1P3FB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKCISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fB00
5GT0B 1TZYB 3AFAC 2NQBA 2YFVB 2IO5C 5B0YC 1KX4B 5AV5D 3KWQB 5BO0A 5GT0C 4KGCB 1TZYC 3AZGA 4WU9C 3W96D 3UT9B 5BS7A 3KWQC 4KGCC 3AN2D 5B33D 4ZBJB 3AZJB 3MGRD 3UT9C 1P3BA 4X23B 4H9SC 3B6FB 5AV6C 5CP6C 3AZJC 4ZBJC 4WNNA 4J8UA 4X23C 2NZDB 3AZEC 5F99A 3B6FC 2F8ND 3AZIB 5BT1C 4JJND 1AOIB 4H9PB 1ID3B 1U35B 5B32A 2HIOD 1M1AB 3B0BA 3AZIC 3X1TB 1HQ3B 5B2IB 1P3GA 3A6ND 1AOIC 4J8VB 1S32A 1ID3C 3WTPA 5AV9B 3TU4A 3WAAD 1M1AC 3X1TC 5B2IC 3REJC 5AV9C 5BNXA 1P34B 2AROB 1P3OB 3REKD 3R45A 2PYOD 1P3OC 5CPJA 5AVBA 4ZUXB 1P3MC 1M19A 3NQJB 4WZSB 2L5AA 1F66B 4CAYB 3MGQB 3LJAD 5B40A 3B6GA 5GXQC 1P3KA 3VH5W 3W99A 3AZFD 4WU8C 1KX4D 3UTAD 4H9OA 3C1BC 4HGAB 3AV1D 2NQBB 5AV8B 3KXBC 4E45A 5B31G 3LELA 5JRGD 5BO0B 4NFTA 3AZMA 4YS3D 2BYKA 3VH6A 3KUYA 4LD9B 5AV8C 1R4VA 1P3LB 4AWLB 1ZLAC 5B0ZA 3W97D 3B0CW 3AYWD 4Z5TA 4LD9C 5DNNA 5AV5B 1P3LC 4AWLC 2NZDD 4KUDA 1KX3D 3B0DB 5FUGA 2FJ7A 1BH8B 3WA9D 5AV5C 3B0DC 1U35D 3AN2B 1M18A 3W96C 5B33B 5GSUA 4R8PA 3O62D 4J8VD 3REID 5B32B 3AN2C 1P3GB 5B33C 1H3OA 3MGRC 4Z66A 5GT3A 2CV5A 3WTPB 3TU4B 2F8NB 1P34D 3WTPE 2AROD 3WKJD 3C1CD 3W98D 4JJNB 5B2JA 5BNXB 2HIOB 2YFWA 3AZND 4JJNC 4ZUXD 3AZLA 3R45B 1F66D 5DNMD 3WAAB 3AV2A 2HIOC 3MGQD 3A6NC 3X1UA 1M19B 3WAAC 5KDMA 1KX5D 1HTAA 4J8WA 1P3ID 5B40B 3LZ0A 3REKB 2CWEA 4XZQA 5DNMA 3AZKA 2NQBD 2PYOB 5AVCA 3REKC 2BYMA 3AZGD 2PYOC 3RELA 3LJAB 3AZMB 3MNNA 3AZFB 1TAFA 1P3BD 3LJAC 5B24A 5C3IB 5G49B 3UTAB 3AZFC 1BFMA 3AV1B 1KX4C 4J8UD 4QLCA 4KUDB 5F99D 5JRGB 5AY8A 3UTAC 4YS3B 1WWSA 3AV1C 2FJ7B 5CPKA 4NE5A 5JRGC 4YS3C 5B32D 3W97B 3AYWB 1P3GD 1P3PA 1S32D 3WTPD 3TU4D 1KX3B 3W97C 3AYWC 3MGSA 1P3FA 4Z66B 3WA9B 3UTBA 3REHA 2NZDC 1KX3C 3VH6T 4EO5B 3WA9C 5B2JB 4H9NA 3O62B 4H9QA 3REIB 4G91B 1U35C 4XUJA 1HQ3C 4EO5C 5CPJD 5AVBD 1EQZA 3O62C 4J8VC 1M19D 3REIC 3WKJB 5B40D 3C1CB 3B6GD 3W98B 1P3KD 3W99D 5KDMB 1B67A 4J8WB 1P34C 3WKJC 2AROC 5E5AA 3C1CC 1P3AA 3AZNB 3W98C 5B1MA 5DNMB 4UUZB 1JFIB 3LELD 3AZNC 4ZUXC 3AZMD 5B32G 4CSRA 3KUYD 1F66C 1KX5B 4KHAA 3MGQC 5CPIA 3RELB 5B1LA 1P3IB 5B31A 4H9RB 5B0ZD 3MNNB 3MGPA 1KX5C 4Z5TD 2F8NG 5DNND 1P3IC 4KUDD 3AZHD 4HGAC 3AZGB 2FJ7D 2NQBC 3MVDA 3LZ1A 5JA4A 1M18D 3AZGC 5CPKB 5GSUD 1P3BB 4R8PD 5BS7C 4YM6A 3AZHA 1N1JA 1P3BC 4WNNB 4Z66D 5GT3D 4J8UB 2CV5D 3X1VA 5F99B 1BH9A 3MGSB 4J8XA 5BNVA 3X1SD 3AFAA 4J8UC 3REHB 5B0YA 5B2JD 5F99C 5GT0A 5CP6D 1TZYA 4WU9A 3AZLD 1S32B 3KWQA 5B32C 4XUJB 3AV2D 4KGCA 1P3GC 2HUEB 3X1SA 3X1UD 3UT9A 1S32C 3WTPC 3TU4C 4Z2MG 4H9SA 5AV6A 5CP6A 4J8WD 3AZJA 3LZ0D 4DRBA 4X23A 3AZEA 3AZKD 4XZQD 3B6FA 5E5AB 5CPJB 5AVCD 5AVBB 3REJD 5B1MB 3AZIA 5CPJC 5AVBC 3RELD 3B6GB 1AOIA 1M19C 4H9PA 4CSRB 1P3KB 3MNND 1ID3A 3W99B 5CPIB 2LY8A 1M1AA 3X1TA 5B24D 5B40C 3B6GC 1P3KC 3REJA 3W99C 3MGPB 4H9OB 5AV9A 4QLCD 3LELB 5GXQD 5AY8D 2BYKB 3KUYB 5CPKD 1WWIA 4WU8D 3MVDB 3LELC 1P3OA 3LZ1B 3AZMC 5JA4B 5CHLB 1P3MA 5B0ZB 3KUYC 4Z5TB 5DNNB 1P3PD 5GXQA 5B0ZC 3AZHB 5FUGB 1N1JB 5C3IC 3NQJA 4Z5TC 3MGSD 4CAYA 1P3FD 5DNNC 4WU8A 3UTBD 3REHD 4G92B 4KUDC 3VH5T 3C1BA 1M18B 2FJ7C 5GSUB 4R8PB 3KXBA 4G92C 1KU5A 4XUJD 1M18C 4WU9B 1H3OB 5GSUC 5AV8A 4R8PC 1EQZD 4E44A 5GT3B 2CV5B 2RVQD 1ZLAA 4LD9A 3X1SB 4Z66C 5GT3C 2CV5C 1P3LA 5AV6B 5CP6B 2YFWB 3B0CT 5E5AD 3X1SC 1P3AD 5B2JC 1Q9CA 3AZLB 5B1MD 5AV5A 3AZEB 4G91C 3AV2B 4DRAA 3W96A 1BH8A 3X1UB 3AZLC 3AV2C 5CPID 3AN2A 5B1LD 1B6WA 5B33A 3LZ0B 5B31D 3X1UC 3KSYA 4NE3A 3MGRA 3MGPD 3AZKB 4XZQB 4J8WC 3LZ0C 5AVCB 2F8NH 3REJB 2BYMB 3AZKC 4XZQC 5DNMC 3VH5A 2F8NA 3V9RA 3MVDD 5AVCC 2JSSA 4NE6A 3LZ1D 4JJNA 1TAFB 2HIOA 4M6BA 3RELC 5B24B 4YM6D 1A7WA 3A6NA 1P3MB 3MNNC 3WAAA 5B24C 4QLCB 3X1VD 5GXQB 5AY8B 4J8XD 3AFAD 4WU8B 5B0YD 4QLCC 5AY8C 3REKA 5GT0D 3C1BB 1TZYD 5CPKC 3NQUA 4WU9D 3KXBB 2PYOA 1P3PB 3KWQD 4KGCD 1ULYA 1P3FB 3UT9D 1P3PC 3UTBB 3VH6W 3LJAA 1ZLAB 3MGSC 5AV6D 3AZFA 3AZJD 1P3FC 3UTBC 2YFVA 4H9NB 4Z2MH 4X23D 4H9QB 3REHC 3AZED 1KX4A 3B6FD 5G49A 3UTAA 3AV1A 5BT1D 1EQZB 2F8NK 5JRGA 4XUJC 4YS3A 3AZID 3W96B 1EQZC 2HUEC 1AOID 1ID3D 2RVQC 3W97A 1M1AD 3AYWA 3X1TD 1HQ3D 5B2ID 3MGRB 1P3AB 2NZDA 5AV9D 1KX3A 5E5AC 1P3AC 3WA9A 5B1MC 1U35A 4KHAB 3V9RB 5B1LB 1P3OD 1HQ3A 5B2IA 5B31B 3O62A 4J8VA 1P3MD 3REIA 5CPIC 5B1LC 3A6NB 5B31C 3MGPC 1P34A 3WKJA 2AROA 3C1CA 3W98A 3C1BD 3KXBD 3MVDC 4YM6B 3LZ1C 4ZUXA 3AZNA 4WV4B 1F66A 3NQUB 4UUZA 5AV8D 1JFIA 3MGQA 3X1VB 4YM6C 1BH9B 1ZLAD 3AZHC 1F1EA 4J8XB 5BNVB 1KX5A 4LD9D 3AFAB 2IO5B 5B0YB 3X1VC 1P3IA 1P3LD 4H9RA 4J8XC
