1P3FB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKCISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fB00
4M6BA 3MGRD 4WNNB 4NE6A 3MGRB 4J8XC 1TZYA 4WV4B 3W97C 5B2IC 1M18B 3AV1C 3WAAB 5B31A 3X1TA 1KX5D 3LELC 4H9RA 5AV8D 5JRGB 4Z66C 1ID3D 4R8PA 5CPKB 3KUYC 3B6FD 3C1BC 3LZ1A 3MGQD 3B6FB 5B1MC 3C1CA 3O62B 3AZJC 1P3AA 4KUDA 2CV5A 3KWQA 4WU8D 4E44A 5BNVB 5B32B 4WU8B 3AZFC 1KX3C 1U35B 5B2JA 4XZQC 3X1UA 5AVBB 1H3OB 5GT3D 3AZEB 5GT3B 3AN2C 1P3KD 3AZKA 2PYOC 4H9PB 3LJAA 3W98D 3W98B 3W97B 2FJ7C 4UUZA 2YFWB 5B2IB 3AV1B 3MGSD 1P34C 1TZYD 3MGSB 1P3GC 5FUGA 4Z66B 4JJNC 1P3MA 4ZBJC 5GXQA 3KUYB 1N1JA 5B31D 3REJC 3X1TD 3C1BB 5DNMD 3UTAA 3AZJB 3B0BA 4H9QA 4XUJA 3LZ1D 3AZFB 3MGPC 4YM6A 1KX3B 4XZQB 1P3PC 3C1CD 5JA4A 4KUDD 3V9RA 4QLCD 2CV5D 3KWQD 4QLCB 1P3OC 3AN2B 3AZGC 2NZDA 2PYOB 2F8ND 1B67A 3X1UD 2F8NB 5BO0B 4EO5C 3W99D 2FJ7B 3W99B 1P3IC 3AZKD 3LJAD 3B6GA 4NE5A 1F66A 5B0ZC 4LD9A 4ZBJB 3NQUA 2HUEC 1BH9A 4Z5TD 4Z5TB 3UTBA 3AZHC 5GXQD 5B24D 1M1AC 5GT0A 5B32G 5CP6A 3UTAD 3AZND 1AOIC 3RELD 3AZNB 2BYMA 1P3OB 2BYKB 4YM6D 3WTPA 3RELB 3AZGB 5AVCA 3X1SC 1WWIA 5CHLB 3AZLA 4YS3A 3REHA 1P3FA 1JFIA 4EO5B 3W96D 1HQ3C 3W96B 1P3IB 2NZDD 3AV2A 5DNNA 3MGRC 1S32D 5B0ZB 3MNNA 1S32B 5B33D 2HUEB 4Z2MH 5B33B 3AZID 1WWSA 3B6GD 5CPIA 1M18C 4KHAA 3WTPE 4KGCA 1M19A 1KX5C 3AZHB 4LD9D 5AV8C 5B0YA 1ID3C 3WKJD 3REIA 1M1AB 1KX4A 3B6FC 4H9SC 3MGQC 2HIOA 1AOIB 3NQJA 4X23D 5AV9A 4WU8C 3WAAA 2IO5B 1U35C 3X1VA 5GT0D 5CP6D 2NQBD 1BH8A 2NQBB 4J8UD 1HQ3B 4WZSB 4J8UB 5AVCD 5GT3C 3AZLD 3REHD 1P3KC 1P3FD 1ZLAD 3O62A 4CAYB 1ZLAB 3W98C 5BNVA 5B40D 3AV2D 1P3BA 5B40B 1EQZA 3AZMA 5AVBA 3MGSC 5F99D 1KX5B 3MNND 1TZYC 5F99B 5AV8B 3AZEA 1B6WA 3B0DC 5BNXB 5CPID 1ID3B 4J8XA 4KGCD 5B31C 3X1TC 5DNMC 3MGQB 4J8WD 4CSRA 5B0YD 3REID 3AV1A 4DRBA 3LELA 3LZ1C 3MVDD 2HIOD 3REKD 3MVDB 3REKB 3C1CC 4KUDC 4QLCC 2CV5C 2YFVB 3KWQC 1P3LA 1P3KB 5B1MA 3A6ND 5KDMA 3X1UC 5E5AA 3W99C 1KX3A 5AV6A 5B1LA 3AZKC 4AWLC 3LJAC 1TZYB 3VH5W 1P3BD 3LZ0A 3AN2A 3B0DB 1EQZD 2PYOA 3AYWA 4Z2MG 3AZMD 4Z5TC 5B31B 3X1TB 5DNMB 4R8PD 1P34A 2AROA 5GXQC 3LZ1B 5B24C 1P3GA 4JJNA 1P3AD 3C1CB 3UTAC 4KUDB 3KXBA 1P3AB 2CV5B 2F8NH 3KWQB 3REJA 3AZNC 3RELC 2LY8A 5B2JD 4YM6C 5B2JB 4E45A 3X1UB 3AFAA 3W96C 4H9NA 3MGPA 1P3LD 5G49A 2NZDC 1P3PA 3AZKB 4AWLB 3LJAB 5E5AD 2CWEA 3R45B 1S32C 5AV6D 4UUZB 5B1LD 5B33C 3B0CW 3AZIC 3UT9A 3B6GC 4WU9A 3TU4A 5AV5A 1P3MD 5FUGB 3LZ0D 4J8VA 4LD9C 3AYWD 4ZUXA 5GXQB 1HTAA 1N1JB 3WA9A 3WKJC 5B24B 5B0ZA 3UTAB 1P34D 2AROD 4H9QB 4XUJD 2IO5C 4X23C 4YM6B 5GT0C 5CP6C 2NQBC 5JA4B 3KXBD 3V9RB 4J8UC 1M1AA 5AY8A 2NZDB 5AVCC 5CPJA 3AZLC 3REHC 5BS7C 1P3FC 3AFAD 1ZLAC 5B40C 3VH6W 3X1SA 3AV2C 4DRAA 3AZIB 3B6GB 1F66D 1TAFA 5GSUA 1F66B 5F99C 5B31G 3MNNC 4LD9B 3NQUB 1BH9B 3UT9D 4WNNA 4WU9D 3MGRA 3TU4D 3WKJB 3UTBD 5AV5D 1F1EA 4KGCC 4J8VD 4J8WC 4H9OB 4ZUXD 1M18A 5B0YC 3WA9D 3REIC 4X23B 5GT0B 5CP6B 5JRGA 3MVDC 5AV8A 2HIOC 3REKC 5CPKA 3WTPD 2RVQD 2BYMB 2F8NG 3WTPB 3B6FA 5AVCB 4YS3D 4H9SA 3AZLB 4YS3B 3REHB 1P3FB 1JFIB 4HGAC 2JSSA 3A6NC 5B32A 5AY8D 4WU8A 1U35A 3AV2B 5DNND 5CPJD 1H3OA 3MNNB 4G91B 5GT3A 3X1SD 1P3BC 4H9PA 5CPIB 1EQZC 4KHAB 3AZMC 1M19D 3W98A 4KGCB 3W97A 5GSUD 1M19B 4J8WB 2YFWA 4R8PC 5B2IA 1KX4D 5B0YB 3VH5T 3REIB 1KX4B 3MGSA 4Z66A 2HIOB 1P3AC 3NQJB 5AV9D 3KUYA 1M18D 3WAAD 3C1BA 5AV9B 3X1VD 3X1VB 5DNMA 5JRGD 5B2JC 1BH8B 3AZJA 5CPKD 4HGAB 3A6NB 1R4VA 3AZFA 5BT1D 4XZQA 1P3LC 3O62D 1ULYA 4QLCA 5B32D 1U35D 5E5AC 1P3BB 5AV6C 1EQZB 5B1LC 5AVBD 2F8NA 3AZMB 5BO0A 4H9RB 2FJ7A 3W99A 3AZED 1P3MC 4R8PB 3LZ0C 4J8XD 3AYWC 5C3IC 4J8XB 3W97D 4NFTA 2L5AA 3R45A 3B0CT 4CSRB 5B2ID 3AV1D 4Z5TA 2AROC 4XUJC 3LELD 3LELB 4Z66D 3KUYD 3KXBC 3C1BD 5B24A 1P3LB 5B1MD 3AZJD 4NE3A 5B1MB 5KDMB 3AZNA 3AZFD 1P3OA 2BYKA 5E5AB 3VH5A 3AFAC 3RELA 3AZGA 1KX3D 4XZQD 5AV6B 5B1LB 3W96A 1F66C 3AN2D 1P3IA 1P3MB 2PYOD 3LZ0B 3AYWB 5C3IB 3UT9C 3VH6T 4WU9C 3TU4C 2FJ7D 3UTBC 5AV5C 1S32A 4J8VC 5B33A 3AZIA 4ZUXC 1P34B 2AROB 4XUJB 3WA9C 1P3GD 3AZHA 4JJND 3KSYA 1P3GB 4JJNB 3REJD 3KXBB 3REJB 3WKJA 3WTPC 2RVQC 4G92C 4YS3C 1AOIA 4H9OA 1A7WA 1KU5A 1Q9CA 3MGPD 3AFAB 4H9NB 4X23A 5AY8C 3MGPB 1P3PD 5G49B 1P3PB 5DNNC 2NQBA 5CPJC 1HQ3A 1P3OD 4J8UA 3AZGD 4G91C 5CPIC 3UT9B 5BS7A 4CAYA 3TU4B 4WU9B 1ZLAA 1M19C 3UTBB 5AV5B 1P3ID 5GSUC 5B40A 4J8VB 4ZUXB 1BFMA 1KX4C 3WA9B 1KX5A 5B0ZD 5F99A 5BNXA 1ID3A 5AV9C 3WAAC 3X1VC 3AZHD 3MGQA 4G92B 4J8WA 5JRGC 5CPKC 1M1AD 5AY8B 3VH6A 5DNNB 5BT1C 3MVDA 1AOID 5CPJB 3REKA 2F8NK 3O62C 2YFVA 5B32C 3X1SB 1P3KA 1HQ3D 5AVBC 3A6NA 1TAFB 5GSUB 3AZEC
