3AZJB

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVQRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjB00
3X1VC 2AROC 5B32B 5AV8D 4H9QA 4YM6D 3AZGC 5BT1D 5B33D 3MVDA 3MGPA 1TZYC 5B40D 3MGQA 3TU4D 3B0CT 5G49B 1P3PD 3B0DC 5B24C 1P3LD 3W96B 4XZQD 1F1EA 2PYOC 3WKJA 5B32D 4R8PA 3AZMB 3AZLC 2L5AA 2LY8A 4DRBA 4XUJB 1BH8B 5CPKA 3W96D 3LZ0C 5GT3B 1U35A 5B1LC 4Z5TA 1N1JA 2F8NG 3LJAD 1P3KD 3KUYA 3MGSA 4XUJD 5G49A 3B6FC 4X23B 4ZUXB 4KGCC 2CV5B 3O62C 1TZYB 5GT3D 5AY8B 3VH5T 5B0YC 3B0DB 3AZMA 1F66C 5CPJA 3W99B 3MNNC 5CPIA 3WA9C 1M18A 1P3OB 2PYOB 2AROD 1AOIA 4ZUXD 3AZGD 4H9OB 4Z2MH 1TZYD 3LELB 1P3FA 5AY8D 3W99D 2IO5B 1EQZA 5AV6C 3AFAC 5B1LB 1P3OD 1M1AA 2PYOD 4X23A 3B6GA 2RVQD 3AV2B 2CV5A 5AVBC 3C1CA 3LELD 3REKA 1Q9CA 5B1MC 4YS3C 5AV9C 2NQBA 3UTAA 3AZFC 2F8NK 1JFIB 3LZ1C 4KGCB 3AN2C 4J8UA 3X1TB 5C3IB 1B67A 5B1LD 3NQUA 3UTBC 5B0YB 1P3GC 3B0BA 4NE5A 4EO5C 4HGAB 5GSUC 3UT9B 3AV1C 3RELC 3B6FD 5DNNA 3WAAB 5BS7C 5B2JB 5B0ZC 4KGCD 5E5AC 4M6BA 5B0YD 4NE3A 4J8XB 4ZBJB 2NZDC 3AV2A 3VH6T 3AFAB 1P3MA 3MVDC 5FUGA 3UT9D 4JJNB 1M19B 5B2IC 3MGQC 5AVCB 5B2JD 3REIA 4WU9B 3WAAD 4KHAA 5CP6B 3X1TA 1P3BB 5B31A 1HQ3C 4J8XD 4H9SA 5BNVA 3VH6A 4LD9B 3AYWA 3WKJC 1TAFB 1KX3B 5GT0A 4J8WC 5AV6D 3KXBB 3C1BB 1ID3B 3AFAD 4JJND 4NE6A 3WTPC 3REHA 1P3GB 1M19D 1KU5A 4WU9D 3MGRA 1KX5B 2F8NB 4WV4B 5CP6D 3A6NC 4H9PB 5BNXB 3AZHC 3RELB 1U35C 3AZJA 4LD9D 1KX3D 3AN2D 3KXBD 1B6WA 1ID3D 5B40B 3UTBD 5BO0B 3KUYC 3MGSC 1M19A 1P3GD 1P3PB 5JRGC 5AVCA 4WU9A 4AWLB 1KX5D 2F8ND 1P3IA 4QLCA 1P3BA 3RELD 3W97B 5F99A 1H3OB 5CPJC 2HUEB 3C1BA 5CPIC 3X1UB 1M18C 5GXQB 5DNMC 1HQ3B 2NZDD 1P34C 1AOIC 4NFTA 1ZLAA 4Z66B 5B31G 4H9RB 3AZIC 1P3FC 3W97D 2BYMA 5B2ID 5AV8A 1WWIA 3LJAB 4G92B 1P3KB 4YM6A 2BYKA 5B33A 