3AZJB

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVQRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjB00
4NE6A 2YFWB 1KX3A 1KX5D 5F99A 4KGCB 5BNXA 3AZIC 3AYWA 5B1LD 5B0ZA 3MGQC 3UTBD 1ZLAD 4J8VA 3AZEC 3AZKB 3WKJA 4WZSB 3UTAC 3AZJA 4YS3D 5AV6A 1P3LC 1P3GC 3MGSA 4ZBJC 2F8ND 3LELB 5B32B 1ID3B 3UT9A 4Z66B 3REHD 3REIB 5GXQC 3REKB 3AV1D 4R8PB 4DRAA 5B2IA 4G91C 5E5AB 3W96C 1HQ3B 5B31D 2AROC 3VH6T 3V9RB 5B33C 2NZDC 1P3IB 3MGRB 4HGAC 4YM6C 3O62A 3WAAD 5AVCD 1KX3C 5F99C 5BS7A 4NE3A 2BYKA 5KDMB 4J8WA 3AYWC 1M18A 5AV9B 1BH9B 5CPJB 1P3FD 3W97D 4J8VC 3X1UD 5B2JD 3WKJC 1F66C 4XUJD 5AV6C 1WWIA 3MGPA 3TU4A 5AV5B 4H9RB 3MGSC 1A7WA 4CSRB 2FJ7A 1P3BD 2NQBA 3UT9C 2PYOA 3B6GD 3MVDD 3AZIB 3X1VA 4JJNA 1P3OA 3AZGD 2YFVA 3KSYA 3WTPA 3AZEB 4WU9C 5CPKD 5G49B 5B2IC 3UTAB 1M1AC 3X1TC 1EQZD 1P3LB 1P3GB 1H3OA 4ZBJB 3LJAA 4LD9D 3KUYD 5GT0A 3O62C 4G92C 5BS7C 5GXQB 2HIOA 3LZ1A 5B1MC 4J8WC 4DRBA 4KGCD 3RELC 4QLCC 5DNMA 3AZKD 4G91B 5BO0B 3W96B 4X23A 2AROB 1N1JA 5AVBC 5B33B 3MGPC 2NZDB 3TU4C 4HGAB 4H9OA 4H9PB 3VH5W 1AOIA 3LELD 2FJ7C 5B32D 1ID3D 1KX3B 2PYOC 5F99B 4Z66D 1P3KA 3AYWB 5B24A 5CHLB 4JJNC 3AFAA 1P34A 1P3OC 3REKD 3WTPC 4J8VB 1U35C 1S32D 4R8PD 3WKJB 1F66B 5E5AD 1P3MC 1BFMA 1HQ3D 3W99A 1TZYD 5AV6B 4J8UC 3KXBB 1P3ID 3LJAC 3MGRD 1TAFA 2CWEA 4J8XA 5GT0C 5CP6A 3MNND 3UT9B 4WV4B 3LZ1C 5DNNA 5GT3C 5CPJD 3AV2B 4WU9B 5B2IB 5DNMC 5B1LA 1M1AB 3WTPE 3X1TB 3B0CW 4X23C 3REJA 1ZLAA 3WA9A 4Z5TC 5AV5D 5AY8C 3AZFC 4Z2MG 5C3IC 3O62B 3AZND 4YS3A 4G92B 5GSUC 5JA4A 3KWQA 1P3KC 5B1MB 4J8WB 5B24C 3AZID 2F8NA 3RELB 3AFAC 1P3AD 4QLCB 5CPIC 3NQUA 3REHA 3AZED 4KHAA 4WNNB 3AV1A 3UTAD 3W99C 1M19C 5AVBB 3W98C 3MGPB 3C1CC 1P3LD 3TU4B 1JFIA 3B6FA 4ZUXA 3B0DC 5B31A 2FJ7B 4J8XC 5CP6C 2PYOB 3C1BA 3AZLC 3A6NA 5GXQD 4JJNB 1P3OB 1P3PC 3WTPB 1U35B 5AVCA 5BNVA 1P3FA 1P3MB 3AZHD 3WA9C 5B0YA 4J8UB 3REJC 1H3OB 5B33D 5AV8D 1KX4D 3LJAB 5B2JA 4H9SA 4UUZA 1ULYA 4XUJA 3AN2C 3KWQC 2HUEC 3LZ1B 3LZ0B 3AYWD 5GT3B 5B0ZC 1P3BA 3B6GA 3MVDA 2F8NG 4X23B 1F66D 1N1JB 5JRGA 3AZJC 4Z5TB 5CPKA 3B6FC 5AY8B 3AZFB 3KXBD 3X1SA 4ZUXC 4H9OB 5C3IB 3AZMA 1EQZA 3R45A 2RVQC 1BH8B 5GSUB 3C1BC 3UT9D 1P3KB 3A6NC 5B24B 2L5AA 4LD9A 5B31G 3VH6A 3AFAB 3MGQB 5CPIB 2CV5D 2YFWA 3AV2D 4WU9D 4KGCA 5B2ID 4WU8D 3W99B 1M19B 1M1AD 5B0YC 3X1TD 3W98B 3C1CB 4H9SC 1TAFB 3B0DB 4J8XB 5CP6B 2F8NK 3O62D 3AZLB 1B67A 5B1MD 5B40A 4J8WD 1P3PB 3RELD 3LELA 1M18C 1ID3A 4QLCD 3MVDC 3REKA 3WA9B 3REJB 5JRGC 5AVBD 1S32A 4R8PA 3X1SC 5E5AA 3AZMC 1EQZC 1TZYA 4YM6B 3AN2B 2PYOD 4KUDA 5JA4B 3KWQB 2HUEB 2NQBC 1P3IA 2F8NB 4LD9C 3MGRA 5BT1C 5BNXB 3X1VC 3REID 5B0ZB 3MNNA 3NQUB 3WTPD 1U35D 4KHAB 4EO5C 5KDMA 1BH9A 1P3MD 4XZQA 3AZJB 4J8UD 3B6FB 5FUGA 3LJAD 4ZUXB 3MGSB 3C1BB 3A6NB 3LZ1D 5B40C 2HIOC 3LZ0D 3AZNA 5GT3D 5AV9D 1KX5A 3AZIA 1P3AA 3REKC 3UTBA 5B0YB 4X23D 4H9NA 3AZEA 1S32C 4Z5TD 5G49A 5AY8D 3AZFD 1TZYC 1P3LA 1AOIC 4KUDC 5GSUD 1P3IC 5B24D 2BYKB 1M18B 3MNNC 3MGQD 5CPID 1P34C 5GXQA 4AWLC 4E44A 4XZQC 5JRGB 1M19D 3W98D 1KU5A 3C1CD 1P3GD 3X1SB 3AZMB 1EQZB 3AZHA 4J8XD 3R45B 3VH5T 5AV8A 3AZLD 1KX4A 2NQBB 3X1VB 5DNNC 3AZNC 1P3PD 3WAAA 2YFVB 1KX5C 4EO5B 1P3AC 5B1LC 3UTBC 3W97A 3REJD 3WA9D 3W96D 1ZLAC 2AROD 3X1UA 4CAYA 2NZDD 1F66A 5GT0B 4YM6D 4YS3C 3AN2D 3KXBA 3KWQD 1KX3D 5B40B 5F99D 2HIOB 1WWSA 5B0ZD 2IO5C 2BYMA 3REHC 3VH5A 4H9QA 4J8VD 5DNMB 3AV1C 3WKJD 3AZGA 2CV5A 3NQJA 3B0CT 3AZJD 3AV2A 4WU9A 1S32B 3B6FD 5AV6D 4Z2MH 4WU8A 3MGSD 4ZUXD 3AZHC 1TZYB 3X1TA 1HTAA 1M1AA 5B31C 1AOIB 4KUDB 5AV8C 2RVQD 3C1BD 1KX4C 3A6ND 4E45A 3MNNB 3KUYA 1Q9CA 1P34B 3WAAC 5AVCC 5B1MA 4AWLB 3RELA 2LY8A 4XZQB 4QLCA 1P3FC 3W97C 5B0YD 5FUGB 3X1UC 1R4VA 4WNNA 3AZKA 5B2JC 4XUJC 5AVBA 3KXBC 5DNNB 3AZNB 1M18D 1P3BC 5B32A 3B6GC 1KX5B 4Z66A 3REIA 5B1LB 3UTBB 1P3AB 4H9NB 3AZGC 4NE5A 5JRGD 1U35A 2CV5C 3AV2C 1ZLAB 3MGPD 5CPKC 3TU4D 3X1SD 4WU8C 1P3MA 3AZMD 4J8UA 1HQ3A 2FJ7D 4YS3B 3V9RA 2NQBD 5BT1D 3X1VD 3KUYC 4JJND 1P3OD 2IO5B 2F8NH 3REHB 3LZ0A 4KGCC 1F1EA 3AV1B 5GT3A 5AV9A 2JSSA 5CPJA 1JFIB 4M6BA 3AZKC 3AZHB 5B31B 5AV8B 1KX4B 4Z5TA 5GT0D 5AY8A 3AZFA 5AV5A 4H9RA 5B40D 2HIOD 4CSRA 3LELC 3WAAB 5B32C 5GSUA 5AVCB 1BH8A 1ID3C 4Z66C 5BNVB 3REIC 5DNMD 1P3FB 3MGQA 5CPIA 3W97B 5B32G 3X1UB 4CAYB 4R8PC 5B2JB 3UTAA 5E5AC 4UUZB 4XUJB 1HQ3C 1M19A 3C1CA 3W98A 1AOID 3VH6W 4KUDD 1P3GA 1P3KD 3MGRC 3AFAD 1P3BB 1P34D 3AZLA 3B6GB 3MVDB 2BYMB 4H9QB 3LZ0C 1P3PA 4NFTA 3AZGB 4XZQD 5AV9C 3NQJB 5CPJC 2CV5B 3W99D 5CPKB 4WU8B 1B6WA 3B0BA 3W96A 5BO0A 2AROA 5CP6D 5B33A 2NZDA 5AV5C 4LD9B 5DNND 3KUYB 4YM6A 4H9PA 3AN2A