chains in the Genus database with same CATH superfamily
3H0LC 5GT0B 1TZYB 3AFAC 2NQBA 2YFVB 2IO5C 5B0YC 1KX4B 3KFUG 5AV5D 3KWQB 5BO0A 5GT0C 4KGCB 1TZYC 3AZGA 4WU9C 3W96D 3UT9B 5BS7A 3KWQC 2UWXA 4KGCC 3AN2D 5B33D 4ZBJB 3AZJB 3MGRD 3UT9C 1P3BA 4X23B 4H9SC 3B6FB 5AV6C 5CP6C 3AZJC 4ZBJC 4WNNA 4J8UA 4X23C 2NZDB 3AZEC 5F99A 3F6TA 3B6FC 2F8ND 3AZIB 5BT1C 4JJND 1AOIB 4H9PB 1ID3B 1U35B 5B32A 2HIOD 1M1AB 3B0BA 3H0RC 3IP4C 1HQ3B 3AZIC 5B2IB 3X1TB 1P3GA 3A6ND 1AOIC 4J8VB 2ZY4A 1S32A 1ID3C 3WTPA 2RIQA 5AV9B 3TU4A 3WAAD 1M1AC 3X1TC 5B2IC 3REJC 5AV9C 5BNXA 1P34B 2AROB 1P3OB 2Y2JA 3REKD 3R45A 2PYOD 1P3OC 5CPJA 5AVBA 4ZUXB 1P3MC 1M19A 2BG1A 3NQJB 4WZSB 2L5AA 1F66B 4CAYB 3MGQB 3LJAD 5B40A 3B6GA 5GXQC 1P3KA 3VH5W 3W99A 3AZFD 1PZRA 2XD5A 4WU8C 1KX4D 2ZM5A 3UTAD 4H9OA 3C1BC 4HGAB 3AV1D 2NQBB 5AV8B 3KXBC 4E45A 1T3UA 5B31G 3LELA 5JRGD 5BO0B 4NFTA 3AZMA 4YS3D 2BYKA 3VH6A 3KUYA 4LD9B 5AV8C 1R4VA 1P3LB 4AWLB 1ZLAC 5B0ZA 3W97D 3B0CW 3AYWD 4Z5TA 4LD9C 5DNNA 5AV5B 1P3LC 4AWLC 2NZDD 4KUDA 1KX3D 3B0DB 5FUGA 2FJ7A 1BH8B 3A1IA 3WA9D 2Y2NA 5AV5C 3B0DC 1U35D 3AN2B 1M18A 3W96C 5B33B 5GSUA 4R8PA 3O62D 4J8VD 3REID 5B32B 3AN2C 1P3GB 5B33C 1H3OA 3MGRC 4Z66A 5GT3A 2CV5A 3WTPB 3TU4B 2F8NB 1P34D 3WTPE 2AROD 3WKJD 3C1CD 3W98D 4JJNB 5B2JA 5BNXB 2HIOB 2YFWA 3AZND 4JJNC 4ZUXD 3AZLA 3R45B 1F66D 5DNMD 3WAAB 2J8PA 2HIOC 3AV2A 3MGQD 3A6NC 3X1UA 1M19B 3WAAC 5KDMA 1KX5D 1HTAA 4J8WA 1P3ID 5B40B 3LZ0A 3FDDA 3REKB 2CWEA 4XZQA 5DNMA 3AZKA 2NQBD 2PYOB 5AVCA 3REKC 2BYMA 3AZGD 2PYOC 3RELA 3LJAB 3AZMB 3MNNA 3AZFB 1TAFA 1P3BD 3LJAC 5B24A 5C3IB 5G49B 3UTAB 3AZFC 1BFMA 3AV1B 1KX4C 4J8UD 3EPJA 4QLCA 4KUDB 5F99D 5JRGB 5AY8A 3UTAC 4YS3B 1WWSA 3AV1C 2FJ7B 5CPKA 4NE5A 5JRGC 4YS3C 5B32D 3W97B 3AYWB 1P3GD 1P3PA 1S32D 2Y2HA 3WTPD 1W2EA 3TU4D 1KX3B 3W97C 3AYWC 3MGSA 2F2AC 2XD1A 1P3FA 4Z66B 3WA9B 3UTBA 3REHA 2NZDC 1KX3C 3VH6T 2JE5A 2Y2LA 4EO5B 3WA9C 5B2JB 4H9NA 3O62B 4H9QA 3REIB 4G91B 1U35C 4XUJA 1HQ3C 4EO5C 2G5HC 5CPJD 5AVBD 1EQZA 3O62C 4J8VC 1M19D 3REIC 3WKJB 5B40D 3C1CB 3B6GD 3W98B 1P3KD 3W99D 5KDMB 1B67A 4J8WB 1P34C 3WKJC 2AROC 5E5AA 3C1CC 1P3AA 3AZNB 3W98C 5B1MA 5DNMB 4UUZB 1JFIB 3LELD 3AZNC 4ZUXC 3H0MC 3AZMD 5B32G 4CSRA 3KUYD 1F66C 1KX5B 4KHAA 3MGQC 5CPIA 3RELB 5B1LA 1P3IB 5B31A 4H9RB 5B0ZD 3MNNB 3MGPA 1KX5C 4Z5TD 2F8NG 5DNND 1P3IC 4KUDD 3AZHD 4HGAC 3AZGB 2FJ7D 2NQBC 4UPKA 3MVDA 3LZ1A 5JA4A 1M18D 3AZGC 5CPKB 5GSUD 1P3BB 4R8PD 5BS7C 2DQNC 4YM6A 3AZHA 1N1JA 2Y2IA 1P3BC 4WNNB 4Z66D 5GT3D 4J8UB 2CV5D 3X1VA 5F99B 1BH9A 2JCHA 3MGSB 4J8XA 5BNVA 3X1SD 3AFAA 4J8UC 3REHB 5B0YA 5B2JD 5F99C 3EPLA 5GT0A 5CP6D 1TZYA 4WU9A 3AZLD 1S32B 3KWQA 5B32C 4XUJB 3AV2D 4KGCA 1P3GC 2HUEB 3X1SA 3X1UD 3UT9A 1S32C 3WTPC 3TU4C 4Z2MG 4H9SA 5AV6A 2Y2MA 5CP6A 4J8WD 3AZJA 3LZ0D 4DRBA 4X23A 3AZEA 2Y2GA 3AZKD 4XZQD 3B6FA 5E5AB 5CPJB 5AVCD 5AVBB 3REJD 5B1MB 3AZIA 5CPJC 5AVBC 3RELD 3B6GB 1AOIA 1M19C 4H9PA 4CSRB 1P3KB 3MNND 1ID3A 3W99B 5CPIB 2LY8A 1M1AA 3X1TA 5B24D 5B40C 3B6GC 1P3KC 3REJA 3W99C 3MGPB 4H9OB 5AV9A 4QLCD 3LELB 5GXQD 5AY8D 2BYKB 3KUYB 5CPKD 1WWIA 4WU8D 3MVDB 3LELC 1P3OA 3LZ1B 3AZMC 5JA4B 5CHLB 1P3MA 5B0ZB 3KUYC 4Z5TB 4WJ3C 5DNNB 1P3PD 5GXQA 5B0ZC 3AZHB 5FUGB 1N1JB 5C3IC 3NQJA 4Z5TC 3MGSD 4CAYA 1P3FD 5DNNC 4WU8A 3UTBD 3REHD 4G92B 4KUDC 3VH5T 3C1BA 1M18B 2FJ7C 5GSUB 4R8PB 3KXBA 4G92C 1KU5A 4XUJD 1M18C 2ZY5A 4WU9B 1H3OB 5GSUC 5AV8A 2G5IC 4R8PC 1EQZD 4E44A 5GT3B 2CV5B 2RVQD 1ZLAA 4LD9A 3X1SB 4Z66C 5GT3C 2CV5C 1P3LA 5AV6B 5CP6B 2YFWB 3B0CT 3P5JB 5E5AD 3X1SC 1P3AD 5B2JC 1Q9CA 3AZLB 5B1MD 5AV5A 3AZEB 4G91C 3AV2B 4DRAA 3W96A 1BH8A 3X1UB 3AZLC 3AV2C 5CPID 2ZY3A 3AN2A 5B1LD 1B6WA 5B33A 3LZ0B 5B31D 3X1UC 3KSYA 4NE3A 3MGRA 3MGPD 3AZKB 4XZQB 3A1KA 4J8WC 3LZ0C 5AVCB 2F8NH 3REJB 2BYMB 3AZKC 4XZQC 5DNMC 3VH5A 2F8NA 3V9RA 3MVDD 5AVCC 2JSSA 4NE6A 3LZ1D 4JJNA 1TAFB 2HIOA 4M6BA 3EPHA 3RELC 5B24B 4YM6D 1A7WA 3A6NA 1P3MB 3MNNC 3WAAA 5B24C 4QLCB 3X1VD 3AL0C 5GXQB 3EPKA 5AY8B 4J8XD 3AFAD 4WU8B 5B0YD 4QLCC 5AY8C 2Y2OA 3REKA 5GT0D 3C1BB 1TZYD 5CPKC 3NQUA 4WU9D 3KXBB 2PYOA 1P3PB 3KWQD 2Y2PA 4KGCD 1ULYA 1P3FB 3UT9D 1P3PC 3UTBB 3EG5B 3VH6W 3LJAA 1ZLAB 3MGSC 5AV6D 3AZFA 2VQRA 3AZJD 1P3FC 3UTBC 2YFVA 4H9NB 4Z2MH 4X23D 4H9QB 3REHC 3AZED 1KX4A 3B6FD 5G49A 3UTAA 3AV1A 5BT1D 1EQZB 2F8NK 2Y2KA 5JRGA 4XUJC 4YS3A 3AZID 2FFFB 3W96B 1EQZC 2HUEC 1AOID 1ID3D 2RVQC 3W97A 1M1AD 3AYWA 3X1TD 1HQ3D 5B2ID 3MGRB 1P3AB 2NZDA 5AV9D 1KX3A 5E5AC 1P3AC 3WA9A 5B1MC 2DF4C 1U35A 4KHAB 3V9RB 5B1LB 1P3OD 1HQ3A 2W8SA 2Y2QA 5B31B 5B2IA 3O62A 4J8VA 1P3MD 3REIA 5CPIC 5B1LC 4DQYB 3A6NB 5B31C 3MGPC 1P34A 3WKJA 2AROA 3C1CA 3W98A 2ZY2A 3C1BD 3KXBD 3MVDC 4YM6B 3LZ1C 4ZUXA 3AZNA 4WV4B 1F66A 3NQUB 4UUZA 5AV8D 1JFIA 3MGQA 3X1VB 4YM6C 1BH9B 1ZLAD 3AZHC 1F1EA 4J8XB 1Z2CB 5BNVB 1KX5A 4LD9D 3AFAB 2IO5B 5B0YB 3X1VC 1P3IA 1P3LD 4H9RA 4J8XC