5B40A 3X1UD 3AZHB 3TU4A 5GXQD 2HIOC 1HQ3D 1P3PA 1P3LA 4KUDC 4J8WD 3B6GC 4XZQA 3AZKC 4J8VC 4Z66D 3C1CC 3REKC 3WTPD 5JRGB 5B32A 2NQBC 3UTAC 3AZNB 3W98B 3A6ND 4J8UC 3AZHD 3X1VB 2AROB 4Z2MG 3W96A 4WU8C 2YFVB 1BH9B 3AZGB 5AV5C 4Z66A 4H9RA 3LJAA 1P3KA 5JRGD 5B24B 5DNNC 3AZND 3W98D 4WNNB 3X1SC 4XUJA 2FJ7C 3X1VD 1BH8A 3AZLB 3VH5A 5GT3A 1P3AC 1P3MC 5DNMD 5B24D 3REJC 1P34D 4KUDB 3REIC 1S32C 3LZ0B 1WWSA 3KWQC 1ULYA 5B31C 2AROA 4ZUXA 3AZEC 3AZLD 1BH9A 3AZGA 3AYWC 2F8NH 1TZYA 1KX4C 3R45B 5AY8A 2HIOD 3B6FB 3REHC 4WU8B 4KUDD 3KSYA 3W99A 3AZKD 3O62B 4WNNA 4CAYB 3LZ0D 4J8VD 1P3OA 4UUZB 2PYOA 1F66B 3MNNB 3AZJC 4H9OA 3WA9B 3X1SB 3LELA 4WU8D 1P3IC 3NQJB 3O62D 5AV5D 1P3AB 5B1LA 4QLCC 1F66D 3MNND 5AV6B 3WA9D 3KWQB 3X1SD 3MGPC 2FJ7D 3B6FA 1JFIA 5JA4B 3AZEB 4KGCA 4CAYA 5AVBB 3VH5W 1P3AD 3WTPE 1ZLAC 5B1MB 4YS3B 5AV9B 5B0YA 3AZFB 3REJD 4R8PC 3LZ1B 3AN2B 4YM6C 1S32D 3KWQD 5KDMB 5BT1C 5B33C 3UTBB 3UT9A 3TU4C 3WAAA 2JSSA 5B2JA 1P3LC 3AZED 5CPKC 4EO5B 4XZQC 4H9NB 5GSUB 5AVBD 3AV1B 4YS3D 5B1MD 5AV9D 4Z5TC 4J8XA 5B0ZB 3AZFD 3LZ1D 5AV6A 3AFAA 4E45A 5E5AB 4JJNA 2NZDB 4H9QB 5CP6A 5GSUD 3MVDB 3AV1D 5B2IB 3MGQB 5B0ZD 4LD9A 1TAFA 3AZMC 1KX3A 3AN2A 3KXBA 1ID3A 3UTBA 5E5AD 1P3GA 4XUJC 1KX5A 2F8NA 3WKJB 4J8WB 4H9PA 5BNXA 3MVDD 3MGPD 5GT3C 3RELA 3WTPB 3MGQD 2CWEA 3A6NB 1EQZC 1U35B 5BO0A 1N1JB 1M1AC 2NZDA 3WKJD 4X23C 4R8PD 3VH6W 4ZUXC 2CV5C 3KUYB 3W97A 3MGSB 5B2IA 5AY8C 1H3OA 1HTAA 5CPKD 3W99C 3X1UA 1U35D 5GXQA 1HQ3A 4Z5TD 1P3OC 4J8WA 2RVQC 5CPJB 5CPIB 1M18B 3LELC 3WTPA 3MGSD 3KUYD 5DNMB 1P34B 1AOIB 3A6NA 2IO5C 3AZHA 1P3FB 3AZIB 3AZMD 5CPJD 3AV2C 1EQZB 5CPID 1M18D 2HIOB 5JRGA 1M1AB 3AZNA 1AOID 3B6GB 3AZKB 3W98A 4J8VB 3X1TC 5C3IC 3C1CB 1P3FD 3REKB 3AZID 3X1VA 2NQBB 3UTAB 2YFWB 4H9SC 2YFVA 