chains in the Genus database with same CATH superfamily
4NE6A 2YFWB 1KX3A 1KX5D 5F99A 4KGCB 5BNXA 3AZIC 3AYWA 5B1LD 5B0ZA 3MGQC 3UTBD 1ZLAD 4J8VA 3AZEC 3AZKB 3WKJA 4WZSB 3UTAC 3AZJA 4YS3D 5AV6A 1P3LC 1P3GC 3MGSA 4ZBJC 2F8ND 3LELB 5B32B 1ID3B 3UT9A 4Z66B 3REHD 3REIB 4DQYB 5GXQC 3REKB 3AV1D 4R8PB 4DRAA 5B2IA 4G91C 5E5AB 3W96C 1HQ3B 5B31D 2AROC 3VH6T 3V9RB 5B33C 2NZDC 1P3IB 3MGRB 4HGAC 4YM6C 3O62A 3WAAD 5AVCD 1KX3C 5F99C 2Y2PA 5BS7A 4NE3A 2BYKA 5KDMB 4J8WA 3AYWC 1M18A 5AV9B 1BH9B 5CPJB 1P3FD 3W97D 2Y2QA 4J8VC 3X1UD 5B2JD 3WKJC 1F66C 4XUJD 5AV6C 1WWIA 3MGPA 3TU4A 5AV5B 4H9RB 3MGSC 1A7WA 4CSRB 2FJ7A 2XD1A 1P3BD 2NQBA 3UT9C 2PYOA 3B6GD 3MVDD 3P5JB 3AZIB 3X1VA 4JJNA 1P3OA 2Y2MA 3AZGD 2YFVA 3KSYA 3WTPA 3AZEB 4WU9C 5CPKD 5G49B 5B2IC 3H0LC 3UTAB 1M1AC 3X1TC 1EQZD 1P3LB 1P3GB 1H3OA 4ZBJB 3LJAA 4LD9D 3KUYD 5GT0A 3O62C 4G92C 5BS7C 2Y2HA 2HIOA 5GXQB 5B1MC 3LZ1A 4DRBA 4J8WC 4KGCD 3RELC 4QLCC 5DNMA 3AZKD 4G91B 5BO0B 3W96B 4X23A 2AROB 1N1JA 5AVBC 5B33B 2G5HC 3MGPC 2NZDB 3TU4C 4HGAB 4H9OA 4H9PB 3VH5W 1AOIA 3LELD 2FJ7C 5B32D 1ID3D 1KX3B 2PYOC 5F99B 4Z66D 1P3KA 3AYWB 5B24A 5CHLB 4JJNC 3AFAA 1P34A 1P3OC 3REKD 3WTPC 4J8VB 1U35C 1S32D 4R8PD 3WKJB 1F66B 5E5AD 1P3MC 1BFMA 1HQ3D 3W99A 1TZYD 5AV6B 4J8UC 3KXBB 1P3ID 3LJAC 3MGRD 1TAFA 2CWEA 4J8XA 5GT0C 5CP6A 3MNND 3UT9B 4WV4B 3LZ1C 5DNNA 5GT3C 5CPJD 3AV2B 4WU9B 5B2IB 5DNMC 2Y2IA 5B1LA 1M1AB 3WTPE 3X1TB 3B0CW 4X23C 3REJA 1ZLAA 3WA9A 4Z5TC 5AV5D 5AY8C 3AZFC 4Z2MG 3EPHA 5C3IC 3O62B 3AZND 4YS3A 4G92B 5GSUC 5JA4A 3KWQA 2Y2OA 5B1MB 4J8WB 1P3KC 5B24C 3AZID 2F8NA 3RELB 3AFAC 1P3AD 4QLCB 5CPIC 3NQUA 3REHA 3AZED 4KHAA 4WNNB 3AV1A 3UTAD 3W99C 1M19C 5AVBB 3W98C 3MGPB 3C1CC 1P3LD 3TU4B 1JFIA 3B6FA 3EPKA 4ZUXA 3B0DC 5B31A 2FJ7B 4J8XC 5CP6C 2PYOB 3C1BA 3AZLC 3A6NA 5GXQD 4JJNB 1P3OB 1P3PC 3WTPB 1U35B 3A1KA 5AVCA 2Y2NA 5BNVA 2DQNC 1P3FA 1P3MB 3AZHD 3WA9C 5B0YA 4J8UB 3REJC 2XD5A 1H3OB 5B33D 5AV8D 1KX4D 2FFFB 3LJAB 5B2JA 4H9SA 3IP4C 4UUZA 1ULYA 4XUJA 3AN2C 3KWQC 2HUEC 3LZ1B 3LZ0B 3AYWD 5GT3B 5B0ZC 1P3BA 3B6GA 3MVDA 2F8NG 3EPLA 4X23B 1F66D 1N1JB 5JRGA 3AZJC 4Z5TB 5CPKA 3B6FC 5AY8B 3AZFB 3KXBD 3X1SA 4ZUXC 4H9OB 5C3IB 3AZMA 1EQZA 3R45A 2RVQC 1BH8B 5GSUB 3C1BC 3UT9D 1P3KB 3A6NC 5B24B 2L5AA 4LD9A 5B31G 2DF4C 3VH6A 3AFAB 3MGQB 5CPIB 2CV5D 2YFWA 2Y2LA 4WU9D 3AV2D 4KGCA 5B2ID 3A1IA 4WU8D 3W99B 1M19B 1M1AD 5B0YC 3X1TD 3W98B 3C1CB 4H9SC 1TAFB 3B0DB 4J8XB 5CP6B 2F8NK 3O62D 3AZLB 1B67A 2VQRA 5B1MD 5B40A 4J8WD 1P3PB 3RELD 3LELA 1M18C 1ID3A 4QLCD 3MVDC 3REKA 3WA9B 3REJB 2UWXA 5JRGC 5AVBD 3H0RC 1S32A 4R8PA 3X1SC 5E5AA 3AZMC 2Y2KA 1EQZC 3AL0C 1TZYA 4YM6B 3AN2B 2PYOD 4KUDA 5JA4B 3KWQB 2HUEB 2NQBC 1P3IA 2F8NB 4LD9C 3MGRA 5BT1C 5BNXB 3X1VC 3REID 5B0ZB 3MNNA 3NQUB 3WTPD 1U35D 4KHAB 4EO5C 1PZRA 5KDMA 1BH9A 1P3MD 4XZQA 3AZJB 4J8UD 3B6FB 5FUGA 3FDDA 3LJAD 4ZUXB 3MGSB 1T3UA 3C1BB 3A6NB 3LZ1D 5B40C 2HIOC 3LZ0D 3AZNA 5GT3D 5AV9D 1KX5A 3AZIA 1P3AA 3REKC 3UTBA 5B0YB 4X23D 4H9NA 2W8SA 3AZEA 1S32C 4Z5TD 5G49A 5AY8D 3AZFD 1TZYC 1P3LA 1AOIC 4KUDC 5GSUD 1P3IC 5B24D 2BYKB 1M18B 3MNNC 3MGQD 5CPID 1P34C 2ZY2A 5GXQA 1W2EA 4AWLC 4E44A 4XZQC 5JRGB 2Y2JA 1M19D 3W98D 1KU5A 3C1CD 1P3GD 3X1SB 3AZMB 1EQZB 3AZHA 4J8XD 3R45B 3VH5T 5AV8A 3AZLD 1KX4A 2NQBB 1Z2CB 3H0MC 3X1VB 5DNNC 3AZNC 1P3PD 3WAAA 2YFVB 1KX5C 4EO5B 1P3AC 5B1LC 3UTBC 3W97A 3REJD 3WA9D 3W96D 1ZLAC 2AROD 2G5IC 2J8PA 3X1UA 4CAYA 2NZDD 1F66A 5GT0B 4YM6D 4YS3C 3AN2D 3KXBA 3KWQD 1KX3D 2ZY4A 5B40B 5F99D 2HIOB 1WWSA 5B0ZD 2IO5C 2BYMA 3REHC 3VH5A 4H9QA 4J8VD 5DNMB 3AV1C 3WKJD 3AZGA 2CV5A 3NQJA 3B0CT 3AZJD 3AV2A 4WU9A 1S32B 3B6FD 5AV6D 4Z2MH 4WU8A 3MGSD 4ZUXD 3AZHC 1TZYB 3X1TA 1HTAA 1M1AA 5B31C 1AOIB 4KUDB 5AV8C 2RVQD 3C1BD 1KX4C 3A6ND 4E45A 2JCHA 3MNNB 3KUYA 1Q9CA 1P34B 3WAAC 5AVCC 5B1MA 4AWLB 3RELA 2LY8A 2RIQA 4XZQB 4QLCA 1P3FC 3W97C 5B0YD 3KFUG 5FUGB 3X1UC 1R4VA 4WNNA 3AZKA 5B2JC 4XUJC 5AVBA 3KXBC 5DNNB 3AZNB 1M18D 2ZY3A 1P3BC 5B32A 3B6GC 1KX5B 4Z66A 3REIA 5B1LB 3UTBB 1P3AB 4H9NB 3AZGC 4NE5A 5JRGD 1U35A 2CV5C 3AV2C 1ZLAB 3MGPD 5CPKC 3TU4D 3X1SD 4WU8C 1P3MA 3AZMD 4J8UA 1HQ3A 2FJ7D 4YS3B 3V9RA 2NQBD 4WJ3C 5BT1D 2JE5A 3X1VD 3KUYC 4JJND 1P3OD 2IO5B 2F8NH 3REHB 3LZ0A 4KGCC 1F1EA 3AV1B 5GT3A 5AV9A 2JSSA 5CPJA 1JFIB 4M6BA 3AZKC 3AZHB 5B31B 2Y2GA 5AV8B 1KX4B 4Z5TA 5GT0D 3EG5B 5AY8A 3AZFA 5AV5A 4UPKA 5B40D 4H9RA 2HIOD 4CSRA 3LELC 3WAAB 5B32C 5GSUA 5AVCB 1BH8A 1ID3C 2BG1A 4Z66C 5BNVB 3REIC 2ZY5A 5DNMD 1P3FB 3MGQA 5CPIA 3W97B 5B32G 3X1UB 2F2AC 4CAYB 3EPJA 4R8PC 5B2JB 3UTAA 5E5AC 4UUZB 4XUJB 1HQ3C 1M19A 3C1CA 3W98A 1AOID 3VH6W 4KUDD 1P3GA 1P3KD 3MGRC 3AFAD 1P3BB 1P34D 3AZLA 3B6GB 3MVDB 2BYMB 4H9QB 3LZ0C 1P3PA 4NFTA 3AZGB 4XZQD 5AV9C 3NQJB 5CPJC 2CV5B 3F6TA 3W99D 5CPKB 4WU8B 1B6WA 3B0BA 3W96A 5BO0A 2AROA 5CP6D 2ZM5A 5B33A 2NZDA 5AV5C 4LD9B 5DNND 3KUYB 4YM6A 4H9PA 3AN2A