chains in the Genus database with same CATH topology
3H0LC 5GT0B 1TZYB 3AFAC 2NQBA 2YFVB 2IO5C 5B0YC 1KX4B 3KFUG 5AV5D 3KWQB 5BO0A 5GT0C 4KGCB 1TZYC 3AZGA 4WU9C 3W96D 3UT9B 5BS7A 3KWQC 2UWXA 4KGCC 3AN2D 5B33D 4ZBJB 3AZJB 3MGRD 3UT9C 1P3BA 4X23B 4H9SC 3B6FB 5AV6C 5CP6C 3AZJC 4ZBJC 4WNNA 4J8UA 4X23C 2NZDB 3AZEC 5F99A 3F6TA 3B6FC 2F8ND 3AZIB 5BT1C 4JJND 1AOIB 4H9PB 1ID3B 1U35B 5B32A 2HIOD 1M1AB 3B0BA 3H0RC 3IP4C 1HQ3B 3AZIC 5B2IB 3X1TB 1P3GA 3A6ND 1AOIC 4J8VB 2ZY4A 1S32A 1ID3C 3WTPA 2RIQA 5AV9B 3TU4A 3WAAD 1M1AC 3X1TC 5B2IC 3REJC 5AV9C 5BNXA 1P34B 2AROB 1P3OB 2Y2JA 3REKD 3R45A 2PYOD 1P3OC 5CPJA 5AVBA 4ZUXB 1P3MC 1M19A 2BG1A 3NQJB 4WZSB 2L5AA 1F66B 4CAYB 3MGQB 3LJAD 5B40A 3B6GA 5GXQC 1P3KA 3VH5W 3W99A 3AZFD 1PZRA 2XD5A 4WU8C 1KX4D 2ZM5A 3UTAD 4H9OA 3C1BC 4HGAB 3AV1D 2NQBB 5AV8B 3KXBC 4E45A 1T3UA 5B31G 3LELA 5JRGD 5BO0B 4NFTA 3AZMA 4YS3D 2BYKA 3VH6A 3KUYA 4LD9B 5AV8C 1R4VA 1P3LB 4AWLB 1ZLAC 5B0ZA 3W97D 3B0CW 3AYWD 4Z5TA 4LD9C 5DNNA 5AV5B 1P3LC 4AWLC 2NZDD 4KUDA 1KX3D 3B0DB 5FUGA 2FJ7A 1BH8B 3A1IA 3WA9D 2Y2NA 5AV5C 3B0DC 1U35D 3AN2B 1M18A 3W96C 5B33B 5GSUA 4R8PA 3O62D 4J8VD 3REID 5B32B 3AN2C 1P3GB 5B33C 1H3OA 3MGRC 4Z66A 5GT3A 2CV5A 3WTPB 3TU4B 2F8NB 1P34D 3WTPE 2AROD 3WKJD 3C1CD 3W98D 4JJNB 5B2JA 5BNXB 2HIOB 2YFWA 3AZND 4JJNC 4ZUXD 3AZLA 3R45B 1F66D 5DNMD 3WAAB 2J8PA 2HIOC 3AV2A 3MGQD 3A6NC 3X1UA 1M19B 3WAAC 5KDMA 1KX5D 1HTAA 4J8WA 1P3ID 5B40B 3LZ0A 3FDDA 3REKB 2CWEA 4XZQA 5DNMA 3AZKA 2NQBD 2PYOB 5AVCA 3REKC 2BYMA 3AZGD 2PYOC 3RELA 3LJAB 3AZMB 3MNNA 3AZFB 1TAFA 1P3BD 3LJAC 5B24A 5C3IB 5G49B 3UTAB 3AZFC 1BFMA 3AV1B 1KX4C 4J8UD 3EPJA 4QLCA 4KUDB 5F99D 5JRGB 5AY8A 3UTAC 4YS3B 1WWSA 3AV1C 2FJ7B 5CPKA 4NE5A 5JRGC 4YS3C 5B32D 3W97B 3AYWB 1P3GD 1P3PA 1S32D 2Y2HA 3WTPD 1W2EA 3TU4D 1KX3B 3W97C 3AYWC 3MGSA 2F2AC 2XD1A 1P3FA 4Z66B 3WA9B 3UTBA 3REHA 2NZDC 1KX3C 3VH6T 2JE5A 2Y2LA 4EO5B 3WA9C 5B2JB 4H9NA 3O62B 4H9QA 3REIB 4G91B 1U35C 4XUJA 1HQ3C 4EO5C 2G5HC 5CPJD 5AVBD 1EQZA 3O62C 4J8VC 1M19D 3REIC 3WKJB 5B40D 3C1CB 3B6GD 3W98B 1P3KD 3W99D 5KDMB 1B67A 4J8WB 1P34C 3WKJC 2AROC 5E5AA 3C1CC 1P3AA 3AZNB 3W98C 5B1MA 5DNMB 4UUZB 1JFIB 3LELD 3AZNC 4ZUXC 3H0MC 3AZMD 5B32G 4CSRA 3KUYD 1F66C 1KX5B 4KHAA 3MGQC 5CPIA 3RELB 5B1LA 1P3IB 5B31A 4H9RB 5B0ZD 3MNNB 3MGPA 1KX5C 4Z5TD 2F8NG 5DNND 1P3IC 4KUDD 3AZHD 4HGAC 3AZGB 2FJ7D 2NQBC 4UPKA 3MVDA 3LZ1A 5JA4A 1M18D 3AZGC 5CPKB 5GSUD 1P3BB 4R8PD 5BS7C 2DQNC 4YM6A 3AZHA 1N1JA 2Y2IA 1P3BC 4WNNB 4Z66D 5GT3D 4J8UB 2CV5D 3X1VA 5F99B 1BH9A 2JCHA 3MGSB 4J8XA 5BNVA 3X1SD 3AFAA 4J8UC 3REHB 5B0YA 5B2JD 5F99C 3EPLA 5GT0A 5CP6D 1TZYA 4WU9A 3AZLD 1S32B 3KWQA 5B32C 4XUJB 3AV2D 4KGCA 1P3GC 2HUEB 3X1SA 3X1UD 3UT9A 1S32C 3WTPC 3TU4C 4Z2MG 4H9SA 5AV6A 2Y2MA 5CP6A 4J8WD 3AZJA 3LZ0D 4DRBA 4X23A 3AZEA 2Y2GA 3AZKD 4XZQD 3B6FA 5E5AB 5CPJB 5AVCD 5AVBB 3REJD 5B1MB 3AZIA 5CPJC 5AVBC 3RELD 3B6GB 1AOIA 1M19C 4H9PA 4CSRB 1P3KB 3MNND 1ID3A 3W99B 5CPIB 2LY8A 1M1AA 3X1TA 5B24D 5B40C 3B6GC 1P3KC 3REJA 3W99C 3MGPB 4H9OB 5AV9A 4QLCD 3LELB 5GXQD 5AY8D 2BYKB 3KUYB 5CPKD 1WWIA 4WU8D 3MVDB 3LELC 1P3OA 3LZ1B 3AZMC 5JA4B 5CHLB 1P3MA 5B0ZB 3KUYC 4Z5TB 4WJ3C 5DNNB 1P3PD 5GXQA 5B0ZC 3AZHB 5FUGB 1N1JB 5C3IC 3NQJA 4Z5TC 3MGSD 4CAYA 1P3FD 5DNNC 4WU8A 3UTBD 3REHD 4G92B 4KUDC 3VH5T 3C1BA 1M18B 2FJ7C 5GSUB 4R8PB 3KXBA 4G92C 1KU5A 4XUJD 1M18C 2ZY5A 4WU9B 1H3OB 5GSUC 5AV8A 2G5IC 4R8PC 1EQZD 4E44A 5GT3B 2CV5B 2RVQD 1ZLAA 4LD9A 3X1SB 4Z66C 5GT3C 2CV5C 1P3LA 5AV6B 5CP6B 2YFWB 3B0CT 3P5JB 5E5AD 3X1SC 1P3AD 5B2JC 1Q9CA 3AZLB 5B1MD 5AV5A 3AZEB 4G91C 3AV2B 4DRAA 3W96A 1BH8A 3X1UB 3AZLC 3AV2C 5CPID 2ZY3A 3AN2A 5B1LD 1B6WA 5B33A 3LZ0B 5B31D 3X1UC 3KSYA 4NE3A 3MGRA 3MGPD 3AZKB 4XZQB 3A1KA 4J8WC 3LZ0C 5AVCB 2F8NH 3REJB 2BYMB 3AZKC 4XZQC 5DNMC 3VH5A 2F8NA 3V9RA 3MVDD 5AVCC 2JSSA 4NE6A 3LZ1D 4JJNA 1TAFB 2HIOA 4M6BA 3EPHA 3RELC 5B24B 4YM6D 1A7WA 3A6NA 