chains in the Genus database with same CATH superfamily
4M6BA 3MGRD 4WNNB 4NE6A 3MGRB 4J8XC 1TZYA 2Y2LA 4WV4B 3W97C 5B2IC 1M18B 3AV1C 3WAAB 5B31A 3X1TA 1KX5D 3LELC 4H9RA 5AV8D 3EPJA 5JRGB 4Z66C 1ID3D 4R8PA 2VQRA 5CPKB 3KUYC 3B6FD 3C1BC 3LZ1A 3MGQD 3B6FB 5B1MC 3C1CA 3O62B 3AZJC 1P3AA 4KUDA 2CV5A 3KWQA 4WU8D 4E44A 5BNVB 5B32B 4WU8B 3AZFC 1KX3C 1U35B 5B2JA 4XZQC 3X1UA 1T3UA 1H3OB 5AVBB 5GT3D 3AZEB 5GT3B 3AN2C 1P3KD 3AZKA 2PYOC 4H9PB 3LJAA 3W98D 3W98B 3W97B 2FJ7C 3IP4C 4UUZA 2YFWB 5B2IB 3AV1B 3MGSD 1P34C 1TZYD 3MGSB 3H0MC 1P3GC 5FUGA 4Z66B 4JJNC 1P3MA 4ZBJC 5GXQA 3KUYB 1N1JA 5B31D 3REJC 3X1TD 3C1BB 2G5HC 2RIQA 2ZY3A 5DNMD 3UTAA 3AZJB 3B0BA 4H9QA 4XUJA 3LZ1D 3AZFB 3MGPC 4YM6A 1KX3B 4XZQB 1P3PC 3C1CD 5JA4A 4KUDD 3V9RA 4QLCD 2CV5D 3KWQD 4QLCB 1P3OC 3AN2B 3AZGC 2NZDA 2PYOB 2F8ND 1B67A 3X1UD 2F8NB 5BO0B 4EO5C 3W99D 2FJ7B 3W99B 2XD5A 1P3IC 3AZKD 2Y2HA 3LJAD 3B6GA 4NE5A 1F66A 5B0ZC 4LD9A 4ZBJB 3NQUA 2HUEC 1BH9A 4Z5TD 4Z5TB 3UTBA 3AZHC 5GXQD 5B24D 1M1AC 5GT0A 5B32G 5CP6A 3UTAD 3EPHA 3AZND 1AOIC 3RELD 3AZNB 2BYMA 1P3OB 2BYKB 4YM6D 3WTPA 3RELB 3AZGB 5AVCA 3X1SC 1WWIA 3P5JB 5CHLB 3AZLA 4YS3A 3REHA 1P3FA 1JFIA 4EO5B 3W96D 1HQ3C 3W96B 1P3IB 2NZDD 3AV2A 5DNNA 3MGRC 1S32D 5B0ZB 3MNNA 1S32B 5B33D 2HUEB 4Z2MH 5B33B 3AZID 1WWSA 3B6GD 5CPIA 1M18C 4KHAA 3WTPE 4KGCA 1M19A 1KX5C 3AZHB 2F2AC 4LD9D 5AV8C 5B0YA 1ID3C 3WKJD 3REIA 1M1AB 1KX4A 3B6FC 4H9SC 3MGQC 2HIOA 1AOIB 3NQJA 4X23D 5AV9A 4WU8C 3WAAA 2IO5B 1U35C 3X1VA 5GT0D 1PZRA 5CP6D 2NQBD 1BH8A 2NQBB 4J8UD 1HQ3B 4WZSB 4J8UB 5AVCD 5GT3C 3AZLD 2Y2NA 3REHD 1P3KC 1P3FD 1ZLAD 3O62A 4CAYB 1ZLAB 3W98C 5BNVA 5B40D 3AV2D 1P3BA 5B40B 3FDDA 1EQZA 3AZMA 5AVBA 3MGSC 5F99D 1KX5B 3MNND 1TZYC 5F99B 5AV8B 3AZEA 1B6WA 3B0DC 5BNXB 5CPID 1ID3B 4J8XA 4KGCD 5B31C 3X1TC 5DNMC 3H0LC 3MGQB 4J8WD 4CSRA 5B0YD 3REID 3AV1A 4DRBA 3LELA 3LZ1C 3MVDD 2HIOD 3REKD 3MVDB 3REKB 3C1CC 4KUDC 4QLCC 2CV5C 2YFVB 3KWQC 1P3LA 1P3KB 5B1MA 2G5IC 3A6ND 5KDMA 3X1UC 5E5AA 3W99C 1KX3A 2XD1A 5AV6A 5B1LA 3AZKC 4AWLC 3LJAC 1TZYB 3VH5W 1P3BD 3EG5B 3LZ0A 3AN2A 3B0DB 1EQZD 2PYOA 3AYWA 4Z2MG 3AZMD 4Z5TC 5B31B 3X1TB 5DNMB 3A1KA 4R8PD 3EPLA 1P34A 2AROA 5GXQC 3LZ1B 5B24C 1P3GA 4JJNA 1P3AD 3C1CB 3UTAC 4KUDB 3KXBA 1P3AB 2CV5B 2F8NH 3KWQB 3REJA 3AZNC 3RELC 2LY8A 5B2JD 4YM6C 5B2JB 4E45A 3X1UB 3AFAA 3W96C 4H9NA 3MGPA 1P3LD 5G49A 2NZDC 1P3PA 3AZKB 3KFUG 4AWLB 3LJAB 5E5AD 2CWEA 3R45B 1S32C 2DF4C 5AV6D 4UUZB 5B1LD 5B33C 3B0CW 3AZIC 3UT9A 3B6GC 4WU9A 2Y2KA 3TU4A 5AV5A 1P3MD 5FUGB 3LZ0D 4J8VA 4LD9C 3AYWD 4ZUXA 5GXQB 1HTAA 1N1JB 3WA9A 3WKJC 5B24B 5B0ZA 3UTAB 1P34D 2AROD 4H9QB 4XUJD 2IO5C 2DQNC 4YM6B 4X23C 5GT0C 5CP6C 2NQBC 5JA4B 3KXBD 3V9RB 4J8UC 1M1AA 5AY8A 2NZDB 3AL0C 5AVCC 5CPJA 3AZLC 3REHC 5BS7C 1P3FC 3AFAD 1ZLAC 5B40C 3VH6W 3X1SA 3AV2C 4DRAA 1W2EA 3AZIB 3B6GB 1F66D 1TAFA 5GSUA 1F66B 5F99C 5B31G 3MNNC 4LD9B 3NQUB 1BH9B 3UT9D 4WNNA 4WU9D 3MGRA 3TU4D 3WKJB 2Y2OA 3UTBD 5AV5D 1F1EA 4KGCC 4J8VD 2Y2IA 2ZY5A 4J8WC 4H9OB 4ZUXD 1M18A 5B0YC 3WA9D 3REIC 4X23B 5GT0B 5CP6B 5JRGA 3MVDC 5AV8A 2HIOC 3REKC 5CPKA 3WTPD 2RVQD 2BYMB 2F8NG 3WTPB 3B6FA 5AVCB 4YS3D 4H9SA 3AZLB 4YS3B 3REHB 1P3FB 1JFIB 4HGAC 2JSSA 3A6NC 5B32A 5AY8D 4WU8A 1U35A 3AV2B 5DNND 5CPJD 1H3OA 3MNNB 4G91B 5GT3A 3X1SD 1P3BC 4H9PA 5CPIB 1EQZC 4KHAB 3AZMC 1M19D 3W98A 4KGCB 3W97A 5GSUD 1M19B 4J8WB 2YFWA 4R8PC 5B2IA 2JE5A 5B0YB 3VH5T 1Z2CB 1KX4D 3REIB 1KX4B 3MGSA 3H0RC 4Z66A 2HIOB 1P3AC 3NQJB 5AV9D 3KUYA 1M18D 3WAAD 3C1BA 5AV9B 3X1VD 3X1VB 5DNMA 5JRGD 5B2JC 1BH8B 3AZJA 5CPKD 4HGAB 3A6NB 3A1IA 1R4VA 3AZFA 5BT1D 4XZQA 1P3LC 2Y2MA 3O62D 1ULYA 4QLCA 5B32D 1U35D 2Y2JA 5E5AC 1P3BB 5AV6C 1EQZB 5B1LC 5AVBD 2F8NA 3AZMB 5BO0A 4H9RB 2FFFB 2FJ7A 3W99A 3AZED 1P3MC 4R8PB 3LZ0C 4J8XD 3AYWC 5C3IC 4J8XB 3W97D 4NFTA 2L5AA 2ZY4A 3B0CT 3R45A 4CSRB 3F6TA 5B2ID 3AV1D 4Z5TA 2AROC 4XUJC 3LELD 3LELB 4Z66D 3KUYD 3KXBC 3C1BD 5B24A 1P3LB 5B1MD 3AZJD 4NE3A 5B1MB 5KDMB 3AZNA 3AZFD 1P3OA 2BYKA 5E5AB 3VH5A 3AFAC 3RELA 3AZGA 1KX3D 4XZQD 5AV6B 5B1LB 2ZM5A 3W96A 1F66C 3AN2D 1P3IA 1P3MB 2PYOD 3LZ0B 3AYWB 2BG1A 5C3IB 3UT9C 3VH6T 4WU9C 3TU4C 2FJ7D 2Y2PA 4DQYB 5AV5C 3UTBC 1S32A 4J8VC 5B33A 2W8SA 3AZIA 2Y2GA 4ZUXC 2AROB 4XUJB 1P34B 3WA9C 1P3GD 3EPKA 2J8PA 4JJND 3KSYA 3AZHA 1P3GB 4JJNB 3REJD 3KXBB 3REJB 3WKJA 3WTPC 2RVQC 4G92C 4YS3C 1AOIA 4H9OA 1A7WA 1KU5A 1Q9CA 3MGPD 3AFAB 2JCHA 4H9NB 4X23A 5AY8C 3MGPB 1P3PD 5G49B 1P3PB 5DNNC 2NQBA 5CPJC 1HQ3A 1P3OD 4J8UA 3AZGD 4G91C 5CPIC 3UT9B 4UPKA 5BS7A 4CAYA 3TU4B 4WU9B 1ZLAA 1M19C 3UTBB 5AV5B 1P3ID 5GSUC 5B40A 4J8VB 4ZUXB 1BFMA 1KX4C 3WA9B 1KX5A 5B0ZD 5F99A 5BNXA 1ID3A 5AV9C 3WAAC 4WJ3C 3X1VC 3AZHD 3MGQA 4G92B 4J8WA 5JRGC 5CPKC 1M1AD 5AY8B 2ZY2A 3VH6A 5DNNB 5BT1C 3MVDA 1AOID 5CPJB 3REKA 2F8NK 3O62C 2YFVA 5B32C 3X1SB 1P3KA 2UWXA 2Y2QA 1HQ3D 5AVBC 3A6NA 1TAFB 5GSUB 3AZEC