chains in the Genus database with same CATH topology
4NE6A 2YFWB 1KX3A 1KX5D 5F99A 4KGCB 5BNXA 3AZIC 3AYWA 5B1LD 5B0ZA 3MGQC 3UTBD 1ZLAD 4J8VA 3AZEC 3AZKB 3WKJA 4WZSB 3UTAC 3AZJA 4YS3D 5AV6A 1P3LC 1P3GC 3MGSA 4ZBJC 2F8ND 3LELB 5B32B 1ID3B 3UT9A 4Z66B 3REHD 3REIB 4DQYB 5GXQC 3REKB 3AV1D 4R8PB 4DRAA 5B2IA 4G91C 5E5AB 3W96C 1HQ3B 5B31D 2AROC 3VH6T 3V9RB 5B33C 2NZDC 1P3IB 3MGRB 4HGAC 4YM6C 3O62A 3WAAD 5AVCD 1KX3C 5F99C 2Y2PA 5BS7A 4NE3A 2BYKA 5KDMB 4J8WA 3AYWC 1M18A 5AV9B 1BH9B 5CPJB 1P3FD 3W97D 2Y2QA 4J8VC 3X1UD 5B2JD 3WKJC 1F66C 4XUJD 5AV6C 1WWIA 3MGPA 3TU4A 5AV5B 4H9RB 3MGSC 1A7WA 4CSRB 2FJ7A 2XD1A 1P3BD 2NQBA 3UT9C 2PYOA 3B6GD 3MVDD 3P5JB 3AZIB 3X1VA 4JJNA 1P3OA 2Y2MA 3AZGD 2YFVA 3KSYA 3WTPA 3AZEB 4WU9C 5CPKD 5G49B 5B2IC 3H0LC 3UTAB 1M1AC 3X1TC 1EQZD 1P3LB 1P3GB 1H3OA 4ZBJB 3LJAA 4LD9D 3KUYD 5GT0A 3O62C 4G92C 5BS7C 2Y2HA 2HIOA 5GXQB 5B1MC 3LZ1A 4DRBA 4J8WC 4KGCD 3RELC 4QLCC 5DNMA 3AZKD 4G91B 5BO0B 3W96B 4X23A 2AROB 1N1JA 5AVBC 5B33B 2G5HC 3MGPC 2NZDB 3TU4C 4HGAB 4H9OA 4H9PB 3VH5W 1AOIA 3LELD 2FJ7C 5B32D 1ID3D 1KX3B 2PYOC 5F99B 4Z66D 1P3KA 3AYWB 5B24A 5CHLB 4JJNC 3AFAA 1P34A 1P3OC 3REKD 3WTPC 4J8VB 1U35C 1S32D 4R8PD 3WKJB 1F66B 5E5AD 1P3MC 1BFMA 1HQ3D 3W99A 1TZYD 5AV6B 4J8UC 3KXBB 1P3ID 3LJAC 3MGRD 1TAFA 2CWEA 4J8XA 5GT0C 5CP6A 3MNND 3UT9B 4WV4B 3LZ1C 5DNNA 5GT3C 5CPJD 3AV2B 4WU9B 5B2IB 5DNMC 2Y2IA 5B1LA 1M1AB 3WTPE 3X1TB 3B0CW 4X23C 3REJA 1ZLAA 3WA9A 4Z5TC 5AV5D 5AY8C 3AZFC 4Z2MG 3EPHA 5C3IC 3O62B 3AZND 4YS3A 4G92B 5GSUC 5JA4A 3KWQA 2Y2OA 5B1MB 4J8WB 1P3KC 5B24C 3AZID 2F8NA 3RELB 3AFAC 1P3AD 4QLCB 5CPIC 3NQUA 3REHA 3AZED 4KHAA 4WNNB 3AV1A 3UTAD 3W99C 1M19C 5AVBB 3W98C 3MGPB 3C1CC 1P3LD 3TU4B 1JFIA 3B6FA 3EPKA 4ZUXA 3B0DC 5B31A 2FJ7B 4J8XC 5CP6C 2PYOB 3C1BA 3AZLC 3A6NA 5GXQD 4JJNB 1P3OB 1P3PC 3WTPB 1U35B 3A1KA 5AVCA 2Y2NA 5BNVA 2DQNC 1P3FA 1P3MB 3AZHD 3WA9C 5B0YA 4J8UB 3REJC 2XD5A 1H3OB 5B33D 5AV8D 1KX4D 2FFFB 3LJAB 5B2JA 4H9SA 3IP4C 4UUZA 1ULYA 4XUJA 3AN2C 3KWQC 2HUEC 3LZ1B 3LZ0B 3AYWD 5GT3B 5B0ZC 1P3BA 3B6GA 3MVDA 2F8NG 3EPLA 4X23B 1F66D 1N1JB 5JRGA 3AZJC 4Z5TB 5CPKA 3B6FC 5AY8B 3AZFB 3KXBD 3X1SA 4ZUXC 4H9OB 5C3IB 3AZMA 1EQZA 3R45A 2RVQC 1BH8B 5GSUB 3C1BC 3UT9D 1P3KB 3A6NC 5B24B 2L5AA 4LD9A 5B31G 2DF4C 3VH6A 3AFAB 3MGQB 5CPIB 2CV5D 2YFWA 2Y2LA 4WU9D 3AV2D 4KGCA 5B2ID 3A1IA 4WU8D 3W99B 1M19B 1M1AD 5B0YC 3X1TD 3W98B 3C1CB 4H9SC 1TAFB 3B0DB 4J8XB 5CP6B 2F8NK 3O62D 3AZLB 1B67A 2VQRA 5B1MD 5B40A 4J8WD 1P3PB 3RELD 3LELA 1M18C 1ID3A 4QLCD 3MVDC 3REKA 3WA9B 3REJB 2UWXA 5JRGC 5AVBD 3H0RC 1S32A 4R8PA 3X1SC 5E5AA 3AZMC 2Y2KA 1EQZC 3AL0C 1TZYA 4YM6B 3AN2B 2PYOD 4KUDA 5JA4B 3KWQB 2HUEB 2NQBC 1P3IA 2F8NB 4LD9C 3MGRA 5BT1C 5BNXB 3X1VC 3REID 5B0ZB 3MNNA 3NQUB 3WTPD 1U35D 4KHAB 4EO5C 1PZRA 5KDMA 1BH9A 1P3MD 4XZQA 3AZJB 4J8UD 3B6FB 5FUGA 3FDDA 3LJAD 4ZUXB 3MGSB 1T3UA 3C1BB 3A6NB 3LZ1D 5B40C 2HIOC 3LZ0D 3AZNA 5GT3D 5AV9D 1KX5A 3AZIA 1P3AA 3REKC 3UTBA 5B0YB 4X23D 4H9NA 2W8SA 3AZEA 1S32C 4Z5TD 5G49A 5AY8D 3AZFD 1TZYC 1P3LA 1AOIC 4KUDC 5GSUD 1P3IC 5B24D 2BYKB 1M18B 3MNNC 3MGQD 5CPID 1P34C 2ZY2A 5GXQA 1W2EA 4AWLC 4E44A 4XZQC 5JRGB 2Y2JA 1M19D 3W98D 1KU5A 3C1CD 1P3GD 3X1SB 3AZMB 1EQZB 3AZHA 4J8XD 3R45B 3VH5T 5AV8A 3AZLD 1KX4A 2NQBB 1Z2CB 3H0MC 3X1VB 5DNNC 3AZNC 1P3PD 3WAAA 2YFVB 1KX5C 4EO5B 1P3AC 5B1LC 3UTBC 3W97A 3REJD 3WA9D 3W96D 1ZLAC 2AROD 2G5IC 2J8PA 3X1UA 4CAYA 2NZDD 1F66A 5GT0B 4YM6D 4YS3C 3AN2D 3KXBA 3KWQD 1KX3D 2ZY4A 5B40B 5F99D 2HIOB 1WWSA 5B0ZD 2IO5C 2BYMA 3REHC 3VH5A 4H9QA 4J8VD 5DNMB 3AV1C 3WKJD 3AZGA 2CV5A 3NQJA 3B0CT 3AZJD 3AV2A 4WU9A 1S32B 3B6FD 5AV6D 4Z2MH 4WU8A 3MGSD 4ZUXD 3AZHC 1TZYB 3X1TA 1HTAA 1M1AA 5B31C 1AOIB 4KUDB 5AV8C 2RVQD 3C1BD 1KX4C 3A6ND 4E45A 2JCHA 3MNNB 3KUYA 1Q9CA 1P34B 3WAAC 5AVCC 5B1MA 4AWLB 3RELA 2LY8A 2RIQA 4XZQB 4QLCA 1P3FC 3W97C 5B0YD 3KFUG 5FUGB 3X1UC 1R4VA 4WNNA 3AZKA 5B2JC 4XUJC 