 2YFVA 5GT3B 2G5HC 3KXBB 5CPJC 3UT9A 3AYWB 5B31A 4M6BA 3MGQD 2F8NH 2HIOC 3AN2B 5DNNC 3AZID 3X1VA 2PYOC 5GSUD 3AV1A 2AROB 5CHLB 5AVCD 3O62D 4WNNB 3NQUA 5DNMA 1P3LA 3WA9C 4ZBJB 3MNNB 5C3IB 3AZND 5B32A 3W97B 5AV5D 3LZ1D 3MGPA 2CV5C 3C1CA 4Z66C 1M1AA 5CPJB 3X1UD 3AZMA 1WWIA 5AY8D 2HIOB 2PYOB 5DNNB 2NZDD 3WTPD 3C1BD 1KX4A 3AZNA 5AVBC 2YFWA 2RVQC 5CP6C 5B0ZA 4H9QB 4KHAA 1P3MA 4H9SA 3REKC 3WA9B 1KX3C 1P3BD 4J8XA 1BH9B 1P3AD 5F99D 4ZUXD 3KUYD 5BS7A 3LELA 3REHC 4Z66B 2CV5B 3AL0C 3X1TD 5JRGD 1F66C 3KWQA 3EPKA 4WU9D 5AVBB 2JE5A 5CP6B 2FJ7A 3AZLC 5AV6C 3LZ0A 1AOIC 5GT0A 4R8PC 5B31G 5AV9A 3REKB 1KX3B 4QLCA 5CPKD 5B1LD 3A6NA 4YM6C 3TU4C 1M19C 2NQBD 1M18D 3MGRC 1TZYA 3REHB 3W98D 4E44A 5B33C 2L5AA 2J8PA 1S32D 1P3KD 2ZY4A 5GXQC 1F66B 4XUJD 4H9NA 3WKJC 4WU8C 3IP4C 3UTAD 5B32G 5B0YA 3AZLB 5AV6B 3REJC 4J8UC 1AOIB 3AZEC 2Y2KA 4R8PB 4KGCD 2RVQD 4YM6B 4XUJA 3TU4B 1BH8A 5E5AC 1M19B 2BYMA 3AZFC 1HTAA 3B0BA 4X23C 3MGRB 3R45B 3EPHA 3B0CW 1PZRA 5B33B 3AV2D 5GXQB 4WU8B 1P3ID 4DRBA 5B40A 1Q9CA 5B24A 3REJB 1P3PC 4J8UB 3AZEB 1U35A 3AZJC 3LJAC 5E5AB 3MGSA 3AZFB 3UTBC 4X23B 4R8PD 3AFAA 4J8WC 3TU4D 4AWLC 3MVDD 5BO0A 4CAYA 4H9RB 2ZY2A 5B1MA 2BYKA 3AZHC 2XD5A 1P3PB 3B6GC 5B2IA 2Y2HA 3UT9C 5B31C 3WKJD 1P34D 4Z5TA 5KDMB 3W99A 3X1VC 3AZJB 3LJAB 4EO5C 3AV1C 1P3FA 3UTBB 4J8WB 4HGAC 5DNMC 3B6FA 2F8ND 4AWLB 1P3LC 4E45A 3REIA 1ID3A 5B2JA 1KX5D 5B32C 2RIQA 4H9PB 3AN2C 4J8VC 5CPID 2YFVB 3KFUG 3B6GB 3C1CC 1M1AC 1B6WA 4XZQD 3UT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 B;  1H3O A;  3W96 A;  3AZM C;  3WAA A;  1HQ3 D;  3X1V B;  4EO5 B;  3AV1 B;  1KX4 C;  4YS3 D;  3REL C;  5AV8 D;  1EQZ A;  5BT1 C;  3X1S D;  4JJN A;  5B0Z C;  5G49 A;  3NQU B;  1P3M C;  4HGA B;  5DNM B;  3AZJ D;  4LD9 D;  1P3L B;  4J8X C;  1ZLA D;  3B0D C;  4YS3 A;  5B32 B;  4J8V B;  1P3G C;  3MGP B;  5BS7 C;  4CSR A;  3WTP E;  3LEL C;  3V9R A;  3C1C B;  1M1A B;  1A7W A;  3AZM B;  3AZH D;  3KWQ C;  3MGQ A;  1KX4 B;  3REL B;  3B6G D;  2YFW B;  3AZI A;  5GSU A;  5B0Z B;  2FJ7 C;  4KHA B;  5AVC A;  3LZ0 C;  3O62 A;  1P3M B;  5GT0 C;  5AV9 C;  4QLC C;  1P3O D;  3NQJ A;  4J8X B;  3A6N C;  1N1J A;  4UUZ A;  3B0D B;  5GT3 D;  1P3G B;  3KXB D;  3LEL B;  1TZY C;  3AYW D;  5AV5 A;  3LZ1 A;  5FUG A;  3AN2 D;  3X1U A;  3KWQ B;  5AY8 A;  2ARO D;  2NZD A;  3WTP A;  5B0Y C;  3C1B A;  2FJ7 B;  3LZ0 B;  5GT0 B;  3AZG C;  5AV9 B;  3REL D;  4QLC B;  3A6N B;  3MNN D;  5JA4 A;  3W97 D;  3VH5 A;  1P3B A;  1P3A A;  5F99 A;  1TZY B;  5CPJ D;  4ZUX A;  3KUY A;  1F1E A;  2HUE C;  2HIO D;  2PYO D;  5DNN D;  3X1T A;  4DRA A;  5JRG A;  4H9N B;  5B0Y B;  4WU9 A;  5B24 C;  4NFT A;  4WZS B;  3AZG B;  1U35 C;  3WA9 D;  1BH8 B;  5CPK A;  2BYM B;  5B1L A;  3MGS C;  2CV5 D;  4Z66 D;  3AFA C;  2NQB A;  1M18 A;  2HUE B;  3W98 A;  1S32 