chains in the Genus database with same CATH topology
4M6BA 3MGRD 4WNNB 4NE6A 3MGRB 4J8XC 1TZYA 2Y2LA 4WV4B 3W97C 5B2IC 1M18B 3AV1C 3WAAB 5B31A 3X1TA 1KX5D 3LELC 4H9RA 5AV8D 3EPJA 5JRGB 4Z66C 1ID3D 4R8PA 2VQRA 5CPKB 3KUYC 3B6FD 3C1BC 3LZ1A 3MGQD 3B6FB 5B1MC 3C1CA 3O62B 3AZJC 1P3AA 4KUDA 2CV5A 3KWQA 4WU8D 4E44A 5BNVB 5B32B 4WU8B 3AZFC 1KX3C 1U35B 5B2JA 4XZQC 3X1UA 1T3UA 1H3OB 5AVBB 5GT3D 3AZEB 5GT3B 3AN2C 1P3KD 3AZKA 2PYOC 4H9PB 3LJAA 3W98D 3W98B 3W97B 2FJ7C 3IP4C 4UUZA 2YFWB 5B2IB 3AV1B 3MGSD 1P34C 1TZYD 3MGSB 3H0MC 1P3GC 5FUGA 4Z66B 4JJNC 1P3MA 4ZBJC 5GXQA 3KUYB 1N1JA 5B31D 3REJC 3X1TD 3C1BB 2G5HC 2RIQA 2ZY3A 5DNMD 3UTAA 3AZJB 3B0BA 4H9QA 4XUJA 3LZ1D 3AZFB 3MGPC 4YM6A 1KX3B 4XZQB 1P3PC 3C1CD 5JA4A 4KUDD 3V9RA 4QLCD 2CV5D 3KWQD 4QLCB 1P3OC 3AN2B 3AZGC 2NZDA 2PYOB 2F8ND 1B67A 3X1UD 2F8NB 5BO0B 4EO5C 3W99D 2FJ7B 3W99B 2XD5A 1P3IC 3AZKD 2Y2HA 3LJAD 3B6GA 4NE5A 1F66A 5B0ZC 4LD9A 4ZBJB 3NQUA 2HUEC 1BH9A 4Z5TD 4Z5TB 3UTBA 3AZHC 5GXQD 5B24D 1M1AC 5GT0A 5B32G 5CP6A 3UTAD 3EPHA 3AZND 1AOIC 3RELD 3AZNB 2BYMA 1P3OB 2BYKB 4YM6D 3WTPA 3RELB 3AZGB 5AVCA 3X1SC 1WWIA 3P5JB 5CHLB 3AZLA 4YS3A 3REHA 1P3FA 1JFIA 4EO5B 3W96D 1HQ3C 3W96B 1P3IB 2NZDD 3AV2A 5DNNA 3MGRC 1S32D 5B0ZB 3MNNA 1S32B 5B33D 2HUEB 4Z2MH 5B33B 3AZID 1WWSA 3B6GD 5CPIA 1M18C 4KHAA 3WTPE 4KGCA 1M19A 1KX5C 3AZHB 2F2AC 4LD9D 5AV8C 5B0YA 1ID3C 3WKJD 3REIA 1M1AB 1KX4A 3B6FC 4H9SC 3MGQC 2HIOA 1AOIB 3NQJA 4X23D 5AV9A 4WU8C 3WAAA 2IO5B 1U35C 3X1VA 5GT0D 1PZRA 5CP6D 2NQBD 1BH8A 2NQBB 4J8UD 1HQ3B 4WZSB 4J8UB 5AVCD 5GT3C 3AZLD 2Y2NA 3REHD 1P3KC 1P3FD 1ZLAD 3O62A 4CAYB 1ZLAB 3W98C 5BNVA 5B40D 3AV2D 1P3BA 5B40B 3FDDA 1EQZA 3AZMA 5AVBA 3MGSC 5F99D 1KX5B 3MNND 1TZYC 5F99B 5AV8B 3AZEA 1B6WA 3B0DC 5BNXB 5CPID 1ID3B 4J8XA 4KGCD 5B31C 3X1TC 5DNMC 3H0LC 3MGQB 4J8WD 4CSRA 5B0YD 3REID 3AV1A 4DRBA 3LELA 3LZ1C 3MVDD 2HIOD 3REKD 3MVDB 3REKB 3C1CC 4KUDC 4QLCC 2CV5C 2YFVB 3KWQC 1P3LA 1P3KB 5B1MA 2G5IC 3A6ND 5KDMA 3X1UC 5E5AA 3W99C 1KX3A 2XD1A 5AV6A 5B1LA 3AZKC 4AWLC 3LJAC 1TZYB 3VH5W 1P3BD 3EG5B 3LZ0A 3AN2A 3B0DB 1EQZD 2PYOA 3AYWA 4Z2MG 3AZMD 4Z5TC 5B31B 3X1TB 5DNMB 3A1KA 4R8PD 3EPLA 1P34A 2AROA 5GXQC 3LZ1B 5B24C 1P3GA 4JJNA 1P3AD 3C1CB 3UTAC 4KUDB 3KXBA 1P3AB 2CV5B 2F8NH 3KWQB 3REJA 3AZNC 3RELC 2LY8A 5B2JD 4YM6C 5B2JB 4E45A 3X1UB 3AFAA 3W96C 4H9NA 3MGPA 1P3LD 5G49A 2NZDC 1P3PA 3AZKB 3KFUG 4AWLB 3LJAB 5E5AD 2CWEA 3R45B 1S32C 2DF4C 5AV6D 4UUZB 5B1LD 5B33C 3B0CW 3AZIC 3UT9A 3B6GC 4WU9A 2Y2KA 3TU4A 5AV5A 1P3MD 5FUGB 3LZ0D 4J8VA 4LD9C 3AYWD 4ZUXA 5GXQB 1HTAA 1N1JB 3WA9A 3WKJC 5B24B 5B0ZA 3UTAB 1P34D 2AROD 4H9QB 4XUJD 2IO5C 2DQNC 4YM6B 4X23C 5GT0C 5CP6C 2NQBC 5JA4B 3KXBD 3V9RB 4J8UC 1M1AA 5AY8A 2NZDB 3AL0C 5AVCC 5CPJA 3AZLC 3REHC 5BS7C 1P3FC 3AFAD 1ZLAC 5B40C 3VH6W 3X1SA 3AV2C 4DRAA 1W2EA 3AZIB 3B6GB 1F66D 1TAFA 5GSUA 1F66B 5F99C 5B31G 3MNNC 4LD9B 3NQUB 1BH9B 3UT9D 4WNNA 4WU9D 3MGRA 3TU4D 3WKJB 2Y2OA 3UTBD 5AV5D 1F1EA 4KGCC 4J8VD 2Y2IA 2ZY5A 4J8WC 4H9OB 4ZUXD 1M18A 5B0YC 3WA9D 3REIC 4X23B 5GT0B 5CP6B 5JRGA 3MVDC 5AV8A 2HIOC 3REKC 5CPKA 3WTPD 2RVQD 2BYMB 2F8NG 3WTPB 3B6FA 5AVCB 4YS3D 4H9SA 3AZLB 4YS3B 3REHB 1P3FB 1JFIB 4HGAC 2JSSA 3A6NC 5B32A 5AY8D 4WU8A 1U35A 3AV2B 5DNND 5CPJD 1H3OA 3MNNB 4G91B 5GT3A 3X1SD 1P3BC 4H9PA 5CPIB 1EQZC 4KHAB 3AZMC 1M19D 3W98A 4KGCB 3W97A 5GSUD 1M19B 4J8WB 2YFWA 4R8PC 5B2IA 2JE5A 5B0YB 3VH5T 1Z2CB 1KX4D 3REIB 1KX4B 3MGSA 3H0RC 4Z66A 2HIOB 1P3AC 3NQJB 5AV9D 3KUYA 1M18D 3WAAD 3C1BA 5AV9B 3X1VD 3X1VB 5DNMA 5JRGD 5B2JC 1BH8B 3AZJA 5CPKD 4HGAB 3A6NB 3A1IA 1R4VA 3AZFA 5BT1D 4XZQA 1P3LC 2Y2MA 3O62D 1ULYA 4QLCA 5B32D 1U35D 2Y2JA 5E5AC 1P3BB 5AV6C 1EQZB 5B1LC 5AVBD 2F8NA 3AZMB 5BO0A 4H9RB 2FFFB 2FJ7A 3W99A 3AZED 1P3MC 4R8PB 3LZ0C 4J8XD 3AYWC 5C3IC 4J8XB 3W97D 4NFTA 2L5AA 2ZY4A 3B0CT 3R45A 4CSRB 3F6TA 5B2ID 3AV1D 4Z5TA 2AROC 4XUJC 3LELD 3LELB 4Z66D 3KUYD 3KXBC 3C1BD 5B24A 1P3LB 5B1MD 3AZJD 4NE3A 5B1MB 5KDMB 3AZNA 3AZFD 1P3OA 2BYKA 5E5AB 3VH5A 3AFAC 3RELA 3AZGA 1KX3D 4XZQD 5AV6B 5B1LB 2ZM5A 3W96A 1F66C 3AN2D 1P3IA 1P3MB 2PYOD 3LZ0B 3AYWB 2BG1A 5C3IB 3UT9C 3VH6T 4WU9C 3TU4C 2FJ7D 2Y2PA 4DQYB 5AV5C 3UTBC 1S32A 4J8VC 5B33A 2W8SA 3AZIA 2Y2GA 4ZUXC 2AROB 4XUJB 1P34B 3WA9C 1P3GD 3EPKA 2J8PA 4JJND 3KSYA 3AZHA 1P3GB 4JJNB 3REJD 3KXBB 3REJB 3WKJA 3WTPC 2RVQC 4G92C 4YS3C 1AOIA 4H9OA 1A7WA 1KU5A 1Q9CA 3MGPD 3AFAB 2JCHA 4H9NB 4X23A 5AY8C 3MGPB 1P3PD 5G49B 1P3PB 5DNNC 2NQBA 5CPJC 1HQ3A 1P3OD 4J8UA 3AZGD 4G91C 5CPIC 3UT9B 4UPKA 5BS7A 4CAYA 3TU4B 4WU9B 1ZLAA 1M19C 3UTBB 5AV5B 1P3ID 5GSUC 5B40A 4J8VB 4ZUXB 1BFMA 1KX4C 3WA9B 1KX5A 5B0ZD 5F99A 5BNXA 1ID3A 5AV9C 3WAAC 4WJ3C 3X1VC 3AZHD 3MGQA 4G92B 4J8WA 5JRGC 5CPKC 1M1AD 5AY8B 2ZY2A 3VH6A 5DNNB 5BT1C 3MVDA 1AOID 5CPJB 3REKA 2F8NK 3O62C 2YFVA 5B32C 3X1SB 1P3KA 2UWXA 2Y2QA 1HQ3D 5AVBC 3A6NA 1TAFB 5GSUB 3AZEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  3MGR D;  4WNN B;  4NE6 A;  3MGR B;  4J8X C;  1TZY A;  4WV4 B;  3W97 C;  5B2I C;  1M18 B;  3AV1 C;  3WAA B;  5B31 A;  3X1T A;  1KX5 D;  3LEL C;  4H9R A;  5AV8 D;  5JRG B;  4Z66 C;  1ID3 D;  4R8P A;  5CPK B;  3KUY C;  3B6F D;  3C1B C;  3LZ1 A;  3MGQ D;  3B6F B;  5B1M C;  3C1C A;  3O62 B;  3AZJ C;  1P3A A;  4KUD A;  2CV5 A;  3KWQ A;  4WU8 D;  4E44 A;  5BNV B;  5B32 B;  4WU8 B;  3AZF C;  1KX3 C;  1U35 B;  5B2J A;  4XZQ C;  3X1U A;  5AVB B;  1H3O B;  5GT3 D;  3AZE B;  5GT3 B;  3AN2 C;  1P3K D;  3AZK A;  2PYO C;  4H9P B;  3LJA A;  3W98 D;  3W98 B;  3W97 B;  2FJ7 C;  4UUZ A;  2YFW B;  5B2I B;  3AV1 B;  3MGS D;  1P34 C;  1TZY D;  3MGS B;  1P3G C;  5FUG A;  4Z66 B;  4JJN C;  1P3M A;  4ZBJ C;  5GXQ A;  3KUY B;  1N1J A;  5B31 D;  3REJ C;  3X1T D;  3C1B B;  5DNM D;  3UTA A;  3AZJ B;  3B0B A;  4H9Q A;  4XUJ A;  3LZ1 D;  3AZF B;  3MGP C;  4YM6 A;  1KX3 B;  4XZQ B;  1P3P C;  3C1C D;  5JA4 A;  4KUD D;  3V9R A;  4QLC D;  2CV5 D;  3KWQ D;  4QLC B;  1P3O C;  3AN2 B;  3AZG C;  2NZD A;  2PYO B;  2F8N D;  1B67 A;  3X1U D;  2F8N B;  5BO0 B;  4EO5 C;  3W99 D;  2FJ7 B;  3W99 B;  1P3I C;  3AZK D;  3LJA D;  3B6G A;  4NE5 A;  1F66 A;  5B0Z C;  4LD9 A;  4ZBJ B;  3NQU A;  2HUE C;  1BH9 A;  4Z5T D;  4Z5T B;  3UTB A;  3AZH C;  5GXQ D;  5B24 D;  1M1A C;  5GT0 A;  5B32 G;  5CP6 A;  3UTA D;  3AZN D;  1AOI C;  3REL D;  3AZN B;  2BYM A;  1P3O B;  2BYK B;  4YM6 D;  3WTP A;  3REL B;  3AZG B;  5AVC A;  3X1S C;  1WWI A;  5CHL B;  3AZL A;  4YS3 A;  3REH A;  1P3F A;  1JFI A;  4EO5 B;  3W96 D;  1HQ3 C;  3W96 B;  1P3I B;  2NZD D;  3AV2 A;  5DNN A;  3MGR C;  1S32 D;  5B0Z B;  3MNN A;  1S32 B;  5B33 D;  2HUE B;  4Z2M H;  5B33 B;  3AZI D;  1WWS A;  3B6G D;  5CPI A;  1M18 C;  4KHA A;  3WTP E;  4KGC A;  1M19 A;  1KX5 C;  3AZH B;  4LD9 D;  5AV8 C;  5B0Y A;  1ID3 C;  3WKJ D;  3REI A;  1M1A B;  1KX4 A;  3B6F C;  4H9S C;  3MGQ C;  2HIO A;  1AOI B;  3NQJ A;  4X23 D;  5AV9 A;  4WU8 C;  3WAA A;  2IO5 B;  1U35 C;  3X1V A;  5GT0 D;  5CP6 D;  2NQB D;  1BH8 A;  2NQB B;  4J8U D;  1HQ3 B;  4WZS B;  4J8U B;  5AVC D;  5GT3 C;  3AZL D;  3REH D;  1P3K C;  1P3F D;  1ZLA D;  3O62 A;  4CAY B;  1ZLA B;  3W98 C;  5BNV A;  5B40 D;  3AV2 D;  1P3B A;  5B40 B;  1EQZ A;  3AZM A;  5AVB A;  3MGS C;  5F99 D;  1KX5 B;  3MNN D;  1TZY C;  5F99 B;  5AV8 B;  3AZE A;  1B6W A;  3B0D C;  5BNX B;  5CPI D;  1ID3 B;  4J8X A;  4KGC D;  5B31 C;  3X1T C;  5DNM C;  3MGQ B;  4J8W D;  4CSR A;  5B0Y D;  3REI D;  3AV1 A;  4DRB A;  3LEL A;  3LZ1 C;  3MVD D;  2HIO D;  3REK D;  3MVD B;  3REK B;  3C1C C;  4KUD C;  4QLC C;  2CV5 C;  2YFV B;  3KWQ C;  1P3L A;  1P3K B;  5B1M A;  3A6N D;  5KDM A;  3X1U C;  5E5A A;  3W99 C;  1KX3 A;  5AV6 A;  5B1L A;  3AZK C;  4AWL C;  3LJA C;  1TZY B;  3VH5 W;  1P3B D;  3LZ0 A;  3AN2 A;  3B0D B;  1EQZ D;  2PYO A;  3AYW A;  4Z2M G;  3AZM D;  4Z5T C;  5B31 B;  3X1T B;  5DNM B;  4R8P D;  1P34 A;  2ARO A;  5GXQ C;  3LZ1 B;  5B24 C;  1P3G A;  4JJN A;  1P3A D;  3C1C B;  3UTA C;  4KUD B;  3KXB A;  1P3A B;  2CV5 B;  2F8N H;  3KWQ B;  3REJ A;  3AZN C;  3REL C;  2LY8 A;  5B2J D;  4YM6 C;  5B2J B;  4E45 A;  3X1U B;  3AFA A;  3W96 C;  4H9N A;  3MGP A;  1P3L D;  5G49 A;  2NZD C;  1P3P A;  3AZK B;  4AWL B;  3LJA B;  5E5A D;  2CWE A;  3R45 B;  1S32 C;  5AV6 D;  4UUZ B;  5B1L D;  5B33 C;  3B0C W;  3AZI C;  3UT9 A;  3B6G C;  4WU9 A;  3TU4 A;  5AV5 A;  1P3M