5AVBA 3KXBC 5DNNB 3AZNB 1M18D 2ZY3A 1P3BC 5B32A 3B6GC 1KX5B 4Z66A 3REIA 5B1LB 3UTBB 1P3AB 4H9NB 3AZGC 4NE5A 5JRGD 1U35A 2CV5C 3AV2C 1ZLAB 3MGPD 5CPKC 3TU4D 3X1SD 4WU8C 1P3MA 3AZMD 4J8UA 1HQ3A 2FJ7D 4YS3B 3V9RA 2NQBD 4WJ3C 5BT1D 2JE5A 3X1VD 3KUYC 4JJND 1P3OD 2IO5B 2F8NH 3REHB 3LZ0A 4KGCC 1F1EA 3AV1B 5GT3A 5AV9A 2JSSA 5CPJA 1JFIB 4M6BA 3AZKC 3AZHB 5B31B 2Y2GA 5AV8B 1KX4B 4Z5TA 5GT0D 3EG5B 5AY8A 3AZFA 5AV5A 4UPKA 5B40D 4H9RA 2HIOD 4CSRA 3LELC 3WAAB 5B32C 5GSUA 5AVCB 1BH8A 1ID3C 2BG1A 4Z66C 5BNVB 3REIC 2ZY5A 5DNMD 1P3FB 3MGQA 5CPIA 3W97B 5B32G 3X1UB 2F2AC 4CAYB 3EPJA 4R8PC 5B2JB 3UTAA 5E5AC 4UUZB 4XUJB 1HQ3C 1M19A 3C1CA 3W98A 1AOID 3VH6W 4KUDD 1P3GA 1P3KD 3MGRC 3AFAD 1P3BB 1P34D 3AZLA 3B6GB 3MVDB 2BYMB 4H9QB 3LZ0C 1P3PA 4NFTA 3AZGB 4XZQD 5AV9C 3NQJB 5CPJC 2CV5B 3F6TA 3W99D 5CPKB 4WU8B 1B6WA 3B0BA 3W96A 5BO0A 2AROA 5CP6D 2ZM5A 5B33A 2NZDA 5AV5C 4LD9B 5DNND 3KUYB 4YM6A 4H9PA 3AN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE6 A;  2YFW B;  1KX3 A;  1KX5 D;  5F99 A;  4KGC B;  5BNX A;  3AZI C;  3AYW A;  5B1L D;  5B0Z A;  3MGQ C;  3UTB D;  1ZLA D;  4J8V A;  3AZE C;  3AZK B;  3WKJ A;  4WZS B;  3UTA C;  3AZJ A;  4YS3 D;  5AV6 A;  1P3L C;  1P3G C;  3MGS A;  4ZBJ C;  2F8N D;  3LEL B;  5B32 B;  1ID3 B;  3UT9 A;  4Z66 B;  3REH D;  3REI B;  5GXQ C;  3REK B;  3AV1 D;  4R8P B;  4DRA A;  5B2I A;  4G91 C;  5E5A B;  3W96 C;  1HQ3 B;  5B31 D;  2ARO C;  3VH6 T;  3V9R B;  5B33 C;  2NZD C;  1P3I B;  3MGR B;  4HGA C;  4YM6 C;  3O62 A;  3WAA D;  5AVC D;  1KX3 C;  5F99 C;  5BS7 A;  4NE3 A;  2BYK A;  5KDM B;  4J8W A;  3AYW C;  1M18 A;  5AV9 B;  1BH9 B;  5CPJ B;  1P3F D;  3W97 D;  4J8V C;  3X1U D;  5B2J D;  3WKJ C;  1F66 C;  4XUJ D;  5AV6 C;  1WWI A;  3MGP A;  3TU4 A;  5AV5 B;  4H9R B;  3MGS C;  1A7W A;  4CSR B;  2FJ7 A;  1P3B D;  2NQB A;  3UT9 C;  2PYO A;  3B6G D;  3MVD D;  3AZI B;  3X1V A;  4JJN A;  1P3O A;  3AZG D;  2YFV A;  3KSY A;  3WTP A;  3AZE B;  4WU9 C;  5CPK D;  5G49 B;  5B2I C;  3UTA B;  1M1A C;  3X1T C;  1EQZ D;  1P3L B;  1P3G B;  1H3O A;  4ZBJ B;  3LJA A;  4LD9 D;  3KUY D;  5GT0 A;  3O62 C;  4G92 C;  5BS7 C;  5GXQ B;  2HIO A;  3LZ1 A;  5B1M C;  4J8W C;  4DRB A;  4KGC D;  3REL C;  4QLC C;  5DNM A;  3AZK D;  4G91 B;  5BO0 B;  3W96 B;  4X23 A;  2ARO B;  1N1J A;  5AVB C;  5B33 B;  3MGP C;  2NZD B;  3TU4 C;  4HGA B;  4H9O A;  4H9P B;  3VH5 W;  1AOI A;  3LEL D;  2FJ7 C;  5B32 D;  1ID3 D;  1KX3 B;  2PYO C;  5F99 B;  4Z66 D;  1P3K A;  3AYW B;  5B24 A;  5CHL B;  4JJN C;  3AFA A;  1P34 A;  1P3O C;  3REK D;  3WTP C;  4J8V B;  1U35 C;  1S32 D;  4R8P D;  3WKJ B;  1F66 B;  5E5A D;  1P3M C;  1BFM A;  1HQ3 D;  3W99 A;  1TZY D;  5AV6 B;  4J8U C;  3KXB B;  1P3I D;  3LJA C;  3MGR D;  1TAF A;  2CWE A;  4J8X A;  5GT0 C;  5CP6 A;  3MNN D;  3UT9 B;  4WV4 B;  3LZ1 C;  5DNN A;  5GT3 C;  5CPJ D;  3AV2 B;  4WU9 B;  5B2I B;  5DNM C;  5B1L A;  1M1A B;  3WTP E;  3X1T B;  3B0C W;  4X23 C;  3REJ A;  1ZLA A;  3WA9 A;  4Z5T C;  5AV5 D;  5AY8 C;  3AZF C;  4Z2M G;  5C3I C;  3O62 B;  3AZN D;  4YS3 A;  4G92 B;  5GSU C;  5JA4 A;  3KWQ A;  1P3K C;  5B1M B;  4J8W B;  5B24 C;  3AZI D;  2F8N A;  3REL B;  3AFA C;  1P3A D;  4QLC B;  5CPI C;  3NQU A;  3REH A;  3AZE D;  4KHA A;  4WNN B;  3AV1 A;  3UTA D;  3W99 C;  1M19 C;  5AVB B;  3W98 C;  3MGP B;  3C1C C;  1P3L D;  3TU4 B;  1JFI A;  3B6F A;  4ZUX A;  3B0D C;  5B31 A;  2FJ7 B;  4J8X C;  5CP6 C;  2PYO B;  3C1B A;  3AZL C;  3A6N A;  5GXQ D;  4JJN B;  1P3O B;  1P3P C;  3WTP B;  1U35 B;  5AVC A;  5BNV A;  1P3F A;  1P3M B;  3AZH D;  3WA9 C;  5B0Y A;  4J8U B;  3REJ C;  1H3O B;  5B33 D;  5AV8 D;  1KX4 D;  3LJA B;  5B2J A;  4H9S A;  4UUZ A;  1ULY A;  4XUJ A;  3AN2 C;  3KWQ C;  2HUE C;  3LZ1 B;  3LZ0 B;  3AYW D;  5GT3 B;  5B0Z C;  1P3B A;  3B6G A;  3MVD A;  2F8N G;  4X23 B;  1F66 D;  1N1J B;  5JRG A;  3AZJ C;  4Z5T B;  5CPK A;  3B6F C;  5AY8 B;  3AZF B;  3KXB D;  3X1S A;  4ZUX C;  4H9O B;  5C3I B;  3AZM A;  1EQZ A;  3R45 A;  2RVQ C;  1BH8 B;  5GSU B;  3C1B C;  3UT9 D;  1P3K B;  3A6N C;  5B24 B;  2L5A A;  4LD9 A;  5B31 G;  3VH6 A;  3AFA B;  3MGQ B;  5CPI B;  2CV5 D;  2YFW A;  3AV2 D;  4WU9 D;  4KGC A;  5B2I D;  4WU8 D;  3W99 B;  1M19 B;  1M1A D;  5B0Y C;  3X1T D;  3W98 B;  3C1C B;  4H9S C;  1TAF B;  3B0D B;  4J8X B;  5CP6 B;  2F8N K;  3O62 D;  3AZL B;  1B67 A;  5B1M D;  5B40 A;  4J8W D;  1P3P B;  3REL D;  