5GT0C 4J8UB 3B0CW 1EQZD 4HGAC 5DNMA 3NQUB 3UT9C 5B32G 1M1AD 5B24A 1P34A 3WAAC 4X23D 5B2JC 3MGRC 3B6GD 5AV5B 2CV5D 3C1CD 3AZIA 3REKD 1BFMA 2NQBD 3UTAD 5DNNB 4J8XC 4ZBJC 3AZLA 4J8UD 4E44A 2FJ7B 2HIOA 4JJNC 1M19C 1R4VA 4KUDA 4WU9C 5AVCC 3AZKA 3LZ0A 4J8VA 5CP6C 1P3MB 1P3BC 5FUGB 5F99C 2YFWA 5DNND 3REJB 3REIB 4LD9C 4KHAB 1S32B 1KX3C 3KXBC 3C1BC 3R45A 1ID3C 4G91C 5B31B 4WU8A 5BNVB 1KX5C 3AYWB 5GT0B 3O62A 3AV2D 5AV5A 1KX4B 4UUZA 1P3MD 3REHB 1F66A 4CSRB 5AV8C 3MGRB 3MNNA 3REID 3WA9A 3X1TD 3X1SA 2FJ7A 5B40C 5B31D 1P3PC 3AZJB 4AWLC 3AYWD 3NQJA 5GT0D 1P3AA 1KX4D 3V9RB 3W97C 3REHD 3REJA 5B32C 3MGRD 1P3IB 1S32A 3KWQA 2HUEC 4QLCB 3X1UC 5GXQC 5F99B 5JA4A 3AZEA 3W96C 3AZJD 5AVBA 4WZSB 3MGPB 1KX4A 4G91B 5B1MA 5AV9A 4Z66C 4YS3A 3AZFA 4CSRA 3LJAC 1P3KC 5AVCD 3LZ1A 4G92C 1P3ID 5KDMA 1ZLAB 4QLCD 1P3BD 2BYMB 5F99D 5AV8B 4R8PB 4YM6B 2BYKB 4H9NA 5GSUA 5B33B 3V9RA 3C1BD 3AV1A 3TU4B 5BS7A 4DRAA 5B0ZA 1P3LB 5CPKB 1A7WA 3AZNC 3W98C 4XZQB 5CHLB 1ZLAD 5E5AA 4Z5TB
chains in the Genus database with same CATH superfamily
3X1VC 2AROC 5B32B 5AV8D 4H9QA 4YM6D 3AZGC 5BT1D 5B33D 3MVDA 3MGPA 1TZYC 5B40D 3MGQA 3TU4D 3B0CT 5G49B 1P3PD 3B0DC 5B24C 1P3LD 3W96B 4XZQD 1F1EA 2PYOC 3WKJA 5B32D 4R8PA 3AZMB 2Y2MA 3AZLC 2L5AA 2LY8A 4DRBA 4XUJB 1BH8B 5CPKA 3W96D 3LZ0C 5GT3B 1U35A 5B1LC 4Z5TA 1N1JA 2F8NG 3LJAD 1P3KD 3KUYA 3MGSA 4XUJD 5G49A 4UPKA 3B6FC 4X23B 4ZUXB 4KGCC 2CV5B 3O62C 1TZYB 5GT3D 5AY8B 3VH5T 5B0YC 3B0DB 3AZMA 1F66C 5CPJA 3W99B 3MNNC 5CPIA 3WA9C 1M18A 1W2EA 1P3OB 2PYOB 2Y2PA 2AROD 1AOIA 4ZUXD 3AZGD 4H9OB 4Z2MH 1TZYD 3LELB 1P3FA 5AY8D 2F2AC 2UWXA 3W99D 2IO5B 1EQZA 5AV6C 2DF4C 3AFAC 5B1LB 1P3OD 1M1AA 2PYOD 4X23A 3B6GA 2RVQD 3AV2B 2CV5A 2RIQA 5AVBC 3C1CA 3LELD 3REKA 1Q9CA 5B1MC 4YS3C 