D;  5FUG B;  3LZ0 D;  4J8V A;  4LD9 C;  3AYW D;  4ZUX A;  5GXQ B;  1HTA A;  1N1J B;  3WA9 A;  3WKJ C;  5B24 B;  5B0Z A;  3UTA B;  1P34 D;  2ARO D;  4H9Q B;  4XUJ D;  2IO5 C;  4X23 C;  4YM6 B;  5GT0 C;  5CP6 C;  2NQB C;  5JA4 B;  3KXB D;  3V9R B;  4J8U C;  1M1A A;  5AY8 A;  2NZD B;  5AVC C;  5CPJ A;  3AZL C;  3REH C;  5BS7 C;  1P3F C;  3AFA D;  1ZLA C;  5B40 C;  3VH6 W;  3X1S A;  3AV2 C;  4DRA A;  3AZI B;  3B6G B;  1F66 D;  1TAF A;  5GSU A;  1F66 B;  5F99 C;  5B31 G;  3MNN C;  4LD9 B;  3NQU B;  1BH9 B;  3UT9 D;  4WNN A;  4WU9 D;  3MGR A;  3TU4 D;  3WKJ B;  3UTB D;  5AV5 D;  1F1E A;  4KGC C;  4J8V D;  4J8W C;  4H9O B;  4ZUX D;  1M18 A;  5B0Y C;  3WA9 D;  3REI C;  4X23 B;  5GT0 B;  5CP6 B;  5JRG A;  3MVD C;  5AV8 A;  2HIO C;  3REK C;  5CPK A;  3WTP D;  2RVQ D;  2BYM B;  2F8N G;  3WTP B;  3B6F A;  5AVC B;  4YS3 D;  4H9S A;  3AZL B;  4YS3 B;  3REH B;  1P3F B;  1JFI B;  4HGA C;  2JSS A;  3A6N C;  5B32 A;  5AY8 D;  4WU8 A;  1U35 A;  3AV2 B;  5DNN D;  5CPJ D;  1H3O A;  3MNN B;  4G91 B;  5GT3 A;  3X1S D;  1P3B C;  4H9P A;  5CPI B;  1EQZ C;  4KHA B;  3AZM C;  1M19 D;  3W98 A;  4KGC B;  3W97 A;  5GSU D;  1M19 B;  4J8W B;  2YFW A;  4R8P C;  5B2I A;  1KX4 D;  5B0Y B;  3VH5 T;  3REI B;  1KX4 B;  3MGS A;  4Z66 A;  2HIO B;  1P3A C;  3NQJ B;  5AV9 D;  3KUY A;  1M18 D;  3WAA D;  3C1B A;  5AV9 B;  3X1V D;  3X1V B;  5DNM A;  5JRG D;  5B2J C;  1BH8 B;  3AZJ A;  5CPK D;  4HGA B;  3A6N B;  1R4V A;  3AZF A;  5BT1 D;  4XZQ A;  1P3L C;  3O62 D;  1ULY A;  4QLC A;  5B32 D;  1U35 D;  5E5A C;  1P3B B;  5AV6 C;  1EQZ B;  5B1L C;  5AVB D;  2F8N A;  3AZM B;  5BO0 A;  4H9R B;  2FJ7 A;  3W99 A;  3AZE D;  1P3M C;  4R8P B;  3LZ0 C;  4J8X D;  3AYW C;  5C3I C;  4J8X B;  3W97 D;  4NFT A;  2L5A A;  3R45 A;  3B0C T;  4CSR B;  5B2I D;  3AV1 D;  4Z5T A;  2ARO C;  4XUJ C;  3LEL D;  3LEL B;  4Z66 D;  3KUY D;  3KXB C;  3C1B D;  5B24 A;  1P3L B;  5B1M D;  3AZJ D;  4NE3 A;  5B1M B;  5KDM B;  3AZN A;  3AZF D;  1P3O A;  2BYK A;  5E5A B;  3VH5 A;  3AFA C;  3REL A;  3AZG A;  1KX3 D;  4XZQ D;  5AV6 B;  5B1L B;  3W96 A;  1F66 C;  3AN2 D;  1P3I A;  1P3M B;  2PYO D;  3LZ0 B;  3AYW B;  5C3I B;  3UT9 C;  3VH6 T;  4WU9 C;  3TU4 C;  2FJ7 D;  3UTB C;  5AV5 C;  1S32 A;  4J8V C;  5B33 A;  3AZI A;  4ZUX C;  1P34 B;  2ARO B;  4XUJ B;  3WA9 C;  1P3G D;  3AZH A;  4JJN D;  3KSY A;  1P3G B;  4JJN B;  3REJ D;  3KXB B;  3REJ B;  3WKJ A;  3WTP C;  2RVQ C;  4G92 C;  4YS3 C;  1AOI A;  4H9O A;  1A7W A;  1KU5 A;  1Q9C A;  3MGP D;  3AFA B;  4H9N B;  4X23 A;  5AY8 C;  3MGP B;  1P3P D;  5G49 B;  1P3P B;  5DNN C;  2NQB A;  5CPJ C;  1HQ3 A;  1P3O D;  4J8U A;  3AZG D;  4G91 C;  5CPI C;  3UT9 B;  5BS7 A;  4CAY A;  3TU4 B;  4WU9 B;  1ZLA A;  1M19 C;  3UTB B;  5AV5 B;  1P3I D;  5GSU C;  5B40 A;  4J8V B;  4ZUX B;  1BFM A;  1KX4 C;  3WA9 B;  1KX5 A;  5B0Z D;  5F99 A;  5BNX A;  1ID3 A;  5AV9 C;  3WAA C;  3X1V C;  3AZH D;  3MGQ A;  4G92 B;  4J8W A;  5JRG C;  5CPK C;  1M1A D;  5AY8 B;  3VH6 A;  5DNN B;  5BT1 C;  3MVD A;  1AOI D;  5CPJ B;  3REK A;  2F8N K;  3O62 C;  2YFV A;  5B32 C;  3X1S B;  1P3K A;  1HQ3 D;  5AVB C;  3A6N A;  1TAF B;  5GSU B;  3AZE C; 
#chains in the Genus database with same CATH topology
 4M6B A;  3MGR D;  4WNN B;  4NE6 A;  3MGR B;  4J8X C;  1TZY A;  2Y2L A;  4WV4 B;  3W97 C;  5B2I C;  1M18 B;  3AV1 C;  3WAA B;  5B31 A;  3X1T A;  1KX5 D;  3LEL C;  4H9R A;  5AV8 D;  3EPJ A;  5JRG B;  4Z66 C;  1ID3 D;  4R8P A;  2VQR A;  5CPK B;  3KUY C;  3B6F D;  3C1B C;  3LZ1 A;  3MGQ D;  3B6F B;  5B1M C;  3C1C A;  3O62 B;  3AZJ C;  1P3A A;  4KUD A;  2CV5 A;  3KWQ A;  4WU8 D;  4E44 A;  5BNV B;  5B32 B;  4WU8 B;  3AZF C;  1KX3 C;  1U35 B;  5B2J A;  4XZQ C;  3X1U A;  1T3U A;  1H3O B;  5AVB B;  5GT3 D;  3AZE B;  5GT3 B;  3AN2 C;  1P3K D;  3AZK A;  2PYO C;  4H9P B;  3LJA A;  3W98 D;  3W98 B;  3W97 B;  2FJ7 C;  3IP4 C;  4UUZ A;  2YFW B;  5B2I B;  3AV1 B;  3MGS D;  1P34 C;  1TZY D;  3MGS B;  3H0M C;  1P3G C;  5FUG A;  4Z66 B;  4JJN C;  1P3M A;  4ZBJ C;  5GXQ A;  3KUY B;  1N1J A;  5B31 D;  3REJ C;  3X1T D;  3C1B B;  2G5H C;  2RIQ A;  2ZY3 A;  5DNM D;  3UTA A;  3AZJ B;  3B0B A;  4H9Q A;  4XUJ A;  3LZ1 D;  3AZF B;  3MGP C;  4YM6 A;  1KX3 B;  4XZQ B;  1P3P C;  3C1C D;  5JA4 A;  4KUD D;  3V9R A;  4QLC D;  2CV5 D;  3KWQ D;  4QLC B;  1P3O C;  3AN2 B;  3AZG C;  2NZD A;  2PYO B;  2F8N D;  1B67 A;  