3LEL A;  1M18 C;  1ID3 A;  4QLC D;  3MVD C;  3REK A;  3WA9 B;  3REJ B;  5JRG C;  5AVB D;  1S32 A;  4R8P A;  3X1S C;  5E5A A;  3AZM C;  1EQZ C;  1TZY A;  4YM6 B;  3AN2 B;  2PYO D;  4KUD A;  5JA4 B;  3KWQ B;  2HUE B;  2NQB C;  1P3I A;  2F8N B;  4LD9 C;  3MGR A;  5BT1 C;  5BNX B;  3X1V C;  3REI D;  5B0Z B;  3MNN A;  3NQU B;  3WTP D;  1U35 D;  4KHA B;  4EO5 C;  5KDM A;  1BH9 A;  1P3M D;  4XZQ A;  3AZJ B;  4J8U D;  3B6F B;  5FUG A;  3LJA D;  4ZUX B;  3MGS B;  3C1B B;  3A6N B;  3LZ1 D;  5B40 C;  2HIO C;  3LZ0 D;  3AZN A;  5GT3 D;  5AV9 D;  1KX5 A;  3AZI A;  1P3A A;  3REK C;  3UTB A;  5B0Y B;  4X23 D;  4H9N A;  3AZE A;  1S32 C;  4Z5T D;  5G49 A;  5AY8 D;  3AZF D;  1TZY C;  1P3L A;  1AOI C;  4KUD C;  5GSU D;  1P3I C;  5B24 D;  2BYK B;  1M18 B;  3MNN C;  3MGQ D;  5CPI D;  1P34 C;  5GXQ A;  4AWL C;  4E44 A;  4XZQ C;  5JRG B;  1M19 D;  3W98 D;  1KU5 A;  3C1C D;  1P3G D;  3X1S B;  3AZM B;  1EQZ B;  3AZH A;  4J8X D;  3R45 B;  3VH5 T;  5AV8 A;  3AZL D;  1KX4 A;  2NQB B;  3X1V B;  5DNN C;  3AZN C;  1P3P D;  3WAA A;  2YFV B;  1KX5 C;  4EO5 B;  1P3A C;  5B1L C;  3UTB C;  3W97 A;  3REJ D;  3WA9 D;  3W96 D;  1ZLA C;  2ARO D;  3X1U A;  4CAY A;  2NZD D;  1F66 A;  5GT0 B;  4YM6 D;  4YS3 C;  3AN2 D;  3KXB A;  3KWQ D;  1KX3 D;  5B40 B;  5F99 D;  2HIO B;  1WWS A;  5B0Z D;  2IO5 C;  2BYM A;  3REH C;  3VH5 A;  4H9Q A;  4J8V D;  5DNM B;  3AV1 C;  3WKJ D;  3AZG A;  2CV5 A;  3NQJ A;  3B0C T;  3AZJ D;  3AV2 A;  4WU9 A;  1S32 B;  3B6F D;  5AV6 D;  4Z2M H;  4WU8 A;  3MGS D;  4ZUX D;  3AZH C;  1TZY B;  3X1T A;  1HTA A;  1M1A A;  5B31 C;  1AOI B;  4KUD B;  5AV8 C;  2RVQ D;  3C1B D;  1KX4 C;  3A6N D;  4E45 A;  3MNN B;  3KUY A;  1Q9C A;  1P34 B;  3WAA C;  5AVC C;  5B1M A;  4AWL B;  3REL A;  2LY8 A;  4XZQ B;  4QLC A;  1P3F C;  3W97 C;  5B0Y D;  5FUG B;  3X1U C;  1R4V A;  4WNN A;  3AZK A;  5B2J C;  4XUJ C;  5AVB A;  3KXB C;  5DNN B;  3AZN B;  1M18 D;  1P3B C;  5B32 A;  3B6G C;  1KX5 B;  4Z66 A;  3REI A;  5B1L B;  3UTB B;  1P3A B;  4H9N B;  3AZG C;  4NE5 A;  5JRG D;  1U35 A;  2CV5 C;  3AV2 C;  1ZLA B;  3MGP D;  5CPK C;  3TU4 D;  3X1S D;  4WU8 C;  1P3M A;  3AZM D;  4J8U A;  1HQ3 A;  2FJ7 D;  4YS3 B;  3V9R A;  2NQB D;  5BT1 D;  3X1V D;  3KUY C;  4JJN D;  1P3O D;  2IO5 B;  2F8N H;  3REH B;  3LZ0 A;  4KGC C;  1F1E A;  3AV1 B;  5GT3 A;  5AV9 A;  2JSS A;  5CPJ A;  1JFI B;  4M6B A;  3AZK C;  3AZH B;  5B31 B;  5AV8 B;  1KX4 B;  4Z5T A;  5GT0 D;  5AY8 A;  3AZF A;  5AV5 A;  4H9R A;  5B40 D;  2HIO D;  4CSR A;  3LEL C;  3WAA B;  5B32 C;  5GSU A;  5AVC B;  1BH8 A;  1ID3 C;  4Z66 C;  5BNV B;  3REI C;  5DNM D;  1P3F B;  3MGQ A;  5CPI A;  3W97 B;  5B32 G;  3X1U B;  4CAY B;  4R8P C;  5B2J B;  3UTA A;  5E5A C;  4UUZ B;  4XUJ B;  1HQ3 C;  1M19 A;  3C1C A;  3W98 A;  1AOI D;  3VH6 W;  4KUD D;  1P3G A;  1P3K D;  3MGR C;  3AFA D;  1P3B B;  1P34 D;  3AZL A;  3B6G B;  3MVD B;  2BYM B;  4H9Q B;  3LZ0 C;  1P3P A;  4NFT A;  3AZG B;  4XZQ D;  5AV9 C;  3NQJ B;  5CPJ C;  2CV5 B;  3W99 D;  5CPK B;  4WU8 B;  1B6W A;  3B0B A;  3W96 A;  5BO0 A;  2ARO A;  5CP6 D;  5B33 A;  2NZD A;  5AV5 C;  4LD9 B;  5DNN D;  3KUY B;  4YM6 A;  4H9P A;  3AN2 A; 
#chains in the Genus database with same CATH topology
 4NE6 A;  2YFW B;  1KX3 A;  1KX5 D;  5F99 A;  4KGC B;  5BNX A;  3AZI C;  3AYW A;  5B1L D;  5B0Z A;  3MGQ C;  3UTB D;  1ZLA D;  4J8V A;  3AZE C;  3AZK B;  3WKJ A;  4WZS B;  3UTA C;  3AZJ A;  4YS3 D;  5AV6 A;  1P3L C;  1P3G C;  3MGS A;  4ZBJ C;  2F8N D;  3LEL B;  5B32 B;  1ID3 B;  3UT9 A;  4Z66 B;  3REH D;  3REI B;  4DQY B;  5GXQ C;  3REK B;  3AV1 D;  4R8P B;  4DRA A;  5B2I A;  4G91 C;  5E5A B;  3W96 C;  1HQ3 B;  5B31 D;  2ARO C;  3VH6 T;  3V9R B;  5B33 C;  2NZD C;  1P3I B;  3MGR B;  4HGA C;  4YM6 C;  3O62 A;  3WAA D;  5AVC D;  1KX3 C;  5F99 C;  2Y2P A;  5BS7 A;  4NE3 A;  2BYK A;  5KDM B;  4J8W A;  3AYW C;  1M18 A;  5AV9 B;  1BH9 B;  5CPJ B;  1P3F D;  3W97 D;  2Y2Q A;  4J8V C;  3X1U D;  5B2J D;  3WKJ C;  1F66 C;  4XUJ D;  5AV6 C;  1WWI A;  3MGP A;  3TU4 A;  5AV5 B;  4H9R B;  3MGS C;  1A7W A;  4CSR B;  2FJ7 A;  2XD1 A;  1P3B D;  2NQB A;  3UT9 C;  2PYO A;  3B6G D;  3MVD D;  3P5J B;  3AZI B;  3X1V A;  4JJN A;  1P3O A;  2Y2M A;  3AZG D;  2YFV A;  3KSY A;  3WTP A;  3AZE B;  4WU9 C;  5CPK D;  5G49 B;  5B2I C;  3H0L C;  3UTA B;  1M1A C;  3X1T C;  1EQZ D;  1P3L B;  1P3G B;  1H3O A;  4ZBJ B;  3LJA A;  4LD9 D;  3KUY D;  5GT0 A;  3O62 C;  4G92 C;  5BS7 C;  2Y2H A;  2HIO A;  5GXQ B;  5B1M C;  3LZ1 A;  4DRB A;  4J8W C;  4KGC D;  3REL C;  4QLC C;  5DNM A;  3AZK D;  4G91 B;  5BO0 B;  3W96 B;  4X23 A;  2ARO B;  1N1J A;  5AVB C;  5B33 B;  2G5H C;  3MGP C;  2NZD B;  3TU4 C;  4HGA B;  4H9O A;  4H9P B;  3VH5 W;  1AOI A;  3LEL D;  2FJ7 C;  5B32 D;  1ID3 D;  1KX3 B;  2PYO C;  5F99 B;  4Z66 D;  1P3K A;  3AYW B;  5B24 A;  5CHL B;  4JJN C;  3AFA A;  1P34 A;  1P3O C;  3REK D;  3WTP C;  4J8V B;  1U35 C;  1S32 D;  4R8P D;  3WKJ B;  1F66 B;  5E5A D;  1P3M C;  1BFM A;  1HQ3 D;  3W99 A;  1TZY D;  5AV6 B;  4J8U C;  3KXB B;  1P3I D;  3LJA C;  3MGR D;  1TAF A;  2CWE A;  4J8X A;  5GT0 C;  5CP6 A;  3MNN D;  3UT9 B;  4WV4 B;  3LZ1 C;  5DNN A;  5GT3 C;  5CPJ D;  3AV2 B;  4WU9 B;  5B2I B;  5DNM C;  2Y2I A;  5B1L A;  1M1A B;  3WTP E;  3X1T B;  3B0C W;  4X23 C;  3REJ A;  1ZLA A;  3WA9 A;  4Z5T C;  5AV5 D;  5AY8 C;  3AZF C;  4Z2M G;  3EPH A;  5C3I C;  3O62 B;  3AZN D;  4YS3 A;  4G92 B;  5GSU C;  5JA4 A;  3KWQ A;  2Y2O A;  5B1M B;  4J8W B;  1P3K C;  5B24 C;  3AZI D;  2F8N A;  3REL B;  3AFA C;  1P3A D;  4QLC B;  5CPI C;  3NQU A;  3REH A;  3AZE D;  4KHA A;  4WNN B;  3AV1 A;  3UTA D;  3W99 C;  1M19 C;  5AVB B;  3W98 C;  3MGP B;  3C1C C;  1P3L D;  3TU4 B;  1JFI A;  3B6F A;  3EPK A;  4ZUX A;  3B0D C;  5B31 A;  2FJ7 B;  4J8X C;  5CP6 C;  2PYO B;  3C1B A;  3AZL C;  3A6N A;  5GXQ D;  4JJN B;  1P3O B;  1P3P C;  3WTP B;  1U35 B;  3A1K A;  5AVC A;  2Y2N A;  5BNV A;  2DQN C;  1P3F A;  1P3M B;  3AZH D;  3WA9 C;  5B0Y A;  4J8U B;  3REJ C;  2XD5 A;  1H3O B;  5B33 D;  5AV8 D;  1KX4 D;  2FFF B;  3LJA B;  5B2J A;  4H9S A;  3IP4 C;  4UUZ A;  1ULY A;  4XUJ A;  3AN2 C;  3KWQ C;  2HUE C;  3LZ1 B;  3LZ0 B;  3AYW D;  5GT3 B;  5B0Z C;  1P3B A;  3B6G A;  3MVD A;  2F8N G;  3EPL A;  4X23 B;  1F66 D;  1N1J B;  5JRG A;  3AZJ C;  4Z5T B;  5CPK A;  3B6F C;  5AY8 B;  3AZF B;  3KXB D;  3X1S A;  4ZUX C;  4H9O B;  5C3I B;  3AZM A;  1EQZ A;  3R45 A;  2RVQ C;  1BH8 B;  5GSU B;  3C1B C;  3UT9 D;  1P3K B;  3A6N C;  5B24 B;  2L5A A;  4LD9 A;  5B31 G;  2DF4 C;  3VH6 A;  3AFA B;  3MGQ B;  5CPI B;  2CV5 D;  2YFW A;  2Y2L A;  4WU9 D;  3AV2 D;  4KGC A;  5B2I D;  3A1I A;  4WU8 D;  3W99 B;  1M19 B;  1M1A D;  5B0Y C;  3X1T D;  3W98 B;  3C1C B;  4H9S C;  1TAF B;  3B0D B;  4J8X B;  5CP6 B;  2F8N K;  3O62 D;  3AZL B;  1B67 A;  2VQR A;  5B1M D;  5B40 A;  4J8W D;  1P3P B;  3REL D;  3LEL A;  1M18 C;  1ID3 A;  4QLC D;  3MVD C;  3REK A;  3WA9 B;  3REJ B;  2UWX A;  5JRG C;  5AVB D;  3H0R C;  1S32 A;  4R8P A;  3X1S C;  5E5A A;  3AZM C;  2Y2K A;  1EQZ C;  3AL0 C;  1TZY A;  4YM6 B;  3AN2 B;  2PYO D;  4KUD A;  5JA4 B;  3KWQ B;  2HUE B;  2NQB C;  1P3I A;  2F8N B;  4LD9 C;  3MGR A;  5BT1 C;  5BNX B;  3X1V C;  3REI D;  5B0Z B;  3MNN A;  3NQU B;  3WTP D;  1U35 D;  4KHA B;  4EO5 C;  1PZR A;  5KDM A;  1BH9 A;  1P3M D;  4XZQ A;  3AZJ B;  4J8U D;  3B6F B;  5FUG A;  3FDD A;  3LJA D;  4ZUX B;  3MGS B;  1T3U A;  3C1B B;  3A6N B;  3LZ1 D;  5B40 C;  2HIO C;  3LZ0 D;  3AZN A;  5GT3 D;  5AV9 D;  1KX5 A;  3AZI A;  1P3A A;  3REK C;  3UTB A;  5B0Y B;  4X23 D;  4H9N A;  2W8S A;  3AZE A;  1S32 C;  4Z5T D;  5G49 A;  5AY8 D;  3AZF D;  1TZY C;  1P3L A;  1AOI C;  4KUD C;  5GSU D;  1P3I C;  5B24 D;  2BYK B;  1M18 B;  3MNN C;  3MGQ D;  5CPI D;  1P34 C;  2ZY2 A;  5GXQ A;  1W2E A;  4AWL C;  4E44 A;  4XZQ C;  5JRG B;  2Y2J A;  1M19 D;  3W98 D;  1KU5 A;  3C1C D;  1P3G D;  3X1S B;  3AZM B;  1EQZ B;  3AZH A;  4J8X D;  3R45 B;  3VH5 T;  5AV8 A;  3AZL D;  1KX4 A;  2NQB B;  1Z2C B;  3H0M C;  3X1V B;  5DNN C;  3AZN C;  1P3P D;  3WAA A;  2YFV B;  1KX5 C;  4EO5 B;  1P3A C;  5B1L C;  3UTB C;  3W97 A;  3REJ D;  3WA9 D;  3W96 D;  1ZLA C;  2ARO D;  2G5I C;  2J8P A;  3X1U A;  4CAY A;  2NZD D;  1F66 A;  5GT0 B;  4YM6 D;  4YS3 C;  3AN2 D;  3KXB A;  3KWQ D;  1KX3 D;  2ZY4 A;  5B40 B;  5F99 D;  2HIO B;  1WWS A;  5B0Z D;  2IO5 C;  2BYM A;  3REH C;  3VH5 A;  4H9Q A;  4J8V D;  5DNM B;  3AV1 C;  3WKJ D;  3AZG A;  2CV5 A;  3NQJ A;  3B0C T;  3AZJ D;  3AV2 A;  4WU9 A;  1S32 B;  3B6F D;  5AV6 D;  4Z2M H;  4WU8 A;  3MGS D;  4ZUX D;  3AZH C;  1TZY B;  3X1T A;  1HTA A;  1M1A A;  5B31 C;  1AOI B;  4KUD B;  5AV8 C;  2RVQ D;  3C1B D;  1KX4 C;  3A6N D;  4E45 A;  2JCH A;  3MNN B;  3KUY A;  1Q9C A;  1P34 B;  3WAA C;  5AVC C;  5B1M A;  