5AV9C 2NQBA 3UTAA 3AZFC 2F8NK 1JFIB 3LZ1C 4KGCB 3AN2C 2XD1A 4J8UA 3X1TB 5C3IB 1B67A 5B1LD 3NQUA 3UTBC 5B0YB 1P3GC 3A1IA 3B0BA 4NE5A 4EO5C 4HGAB 5GSUC 3UT9B 3AV1C 3RELC 2G5HC 3B6FD 5DNNA 3WAAB 5BS7C 5B2JB 5B0ZC 4KGCD 2XD5A 4M6BA 5E5AC 5B0YD 4NE3A 4J8XB 4ZBJB 2NZDC 3AV2A 3VH6T 3AFAB 1P3MA 3MVDC 5FUGA 3UT9D 4JJNB 1M19B 5B2IC 3MGQC 5AVCB 5B2JD 3REIA 4WU9B 3WAAD 4KHAA 2Y2HA 5CP6B 3X1TA 2Y2KA 1P3BB 5B31A 1HQ3C 4J8XD 4H9SA 5BNVA 3VH6A 4LD9B 2ZY5A 3AYWA 1TAFB 1KX3B 5GT0A 4J8WC 3WKJC 5AV6D 3KXBB 3C1BB 1ID3B 3AFAD 4JJND 4NE6A 3WTPC 3REHA 1P3GB 1M19D 1KU5A 4WU9D 3MGRA 1KX5B 2F8NB 4WV4B 5CP6D 3A6NC 4H9PB 5BNXB 3AZHC 3H0RC 3RELB 1U35C 3AZJA 4LD9D 2Y2IA 1KX3D 3AN2D 3KXBD 1B6WA 1ID3D 5B40B 3UTBD 5BO0B 3KUYC 3MGSC 1M19A 1P3GD 1P3PB 5JRGC 5AVCA 2BG1A 4AWLB 4WU9A 1KX5D 2W8SA 1P3IA 2F8ND 2Y2QA 4QLCA 1P3BA 3RELD 3W97B 5F99A 1H3OB 3EG5B 5CPJC 2HUEB 3C1BA 5CPIC 3X1UB 1M18C 5GXQB 5DNMC 1HQ3B 2NZDD 1P34C 1AOIC 3F6TA 4NFTA 1ZLAA 4Z66B 5B31G 4H9RB 3AZIC 1P3FC 3W97D 2BYMA 5B2ID 5AV8A 1WWIA 3LJAB 4G92B 1P3KB 4YM6A 2BYKA 5B33A 5B40A 3X1UD 3AZHB 2JCHA 3TU4A 5GXQD 2HIOC 1HQ3D 1P3PA 1P3LA 4KUDC 4J8WD 3B6GC 4XZQA 3AZKC 2DQNC 4J8VC 4Z66D 3C1CC 3REKC 3H0MC 3WTPD 5JRGB 5B32A 2NQBC 3UTAC 3AZNB 3W98B 3A6ND 4J8UC 3AZHD 3X1VB 2AROB 2Y2JA 3W96A 4Z2MG 4WU8C 2YFVB 1BH9B 3AZGB 5AV5C 4Z66A 4H9RA 3LJAA 1P3KA 5JRGD 5B24B 5DNNC 3AZND 3W98D 4WNNB 3X1SC 4XUJA 2FJ7C 3X1VD 1BH8A 3AZLB 3VH5A 5GT3A 1P3AC 1P3MC 5DNMD 5B24D 3REJC 1P34D 4KUDB 3REIC 1S32C 3LZ0B 1WWSA 3KWQC 1ULYA 5B31C 2AROA 4ZUXA 2Y2LA 3AZEC 1BH9A 3AZGA 3AZLD 3AYWC 2F8NH 1TZYA 1KX4C 3R45B 5AY8A 2HIOD 3B6FB 3REHC 4WU8B 2ZY2A 3KSYA 3W99A 4KUDD 3AZKD 3O62B 4WNNA 4CAYB 3LZ0D 4J8VD 1P3OA 4UUZB 2PYOA 1F66B 3MNNB 3AZJC 4H9OA 3WA9B 2FFFB 