1P3MB 3MNNC 3WAAA 5B24C 4QLCB 3X1VD 3AL0C 5GXQB 3EPKA 5AY8B 4J8XD 3AFAD 4WU8B 5B0YD 4QLCC 5AY8C 2Y2OA 3REKA 5GT0D 3C1BB 1TZYD 5CPKC 3NQUA 4WU9D 3KXBB 2PYOA 1P3PB 3KWQD 2Y2PA 4KGCD 1ULYA 1P3FB 3UT9D 1P3PC 3UTBB 3EG5B 3VH6W 3LJAA 1ZLAB 3MGSC 5AV6D 3AZFA 2VQRA 3AZJD 1P3FC 3UTBC 2YFVA 4H9NB 4Z2MH 4X23D 4H9QB 3REHC 3AZED 1KX4A 3B6FD 5G49A 3UTAA 3AV1A 5BT1D 1EQZB 2F8NK 2Y2KA 5JRGA 4XUJC 4YS3A 3AZID 2FFFB 3W96B 1EQZC 2HUEC 1AOID 1ID3D 2RVQC 3W97A 1M1AD 3AYWA 3X1TD 1HQ3D 5B2ID 3MGRB 1P3AB 2NZDA 5AV9D 1KX3A 5E5AC 1P3AC 3WA9A 5B1MC 2DF4C 1U35A 4KHAB 3V9RB 5B1LB 1P3OD 1HQ3A 2W8SA 2Y2QA 5B31B 5B2IA 3O62A 4J8VA 1P3MD 3REIA 5CPIC 5B1LC 4DQYB 3A6NB 5B31C 3MGPC 1P34A 3WKJA 2AROA 3C1CA 3W98A 2ZY2A 3C1BD 3KXBD 3MVDC 4YM6B 3LZ1C 4ZUXA 3AZNA 4WV4B 1F66A 3NQUB 4UUZA 5AV8D 1JFIA 3MGQA 3X1VB 4YM6C 1BH9B 1ZLAD 3AZHC 1F1EA 4J8XB 1Z2CB 5BNVB 1KX5A 4LD9D 3AFAB 2IO5B 5B0YB 3X1VC 1P3IA 1P3LD 4H9RA 4J8XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 B;  1TZY B;  3AFA C;  2NQB A;  2YFV B;  2IO5 C;  5B0Y C;  1KX4 B;  5AV5 D;  3KWQ B;  5BO0 A;  5GT0 C;  4KGC B;  1TZY C;  3AZG A;  4WU9 C;  3W96 D;  3UT9 B;  5BS7 A;  3KWQ C;  4KGC C;  3AN2 D;  5B33 D;  4ZBJ B;  3AZJ B;  3MGR D;  3UT9 C;  1P3B A;  4X23 B;  4H9S C;  3B6F B;  5AV6 C;  5CP6 C;  3AZJ C;  4ZBJ C;  4WNN A;  4J8U A;  4X23 C;  2NZD B;  3AZE C;  5F99 A;  3B6F C;  2F8N D;  3AZI B;  5BT1 C;  4JJN D;  1AOI B;  4H9P B;  1ID3 B;  1U35 B;  5B32 A;  2HIO D;  1M1A B;  3B0B A;  3AZI C;  3X1T B;  1HQ3 B;  5B2I B;  1P3G A;  3A6N D;  1AOI C;  4J8V B;  1S32 A;  1ID3 C;  3WTP A;  5AV9 B;  3TU4 A;  3WAA D;  1M1A C;  3X1T C;  5B2I C;  3REJ C;  5AV9 C;  5BNX A;  1P34 B;  2ARO B;  1P3O B;  3REK D;  3R45 A;  2PYO D;  1P3O C;  5CPJ A;  5AVB A;  4ZUX B;  1P3M C;  1M19 A;  3NQJ B;  4WZS B;  2L5A A;  1F66 B;  4CAY B;  3MGQ B;  3LJA D;  5B40 A;  3B6G A;  5GXQ C;  1P3K A;  3VH5 W;  3W99 A;  3AZF D;  4WU8 C;  1KX4 D;  3UTA D;  4H9O A;  3C1B C;  4HGA B;  3AV1 D;  2NQB B;  5AV8 B;  3KXB C;  4E45 A;  5B31 G;  3LEL A;  5JRG D;  5BO0 B;  4NFT A;  3AZM A;  4YS3 D;  2BYK A;  3VH6 A;  3KUY A;  4LD9 B;  5AV8 C;  1R4V A;  1P3L B;  4AWL B;  1ZLA C;  5B0Z A;  3W97 D;  3B0C W;  3AYW D;  4Z5T A;  4LD9 C;  5DNN A;  5AV5 B;  1P3L C;  4AWL C;  2NZD D;  4KUD A;  1KX3 D;  3B0D B;  5FUG A;  2FJ7 A;  1BH8 B;  3WA9 D;  5AV5 C;  3B0D C;  1U35 D;  3AN2 B;  1M18 A;  3W96 C;  5B33 B;  5GSU A;  4R8P A;  3O62 D;  4J8V D;  3REI D;  5B32 B;  3AN2 C;  1P3G B;  5B33 C;  1H3O A;  3MGR C;  4Z66 A;  5GT3 A;  2CV5 A;  3WTP B;  3TU4 B;  2F8N B;  1P34 D;  3WTP E;  2ARO D;  3WKJ D;  3C1C D;  3W98 D;  4JJN B;  5B2J A;  5BNX B;  2HIO B;  2YFW A;  3AZN D;  4JJN C;  4ZUX D;  3AZL A;  3R45 B;  1F66 D;  5DNM D;  3WAA B;  3AV2 A;  2HIO C;  3MGQ D;  3A6N C;  3X1U A;  1M19 B;  3WAA C;  5KDM A;  1KX5 D;  1HTA A;  4J8W A;  1P3I D;  5B40 B;  3LZ0 A;  3REK B;  2CWE A;  4XZQ A;  5DNM A;  3AZK A;  2NQB D;  2PYO B;  5AVC A;  3REK C;  2BYM A;  3AZG D;  2PYO C;  3REL A;  3LJA B;  3AZM B;  3MNN A;  3AZF B;  1TAF A;  1P3B D;  3LJA C;  5B24 A;  5C3I B;  5G49 B;  3UTA B;  3AZF C;  1BFM A;  3AV1 B;  1KX4 C;  4J8U D;  4QLC A;  4KUD B;  5F99 D;  5JRG B;  5AY8 A;  3UTA C;  4YS3 B;  1WWS A;  3AV1 C;  2FJ7 B;  5CPK A;  4NE5 A;  5JRG C;  4YS3 C;  5B32 D;  3W97 B;  3AYW B;  1P3G D;  1P3P A;  1S32 D;  3WTP D;  3TU4 D;  1KX3 B;  3W97 C;  3AYW C;  3MGS A;  1P3F A;  4Z66 B;  3WA9 B;  3UTB A;  3REH A;  2NZD C;  1KX3 C;  3VH6 T;  4EO5 B;  3WA9 C;  5B2J B;  4H9N A;  3O62 B;  4H9Q A;  3REI B;  4G91 B;  1U35 C;  4XUJ A;  1HQ3 C;  4EO5 C;  5CPJ D;  5AVB D;  1EQZ A;  3O62 C;  4J8V C;  1M19 D;  3REI C;  3WKJ B;  5B40 D;  3C1C B;  3B6G D;  3W98 B;  1P3K D;  3W99 D;  5KDM B;  1B67 A;  4J8W B;  1P34 C;  3WKJ C;  2ARO C;  5E5A A;  3C1C C;  1P3A A;  3AZN B;  3W98 C;  5B1M A;  5DNM B;  4UUZ B;  1JFI B;  3LEL D;  3AZN C;  4ZUX C;  3AZM D;  5B32 G;  4CSR A;  3KUY D;  1F66 C;  1KX5 B;  4KHA A;  3MGQ C;  5CPI A;  3REL B;  5B1L A;  1P3I B;  5B31 A;  4H9R B;  5B0Z D;  3MNN B;  3MGP A;  1KX5 C;  4Z5T D;  2F8N G;  5DNN D;  1P3I C;  4KUD D;  3AZH D;  4HGA C;  3AZG B;  2FJ7 D;  2NQB C;  3MVD A;  3LZ1 A;  5JA4 A;  1M18 D;  3AZG C;  5CPK B;  5GSU D;  1P3B B;  4R8P D;  5BS7 C;  4YM6 A;  3AZH A;  1N1J A;  1P3B C;  4WNN B;  4Z66 D;  5GT3 D;  4J8U B;  2CV5 D;  3X1V A;  5F99 B;  1BH9 A;  3MGS