A;  5AVB D;  1P3K A;  5CP6 D;  5B1M C;  5B40 B;  1WWS A;  5B24 B;  3UTA A;  5B2I C;  3REK D;  1U35 B;  4Z5T C;  1ULY A;  1KX3 D;  3W99 C;  4KGC A;  3MGS B;  1P3F C;  3AZG D;  3REH D;  3AFA B;  3KSY A;  3B6F C;  3VH6 A;  5BO0 B;  4CAY B;  3REI C;  1ID3 C;  1F66 D;  4KUD C;  3AV2 A;  5B2J C;  5BNV A;  5B1M B;  3AZL D;  2BYK B;  5AV6 D;  3AZK C;  5BNX A;  1P3I A;  5B2I B;  1AOI D;  4Z5T B;  3W96 C;  3WAA C;  3W99 B;  4YM6 D;  1JFI A;  1M19 D;  1P3F B;  1EQZ C;  3MGR D;  4JJN C;  4R8P A;  3B6F B;  5B33 D;  3REI B;  5GXQ D;  1ID3 B;  3TU4 A;  4KUD B;  1TAF A;  4H9O A;  5B2J B;  4WU8 D;  3MVD A;  4WV4 B;  3REJ D;  4J8U D;  3AZK B;  3AZE D;  1H3O B;  3W96 B;  3WAA B;  3WKJ A;  1P34 A;  5E5A D;  3MGQ C;  3AZF D;  3AZI C;  1EQZ B;  4X23 D;  4JJN B;  5G49 B;  5AVC C;  3O62 C;  3MGP C;  4Z2M G;  3VH5 T;  2F8N A;  5E5A A;  1P3P D;  3AZN C;  4CSR B;  1KX5 A;  3V9R B;  5CPI A;  5AV5 C;  4KUD D;  3LZ1 C;  4XZQ A;  4H9S C;  3LJA D;  3X1U C;  3MGQ B;  1HQ3 A;  5AY8 C;  3UTB D;  3AZI B;  2NZD C;  3WTP C;  4J8W D;  3C1B C;  5AVC B;  5AV8 A;  3O62 B;  3X1S A;  3NQJ B;  3AZJ A;  4LD9 A;  1N1J B;  4UUZ B;  1P3B C;  1ZLA A;  1P3A C;  5F99 C;  3AZN B;  4ZUX C;  3UT9 D;  5B31 D;  5AV5 B;  3LZ1 B;  5FUG B;  3X1V D;  3X1U B;  3X1T C;  2IO5 C;  5JRG C;  3AV1 D;  5AY8 B;  4G92 C;  2NZD B;  3WTP B;  3AZH A;  3C1B B;  3B6G A;  4WU9 C;  5DNM D;  1P3L D;  4G91 C;  2LY8 A;  5JA4 B;  5B32 D;  5CPK C;  1P3O A;  5B1L C;  4J8V D;  1P3B B;  1P3A B;  5F99 B;  3MGP D;  3C1C D;  1M1A D;  2NQB C;  4ZUX B;  3VH6 T;  5GT3 A;  1M18 C;  3KXB A;  3KUY B;  3AZM D;  3W98 C;  3AYW A;  3X1T B;  2IO5 B;  5JRG B;  1KX4 D;  1S32 C;  3AN2 A;  4G92 B;  1P3K C;  4J8V A;  2F8N G;  5BT1 D;  5B0Z D;  4XUJ C;  4WU9 B;  2ARO A;  3UTA C;  1P3M D;  4WNN A;  4G91 B;  4J8X D;  4KGC C;  3REL A;  5CPK B;  5B1L B;  1P3G D;  3MNN A;  3LEL D;  3W97 A;  2NQB B;  1KU5 A;  1M18 B;  5B40 C;  5CPJ A;  3W98 B;  3KWQ D;  1S32 B;  2HIO A;  3AV2 C;  5DNN A;  1P3K B;  1P3G A;  2PYO A;  2FJ7 D;  4XUJ B;  3UTA B;  3LZ0 D;  1P3I C;  5GT0 D;  4H9Q A;  5AV9 D;  4QLC D;  3A6N D;  3WA9 A;  4KGC B;  1BH9 A;  1TZY D;  2CV5 A;  4Z66 A;  3AV2 B;  3MVD C;  5BNV B;  5B0Y D;  5AVB A;  4NE5 A;  1P3I B;  5BNX B;  5CP6 A;  2JSS A;  1JFI B;  3REK A;  1B67 A;  1P34 C;  1KX3 A;  1BFM A;  3AZG A;  3REH A;  1TAF B;  4H9O B;  3VH5 W;  3MVD B;  1F66 A;  5B40 D;  5B24 D;  1KX5 C;  5CPI C;  3AZL A;  4NE3 A;  5AV6 A;  1U35 D;  1AOI A;  4XZQ C;  3WKJ B;  1P34 B;  3MGS D;  1HQ3 C;  4YM6 A;  1M19 A;  3AFA D;  4YS3 C;  5AV8 C;  3MGR A;  3X1S C;  3R45 A;  4Z2M H;  4LD9 C;  5B33 A;  2F8N B;  5GXQ A;  1ZLA C;  5B1M D;  4WU8 A;  1KX5 B;  5B2I D;  5CPI B;  1R4V A;  5GSU C;  3REJ A;  4Z5T D;  4J8U A;  3W99 D;  4XZQ B;  3AZE A;  1P3F D;  