3X1SB 3LELA 4WU8D 1P3IC 3A1KA 3NQJB 3O62D 5AV5D 1P3AB 5B1LA 4QLCC 1F66D 3P5JB 3MNND 5AV6B 3WA9D 3KWQB 2ZY3A 3X1SD 2Y2NA 3MGPC 2FJ7D 3B6FA 1JFIA 5JA4B 2Y2OA 3AZEB 4KGCA 4CAYA 5AVBB 3VH5W 1P3AD 3WTPE 1ZLAC 5B1MB 4YS3B 5AV9B 5B0YA 3AZFB 3REJD 4R8PC 3LZ1B 3AN2B 4YM6C 1S32D 3KWQD 5KDMB 5BT1C 5B33C 3UTBB 3UT9A 4WJ3C 3TU4C 3WAAA 2JSSA 5B2JA 1P3LC 3AZED 5CPKC 4EO5B 4XZQC 4H9NB 5GSUB 5AVBD 3AV1B 5B1MD 4YS3D 5AV9D 4Z5TC 4J8XA 5B0ZB 3AZFD 3LZ1D 5AV6A 3AFAA 4E45A 5E5AB 4JJNA 2NZDB 4H9QB 5CP6A 5GSUD 3MVDB 3AV1D 5B2IB 3MGQB 5B0ZD 4LD9A 1TAFA 3AZMC 1KX3A 3AN2A 3KXBA 1ID3A 3UTBA 5E5AD 1P3GA 4XUJC 1KX5A 2F8NA 3WKJB 4J8WB 4H9PA 5BNXA 3MVDD 3MGPD 5GT3C 3RELA 3WTPB 3MGQD 2CWEA 3A6NB 1EQZC 1U35B 5BO0A 1N1JB 1M1AC 2NZDA 3WKJD 4X23C 4R8PD 3VH6W 4ZUXC 2CV5C 3KUYB 3W97A 3MGSB 5B2IA 5AY8C 1H3OA 1HTAA 5CPKD 3W99C 3X1UA 1U35D 5GXQA 1HQ3A 4Z5TD 1P3OC 4J8WA 2RVQC 3EPJA 5CPJB 5CPIB 1M18B 3LELC 3WTPA 3MGSD 3KUYD 5DNMB 1P34B 2G5IC 1AOIB 2J8PA 3EPHA 2JE5A 3H0LC 2IO5C 3A6NA 3AZHA 1P3FB 3AZIB 3AZMD 5CPJD 3AV2C 2Y2GA 3EPKA 5CPID 1EQZB 1M18D 2ZY4A 2HIOB 5JRGA 1M1AB 3AZNA 1AOID 3B6GB 3AZKB 3W98A 3KFUG 4J8VB 3X1TC 5C3IC 3C1CB 1P3FD 3REKB 3AZID 3X1VA 2NQBB 3UTAB 2YFWB 4H9SC 2YFVA 5GT0C 4J8UB 3B0CW 1EQZD 4HGAC 5DNMA 3NQUB 3UT9C 5B32G 3EPLA 5B24A 1M1AD 1P34A 3WAAC 4X23D 5B2JC 3MGRC 3B6GD 5AV5B 2CV5D 1PZRA 3C1CD 3AZIA 3REKD 1BFMA 2NQBD 3UTAD 5DNNB 4J8XC 4ZBJC 3AZLA 4J8UD 4E44A 2FJ7B 2HIOA 4JJNC 1M19C 1R4VA 4KUDA 4WU9C 5AVCC 3AZKA 3LZ0A 4J8VA 5CP6C 1P3MB 1P3BC 5FUGB 5F99C 2YFWA 5DNND 3REJB 3REIB 4LD9C 4KHAB 1S32B 1KX3C 3KXBC 3C1BC 3R45A 1ID3C 4G91C 5B31B 1T3UA 4WU8A 5BNVB 1KX5C 3AYWB 2VQRA 5GT0B 3O62A 3AV2D 5AV5A 1KX4B 3FDDA 4UUZA 1P3MD 3REHB 1F66A 4CSRB 3IP4C 5AV8C 3MGRB 3MNNA 3REID 4DQYB 