B;  4J8X A;  5BNV A;  3X1S D;  3AFA A;  4J8U C;  3REH B;  5B0Y A;  5B2J D;  5F99 C;  5GT0 A;  5CP6 D;  1TZY A;  4WU9 A;  3AZL D;  1S32 B;  3KWQ A;  5B32 C;  4XUJ B;  3AV2 D;  4KGC A;  1P3G C;  2HUE B;  3X1S A;  3X1U D;  3UT9 A;  1S32 C;  3WTP C;  3TU4 C;  4Z2M G;  4H9S A;  5AV6 A;  5CP6 A;  4J8W D;  3AZJ A;  3LZ0 D;  4DRB A;  4X23 A;  3AZE A;  3AZK D;  4XZQ D;  3B6F A;  5E5A B;  5CPJ B;  5AVC D;  5AVB B;  3REJ D;  5B1M B;  3AZI A;  5CPJ C;  5AVB C;  3REL D;  3B6G B;  1AOI A;  1M19 C;  4H9P A;  4CSR B;  1P3K B;  3MNN D;  1ID3 A;  3W99 B;  5CPI B;  2LY8 A;  1M1A A;  3X1T A;  5B24 D;  5B40 C;  3B6G C;  1P3K C;  3REJ A;  3W99 C;  3MGP B;  4H9O B;  5AV9 A;  4QLC D;  3LEL B;  5GXQ D;  5AY8 D;  2BYK B;  3KUY B;  5CPK D;  1WWI A;  4WU8 D;  3MVD B;  3LEL C;  1P3O A;  3LZ1 B;  3AZM C;  5JA4 B;  5CHL B;  1P3M A;  5B0Z B;  3KUY C;  4Z5T B;  5DNN B;  1P3P D;  5GXQ A;  5B0Z C;  3AZH B;  5FUG B;  1N1J B;  5C3I C;  3NQJ A;  4Z5T C;  3MGS D;  4CAY A;  1P3F D;  5DNN C;  4WU8 A;  3UTB D;  3REH D;  4G92 B;  4KUD C;  3VH5 T;  3C1B A;  1M18 B;  2FJ7 C;  5GSU B;  4R8P B;  3KXB A;  4G92 C;  1KU5 A;  4XUJ D;  1M18 C;  4WU9 B;  1H3O B;  5GSU C;  5AV8 A;  4R8P C;  1EQZ D;  4E44 A;  5GT3 B;  2CV5 B;  2RVQ D;  1ZLA A;  4LD9 A;  3X1S B;  4Z66 C;  5GT3 C;  2CV5 C;  1P3L A;  5AV6 B;  5CP6 B;  2YFW B;  3B0C T;  5E5A D;  3X1S C;  1P3A D;  5B2J C;  1Q9C A;  3AZL B;  5B1M D;  5AV5 A;  3AZE B;  4G91 C;  3AV2 B;  4DRA A;  3W96 A;  1BH8 A;  3X1U B;  3AZL C;  3AV2 C;  5CPI D;  3AN2 A;  5B1L D;  1B6W A;  5B33 A;  3LZ0 B;  5B31 D;  3X1U C;  3KSY A;  4NE3 A;  3MGR A;  3MGP D;  3AZK B;  4XZQ B;  4J8W C;  3LZ0 C;  5AVC B;  2F8N H;  3REJ B;  2BYM B;  3AZK C;  4XZQ C;  5DNM C;  3VH5 A;  2F8N A;  3V9R A;  3MVD D;  5AVC C;  2JSS A;  4NE6 A;  3LZ1 D;  4JJN A;  1TAF B;  2HIO A;  4M6B A;  3REL C;  5B24 B;  4YM6 D;  1A7W A;  3A6N A;  1P3M B;  3MNN C;  3WAA A;  5B24 C;  4QLC B;  3X1V D;  5GXQ B;  5AY8 B;  4J8X D;  3AFA D;  4WU8 B;  5B0Y D;  4QLC C;  5AY8 C;  3REK A;  5GT0 D;  3C1B B;  1TZY D;  5CPK C;  3NQU A;  4WU9 D;  3KXB B;  2PYO A;  1P3P B;  3KWQ D;  4KGC D;  1ULY A;  1P3F B;  3UT9 D;  1P3P C;  3UTB B;  3VH6 W;  3LJA A;  1ZLA B;  3MGS C;  5AV6 D;  3AZF A;  3AZJ D;  1P3F C;  3UTB C;  2YFV A;  4H9N B;  4Z2M H;  4X23 D;  4H9Q B;  3REH C;  3AZE D;  1KX4 A;  3B6F D;  5G49 A;  3UTA A;  3AV1 A;  5BT1 D;  1EQZ B;  2F8N K;  5JRG A;  4XUJ C;  4YS3 A;  3AZI D;  3W96 B;  1EQZ C;  2HUE C;  1AOI D;  1ID3 D;  2RVQ C;  3W97 A;  1M1A D;  3AYW A;  3X1T D;  1HQ3 D;  5B2I D;  3MGR B;  1P3A B;  2NZD A;  5AV9 D;  1KX3 A;  5E5A C;  1P3A C;  3WA9 A;  5B1M C;  1U35 A;  4KHA B;  3V9R B;  5B1L B;  1P3O D;  1HQ3 A;  5B2I A;  5B31 B;  3O62 A;  4J8V A;  1P3M D;  3REI A;  5CPI C;  5B1L C;  3A6N B;  5B31 C;  3MGP C;  1P34 A;  3WKJ A;  2ARO A;  3C1C A;  3W98 A;  3C1B D;  3KXB D;  3MVD C;  4YM6 B;  3LZ1 C;  4ZUX A;  3AZN A;  4WV4 B;  1F66 A;  3NQU B;  4UUZ A;  5AV8 D;  1JFI A;  3MGQ A;  3X1V B;  4YM6 C;  1BH9 B;  1ZLA D;  3AZH C;  1F1E A;  4J8X B;  5BNV B;  1KX5 A;  4LD9 D;  3AFA B;  2IO5 B;  5B0Y B;  3X1V C;  1P3I A;  1P3L D;  4H9R A;  4J8X C; 
#chains in the Genus database with same CATH topology
 3H0L C;  5GT0 B;  1TZY B;  3AFA C;  2NQB A;  2YFV B;  2IO5 C;  5B0Y C;  1KX4 B;  3KFU G;  5AV5 D;  3KWQ B;  5BO0 A;  5GT0 C;  4KGC B;  1TZY C;  3AZG A;  4WU9 C;  3W96 D;  3UT9 B;  5BS7 A;  3KWQ C;  2UWX A;  4KGC C;  3AN2 D;  5B33 D;  4ZBJ B;  3AZJ B;  3MGR D;  3UT9 C;  1P3B A;  4X23 B;  4H9S C;  3B6F B;  5AV6 C;  5CP6 C;  3AZJ C;  4ZBJ C;  4WNN A;  4J8U A;  4X23 C;  2NZD B;  3AZE C;  5F99 A;  3F6T A;  3B6F C;  2F8N D;  3AZI B;  5BT1 C;  4JJN D;  1AOI B;  4H9P B;  1ID3 B;  1U35 B;  5B32 A;  2HIO D;  1M1A B;  3B0B A;  3H0R C;  3IP4 C;  1HQ3 B;  3AZI C;  5B2I B;  3X1T B;  1P3G A;  3A6N D;  1AOI C;  4J8V B;  2ZY4 A;  1S32 A;  1ID3 C;  3WTP A;  2RIQ A;  5AV9 B;  3TU4 A;  3WAA D;  1M1A C;  3X1T C;  5B2I C;  3REJ C;  5AV9 C;  5BNX A;  1P34 B;  2ARO B;  1P3O B;  2Y2J A;  3REK D;  3R45 A;  2PYO D;  1P3O C;  5CPJ A;  5AVB A;  4ZUX B;  1P3M C;  1M19 A;  2BG1 A;  3NQJ B;  4WZS B;  2L5A A;  1F66 B;  4CAY B;  3MGQ B;  3LJA D;  5B40 A;  3B6G A;  5GXQ C;  1P3K A;  3VH5 W;  3W99 A;  3AZF D;  1PZR A;  2XD5 A;  4WU8 C;  1KX4 D;  2ZM5 A;  3UTA D;  4H9O A;  3C1B C;  4HGA B;  3AV1 D;  2NQB B;  5AV8 