3X1U D;  2F8N B;  5BO0 B;  4EO5 C;  3W99 D;  2FJ7 B;  3W99 B;  2XD5 A;  1P3I C;  3AZK D;  2Y2H A;  3LJA D;  3B6G A;  4NE5 A;  1F66 A;  5B0Z C;  4LD9 A;  4ZBJ B;  3NQU A;  2HUE C;  1BH9 A;  4Z5T D;  4Z5T B;  3UTB A;  3AZH C;  5GXQ D;  5B24 D;  1M1A C;  5GT0 A;  5B32 G;  5CP6 A;  3UTA D;  3EPH A;  3AZN D;  1AOI C;  3REL D;  3AZN B;  2BYM A;  1P3O B;  2BYK B;  4YM6 D;  3WTP A;  3REL B;  3AZG B;  5AVC A;  3X1S C;  1WWI A;  3P5J B;  5CHL B;  3AZL A;  4YS3 A;  3REH A;  1P3F A;  1JFI A;  4EO5 B;  3W96 D;  1HQ3 C;  3W96 B;  1P3I B;  2NZD D;  3AV2 A;  5DNN A;  3MGR C;  1S32 D;  5B0Z B;  3MNN A;  1S32 B;  5B33 D;  2HUE B;  4Z2M H;  5B33 B;  3AZI D;  1WWS A;  3B6G D;  5CPI A;  1M18 C;  4KHA A;  3WTP E;  4KGC A;  1M19 A;  1KX5 C;  3AZH B;  2F2A C;  4LD9 D;  5AV8 C;  5B0Y A;  1ID3 C;  3WKJ D;  3REI A;  1M1A B;  1KX4 A;  3B6F C;  4H9S C;  3MGQ C;  2HIO A;  1AOI B;  3NQJ A;  4X23 D;  5AV9 A;  4WU8 C;  3WAA A;  2IO5 B;  1U35 C;  3X1V A;  5GT0 D;  1PZR A;  5CP6 D;  2NQB D;  1BH8 A;  2NQB B;  4J8U D;  1HQ3 B;  4WZS B;  4J8U B;  5AVC D;  5GT3 C;  3AZL D;  2Y2N A;  3REH D;  1P3K C;  1P3F D;  1ZLA D;  3O62 A;  4CAY B;  1ZLA B;  3W98 C;  5BNV A;  5B40 D;  3AV2 D;  1P3B A;  5B40 B;  3FDD A;  1EQZ A;  3AZM A;  5AVB A;  3MGS C;  5F99 D;  1KX5 B;  3MNN D;  1TZY C;  5F99 B;  5AV8 B;  3AZE A;  1B6W A;  3B0D C;  5BNX B;  5CPI D;  1ID3 B;  4J8X A;  4KGC D;  5B31 C;  3X1T C;  5DNM C;  3H0L C;  3MGQ B;  4J8W D;  4CSR A;  5B0Y D;  3REI D;  3AV1 A;  4DRB A;  3LEL A;  3LZ1 C;  3MVD D;  2HIO D;  3REK D;  3MVD B;  3REK B;  3C1C C;  4KUD C;  4QLC C;  2CV5 C;  2YFV B;  3KWQ C;  1P3L A;  1P3K B;  5B1M A;  2G5I C;  3A6N D;  5KDM A;  3X1U C;  5E5A A;  3W99 C;  1KX3 A;  2XD1 A;  5AV6 A;  5B1L A;  3AZK C;  4AWL C;  3LJA C;  1TZY B;  3VH5 W;  1P3B D;  3EG5 B;  3LZ0 A;  3AN2 A;  3B0D B;  1EQZ D;  2PYO A;  3AYW A;  4Z2M G;  3AZM D;  4Z5T C;  5B31 B;  3X1T B;  5DNM B;  3A1K A;  4R8P D;  3EPL A;  1P34 A;  2ARO A;  5GXQ C;  3LZ1 B;  5B24 C;  1P3G A;  4JJN A;  1P3A D;  3C1C B;  3UTA C;  4KUD B;  3KXB A;  1P3A B;  2CV5 B;  2F8N H;  3KWQ B;  3REJ A;  3AZN C;  3REL C;  2LY8 A;  5B2J D;  4YM6 C;  5B2J B;  4E45 A;  3X1U B;  3AFA A;  3W96 C;  4H9N A;  3MGP A;  1P3L D;  5G49 A;  2NZD C;  1P3P A;  3AZK B;  3KFU G;  4AWL B;  3LJA B;  5E5A D;  2CWE A;  3R45 B;  1S32 C;  2DF4 C;  5AV6 D;  4UUZ B;  5B1L D;  5B33 C;  3B0C W;  3AZI C;  3UT9 A;  3B6G C;  4WU9 A;  2Y2K A;  3TU4 A;  5AV5 A;  1P3M D;  5FUG B;  3LZ0 D;  4J8V A;  4LD9 C;  3AYW D;  4ZUX A;  5GXQ B;  1HTA A;  1N1J B;  3WA9 A;  3WKJ C;  5B24 B;  5B0Z A;  3UTA B;  1P34 D;  2ARO D;  4H9Q B;  4XUJ D;  2IO5 C;  2DQN C;  4YM6 B;  4X23 C;  5GT0 C;  5CP6 C;  2NQB C;  5JA4 B;  3KXB D;  3V9R B;  4J8U C;  1M1A A;  5AY8 A;  2NZD B;  3AL0 C;  5AVC C;  5CPJ A;  3AZL C;  3REH C;  5BS7 C;  1P3F C;  3AFA D;  1ZLA C;  5B40 C;  3VH6 W;  3X1S A;  3AV2 C;  4DRA A;  1W2E A;  3AZI B;  3B6G B;  1F66 D;  1TAF A;  5GSU A;  1F66 B;  5F99 C;  5B31 G;  3MNN C;  4LD9 B;  3NQU B;  1BH9 B;  3UT9 D;  4WNN A;  4WU9 D;  3MGR A;  3TU4 D;  3WKJ B;  2Y2O A;  3UTB D;  5AV5 D;  1F1E A;  4KGC C;  4J8V D;  2Y2I A;  2ZY5 A;  4J8W C;  4H9O B;  4ZUX D;  1M18 A;  5B0Y C;  3WA9 D;  3REI C;  4X23 B;  5GT0 B;  5CP6 B;  5JRG A;  3MVD C;  5AV8 A;  2HIO C;  3REK C;  5CPK A;  3WTP D;  2RVQ D;  2BYM B;  2F8N G;  3WTP B;  3B6F A;  5AVC B;  4YS3 D;  4H9S A;  3AZL B;  4YS3 B;  3REH B;  1P3F B;  1JFI B;  4HGA C;  2JSS A;  3A6N C;  5B32 A;  5AY8 D;  4WU8 A;  1U35 A;  3AV2 B;  5DNN D;  5CPJ D;  1H3O A;  3MNN B;  4G91 B;  5GT3 A;  3X1S D;  1P3B C;  4H9P A;  5CPI B;  1EQZ C;  4KHA B;  3AZM C;  1M19 D;  3W98 A;  4KGC B;  3W97 A;  5GSU D;  1M19 B;  4J8W B;  2YFW A;  4R8P C;  5B2I A;  2JE5 A;  5B0Y B;  3VH5 T;  1Z2C B;  1KX4 D;  3REI B;  1KX4 B;  3MGS A;  3H0R C;  4Z66 A;  2HIO B;  1P3A C;  3NQJ B;  5AV9 D;  3KUY A;  1M18 D;  3WAA D;  3C1B A;  5AV9 B;  3X1V D;  3X1V B;  5DNM A;  5JRG D;  5B2J C;  1BH8 B;  3AZJ A;  5CPK D;  4HGA B;  3A6N B;  3A1I A;  1R4V A;  3AZF A;  5BT1 D;  4XZQ A;  1P3L C;  2Y2M A;  3O62 D;  1ULY A;  4QLC A;  5B32 D;  1U35 D;  2Y2J A;  5E5A C;  1P3B B;  5AV6 C;  1EQZ B;  5B1L C;  5AVB D;  2F8N A;  3AZM B;  5BO0 A;  4H9R B;  2FFF B;  2FJ7 A;  3W99 A;  3AZE D;  1P3M C;  4R8P B;  3LZ0 C;  4J8X D;  3AYW C;  5C3I C;  4J8X B;  3W97 D;  4NFT A;  