1HQ3 B;  3AZF A;  4YS3 B;  3AZK A;  5AV8 B;  4X23 A;  3X1S B;  3B6F D;  3B0C T;  3REI D;  1ID3 D;  4LD9 B;  5B2J D;  1P3O C;  1ZLA B;  2F8N K;  4H9R A;  3AZK D;  5GT3 C;  1P3P A;  5GSU B;  4NE6 A;  3KXB C;  3VH6 W;  3W96 D;  3WAA D;  3AYW C;  4KUD A;  5KDM A;  1EQZ D;  3LJA A;  4JJN D;  3AZH B;  3UTB A;  2ARO C;  4J8W A;  3KUY C;  4ZBJ C;  1P3O B;  2CWE A;  3MNN C;  5C3I C;  4H9P A;  3W97 C;  2YFV A;  5GT3 B;  3KXB B;  5CPJ C;  3UT9 A;  3AYW B;  5B31 A;  4M6B A;  3MGQ D;  2F8N H;  2HIO C;  3AN2 B;  5DNN C;  3AZI D;  3X1V A;  2PYO C;  5GSU D;  3AV1 A;  2ARO B;  5CHL B;  5AVC D;  3O62 D;  4WNN B;  3NQU A;  5DNM A;  1P3L A;  3WA9 C;  4ZBJ B;  3MNN B;  5C3I B;  3AZN D;  5B32 A;  3W97 B;  5AV5 D;  3LZ1 D;  3MGP A;  2CV5 C;  3C1C A;  4Z66 C;  1M1A A;  5CPJ B;  3X1U D;  3AZM A;  1WWI A;  5AY8 D;  2HIO B;  2PYO B;  5DNN B;  2NZD D;  3WTP D;  3C1B D;  1KX4 A;  3AZN A;  5AVB C;  2YFW A;  2RVQ C;  5CP6 C;  5B0Z A;  4H9Q B;  4KHA A;  1P3M A;  4H9S A;  3REK C;  3WA9 B;  1KX3 C;  1P3B D;  4J8X A;  1BH9 B;  1P3A D;  5F99 D;  4ZUX D;  3KUY D;  5BS7 A;  3LEL A;  3REH C;  4Z66 B;  2CV5 B;  3X1T D;  5JRG D;  1F66 C;  3KWQ A;  4WU9 D;  5AVB B;  5CP6 B;  2FJ7 A;  3AZL C;  5AV6 C;  3LZ0 A;  1AOI C;  5GT0 A;  4R8P C;  5B31 G;  5AV9 A;  3REK B;  1KX3 B;  4QLC A;  5CPK D;  5B1L D;  3A6N A;  4YM6 C;  3TU4 C;  1M19 C;  2NQB D;  1M18 D;  3MGR C;  1TZY A;  3REH B;  3W98 D;  4E44 A;  5B33 C;  2L5A A;  1S32 D;  1P3K D;  3WKJ C;  5GXQ C;  1F66 B;  4XUJ D;  4H9N A;  4WU8 C;  3UTA D;  5B32 G;  5B0Y A;  3AZL B;  5AV6 B;  3REJ C;  4J8U C;  1AOI B;  3AZE C;  4R8P B;  4KGC D;  2RVQ D;  4YM6 B;  4XUJ A;  3TU4 B;  1BH8 A;  5E5A C;  1M19 B;  2BYM A;  3AZF C;  1HTA A;  3B0B A;  4X23 C;  3MGR B;  3R45 B;  3B0C W;  5B33 B;  3AV2 D;  5GXQ B;  4WU8 B;  1P3I D;  4DRB A;  5B40 A;  1Q9C A;  5B24 A;  3REJ B;  1P3P C;  4J8U B;  3AZE B;  1U35 A;  3AZJ C;  3LJA C;  5E5A B;  3MGS A;  3AZF B;  3UTB C;  4X23 B;  4R8P D;  3AFA A;  4J8W C;  3TU4 D;  4AWL C;  3MVD D;  5BO0 A;  4CAY A;  4H9R B;  5B1M A;  2BYK A;  3AZH C;  1P3P B;  3B6G C;  5B2I A;  3UT9 C;  5B31 C;  3WKJ D;  1P34 D;  4Z5T A;  5KDM B;  3W99 A;  3X1V C;  3AZJ B;  3LJA B;  4EO5 C;  3AV1 C;  1P3F A;  3UTB B;  4J8W B;  4HGA C;  5DNM C;  3B6F A;  2F8N D;  4AWL B;  1P3L C;  4E45 A;  3REI A;  1ID3 A;  5B2J A;  1KX5 D;  5B32 C;  4H9P B;  3AN2 C;  5CPI D;  4J8V C;  2YFV B;  3B6G B;  3C1C C;  1M1A C;  1B6W A;  4XZQ D;  3UT9 B; 
#chains in the Genus database with same CATH topology