B;  3KXB C;  4E45 A;  1T3U A;  5B31 G;  3LEL A;  5JRG D;  5BO0 B;  4NFT A;  3AZM A;  4YS3 D;  2BYK A;  3VH6 A;  3KUY A;  4LD9 B;  5AV8 C;  1R4V A;  1P3L B;  4AWL B;  1ZLA C;  5B0Z A;  3W97 D;  3B0C W;  3AYW D;  4Z5T A;  4LD9 C;  5DNN A;  5AV5 B;  1P3L C;  4AWL C;  2NZD D;  4KUD A;  1KX3 D;  3B0D B;  5FUG A;  2FJ7 A;  1BH8 B;  3A1I A;  3WA9 D;  2Y2N A;  5AV5 C;  3B0D C;  1U35 D;  3AN2 B;  1M18 A;  3W96 C;  5B33 B;  5GSU A;  4R8P A;  3O62 D;  4J8V D;  3REI D;  5B32 B;  3AN2 C;  1P3G B;  5B33 C;  1H3O A;  3MGR C;  4Z66 A;  5GT3 A;  2CV5 A;  3WTP B;  3TU4 B;  2F8N B;  1P34 D;  3WTP E;  2ARO D;  3WKJ D;  3C1C D;  3W98 D;  4JJN B;  5B2J A;  5BNX B;  2HIO B;  2YFW A;  3AZN D;  4JJN C;  4ZUX D;  3AZL A;  3R45 B;  1F66 D;  5DNM D;  3WAA B;  2J8P A;  2HIO C;  3AV2 A;  3MGQ D;  3A6N C;  3X1U A;  1M19 B;  3WAA C;  5KDM A;  1KX5 D;  1HTA A;  4J8W A;  1P3I D;  5B40 B;  3LZ0 A;  3FDD A;  3REK B;  2CWE A;  4XZQ A;  5DNM A;  3AZK A;  2NQB D;  2PYO B;  5AVC A;  3REK C;  2BYM A;  3AZG D;  2PYO C;  3REL A;  3LJA B;  3AZM B;  3MNN A;  3AZF B;  1TAF A;  1P3B D;  3LJA C;  5B24 A;  5C3I B;  5G49 B;  3UTA B;  3AZF C;  1BFM A;  3AV1 B;  1KX4 C;  4J8U D;  3EPJ A;  4QLC A;  4KUD B;  5F99 D;  5JRG B;  5AY8 A;  3UTA C;  4YS3 B;  1WWS A;  3AV1 C;  2FJ7 B;  5CPK A;  4NE5 A;  5JRG C;  4YS3 C;  5B32 D;  3W97 B;  3AYW B;  1P3G D;  1P3P A;  1S32 D;  2Y2H A;  3WTP D;  1W2E A;  3TU4 D;  1KX3 B;  3W97 C;  3AYW C;  3MGS A;  2F2A C;  2XD1 A;  1P3F A;  4Z66 B;  3WA9 B;  3UTB A;  3REH A;  2NZD C;  1KX3 C;  3VH6 T;  2JE5 A;  2Y2L A;  4EO5 B;  3WA9 C;  5B2J B;  4H9N A;  3O62 B;  4H9Q A;  3REI B;  4G91 B;  1U35 C;  4XUJ A;  1HQ3 C;  4EO5 C;  2G5H C;  5CPJ D;  5AVB D;  1EQZ A;  3O62 C;  4J8V C;  1M19 D;  3REI C;  3WKJ B;  5B40 D;  3C1C B;  3B6G D;  3W98 B;  1P3K D;  3W99 D;  5KDM B;  1B67 A;  4J8W B;  1P34 C;  3WKJ C;  2ARO C;  5E5A A;  3C1C C;  1P3A A;  3AZN B;  3W98 C;  5B1M A;  5DNM B;  4UUZ B;  1JFI B;  3LEL D;  3AZN C;  4ZUX C;  3H0M C;  3AZM D;  5B32 G;  4CSR A;  3KUY D;  1F66 C;  1KX5 B;  4KHA A;  3MGQ C;  5CPI A;  3REL B;  5B1L A;  1P3I B;  5B31 A;  4H9R B;  5B0Z D;  3MNN B;  3MGP A;  1KX5 C;  4Z5T D;  2F8N G;  5DNN D;  1P3I C;  4KUD D;  3AZH D;  4HGA C;  3AZG B;  2FJ7 D;  2NQB C;  4UPK A;  3MVD A;  3LZ1 A;  5JA4 A;  1M18 D;  3AZG C;  5CPK B;  5GSU D;  1P3B B;  4R8P D;  5BS7 C;  2DQN C;  4YM6 A;  3AZH A;  1N1J A;  2Y2I A;  1P3B C;  4WNN B;  4Z66 D;  5GT3 D;  4J8U B;  2CV5 D;  3X1V A;  5F99 B;  1BH9 A;  2JCH A;  3MGS B;  4J8X A;  5BNV A;  3X1S D;  3AFA A;  4J8U C;  3REH B;  5B0Y A;  5B2J D;  5F99 C;  3EPL A;  5GT0 A;  5CP6 D;  1TZY A;  4WU9 A;  3AZL D;  1S32 B;  3KWQ A;  5B32 C;  4XUJ B;  3AV2 D;  4KGC A;  1P3G C;  2HUE B;  3X1S A;  3X1U D;  3UT9 A;  1S32 C;  3WTP C;  3TU4 C;  4Z2M G;  4H9S A;  5AV6 A;  2Y2M A;  5CP6 A;  4J8W D;  3AZJ A;  3LZ0 D;  4DRB A;  4X23 A;  3AZE A;  2Y2G A;  3AZK D;  4XZQ D;  3B6F A;  5E5A B;  5CPJ B;  5AVC D;  5AVB B;  3REJ D;  5B1M B;  3AZI A;  5CPJ C;  5AVB C;  3REL D;  3B6G B;  1AOI A;  1M19 C;  4H9P A;  4CSR B;  1P3K B;  3MNN D;  1ID3 A;  3W99 B;  5CPI B;  2LY8 A;  1M1A A;  3X1T A;  5B24 D;  5B40 C;  3B6G C;  1P3K C;  3REJ A;  3W99 C;  3MGP B;  4H9O B;  5AV9 A;  4QLC D;  3LEL B;  5GXQ D;  5AY8 D;  2BYK B;  3KUY B;  5CPK D;  1WWI A;  4WU8 D;  3MVD B;  3LEL C;  1P3O A;  3LZ1 B;  3AZM C;  5JA4 B;  5CHL B;  1P3M A;  5B0Z B;  3KUY C;  4Z5T B;  4WJ3 C;  5DNN B;  1P3P D;  5GXQ A;  5B0Z C;  3AZH B;  5FUG B;  1N1J B;  5C3I C;  3NQJ A;  4Z5T C;  3MGS D;  4CAY A;  1P3F D;  5DNN C;  4WU8 A;  3UTB D;  3REH D;  4G92 B;  4KUD C;  3VH5 T;  3C1B A;  1M18 B;  2FJ7 C;  5GSU B;  4R8P B;  3KXB A;  4G92 C;  1KU5 A;  4XUJ D;  1M18 C;  2ZY5 A;  4WU9 B;  1H3O B;  5GSU C;  5AV8 A;  2G5I C;  4R8P C;  1EQZ D;  4E44 A;  5GT3 B;  2CV5 B;  2RVQ D;  1ZLA A;  4LD9 A;  3X1S B;  4Z66 C;  5GT3 C;  2CV5 C;  1P3L A;  5AV6 B;  5CP6 B;  2YFW B;  3B0C T;  3P5J B;  5E5A D;  3X1S C;  1P3A D;  5B2J C;  1Q9C A;  3AZL B;  5B1M D;  5AV5 A;  3AZE B;  4G91 C;  3AV2 B;  4DRA A;  3W96 A;  1BH8 A;  3X1U B;  3AZL C;  3AV2 C;  5CPI D;  2ZY3 A;  3AN2 A;  5B1L D;  1B6W A;  5B33 A;  3LZ0 B;  5B31 D;  3X1U C;  3KSY A;  4NE3 A;  3MGR A;  3MGP D;  3AZK B;  4XZQ B;  3A1K A;  4J8W C;  3LZ0 C;  5AVC B;  2F8N H;  3REJ B;  2BYM B;  3AZK C;  4XZQ C;  5DNM C;  3VH5 A;  