2L5A A;  2ZY4 A;  3B0C T;  3R45 A;  4CSR B;  3F6T A;  5B2I D;  3AV1 D;  4Z5T A;  2ARO C;  4XUJ C;  3LEL D;  3LEL B;  4Z66 D;  3KUY D;  3KXB C;  3C1B D;  5B24 A;  1P3L B;  5B1M D;  3AZJ D;  4NE3 A;  5B1M B;  5KDM B;  3AZN A;  3AZF D;  1P3O A;  2BYK A;  5E5A B;  3VH5 A;  3AFA C;  3REL A;  3AZG A;  1KX3 D;  4XZQ D;  5AV6 B;  5B1L B;  2ZM5 A;  3W96 A;  1F66 C;  3AN2 D;  1P3I A;  1P3M B;  2PYO D;  3LZ0 B;  3AYW B;  2BG1 A;  5C3I B;  3UT9 C;  3VH6 T;  4WU9 C;  3TU4 C;  2FJ7 D;  2Y2P A;  4DQY B;  5AV5 C;  3UTB C;  1S32 A;  4J8V C;  5B33 A;  2W8S A;  3AZI A;  2Y2G A;  4ZUX C;  2ARO B;  4XUJ B;  1P34 B;  3WA9 C;  1P3G D;  3EPK A;  2J8P A;  4JJN D;  3KSY A;  3AZH A;  1P3G B;  4JJN B;  3REJ D;  3KXB B;  3REJ B;  3WKJ A;  3WTP C;  2RVQ C;  4G92 C;  4YS3 C;  1AOI A;  4H9O A;  1A7W A;  1KU5 A;  1Q9C A;  3MGP D;  3AFA B;  2JCH A;  4H9N B;  4X23 A;  5AY8 C;  3MGP B;  1P3P D;  5G49 B;  1P3P B;  5DNN C;  2NQB A;  5CPJ C;  1HQ3 A;  1P3O D;  4J8U A;  3AZG D;  4G91 C;  5CPI C;  3UT9 B;  4UPK A;  5BS7 A;  4CAY A;  3TU4 B;  4WU9 B;  1ZLA A;  1M19 C;  3UTB B;  5AV5 B;  1P3I D;  5GSU C;  5B40 A;  4J8V B;  4ZUX B;  1BFM A;  1KX4 C;  3WA9 B;  1KX5 A;  5B0Z D;  5F99 A;  5BNX A;  1ID3 A;  5AV9 C;  3WAA C;  4WJ3 C;  3X1V C;  3AZH D;  3MGQ A;  4G92 B;  4J8W A;  5JRG C;  5CPK C;  1M1A D;  5AY8 B;  2ZY2 A;  3VH6 A;  5DNN B;  5BT1 C;  3MVD A;  1AOI D;  5CPJ B;  3REK A;  2F8N K;  3O62 C;  2YFV A;  5B32 C;  3X1S B;  1P3K A;  2UWX A;  2Y2Q A;  1HQ3 D;  5AVB C;  3A6N A;  1TAF B;  5GSU B;  3AZE C; 
#chains in the Genus database with same CATH homology
 4M6B A;  3MGR D;  4WNN B;  4NE6 A;  3MGR B;  4J8X C;  1TZY A;  2Y2L A;  4WV4 B;  3W97 C;  5B2I C;  1M18 B;  3AV1 C;  3WAA B;  5B31 A;  3X1T A;  1KX5 D;  3LEL C;  4H9R A;  5AV8 D;  3EPJ A;  5JRG B;  4Z66 C;  1ID3 D;  4R8P A;  2VQR A;  5CPK B;  3KUY C;  3B6F D;  3C1B C;  3LZ1 A;  3MGQ D;  3B6F B;  5B1M C;  3C1C A;  3O62 B;  3AZJ C;  1P3A A;  4KUD A;  2CV5 A;  3KWQ A;  4WU8 D;  4E44 A;  5BNV B;  5B32 B;  4WU8 B;  3AZF C;  1KX3 C;  1U35 B;  5B2J A;  4XZQ C;  3X1U A;  1T3U A;  1H3O B;  5AVB B;  5GT3 D;  3AZE B;  5GT3 B;  3AN2 C;  1P3K D;  3AZK A;  2PYO C;  4H9P B;  3LJA A;  3W98 D;  3W98 B;  3W97 B;  2FJ7 C;  3IP4 C;  4UUZ A;  2YFW B;  5B2I B;  3AV1 B;  3MGS D;  1P34 C;  1TZY D;  3MGS B;  3H0M C;  1P3G C;  5FUG A;  4Z66 B;  4JJN C;  1P3M A;  4ZBJ C;  5GXQ A;  3KUY B;  1N1J A;  5B31 D;  3REJ C;  3X1T D;  3C1B B;  2G5H C;  2RIQ A;  2ZY3 A;  5DNM D;  3UTA A;  3AZJ B;  3B0B A;  4H9Q A;  4XUJ A;  3LZ1 D;  3AZF B;  3MGP C;  4YM6 A;  1KX3 B;  4XZQ B;  1P3P C;  3C1C D;  5JA4 A;  4KUD D;  3V9R A;  4QLC D;  2CV5 D;  3KWQ D;  4QLC B;  1P3O C;  3AN2 B;  3AZG C;  2NZD A;  2PYO B;  2F8N D;  1B67 A;  3X1U D;  2F8N B;  5BO0 B;  4EO5 C;  3W99 D;  2FJ7 B;  3W99 B;  2XD5 A;  1P3I C;  3AZK D;  2Y2H A;  3LJA D;  3B6G A;  4NE5 A;  1F66 A;  5B0Z C;  4LD9 A;  4ZBJ B;  3NQU A;  2HUE C;  1BH9 A;  4Z5T D;  4Z5T B;  3UTB A;  3AZH C;  5GXQ D;  5B24 D;  1M1A C;  5GT0 A;  5B32 G;  5CP6 A;  3UTA D;  3EPH A;  3AZN D;  1AOI C;  3REL D;  3AZN B;  2BYM A;  1P3O B;  2BYK B;  4YM6 D;  3WTP A;  3REL B;  3AZG B;  5AVC A;  3X1S C;  1WWI A;  3P5J B;  5CHL B;  3AZL A;  4YS3 A;  3REH A;  1P3F A;  1JFI A;  4EO5 B;  3W96 D;  1HQ3 C;  3W96 B;  1P3I B;  2NZD D;  3AV2 A;  5DNN A;  3MGR C;  1S32 D;  5B0Z B;  3MNN A;  1S32 B;  5B33 D;  2HUE B;  4Z2M H;  5B33 B;  3AZI D;  1WWS A;  3B6G D;  5CPI A;  1M18 C;  4KHA A;  3WTP E;  4KGC A;  1M19 A;  1KX5 C;  3AZH B;  2F2A C;  4LD9 D;  5AV8 C;  5B0Y A;  1ID3 C;  3WKJ D;  3REI A;  1M1A B;  1KX4 A;  3B6F C;  4H9S C;  3MGQ C;  2HIO A;  1AOI B;  3NQJ A;  4X23 D;  5AV9 A;  4WU8 C;  3WAA A;  2IO5 B;  1U35 C;  3X1V A;  5GT0 D;  1PZR A;  5CP6 D;  2NQB D;  1BH8 A;  2NQB B;  4J8U D;  1HQ3 B;  4WZS B;  4J8U B;  5AVC D;  5GT3 C;  3AZL D;  2Y2N A;  3REH D;  1P3K C;  1P3F D;  1ZLA D;  3O62 A;  4CAY B;  1ZLA B;  3W98 C;  5BNV A;  5B40 D;  3AV2 D;  1P3B A;  5B40 B;  3FDD A;  1EQZ A;  3AZM A;  5AVB A;  3MGS C;  5F99 D;  1KX5 B;  3MNN D;  1TZY C;  5F99 B;  5AV8 B;  3AZE A;  1B6W A;  3B0D C;  5BNX B;  5CPI D;  1ID3 B;  4J8X A;  4KGC D;  5B31 C;  3X1T C;  5DNM C;  3H0L C;  3MGQ B;  4J8W D;  4CSR A;  5B0Y D;  3REI D;  3AV1 A;  4DRB A;  3LEL A;  3LZ1 C;  3MVD D;  2HIO D;  3REK D;  3MVD B;  3REK B;  3C1C C;  4KUD C;  4QLC