 5B31 B;  1H3O A;  3W96 A;  3AZM C;  3WAA A;  1HQ3 D;  3X1V B;  2Y2N A;  4EO5 B;  3AV1 B;  1KX4 C;  4YS3 D;  3REL C;  5AV8 D;  1EQZ A;  5BT1 C;  3X1S D;  4JJN A;  5B0Z C;  5G49 A;  2G5I C;  3NQU B;  1P3M C;  4HGA B;  5DNM B;  3AZJ D;  4LD9 D;  1P3L B;  2ZY3 A;  4J8X C;  1ZLA D;  3B0D C;  4YS3 A;  5B32 B;  4J8V B;  1P3G C;  3MGP B;  5BS7 C;  4CSR A;  3WTP E;  3LEL C;  3V9R A;  3C1C B;  1M1A B;  2DQN C;  1A7W A;  3AZM B;  3EG5 B;  2XD1 A;  3AZH D;  3KWQ C;  3MGQ A;  1KX4 B;  3REL B;  3B6G D;  2YFW B;  3AZI A;  5GSU A;  5B0Z B;  2FJ7 C;  4KHA B;  5AVC A;  3LZ0 C;  3O62 A;  1P3M B;  3FDD A;  3H0M C;  5GT0 C;  5AV9 C;  4QLC C;  1P3O D;  3NQJ A;  4J8X B;  3A6N C;  1N1J A;  4UUZ A;  3B0D B;  5GT3 D;  1P3G B;  3KXB D;  3LEL B;  1TZY C;  3AYW D;  5AV5 A;  3LZ1 A;  2ZM5 A;  5FUG A;  3AN2 D;  3X1U A;  3KWQ B;  1Z2C B;  5AY8 A;  2ARO D;  2NZD A;  3WTP A;  5B0Y C;  3C1B A;  2FJ7 B;  3LZ0 B;  5GT0 B;  3AZG C;  2UWX A;  5AV9 B;  3REL D;  2BG1 A;  4QLC B;  3H0L C;  3A6N B;  3MNN D;  5JA4 A;  3W97 D;  3VH5 A;  1P3B A;  1P3A A;  5F99 A;  1TZY B;  5CPJ D;  4ZUX A;  3KUY A;  1F1E A;  2HUE C;  2HIO D;  2PYO D;  5DNN D;  3X1T A;  4DRA A;  5JRG A;  4H9N B;  5B0Y B;  2F2A C;  1W2E A;  4WU9 A;  5B24 C;  4NFT A;  4WZS B;  3AZG B;  1U35 C;  3WA9 D;  4DQY B;  1BH8 B;  5CPK A;  2BYM B;  5B1L A;  3MGS C;  2CV5 D;  4Z66 D;  2ZY5 A;  3AFA C;  2NQB A;  1M18 A;  2HUE B;  3W98 A;  2Y2O A;  1S32 A;  5AVB D;  1P3K A;  5CP6 D;  5B1M C;  5B40 B;  1WWS A;  5B24 B;  3UTA A;  5B2I C;  3REK D;  1U35 B;  4Z5T C;  1ULY A;  1KX3 D;  3W99 C;  4KGC A;  3MGS B;  1P3F C;  3AZG D;  3REH D;  1T3U A;  3AFA B;  3KSY A;  3B6F C;  3VH6 A;  5BO0 B;  4CAY B;  3REI C;  1ID3 C;  1F66 D;  4KUD C;  3AV2 A;  5B2J C;  5BNV A;  5B1M B;  3AZL D;  2BYK B;  5AV6 D;  3AZK C;  5BNX A;  1P3I A;  5B2I B;  1AOI D;  4Z5T B;  3W96 C;  3WAA C;  3W99 B;  3A1K A;  3F6T A;  4YM6 D;  1JFI A;  1M19 D;  1P3F B;  1EQZ C;  3MGR D;  4JJN C;  4R8P A;  3B6F B;  5B33 D;  3REI B;  5GXQ D;  1ID3 B;  3TU4 A;  4KUD B;  1TAF A;  4H9O A;  5B2J B;  4WU8 D;  3MVD A;  4WV4 B;  3REJ D;  4J8U D;  3AZK B;  3AZE D;  1H3O B;  3W96 B;  3WAA B;  3WKJ A;  1P34 A;  5E5A D;  3MGQ C;  3AZF D;  3AZI C;  1EQZ B;  4X23 D;  4JJN B;  5G49 B;  5AVC C;  3O62 C;  3MGP C;  4Z2M G;  3VH5 T;  2F8N A;  5E5A A;  1P3P D;  3AZN C;  4CSR B;  1KX5 A;  3V9R B;  5CPI A;  5AV5 C;  4KUD D;  3LZ1 C;  4XZQ A;  4H9S C;  3LJA D;  3X1U C;  3MGQ B;  1HQ3 A;  5AY8 C;  3UTB D;  3AZI B;  2NZD C;  3WTP C;  4J8W D;  3C1B C;  5AVC B;  5AV8 A;  3O62 B;  3X1S A;  3NQJ B;  3AZJ A;  4LD9 A;  1N1J B;  4UUZ B;  2Y2I A;  3EPL A;  1P3B C;  1ZLA A;  2Y2L A;  1P3A C;  5F99 C;  2DF4 C;  3AZN B;  4ZUX C;  3UT9 D;  5B31 D;  5AV5 B;  3LZ1 B;  5FUG B;  3X1V D;  2W8S A;  3X1U B;  3X1T C;  2IO5 C;  5JRG C;  3AV1 D;  5AY8 B;  4G92 C;  2NZD B;  3WTP B;  3AZH A;  3C1B B;  3B6G A;  4WU9 C;  5DNM D;  1P3L D;  4G91 C;  2LY8 A;  2Y2Q A;  5JA4 B;  5B32 D;  5CPK C;  1P3O A;  5B1L C;  4J8V D;  1P3B B;  1P3A B;  5F99 B;  3MGP D;  3C1C