4AWL B;  3REL A;  2LY8 A;  2RIQ A;  4XZQ B;  4QLC A;  1P3F C;  3W97 C;  5B0Y D;  3KFU G;  5FUG B;  3X1U C;  1R4V A;  4WNN A;  3AZK A;  5B2J C;  4XUJ C;  5AVB A;  3KXB C;  5DNN B;  3AZN B;  1M18 D;  2ZY3 A;  1P3B C;  5B32 A;  3B6G C;  1KX5 B;  4Z66 A;  3REI A;  5B1L B;  3UTB B;  1P3A B;  4H9N B;  3AZG C;  4NE5 A;  5JRG D;  1U35 A;  2CV5 C;  3AV2 C;  1ZLA B;  3MGP D;  5CPK C;  3TU4 D;  3X1S D;  4WU8 C;  1P3M A;  3AZM D;  4J8U A;  1HQ3 A;  2FJ7 D;  4YS3 B;  3V9R A;  2NQB D;  4WJ3 C;  5BT1 D;  2JE5 A;  3X1V D;  3KUY C;  4JJN D;  1P3O D;  2IO5 B;  2F8N H;  3REH B;  3LZ0 A;  4KGC C;  1F1E A;  3AV1 B;  5GT3 A;  5AV9 A;  2JSS A;  5CPJ A;  1JFI B;  4M6B A;  3AZK C;  3AZH B;  5B31 B;  2Y2G A;  5AV8 B;  1KX4 B;  4Z5T A;  5GT0 D;  3EG5 B;  5AY8 A;  3AZF A;  5AV5 A;  4UPK A;  5B40 D;  4H9R A;  2HIO D;  4CSR A;  3LEL C;  3WAA B;  5B32 C;  5GSU A;  5AVC B;  1BH8 A;  1ID3 C;  2BG1 A;  4Z66 C;  5BNV B;  3REI C;  2ZY5 A;  5DNM D;  1P3F B;  3MGQ A;  5CPI A;  3W97 B;  5B32 G;  3X1U B;  2F2A C;  4CAY B;  3EPJ A;  4R8P C;  5B2J B;  3UTA A;  5E5A C;  4UUZ B;  4XUJ B;  1HQ3 C;  1M19 A;  3C1C A;  3W98 A;  1AOI D;  3VH6 W;  4KUD D;  1P3G A;  1P3K D;  3MGR C;  3AFA D;  1P3B B;  1P34 D;  3AZL A;  3B6G B;  3MVD B;  2BYM B;  4H9Q B;  3LZ0 C;  1P3P A;  4NFT A;  3AZG B;  4XZQ D;  5AV9 C;  3NQJ B;  5CPJ C;  2CV5 B;  3F6T A;  3W99 D;  5CPK B;  4WU8 B;  1B6W A;  3B0B A;  3W96 A;  5BO0 A;  2ARO A;  5CP6 D;  2ZM5 A;  5B33 A;  2NZD A;  5AV5 C;  4LD9 B;  5DNN D;  3KUY B;  4YM6 A;  4H9P A;  3AN2 A; 
#chains in the Genus database with same CATH homology
 4NE6 A;  2YFW B;  1KX3 A;  1KX5 D;  5F99 A;  4KGC B;  5BNX A;  3AZI C;  3AYW A;  5B1L D;  5B0Z A;  3MGQ C;  3UTB D;  1ZLA D;  4J8V A;  3AZE C;  3AZK B;  3WKJ A;  4WZS B;  3UTA C;  3AZJ A;  4YS3 D;  5AV6 A;  1P3L C;  1P3G C;  3MGS A;  4ZBJ C;  2F8N D;  3LEL B;  5B32 B;  1ID3 B;  3UT9 A;  4Z66 B;  3REH D;  3REI B;  4DQY B;  5GXQ C;  3REK B;  3AV1 D;  4R8P B;  4DRA A;  5B2I A;  4G91 C;  5E5A B;  3W96 C;  1HQ3 B;  5B31 D;  2ARO C;  3VH6 T;  3V9R B;  5B33 C;  2NZD C;  1P3I B;  3MGR B;  4HGA C;  4YM6 C;  3O62 A;  3WAA D;  5AVC D;  1KX3 C;  5F99 C;  2Y2P A;  5BS7 A;  4NE3 A;  2BYK A;  5KDM B;  4J8W A;  3AYW C;  1M18 A;  5AV9 B;  1BH9 B;  5CPJ B;  1P3F D;  3W97 D;  2Y2Q A;  4J8V C;  3X1U D;  5B2J D;  3WKJ C;  1F66 C;  4XUJ D;  5AV6 C;  1WWI A;  3MGP A;  3TU4 A;  5AV5 B;  4H9R B;  3MGS C;  1A7W A;  4CSR B;  2FJ7 A;  2XD1 A;  1P3B D;  2NQB A;  3UT9 C;  2PYO A;  3B6G D;  3MVD D;  3P5J B;  3AZI B;  3X1V A;  4JJN A;  1P3O A;  2Y2M A;  3AZG D;  2YFV A;  3KSY A;  3WTP A;  3AZE B;  4WU9 C;  5CPK D;  5G49 B;  5B2I C;  3H0L C;  3UTA B;  1M1A C;  3X1T C;  1EQZ D;  1P3L B;  1P3G B;  1H3O A;  4ZBJ B;  3LJA A;  4LD9 D;  3KUY D;  5GT0 A;  3O62 C;  4G92 C;  5BS7 C;  2Y2H A;  2HIO A;  5GXQ B;  5B1M C;  3LZ1 A;  4DRB A;  4J8W C;  4KGC D;  3REL C;  4QLC C;  5DNM A;  3AZK D;  4G91 B;  5BO0 B;  3W96 B;  4X23 A;  2ARO B;  1N1J A;  5AVB C;  5B33 B;  2G5H C;  3MGP C;  2NZD B;  3TU4 C;  4HGA B;  4H9O A;  4H9P B;  3VH5 W;  1AOI A;  3LEL D;  2FJ7 C;  5B32 D;  1ID3 D;  1KX3 B;  2PYO C;  5F99 B;  4Z66 D;  1P3K A;  3AYW B;  5B24 A;  5CHL B;  4JJN C;  3AFA A;  1P34 A;  1P3O C;  3REK D;  3WTP C;  4J8V B;  1U35 C;  1S32 D;  4R8P D;  3WKJ B;  1F66 B;  5E5A D;  1P3M C;  1BFM A;  1HQ3 D;  3W99 A;  1TZY D;  5AV6 B;  4J8U C;  3KXB B;  1P3I D;  3LJA C;  3MGR D;  1TAF A;  2CWE A;  4J8X A;  5GT0 C;  5CP6 A;  3MNN D;  3UT9 B;  4WV4 B;  3LZ1 C;  5DNN A;  5GT3 C;  5CPJ D;  3AV2 B;  4WU9 B;  5B2I B;  5DNM C;  2Y2I A;  5B1L A;  1M1A B;  3WTP E;  3X1T B;  3B0C W;  4X23 C;  3REJ A;  1ZLA A;  3WA9 A;  4Z5T C;  5AV5 D;  5AY8 C;  3AZF C;  4Z2M G;  3EPH A;  5C3I C;  3O62 B;  3AZN D;  4YS3 A;  4G92 B;  5GSU C;  5JA4 A;  3KWQ A;  2Y2O A;  5B1M B;  4J8W B;  1P3K C;  5B24 C;  3AZI D;  2F8N A;  3REL B;  3AFA C;  1P3A D;  4QLC B;  5CPI C;  3NQU A;  3REH A;  3AZE D;  4KHA A;  4WNN B;  3AV1 A;  3UTA D;  3W99 C;  1M19 C;  5AVB B;  3W98 C;  3MGP B;  3C1C C;  1P3L D;  3TU4 B;  1JFI A;  3B6F A;  3EPK A;  4ZUX A;  3B0D C;  5B31 A;  2FJ7 B;  4J8X C;  5CP6 C;  2PYO B;  3C1B A;  3AZL C;  3A6N A;  5GXQ D;  4JJN B;  1P3O B;  1P3P C;  3WTP B;  1U35 B;  3A1K A;  5AVC A;  2Y2N A;  5BNV A;  2DQN C;  1P3F A;  1P3M B;  3AZH D;  3WA9 C;  5B0Y A;  4J8U B;  3REJ C;  