2F8N A;  3V9R A;  3MVD D;  5AVC C;  2JSS A;  4NE6 A;  3LZ1 D;  4JJN A;  1TAF B;  2HIO A;  4M6B A;  3EPH A;  3REL C;  5B24 B;  4YM6 D;  1A7W A;  3A6N A;  1P3M B;  3MNN C;  3WAA A;  5B24 C;  4QLC B;  3X1V D;  3AL0 C;  5GXQ B;  3EPK A;  5AY8 B;  4J8X D;  3AFA D;  4WU8 B;  5B0Y D;  4QLC C;  5AY8 C;  2Y2O A;  3REK A;  5GT0 D;  3C1B B;  1TZY D;  5CPK C;  3NQU A;  4WU9 D;  3KXB B;  2PYO A;  1P3P B;  3KWQ D;  2Y2P A;  4KGC D;  1ULY A;  1P3F B;  3UT9 D;  1P3P C;  3UTB B;  3EG5 B;  3VH6 W;  3LJA A;  1ZLA B;  3MGS C;  5AV6 D;  3AZF A;  2VQR A;  3AZJ D;  1P3F C;  3UTB C;  2YFV A;  4H9N B;  4Z2M H;  4X23 D;  4H9Q B;  3REH C;  3AZE D;  1KX4 A;  3B6F D;  5G49 A;  3UTA A;  3AV1 A;  5BT1 D;  1EQZ B;  2F8N K;  2Y2K A;  5JRG A;  4XUJ C;  4YS3 A;  3AZI D;  2FFF B;  3W96 B;  1EQZ C;  2HUE C;  1AOI D;  1ID3 D;  2RVQ C;  3W97 A;  1M1A D;  3AYW A;  3X1T D;  1HQ3 D;  5B2I D;  3MGR B;  1P3A B;  2NZD A;  5AV9 D;  1KX3 A;  5E5A C;  1P3A C;  3WA9 A;  5B1M C;  2DF4 C;  1U35 A;  4KHA B;  3V9R B;  5B1L B;  1P3O D;  1HQ3 A;  2W8S A;  2Y2Q A;  5B31 B;  5B2I A;  3O62 A;  4J8V A;  1P3M D;  3REI A;  5CPI C;  5B1L C;  4DQY B;  3A6N B;  5B31 C;  3MGP C;  1P34 A;  3WKJ A;  2ARO A;  3C1C A;  3W98 A;  2ZY2 A;  3C1B D;  3KXB D;  3MVD C;  4YM6 B;  3LZ1 C;  4ZUX A;  3AZN A;  4WV4 B;  1F66 A;  3NQU B;  4UUZ A;  5AV8 D;  1JFI A;  3MGQ A;  3X1V B;  4YM6 C;  1BH9 B;  1ZLA D;  3AZH C;  1F1E A;  4J8X B;  1Z2C B;  5BNV B;  1KX5 A;  4LD9 D;  3AFA B;  2IO5 B;  5B0Y B;  3X1V C;  1P3I A;  1P3L D;  4H9R A;  4J8X C; 
#chains in the Genus database with same CATH homology
 3H0L C;  5GT0 B;  1TZY B;  3AFA C;  2NQB A;  2YFV B;  2IO5 C;  5B0Y C;  1KX4 B;  3KFU G;  5AV5 D;  3KWQ B;  5BO0 A;  5GT0 C;  4KGC B;  1TZY C;  3AZG A;  4WU9 C;  3W96 D;  3UT9 B;  5BS7 A;  3KWQ C;  2UWX A;  4KGC C;  3AN2 D;  5B33 D;  4ZBJ B;  3AZJ B;  3MGR D;  3UT9 C;  1P3B A;  4X23 B;  4H9S C;  3B6F B;  5AV6 C;  5CP6 C;  3AZJ C;  4ZBJ C;  4WNN A;  4J8U A;  4X23 C;  2NZD B;  3AZE C;  5F99 A;  3F6T A;  3B6F C;  2F8N D;  3AZI B;  5BT1 C;  4JJN D;  1AOI B;  4H9P B;  1ID3 B;  1U35 B;  5B32 A;  2HIO D;  1M1A B;  3B0B A;  3H0R C;  3IP4 C;  1HQ3 B;  3AZI C;  5B2I B;  3X1T B;  1P3G A;  3A6N D;  1AOI C;  4J8V B;  2ZY4 A;  1S32 A;  1ID3 C;  3WTP A;  2RIQ A;  5AV9 B;  3TU4 A;  3WAA D;  1M1A C;  3X1T C;  5B2I C;  3REJ C;  5AV9 C;  5BNX A;  1P34 B;  2ARO B;  1P3O B;  2Y2J A;  3REK D;  3R45 A;  2PYO D;  1P3O C;  5CPJ A;  5AVB A;  4ZUX B;  1P3M C;  1M19 A;  2BG1 A;  3NQJ B;  4WZS B;  2L5A A;  1F66 B;  4CAY B;  3MGQ B;  3LJA D;  5B40 A;  3B6G A;  5GXQ C;  1P3K A;  3VH5 W;  3W99 A;  3AZF D;  1PZR A;  2XD5 A;  4WU8 C;  1KX4 D;  2ZM5 A;  3UTA D;  4H9O A;  3C1B C;  4HGA B;  3AV1 D;  2NQB B;  5AV8 B;  3KXB C;  4E45 A;  1T3U A;  5B31 G;  3LEL A;  5JRG D;  5BO0 B;  4NFT A;  3AZM A;  4YS3 D;  2BYK A;  3VH6 A;  3KUY A;  4LD9 B;  5AV8 C;  1R4V A;  1P3L B;  4AWL B;  1ZLA C;  5B0Z A;  3W97 D;  3B0C W;  3AYW D;  4Z5T A;  4LD9 C;  5DNN A;  5AV5 B;  1P3L C;  4AWL C;  2NZD D;  4KUD A;  1KX3 D;  3B0D B;  5FUG A;  2FJ7 A;  1BH8 B;  3A1I A;  3WA9 D;  2Y2N A;  5AV5 C;  3B0D C;  1U35 D;  3AN2 B;  1M18 A;  3W96 C;  5B33 B;  5GSU A;  4R8P A;  3O62 D;  4J8V D;  3REI D;  5B32 B;  3AN2 C;  1P3G B;  5B33 C;  1H3O A;  3MGR C;  4Z66 A;  5GT3 A;  2CV5 A;  3WTP B;  3TU4 B;  2F8N B;  1P34 D;  3WTP E;  2ARO D;  3WKJ D;  3C1C D;  3W98 D;  4JJN B;  5B2J A;  5BNX B;  2HIO B;  2YFW A;  3AZN D;  4JJN C;  4ZUX D;  3AZL A;  3R45 B;  1F66 D;  5DNM D;  3WAA B;  2J8P A;  2HIO C;  3AV2 A;  3MGQ D;  3A6N C;  3X1U A;  1M19 B;  3WAA C;  5KDM A;  1KX5 D;  1HTA A;  4J8W A;  1P3I D;  5B40 B;  3LZ0 A;  3FDD A;  3REK B;  2CWE A;  4XZQ A;  5DNM A;  3AZK A;  2NQB D;  2PYO B;  5AVC A;  3REK C;  2BYM A;  3AZG D;  2PYO C;  3REL A;  3LJA B;  3AZM B;  3MNN A;  3AZF B;  1TAF A;  1P3B D;  3LJA C;  5B24 A;  5C3I B;  5G49 B;  3UTA B;  3AZF C;  1BFM A;  3AV1 B;  1KX4 C;  4J8U D;  3EPJ A;  4QLC A;  4KUD B;  5F99 D;  5JRG B;  5AY8 A;  3UTA C;  4YS3 B;  1WWS A;  3AV1 C;  2FJ7 B;  5CPK A;  4NE5 A;  5JRG C;  4YS3 C;  5B32 D;  3W97 B;  3AYW B;  1P3G D;  1P3P A;  1S32 D;  2Y2H A;  3WTP D;  1W2E A;  3TU4 D;  1KX3 B;  3W97 C;  3AYW C;  3MGS A;  2F2A C;  2XD1 A;  1P3F A;  4Z66 B;  3WA9 B;  3UTB A;  3REH A;  2NZD C;  1KX3 C;  3VH6 T;  2JE5 A;  2Y2L A;  4EO5 B;  3WA9 C;  5B2J