D;  1M1A D;  2NQB C;  4ZUX B;  3VH6 T;  5GT3 A;  1M18 C;  3KXB A;  3KUY B;  3AZM D;  3W98 C;  3AYW A;  3X1T B;  2IO5 B;  5JRG B;  1KX4 D;  1S32 C;  3AN2 A;  4G92 B;  1P3K C;  4J8V A;  2F8N G;  5BT1 D;  5B0Z D;  4XUJ C;  4WU9 B;  2ARO A;  3UTA C;  1P3M D;  4WNN A;  4G91 B;  4J8X D;  4KGC C;  3REL A;  5CPK B;  5B1L B;  1P3G D;  3MNN A;  3LEL D;  3W97 A;  2NQB B;  1KU5 A;  1M18 B;  5B40 C;  5CPJ A;  4WJ3 C;  3W98 B;  3KWQ D;  2JCH A;  1S32 B;  2HIO A;  3AV2 C;  5DNN A;  1P3K B;  1P3G A;  2PYO A;  2FJ7 D;  4XUJ B;  3UTA B;  3LZ0 D;  1P3I C;  5GT0 D;  4H9Q A;  5AV9 D;  4QLC D;  3A6N D;  3WA9 A;  4KGC B;  3H0R C;  1BH9 A;  1TZY D;  2CV5 A;  3EPJ A;  4Z66 A;  3A1I A;  3AV2 B;  3MVD C;  5BNV B;  5B0Y D;  5AVB A;  4NE5 A;  1P3I B;  5BNX B;  5CP6 A;  2FFF B;  2JSS A;  1JFI B;  3REK A;  1B67 A;  1P34 C;  1KX3 A;  1BFM A;  3AZG A;  3REH A;  1TAF B;  4H9O B;  3VH5 W;  3MVD B;  1F66 A;  5B40 D;  2Y2G A;  5B24 D;  3P5J B;  1KX5 C;  5CPI C;  3AZL A;  4NE3 A;  5AV6 A;  1U35 D;  1AOI A;  4XZQ C;  3WKJ B;  1P34 B;  3MGS D;  1HQ3 C;  4YM6 A;  1M19 A;  3AFA D;  4YS3 C;  5AV8 C;  3MGR A;  3X1S C;  3R45 A;  2Y2J A;  4Z2M H;  2Y2P A;  5B33 A;  2F8N B;  4LD9 C;  5GXQ A;  1ZLA C;  5B1M D;  4WU8 A;  1KX5 B;  5B2I D;  5CPI B;  1R4V A;  5GSU C;  3REJ A;  4Z5T D;  4J8U A;  3W99 D;  4XZQ B;  3AZE A;  1P3F D;  1HQ3 B;  3AZF A;  4YS3 B;  3AZK A;  5AV8 B;  4X23 A;  3X1S B;  3B6F D;  3B0C T;  3REI D;  1ID3 D;  4LD9 B;  5B2J D;  1P3O C;  1ZLA B;  2F8N K;  4H9R A;  3AZK D;  5GT3 C;  1P3P A;  5GSU B;  4NE6 A;  3KXB C;  3VH6 W;  3W96 D;  3WAA D;  3AYW C;  4KUD A;  5KDM A;  1EQZ D;  3LJA A;  4JJN D;  3AZH B;  3UTB A;  2ARO C;  4J8W A;  3KUY C;  4ZBJ C;  1P3O B;  2CWE A;  2VQR A;  4UPK A;  3MNN C;  5C3I C;  4H9P A;  3W97 C;  2Y2M A;  2YFV A;  5GT3 B;  2G5H C;  3KXB B;  5CPJ C;  3UT9 A;  3AYW B;  5B31 A;  4M6B A;  3MGQ D;  2F8N H;  2HIO C;  3AN2 B;  5DNN C;  3AZI D;  3X1V A;  2PYO C;  5GSU D;  3AV1 A;  2ARO B;  5CHL B;  5AVC D;  3O62 D;  4WNN B;  3NQU A;  5DNM A;  1P3L A;  3WA9 C;  4ZBJ B;  3MNN B;  5C3I B;  3AZN D;  5B32 A;  3W97 B;  5AV5 D;  3LZ1 D;  3MGP A;  2CV5 C;  3C1C A;  4Z66 C;  1M1A A;  5CPJ B;  3X1U D;  3AZM A;  1WWI A;  5AY8 D;  2HIO B;  2PYO B;  5DNN B;  2NZD D;  3WTP D;  3C1B D;  1KX4 A;  3AZN A;  5AVB C;  2YFW A;  2RVQ C;  5CP6 C;  5B0Z A;  4H9Q B;  4KHA A;  1P3M A;  4H9S A;  3REK C;  3WA9 B;  1KX3 C;  1P3B D;  4J8X A;  1BH9 B;  1P3A D;  5F99 D;  4ZUX D;  3KUY D;  5BS7 A;  3LEL A;  3REH C;  4Z66 B;  2CV5 B;  3AL0 C;  3X1T D;  5JRG D;  1F66 C;  3KWQ A;  3EPK A;  4WU9 D;  5AVB B;  2JE5 A;  5CP6 B;  2FJ7 A;  3AZL C;  5AV6 C;  3LZ0 A;  1AOI C;  5GT0 A;  4R8P C;  5B31 G;  5AV9 A;  3REK B;  1KX3 B;  4QLC A;  5CPK D;  5B1L D;  3A6N A;  4YM6 C;  3TU4 C;  1M19 