3WA9A 3X1TD 3X1SA 2FJ7A 1Z2CB 5B40C 5B31D 1P3PC 3AZJB 4AWLC 3AYWD 3NQJA 5GT0D 1P3AA 1KX4D 3V9RB 3W97C 3REHD 3REJA 5B32C 3MGRD 1P3IB 1S32A 3KWQA 2HUEC 4QLCB 3X1UC 5GXQC 5F99B 5JA4A 3AZEA 3W96C 3AZJD 5AVBA 4WZSB 3MGPB 1KX4A 4G91B 5B1MA 5AV9A 4Z66C 4YS3A 3AZFA 4CSRA 3LJAC 1P3KC 5AVCD 3LZ1A 4G92C 1P3ID 5KDMA 1ZLAB 4QLCD 1P3BD 2BYMB 5F99D 5AV8B 4R8PB 4YM6B 2BYKB 4H9NA 5GSUA 5B33B 3V9RA 3C1BD 3AV1A 3AL0C 3TU4B 5BS7A 4DRAA 5B0ZA 2ZM5A 1P3LB 5CPKB 1A7WA 3AZNC 3W98C 4XZQB 5CHLB 1ZLAD 5E5AA 4Z5TB
chains in the Genus database with same CATH topology
3X1VC 2AROC 5B32B 5AV8D 4H9QA 4YM6D 3AZGC 5BT1D 5B33D 3MVDA 3MGPA 1TZYC 5B40D 3MGQA 3TU4D 3B0CT 5G49B 1P3PD 3B0DC 5B24C 1P3LD 3W96B 4XZQD 1F1EA 2PYOC 3WKJA 5B32D 4R8PA 3AZMB 2Y2MA 3AZLC 2L5AA 2LY8A 4DRBA 4XUJB 1BH8B 5CPKA 3W96D 3LZ0C 5GT3B 1U35A 5B1LC 4Z5TA 1N1JA 2F8NG 3LJAD 1P3KD 3KUYA 3MGSA 4XUJD 5G49A 4UPKA 3B6FC 4X23B 4ZUXB 4KGCC 2CV5B 3O62C 1TZYB 5GT3D 5AY8B 3VH5T 5B0YC 3B0DB 3AZMA 1F66C 5CPJA 3W99B 3MNNC 5CPIA 3WA9C 1M18A 1W2EA 1P3OB 2PYOB 2Y2PA 2AROD 1AOIA 4ZUXD 3AZGD 4H9OB 4Z2MH 1TZYD 3LELB 1P3FA 5AY8D 2F2AC 2UWXA 3W99D 2IO5B 1EQZA 5AV6C 2DF4C 3AFAC 5B1LB 1P3OD 1M1AA 2PYOD 4X23A 3B6GA 2RVQD 3AV2B 2CV5A 2RIQA 5AVBC 3C1CA 3LELD 3REKA 1Q9CA 5B1MC 4YS3C 5AV9C 2NQBA 3UTAA 3AZFC 2F8NK 1JFIB 3LZ1C 4KGCB 3AN2C 2XD1A 4J8UA 3X1TB 5C3IB 1B67A 5B1LD 3NQUA 3UTBC 5B0YB 1P3GC 3A1IA 3B0BA 4NE5A 4EO5C 4HGAB 5GSUC 3UT9B 3AV1C 3RELC 2G5HC 3B6FD 5DNNA 3WAAB 5BS7C 5B2JB 5B0ZC 4KGCD 2XD5A 4M6BA 5E5AC 5B0YD 4NE3A 4J8XB 4ZBJB 2NZDC 3AV2A 3VH6T 3AFAB 1P3MA 3MVDC 5FUGA 3UT9D 4JJNB 1M19B 5B2IC 3MGQC 5AVCB 5B2JD 3REIA 4WU9B 3WAAD 4KHAA 2Y2HA 5CP6B 3X1TA 2Y2KA 1P3BB 5B31A 1HQ3C 4J8XD 4H9SA 5BNVA 3VH6A 4LD9B 2ZY5A 3AYWA 1TAFB 1KX3B 