2XD5 A;  1H3O B;  5B33 D;  5AV8 D;  1KX4 D;  2FFF B;  3LJA B;  5B2J A;  4H9S A;  3IP4 C;  4UUZ A;  1ULY A;  4XUJ A;  3AN2 C;  3KWQ C;  2HUE C;  3LZ1 B;  3LZ0 B;  3AYW D;  5GT3 B;  5B0Z C;  1P3B A;  3B6G A;  3MVD A;  2F8N G;  3EPL A;  4X23 B;  1F66 D;  1N1J B;  5JRG A;  3AZJ C;  4Z5T B;  5CPK A;  3B6F C;  5AY8 B;  3AZF B;  3KXB D;  3X1S A;  4ZUX C;  4H9O B;  5C3I B;  3AZM A;  1EQZ A;  3R45 A;  2RVQ C;  1BH8 B;  5GSU B;  3C1B C;  3UT9 D;  1P3K B;  3A6N C;  5B24 B;  2L5A A;  4LD9 A;  5B31 G;  2DF4 C;  3VH6 A;  3AFA B;  3MGQ B;  5CPI B;  2CV5 D;  2YFW A;  2Y2L A;  4WU9 D;  3AV2 D;  4KGC A;  5B2I D;  3A1I A;  4WU8 D;  3W99 B;  1M19 B;  1M1A D;  5B0Y C;  3X1T D;  3W98 B;  3C1C B;  4H9S C;  1TAF B;  3B0D B;  4J8X B;  5CP6 B;  2F8N K;  3O62 D;  3AZL B;  1B67 A;  2VQR A;  5B1M D;  5B40 A;  4J8W D;  1P3P B;  3REL D;  3LEL A;  1M18 C;  1ID3 A;  4QLC D;  3MVD C;  3REK A;  3WA9 B;  3REJ B;  2UWX A;  5JRG C;  5AVB D;  3H0R C;  1S32 A;  4R8P A;  3X1S C;  5E5A A;  3AZM C;  2Y2K A;  1EQZ C;  3AL0 C;  1TZY A;  4YM6 B;  3AN2 B;  2PYO D;  4KUD A;  5JA4 B;  3KWQ B;  2HUE B;  2NQB C;  1P3I A;  2F8N B;  4LD9 C;  3MGR A;  5BT1 C;  5BNX B;  3X1V C;  3REI D;  5B0Z B;  3MNN A;  3NQU B;  3WTP D;  1U35 D;  4KHA B;  4EO5 C;  1PZR A;  5KDM A;  1BH9 A;  1P3M D;  4XZQ A;  3AZJ B;  4J8U D;  3B6F B;  5FUG A;  3FDD A;  3LJA D;  4ZUX B;  3MGS B;  1T3U A;  3C1B B;  3A6N B;  3LZ1 D;  5B40 C;  2HIO C;  3LZ0 D;  3AZN A;  5GT3 D;  5AV9 D;  1KX5 A;  3AZI A;  1P3A A;  3REK C;  3UTB A;  5B0Y B;  4X23 D;  4H9N A;  2W8S A;  3AZE A;  1S32 C;  4Z5T D;  5G49 A;  5AY8 D;  3AZF D;  1TZY C;  1P3L A;  1AOI C;  4KUD C;  5GSU D;  1P3I C;  5B24 D;  2BYK B;  1M18 B;  3MNN C;  3MGQ D;  5CPI D;  1P34 C;  2ZY2 A;  5GXQ A;  1W2E A;  4AWL C;  4E44 A;  4XZQ C;  5JRG B;  2Y2J A;  1M19 D;  3W98 D;  1KU5 A;  3C1C D;  1P3G D;  3X1S B;  3AZM B;  1EQZ B;  3AZH A;  4J8X D;  3R45 B;  3VH5 T;  5AV8 A;  3AZL D;  1KX4 A;  2NQB B;  1Z2C B;  3H0M C;  3X1V B;  5DNN C;  3AZN C;  1P3P D;  3WAA A;  2YFV B;  1KX5 C;  4EO5 B;  1P3A C;  5B1L C;  3UTB C;  3W97 A;  3REJ D;  3WA9 D;  3W96 D;  1ZLA C;  2ARO D;  2G5I C;  2J8P A;  3X1U A;  4CAY A;  2NZD D;  1F66 A;  5GT0 B;  4YM6 D;  4YS3 C;  3AN2 D;  3KXB A;  3KWQ D;  1KX3 D;  2ZY4 A;  5B40 B;  5F99 D;  2HIO B;  1WWS A;  5B0Z D;  2IO5 C;  2BYM A;  3REH C;  3VH5 A;  4H9Q A;  4J8V D;  5DNM B;  3AV1 C;  3WKJ D;  3AZG A;  2CV5 A;  3NQJ A;  3B0C T;  3AZJ D;  3AV2 A;  4WU9 A;  1S32 B;  3B6F D;  5AV6 D;  4Z2M H;  4WU8 A;  3MGS D;  4ZUX D;  3AZH C;  1TZY B;  3X1T A;  1HTA A;  1M1A A;  5B31 C;  1AOI B;  4KUD B;  5AV8 C;  2RVQ D;  3C1B D;  1KX4 C;  3A6N D;  4E45 A;  2JCH A;  3MNN B;  3KUY A;  1Q9C A;  1P34 B;  3WAA C;  5AVC C;  5B1M A;  4AWL B;  3REL A;  2LY8 A;  2RIQ A;  4XZQ B;  4QLC A;  1P3F C;  3W97 C;  5B0Y D;  3KFU G;  5FUG B;  3X1U C;  1R4V A;  4WNN A;  3AZK A;  5B2J C;  4XUJ C;  5AVB A;  3KXB C;  5DNN B;  3AZN B;  1M18 D;  2ZY3 A;  1P3B C;  5B32 A;  3B6G C;  1KX5 B;  4Z66 A;  3REI A;  5B1L B;  3UTB B;  1P3A B;  4H9N B;  3AZG C;  4NE5 A;  5JRG D;  1U35 A;  2CV5 C;  3AV2 C;  1ZLA B;  3MGP D;  5CPK C;  3TU4 D;  3X1S D;  4WU8 C;  1P3M A;  3AZM D;  4J8U A;  1HQ3 A;  2FJ7 D;  4YS3 B;  3V9R A;  2NQB D;  4WJ3 C;  5BT1 D;  2JE5 A;  3X1V D;  3KUY C;  4JJN D;  1P3O D;  2IO5 B;  2F8N H;  3REH B;  3LZ0 A;  4KGC C;  1F1E A;  3AV1 B;  5GT3 A;  5AV9 A;  2JSS A;  5CPJ A;  1JFI B;  4M6B A;  3AZK C;  3AZH B;  5B31 B;  2Y2G A;  5AV8 B;  1KX4 B;  4Z5T A;  5GT0 D;  3EG5 B;  5AY8 A;  3AZF A;  5AV5 A;  4UPK A;  5B40 D;  4H9R A;  2HIO D;  4CSR A;  3LEL C;  3WAA B;  5B32 C;  5GSU A;  5AVC B;  1BH8 A;  1ID3 C;  2BG1 A;  4Z66 C;  5BNV B;  3REI C;  2ZY5 A;  5DNM D;  1P3F B;  3MGQ A;  5CPI A;  3W97 B;  5B32 G;  3X1U B;  2F2A C;  4CAY B;  3EPJ A;  4R8P C;  5B2J B;  3UTA A;  5E5A C;  4UUZ B;  4XUJ B;  1HQ3 C;  1M19 A;  3C1C A;  3W98 A;  1AOI D;  3VH6 W;  4KUD D;  1P3G A;  1P3K D;  3MGR C;  3AFA D;  1P3B B;  1P34 D;  3AZL A;  3B6G B;  3MVD B;  2BYM B;  4H9Q B;  3LZ0 C;  1P3P A;  4NFT A;  3AZG B;  4XZQ D;  5AV9 C;  3NQJ B;  5CPJ C;  2CV5 B;  3F6T A;  3W99 D;  5CPK B;  4WU8 B;  1B6W A;  3B0B A;  3W96 A;  5BO0 A;  2ARO A;  5CP6 D;  2ZM5 A;  5B33 A;  2NZD A;  5AV5 C;  4LD9 B;  5DNN D;  3KUY B;  4YM6 A;  4H9P A;  3AN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...