C;  2NQB D;  1M18 D;  3MGR C;  1TZY A;  3REH B;  3W98 D;  4E44 A;  5B33 C;  2L5A A;  2J8P A;  1S32 D;  1P3K D;  2ZY4 A;  5GXQ C;  1F66 B;  4XUJ D;  4H9N A;  3WKJ C;  4WU8 C;  3IP4 C;  3UTA D;  5B32 G;  5B0Y A;  3AZL B;  5AV6 B;  3REJ C;  4J8U C;  1AOI B;  3AZE C;  2Y2K A;  4R8P B;  4KGC D;  2RVQ D;  4YM6 B;  4XUJ A;  3TU4 B;  1BH8 A;  5E5A C;  1M19 B;  2BYM A;  3AZF C;  1HTA A;  3B0B A;  4X23 C;  3MGR B;  3R45 B;  3EPH A;  3B0C W;  1PZR A;  5B33 B;  3AV2 D;  5GXQ B;  4WU8 B;  1P3I D;  4DRB A;  5B40 A;  1Q9C A;  5B24 A;  3REJ B;  1P3P C;  4J8U B;  3AZE B;  1U35 A;  3AZJ C;  3LJA C;  5E5A B;  3MGS A;  3AZF B;  3UTB C;  4X23 B;  4R8P D;  3AFA A;  4J8W C;  3TU4 D;  4AWL C;  3MVD D;  5BO0 A;  4CAY A;  4H9R B;  2ZY2 A;  5B1M A;  2BYK A;  3AZH C;  2XD5 A;  1P3P B;  3B6G C;  5B2I A;  2Y2H A;  3UT9 C;  5B31 C;  3WKJ D;  1P34 D;  4Z5T A;  5KDM B;  3W99 A;  3X1V C;  3AZJ B;  3LJA B;  4EO5 C;  3AV1 C;  1P3F A;  3UTB B;  4J8W B;  4HGA C;  5DNM C;  3B6F A;  2F8N D;  4AWL B;  1P3L C;  4E45 A;  3REI A;  1ID3 A;  5B2J A;  1KX5 D;  5B32 C;  2RIQ A;  4H9P B;  3AN2 C;  4J8V C;  5CPI D;  2YFV B;  3KFU G;  3B6G B;  3C1C C;  1M1A C;  1B6W A;  4XZQ D;  3UT9 B; 
#chains in the Genus database with same CATH homology
 5B31 B;  1H3O A;  3W96 A;  3AZM C;  3WAA A;  1HQ3 D;  3X1V B;  2Y2N A;  4EO5 B;  3AV1 B;  1KX4 C;  4YS3 D;  3REL C;  5AV8 D;  1EQZ A;  5BT1 C;  3X1S D;  4JJN A;  5B0Z C;  5G49 A;  2G5I C;  3NQU B;  1P3M C;  4HGA B;  5DNM B;  3AZJ D;  4LD9 D;  1P3L B;  2ZY3 A;  4J8X C;  1ZLA D;  3B0D C;  4YS3 A;  5B32 B;  4J8V B;  1P3G C;  3MGP B;  5BS7 C;  4CSR A;  3WTP E;  3LEL C;  3V9R A;  3C1C B;  1M1A B;  2DQN C;  1A7W A;  3AZM B;  3EG5 B;  2XD1 A;  3AZH D;  3KWQ C;  3MGQ A;  1KX4 B;  3REL B;  3B6G D;  2YFW B;  3AZI A;  5GSU A;  5B0Z B;  2FJ7 C;  4KHA B;  5AVC A;  3LZ0 C;  3O62 A;  1P3M B;  3FDD A;  3H0M C;  5GT0 C;  5AV9 C;  4QLC C;  1P3O D;  3NQJ A;  4J8X B;  3A6N C;  1N1J A;  4UUZ A;  3B0D B;  5GT3 D;  1P3G B;  3KXB D;  3LEL B;  1TZY C;  3AYW D;  5AV5 A;  3LZ1 A;  2ZM5 A;  5FUG A;  3AN2 D;  3X1U A;  3KWQ B;  1Z2C B;  5AY8 A;  2ARO D;  2NZD A;  3WTP A;  5B0Y C;  3C1B A;  2FJ7 B;  3LZ0 B;  5GT0 B;  3AZG C;  2UWX A;  5AV9 B;  3REL D;  2BG1 A;  4QLC B;  3H0L C;  3A6N B;  3MNN D;  5JA4 A;  3W97 D;  3VH5 A;  1P3B A;  1P3A A;  5F99 A;  1TZY B;  5CPJ D;  4ZUX A;  3KUY A;  1F1E A;  2HUE C;  2HIO D;  2PYO D;  5DNN D;  3X1T A;  4DRA A;  5JRG A;  4H9N B;  5B0Y B;  2F2A C;  1W2E A;  4WU9 A;  5B24 C;  4NFT A;  4WZS B;  3AZG B;  1U35 C;  3WA9 D;  4DQY B;  1BH8 B;  5CPK A;  2BYM B;  5B1L A;  3MGS C;  2CV5 D;  4Z66 D;  2ZY5 A;  3AFA C;  2NQB A;  1M18 A;  2HUE B;  3W98 A;  2Y2O A;  1S32 A;  5AVB D;  1P3K A;  5CP6 D;  5B1M C;  5B40 B;  1WWS A;  5B24 B;  3UTA A;  