B;  4H9N A;  3O62 B;  4H9Q A;  3REI B;  4G91 B;  1U35 C;  4XUJ A;  1HQ3 C;  4EO5 C;  2G5H C;  5CPJ D;  5AVB D;  1EQZ A;  3O62 C;  4J8V C;  1M19 D;  3REI C;  3WKJ B;  5B40 D;  3C1C B;  3B6G D;  3W98 B;  1P3K D;  3W99 D;  5KDM B;  1B67 A;  4J8W B;  1P34 C;  3WKJ C;  2ARO C;  5E5A A;  3C1C C;  1P3A A;  3AZN B;  3W98 C;  5B1M A;  5DNM B;  4UUZ B;  1JFI B;  3LEL D;  3AZN C;  4ZUX C;  3H0M C;  3AZM D;  5B32 G;  4CSR A;  3KUY D;  1F66 C;  1KX5 B;  4KHA A;  3MGQ C;  5CPI A;  3REL B;  5B1L A;  1P3I B;  5B31 A;  4H9R B;  5B0Z D;  3MNN B;  3MGP A;  1KX5 C;  4Z5T D;  2F8N G;  5DNN D;  1P3I C;  4KUD D;  3AZH D;  4HGA C;  3AZG B;  2FJ7 D;  2NQB C;  4UPK A;  3MVD A;  3LZ1 A;  5JA4 A;  1M18 D;  3AZG C;  5CPK B;  5GSU D;  1P3B B;  4R8P D;  5BS7 C;  2DQN C;  4YM6 A;  3AZH A;  1N1J A;  2Y2I A;  1P3B C;  4WNN B;  4Z66 D;  5GT3 D;  4J8U B;  2CV5 D;  3X1V A;  5F99 B;  1BH9 A;  2JCH A;  3MGS B;  4J8X A;  5BNV A;  3X1S D;  3AFA A;  4J8U C;  3REH B;  5B0Y A;  5B2J D;  5F99 C;  3EPL A;  5GT0 A;  5CP6 D;  1TZY A;  4WU9 A;  3AZL D;  1S32 B;  3KWQ A;  5B32 C;  4XUJ B;  3AV2 D;  4KGC A;  1P3G C;  2HUE B;  3X1S A;  3X1U D;  3UT9 A;  1S32 C;  3WTP C;  3TU4 C;  4Z2M G;  4H9S A;  5AV6 A;  2Y2M A;  5CP6 A;  4J8W D;  3AZJ A;  3LZ0 D;  4DRB A;  4X23 A;  3AZE A;  2Y2G A;  3AZK D;  4XZQ D;  3B6F A;  5E5A B;  5CPJ B;  5AVC D;  5AVB B;  3REJ D;  5B1M B;  3AZI A;  5CPJ C;  5AVB C;  3REL D;  3B6G B;  1AOI A;  1M19 C;  4H9P A;  4CSR B;  1P3K B;  3MNN D;  1ID3 A;  3W99 B;  5CPI B;  2LY8 A;  1M1A A;  3X1T A;  5B24 D;  5B40 C;  3B6G C;  1P3K C;  3REJ A;  3W99 C;  3MGP B;  4H9O B;  5AV9 A;  4QLC D;  3LEL B;  5GXQ D;  5AY8 D;  2BYK B;  3KUY B;  5CPK D;  1WWI A;  4WU8 D;  3MVD B;  3LEL C;  1P3O A;  3LZ1 B;  3AZM C;  5JA4 B;  5CHL B;  1P3M A;  5B0Z B;  3KUY C;  4Z5T B;  4WJ3 C;  5DNN B;  1P3P D;  5GXQ A;  5B0Z C;  3AZH B;  5FUG B;  1N1J B;  5C3I C;  3NQJ A;  4Z5T C;  3MGS D;  4CAY A;  1P3F D;  5DNN C;  4WU8 A;  3UTB D;  3REH D;  4G92 B;  4KUD C;  3VH5 T;  3C1B A;  1M18 B;  2FJ7 C;  5GSU B;  4R8P B;  3KXB A;  4G92 C;  1KU5 A;  4XUJ D;  1M18 C;  2ZY5 A;  4WU9 B;  1H3O B;  5GSU C;  5AV8 A;  2G5I C;  4R8P C;  1EQZ D;  4E44 A;  5GT3 B;  2CV5 B;  2RVQ D;  1ZLA A;  4LD9 A;  3X1S B;  4Z66 C;  5GT3 C;  2CV5 C;  1P3L A;  5AV6 B;  5CP6 B;  2YFW B;  3B0C T;  3P5J B;  5E5A D;  3X1S C;  1P3A D;  5B2J C;  1Q9C A;  3AZL B;  5B1M D;  5AV5 A;  3AZE B;  4G91 C;  3AV2 B;  4DRA A;  3W96 A;  1BH8 A;  3X1U B;  3AZL C;  3AV2 C;  5CPI D;  2ZY3 A;  3AN2 A;  5B1L D;  1B6W A;  5B33 A;  3LZ0 B;  5B31 D;  3X1U C;  3KSY A;  4NE3 A;  3MGR A;  3MGP D;  3AZK B;  4XZQ B;  3A1K A;  4J8W C;  3LZ0 C;  5AVC B;  2F8N H;  3REJ B;  2BYM B;  3AZK C;  4XZQ C;  5DNM C;  3VH5 A;  2F8N A;  3V9R A;  3MVD D;  5AVC C;  2JSS A;  4NE6 A;  3LZ1 D;  4JJN A;  1TAF B;  2HIO A;  4M6B A;  3EPH A;  3REL C;  5B24 B;  4YM6 D;  1A7W A;  3A6N A;  1P3M B;  3MNN C;  3WAA A;  5B24 C;  4QLC B;  3X1V D;  3AL0 C;  5GXQ B;  3EPK A;  5AY8 B;  4J8X D;  3AFA D;  4WU8 B;  5B0Y D;  4QLC C;  5AY8 C;  2Y2O A;  3REK A;  5GT0 D;  3C1B B;  1TZY D;  5CPK C;  3NQU A;  4WU9 D;  3KXB B;  2PYO A;  1P3P B;  3KWQ D;  2Y2P A;  4KGC D;  1ULY A;  1P3F B;  3UT9 D;  1P3P C;  3UTB B;  3EG5 B;  3VH6 W;  3LJA A;  1ZLA B;  3MGS C;  5AV6 D;  3AZF A;  2VQR A;  3AZJ D;  1P3F C;  3UTB C;  2YFV A;  4H9N B;  4Z2M H;  4X23 D;  4H9Q B;  3REH C;  3AZE D;  1KX4 A;  3B6F D;  5G49 A;  3UTA A;  3AV1 A;  5BT1 D;  1EQZ B;  2F8N K;  2Y2K A;  5JRG A;  4XUJ C;  4YS3 A;  3AZI D;  2FFF B;  3W96 B;  1EQZ C;  2HUE C;  1AOI D;  1ID3 D;  2RVQ C;  3W97 A;  1M1A D;  3AYW A;  3X1T D;  1HQ3 D;  5B2I D;  3MGR B;  1P3A B;  2NZD A;  5AV9 D;  1KX3 A;  5E5A C;  1P3A C;  3WA9 A;  5B1M C;  2DF4 C;  1U35 A;  4KHA B;  3V9R B;  5B1L B;  1P3O D;  1HQ3 A;  2W8S A;  2Y2Q A;  5B31 B;  5B2I A;  3O62 A;  4J8V A;  1P3M D;  3REI A;  5CPI C;  5B1L C;  4DQY B;  3A6N B;  5B31 C;  3MGP C;  1P34 A;  3WKJ A;  2ARO A;  3C1C A;  3W98 A;  2ZY2 A;  3C1B D;  3KXB D;  3MVD C;  4YM6 B;  3LZ1 C;  4ZUX A;  3AZN A;  4WV4 B;  1F66 A;  3NQU B;  4UUZ A;  5AV8 D;  1JFI A;  3MGQ A;  3X1V B;  4YM6 C;  1BH9 B;  1ZLA D;  3AZH C;  1F1E A;  4J8X B;  1Z2C B;  5BNV B;  1KX5 A;  4LD9 D;  3AFA B;  2IO5 B;  5B0Y B;  3X1V C;  1P3I A;  1P3L D;  4H9R A;  4J8X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...