C;  2CV5 C;  2YFV B;  3KWQ C;  1P3L A;  1P3K B;  5B1M A;  2G5I C;  3A6N D;  5KDM A;  3X1U C;  5E5A A;  3W99 C;  1KX3 A;  2XD1 A;  5AV6 A;  5B1L A;  3AZK C;  4AWL C;  3LJA C;  1TZY B;  3VH5 W;  1P3B D;  3EG5 B;  3LZ0 A;  3AN2 A;  3B0D B;  1EQZ D;  2PYO A;  3AYW A;  4Z2M G;  3AZM D;  4Z5T C;  5B31 B;  3X1T B;  5DNM B;  3A1K A;  4R8P D;  3EPL A;  1P34 A;  2ARO A;  5GXQ C;  3LZ1 B;  5B24 C;  1P3G A;  4JJN A;  1P3A D;  3C1C B;  3UTA C;  4KUD B;  3KXB A;  1P3A B;  2CV5 B;  2F8N H;  3KWQ B;  3REJ A;  3AZN C;  3REL C;  2LY8 A;  5B2J D;  4YM6 C;  5B2J B;  4E45 A;  3X1U B;  3AFA A;  3W96 C;  4H9N A;  3MGP A;  1P3L D;  5G49 A;  2NZD C;  1P3P A;  3AZK B;  3KFU G;  4AWL B;  3LJA B;  5E5A D;  2CWE A;  3R45 B;  1S32 C;  2DF4 C;  5AV6 D;  4UUZ B;  5B1L D;  5B33 C;  3B0C W;  3AZI C;  3UT9 A;  3B6G C;  4WU9 A;  2Y2K A;  3TU4 A;  5AV5 A;  1P3M D;  5FUG B;  3LZ0 D;  4J8V A;  4LD9 C;  3AYW D;  4ZUX A;  5GXQ B;  1HTA A;  1N1J B;  3WA9 A;  3WKJ C;  5B24 B;  5B0Z A;  3UTA B;  1P34 D;  2ARO D;  4H9Q B;  4XUJ D;  2IO5 C;  2DQN C;  4YM6 B;  4X23 C;  5GT0 C;  5CP6 C;  2NQB C;  5JA4 B;  3KXB D;  3V9R B;  4J8U C;  1M1A A;  5AY8 A;  2NZD B;  3AL0 C;  5AVC C;  5CPJ A;  3AZL C;  3REH C;  5BS7 C;  1P3F C;  3AFA D;  1ZLA C;  5B40 C;  3VH6 W;  3X1S A;  3AV2 C;  4DRA A;  1W2E A;  3AZI B;  3B6G B;  1F66 D;  1TAF A;  5GSU A;  1F66 B;  5F99 C;  5B31 G;  3MNN C;  4LD9 B;  3NQU B;  1BH9 B;  3UT9 D;  4WNN A;  4WU9 D;  3MGR A;  3TU4 D;  3WKJ B;  2Y2O A;  3UTB D;  5AV5 D;  1F1E A;  4KGC C;  4J8V D;  2Y2I A;  2ZY5 A;  4J8W C;  4H9O B;  4ZUX D;  1M18 A;  5B0Y C;  3WA9 D;  3REI C;  4X23 B;  5GT0 B;  5CP6 B;  5JRG A;  3MVD C;  5AV8 A;  2HIO C;  3REK C;  5CPK A;  3WTP D;  2RVQ D;  2BYM B;  2F8N G;  3WTP B;  3B6F A;  5AVC B;  4YS3 D;  4H9S A;  3AZL B;  4YS3 B;  3REH B;  1P3F B;  1JFI B;  4HGA C;  2JSS A;  3A6N C;  5B32 A;  5AY8 D;  4WU8 A;  1U35 A;  3AV2 B;  5DNN D;  5CPJ D;  1H3O A;  3MNN B;  4G91 B;  5GT3 A;  3X1S D;  1P3B C;  4H9P A;  5CPI B;  1EQZ C;  4KHA B;  3AZM C;  1M19 D;  3W98 A;  4KGC B;  3W97 A;  5GSU D;  1M19 B;  4J8W B;  2YFW A;  4R8P C;  5B2I A;  2JE5 A;  5B0Y B;  3VH5 T;  1Z2C B;  1KX4 D;  3REI B;  1KX4 B;  3MGS A;  3H0R C;  4Z66 A;  2HIO B;  1P3A C;  3NQJ B;  5AV9 D;  3KUY A;  1M18 D;  3WAA D;  3C1B A;  5AV9 B;  3X1V D;  3X1V B;  5DNM A;  5JRG D;  5B2J C;  1BH8 B;  3AZJ A;  5CPK D;  4HGA B;  3A6N B;  3A1I A;  1R4V A;  3AZF A;  5BT1 D;  4XZQ A;  1P3L C;  2Y2M A;  3O62 D;  1ULY A;  4QLC A;  5B32 D;  1U35 D;  2Y2J A;  5E5A C;  1P3B B;  5AV6 C;  1EQZ B;  5B1L C;  5AVB D;  2F8N A;  3AZM B;  5BO0 A;  4H9R B;  2FFF B;  2FJ7 A;  3W99 A;  3AZE D;  1P3M C;  4R8P B;  3LZ0 C;  4J8X D;  3AYW C;  5C3I C;  4J8X B;  3W97 D;  4NFT A;  2L5A A;  2ZY4 A;  3B0C T;  3R45 A;  4CSR B;  3F6T A;  5B2I D;  3AV1 D;  4Z5T A;  2ARO C;  4XUJ C;  3LEL D;  3LEL B;  4Z66 D;  3KUY D;  3KXB C;  3C1B D;  5B24 A;  1P3L B;  5B1M D;  3AZJ D;  4NE3 A;  5B1M B;  5KDM B;  3AZN A;  3AZF D;  1P3O A;  2BYK A;  5E5A B;  3VH5 A;  3AFA C;  3REL A;  3AZG A;  1KX3 D;  4XZQ D;  5AV6 B;  5B1L B;  2ZM5 A;  3W96 A;  1F66 C;  3AN2 D;  1P3I A;  1P3M B;  2PYO D;  3LZ0 B;  3AYW B;  2BG1 A;  5C3I B;  3UT9 C;  3VH6 T;  4WU9 C;  3TU4 C;  2FJ7 D;  2Y2P A;  4DQY B;  5AV5 C;  3UTB C;  1S32 A;  4J8V C;  5B33 A;  2W8S A;  3AZI A;  2Y2G A;  4ZUX C;  2ARO B;  4XUJ B;  1P34 B;  3WA9 C;  1P3G D;  3EPK A;  2J8P A;  4JJN D;  3KSY A;  3AZH A;  1P3G B;  4JJN B;  3REJ D;  3KXB B;  3REJ B;  3WKJ A;  3WTP C;  2RVQ C;  4G92 C;  4YS3 C;  1AOI A;  4H9O A;  1A7W A;  1KU5 A;  1Q9C A;  3MGP D;  3AFA B;  2JCH A;  4H9N B;  4X23 A;  5AY8 C;  3MGP B;  1P3P D;  5G49 B;  1P3P B;  5DNN C;  2NQB A;  5CPJ C;  1HQ3 A;  1P3O D;  4J8U A;  3AZG D;  4G91 C;  5CPI C;  3UT9 B;  4UPK A;  5BS7 A;  4CAY A;  3TU4 B;  4WU9 B;  1ZLA A;  1M19 C;  3UTB B;  5AV5 B;  1P3I D;  5GSU C;  5B40 A;  4J8V B;  4ZUX B;  1BFM A;  1KX4 C;  3WA9 B;  1KX5 A;  5B0Z D;  5F99 A;  5BNX A;  1ID3 A;  5AV9 C;  3WAA C;  4WJ3 C;  3X1V C;  3AZH D;  3MGQ A;  4G92 B;  4J8W A;  5JRG C;  5CPK C;  1M1A D;  5AY8 B;  2ZY2 A;  3VH6 A;  5DNN B;  5BT1 C;  3MVD A;  1AOI D;  5CPJ B;  3REK A;  2F8N K;  3O62 C;  2YFV A;  5B32 C;  3X1S B;  1P3K A;  2UWX A;  2Y2Q A;  1HQ3 D;  5AVB C;  3A6N A;  1TAF B;  5GSU B;  3AZE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...