5B2I C;  3REK D;  1U35 B;  4Z5T C;  1ULY A;  1KX3 D;  3W99 C;  4KGC A;  3MGS B;  1P3F C;  3AZG D;  3REH D;  1T3U A;  3AFA B;  3KSY A;  3B6F C;  3VH6 A;  5BO0 B;  4CAY B;  3REI C;  1ID3 C;  1F66 D;  4KUD C;  3AV2 A;  5B2J C;  5BNV A;  5B1M B;  3AZL D;  2BYK B;  5AV6 D;  3AZK C;  5BNX A;  1P3I A;  5B2I B;  1AOI D;  4Z5T B;  3W96 C;  3WAA C;  3W99 B;  3A1K A;  3F6T A;  4YM6 D;  1JFI A;  1M19 D;  1P3F B;  1EQZ C;  3MGR D;  4JJN C;  4R8P A;  3B6F B;  5B33 D;  3REI B;  5GXQ D;  1ID3 B;  3TU4 A;  4KUD B;  1TAF A;  4H9O A;  5B2J B;  4WU8 D;  3MVD A;  4WV4 B;  3REJ D;  4J8U D;  3AZK B;  3AZE D;  1H3O B;  3W96 B;  3WAA B;  3WKJ A;  1P34 A;  5E5A D;  3MGQ C;  3AZF D;  3AZI C;  1EQZ B;  4X23 D;  4JJN B;  5G49 B;  5AVC C;  3O62 C;  3MGP C;  4Z2M G;  3VH5 T;  2F8N A;  5E5A A;  1P3P D;  3AZN C;  4CSR B;  1KX5 A;  3V9R B;  5CPI A;  5AV5 C;  4KUD D;  3LZ1 C;  4XZQ A;  4H9S C;  3LJA D;  3X1U C;  3MGQ B;  1HQ3 A;  5AY8 C;  3UTB D;  3AZI B;  2NZD C;  3WTP C;  4J8W D;  3C1B C;  5AVC B;  5AV8 A;  3O62 B;  3X1S A;  3NQJ B;  3AZJ A;  4LD9 A;  1N1J B;  4UUZ B;  2Y2I A;  3EPL A;  1P3B C;  1ZLA A;  2Y2L A;  1P3A C;  5F99 C;  2DF4 C;  3AZN B;  4ZUX C;  3UT9 D;  5B31 D;  5AV5 B;  3LZ1 B;  5FUG B;  3X1V D;  2W8S A;  3X1U B;  3X1T C;  2IO5 C;  5JRG C;  3AV1 D;  5AY8 B;  4G92 C;  2NZD B;  3WTP B;  3AZH A;  3C1B B;  3B6G A;  4WU9 C;  5DNM D;  1P3L D;  4G91 C;  2LY8 A;  2Y2Q A;  5JA4 B;  5B32 D;  5CPK C;  1P3O A;  5B1L C;  4J8V D;  1P3B B;  1P3A B;  5F99 B;  3MGP D;  3C1C D;  1M1A D;  2NQB C;  4ZUX B;  3VH6 T;  5GT3 A;  1M18 C;  3KXB A;  3KUY B;  3AZM D;  3W98 C;  3AYW A;  3X1T B;  2IO5 B;  5JRG B;  1KX4 D;  1S32 C;  3AN2 A;  4G92 B;  1P3K C;  4J8V A;  2F8N G;  5BT1 D;  5B0Z D;  4XUJ C;  4WU9 B;  2ARO A;  3UTA C;  1P3M D;  4WNN A;  4G91 B;  4J8X D;  4KGC C;  3REL A;  5CPK B;  5B1L B;  1P3G D;  3MNN A;  3LEL D;  3W97 A;  2NQB B;  1KU5 A;  1M18 B;  5B40 C;  5CPJ A;  4WJ3 C;  3W98 B;  3KWQ D;  2JCH A;  1S32 B;  2HIO A;  3AV2 C;  5DNN A;  1P3K B;  1P3G A;  2PYO A;  2FJ7 D;  4XUJ B;  3UTA B;  3LZ0 D;  1P3I C;  5GT0 D;  4H9Q A;  5AV9 D;  4QLC D;  3A6N D;  3WA9 A;  4KGC B;  3H0R C;  1BH9 A;  1TZY D;  2CV5 A;  3EPJ A;  4Z66 A;  3A1I A;  3AV2 B;  3MVD C;  5BNV B;  5B0Y D;  5AVB A;  4NE5 A;  1P3I B;  5BNX B;  5CP6 A;  2FFF B;  2JSS A;  1JFI B;  3REK A;  1B67 A;  1P34 C;  1KX3 A;  1BFM A;  3AZG A;  3REH A;  1TAF B;  4H9O B;  3VH5 W;  3MVD B;  1F66 A;  5B40 D;  2Y2G A;  5B24 D;  3P5J B;  1KX5 C;  5CPI C;  3AZL A;  4NE3 A;  5AV6 A;  1U35 D;  1AOI A;  4XZQ C;  3WKJ B;  1P34 B;  3MGS D;  1HQ3 C;  4YM6 A;  1M19 A;  3AFA D;  4YS3 C;  5AV8 C;  3MGR A;  3X1S C;  3R45 A;  2Y2J A;  4Z2M H;  2Y2P A;  5B33 A;  2F8N B;  4LD9 C;  5GXQ A;  1ZLA C;  5B1M D;  4WU8 A;  1KX5 B;  5B2I D;  5CPI B;  1R4V A;  5GSU C;  3REJ A;  4Z5T D;  4J8U A;  3W99 D;  4XZQ B;  3AZE A;  1P3F D;  1HQ3 B;  3AZF A;  4YS3 B;  3AZK A;  5AV8 B;  4X23 A;  3X1S B;  3B6F D;  3B0C T;  3REI D;  1ID3 D;  4LD9 B;  5B2J D;  1P3O C;  1ZLA B;  2F8N K;  4H9R A;  3AZK D;  5GT3 C;  1P3P A;  5GSU B;  4NE6 A;  3KXB C;  3VH6 W;  3W96 D;  3WAA D;  3AYW C;  4KUD A;  5KDM A;  1EQZ D;  3LJA A;  4JJN D;  3AZH B;  3UTB A;  2ARO C;  4J8W A;  3KUY C;  4ZBJ C;  1P3O B;  2CWE A;  2VQR A;  4UPK A;  3MNN C;  5C3I C;  4H9P A;  3W97 C;  2Y2M A;  2YFV A;  5GT3 B;  2G5H C;  3KXB B;  5CPJ C;  3UT9 A;  3AYW B;  5B31 A;  4M6B A;  3MGQ D;  2F8N H;  2HIO C;  3AN2 B;  5DNN C;  3AZI D;  3X1V A;  2PYO C;  5GSU D;  3AV1 A;  2ARO B;  5CHL B;  5AVC D;  3O62 D;  4WNN B;  3NQU A;  5DNM A;  1P3L A;  3WA9 C;  4ZBJ B;  3MNN B;  5C3I B;  3AZN D;  5B32 A;  3W97 B;  5AV5 D;  3LZ1 D;  3MGP A;  2CV5 C;  3C1C A;  4Z66 C;  1M1A A;  5CPJ B;  3X1U D;  3AZM A;  1WWI A;  5AY8 D;  2HIO B;  2PYO B;  5DNN B;  2NZD D;  3WTP D;  3C1B D;  1KX4 A;  3AZN A;  5AVB C;  2YFW A;  2RVQ C;  5CP6 C;  5B0Z A;  4H9Q B;  4KHA A;  1P3M A;  4H9S A;  3REK C;  3WA9 B;  1KX3 C;  1P3B D;  4J8X A;  1BH9 B;  1P3A D;  5F99 D;  4ZUX D;  3KUY D;  5BS7 A;  3LEL A;  3REH C;  4Z66 B;  2CV5 B;  3AL0 C;  3X1T D;  5JRG D;  1F66 C;  3KWQ A;  3EPK A;  4WU9 D;  5AVB B;  2JE5 A;  5CP6 B;  2FJ7 A;  3AZL C;  5AV6 C;  3LZ0 A;  1AOI C;  5GT0 A;  4R8P C;  5B31 G;  5AV9 A;  3REK B;  1KX3 B;  4QLC A;  5CPK D;  5B1L D;  3A6N A;  4YM6 C;  3TU4 C;  1M19 C;  2NQB D;  1M18 D;  3MGR C;  1TZY A;  3REH B;  3W98 D;  4E44 A;  5B33 C;  2L5A A;  2J8P A;  1S32 D;  1P3K D;  2ZY4 A;  5GXQ C;  1F66 B;  4XUJ D;  4H9N A;  3WKJ C;  4WU8 C;  3IP4 C;  3UTA D;  5B32 G;  5B0Y A;  3AZL B;  5AV6 B;  3REJ C;  4J8U C;  1AOI B;  3AZE C;  2Y2K A;  4R8P B;  4KGC D;  2RVQ D;  4YM6 B;  4XUJ A;  3TU4 B;  1BH8 A;  5E5A C;  1M19 B;  2BYM A;  3AZF C;  1HTA A;  3B0B A;  4X23 C;  3MGR B;  3R45 B;  3EPH A;  3B0C W;  1PZR A;  5B33 B;  3AV2 D;  5GXQ B;  4WU8 B;  1P3I D;  4DRB A;  5B40 A;  1Q9C A;  5B24 A;  3REJ B;  1P3P C;  4J8U B;  3AZE B;  1U35 A;  3AZJ C;  3LJA C;  5E5A B;  3MGS A;  3AZF B;  3UTB C;  4X23 B;  4R8P D;  3AFA A;  4J8W C;  3TU4 D;  4AWL C;  3MVD D;  5BO0 A;  4CAY A;  4H9R B;  2ZY2 A;  5B1M A;  2BYK A;  3AZH C;  2XD5 A;  1P3P B;  3B6G C;  5B2I A;  2Y2H A;  3UT9 C;  5B31 C;  3WKJ D;  1P34 D;  4Z5T A;  5KDM B;  3W99 A;  3X1V C;  3AZJ B;  3LJA B;  4EO5 C;  3AV1 C;  1P3F A;  3UTB B;  4J8W B;  4HGA C;  5DNM C;  3B6F A;  2F8N D;  4AWL B;  1P3L C;  4E45 A;  3REI A;  1ID3 A;  5B2J A;  1KX5 D;  5B32 C;  2RIQ A;  4H9P B;  3AN2 C;  4J8V C;  5CPI D;  2YFV B;  3KFU G;  3B6G B;  3C1C C;  1M1A C;  1B6W A;  4XZQ D;  3UT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...