5GT0A 4J8WC 3WKJC 5AV6D 3KXBB 3C1BB 1ID3B 3AFAD 4JJND 4NE6A 3WTPC 3REHA 1P3GB 1M19D 1KU5A 4WU9D 3MGRA 1KX5B 2F8NB 4WV4B 5CP6D 3A6NC 4H9PB 5BNXB 3AZHC 3H0RC 3RELB 1U35C 3AZJA 4LD9D 2Y2IA 1KX3D 3AN2D 3KXBD 1B6WA 1ID3D 5B40B 3UTBD 5BO0B 3KUYC 3MGSC 1M19A 1P3GD 1P3PB 5JRGC 5AVCA 2BG1A 4AWLB 4WU9A 1KX5D 2W8SA 1P3IA 2F8ND 2Y2QA 4QLCA 1P3BA 3RELD 3W97B 5F99A 1H3OB 3EG5B 5CPJC 2HUEB 3C1BA 5CPIC 3X1UB 1M18C 5GXQB 5DNMC 1HQ3B 2NZDD 1P34C 1AOIC 3F6TA 4NFTA 1ZLAA 4Z66B 5B31G 4H9RB 3AZIC 1P3FC 3W97D 2BYMA 5B2ID 5AV8A 1WWIA 3LJAB 4G92B 1P3KB 4YM6A 2BYKA 5B33A 5B40A 3X1UD 3AZHB 2JCHA 3TU4A 5GXQD 2HIOC 1HQ3D 1P3PA 1P3LA 4KUDC 4J8WD 3B6GC 4XZQA 3AZKC 2DQNC 4J8VC 4Z66D 3C1CC 3REKC 3H0MC 3WTPD 5JRGB 5B32A 2NQBC 3UTAC 3AZNB 3W98B 3A6ND 4J8UC 3AZHD 3X1VB 2AROB 2Y2JA 3W96A 4Z2MG 4WU8C 2YFVB 1BH9B 3AZGB 5AV5C 4Z66A 4H9RA 3LJAA 1P3KA 5JRGD 5B24B 5DNNC 3AZND 3W98D 4WNNB 3X1SC 4XUJA 2FJ7C 3X1VD 1BH8A 3AZLB 3VH5A 5GT3A 1P3AC 1P3MC 5DNMD 5B24D 3REJC 1P34D 4KUDB 3REIC 1S32C 3LZ0B 1WWSA 3KWQC 1ULYA 5B31C 2AROA 4ZUXA 2Y2LA 3AZEC 1BH9A 3AZGA 3AZLD 3AYWC 2F8NH 1TZYA 1KX4C 3R45B 5AY8A 2HIOD 3B6FB 3REHC 4WU8B 2ZY2A 3KSYA 3W99A 4KUDD 3AZKD 3O62B 4WNNA 4CAYB 3LZ0D 4J8VD 1P3OA 4UUZB 2PYOA 1F66B 3MNNB 3AZJC 4H9OA 3WA9B 2FFFB 3X1SB 3LELA 4WU8D 1P3IC 3A1KA 3NQJB 3O62D 5AV5D 1P3AB 5B1LA 4QLCC 1F66D 3P5JB 3MNND 5AV6B 3WA9D 3KWQB 2ZY3A 3X1SD 2Y2NA 3MGPC 2FJ7D 3B6FA 1JFIA 5JA4B 2Y2OA 3AZEB 4KGCA 4CAYA 5AVBB 3VH5W 1P3AD 3WTPE 1ZLAC 5B1MB 4YS3B 5AV9B 5B0YA 3AZFB 3REJD 4R8PC 3LZ1B 3AN2B 4YM6C 1S32D 3KWQD 5KDMB 5BT1C 5B33C 3UTBB 3UT9A 4WJ3C 3TU4C 3WAAA 2JSSA 5B2JA 1P3LC 3AZED 5CPKC 4EO5B 4XZQC 4H9NB 5GSUB 5AVBD 3AV1B 5B1MD 4YS3D 5AV9D 4Z5TC 4J8XA 5B0ZB 3AZFD 3LZ1D 5AV6A 3AFAA 4E45A 5E5AB 4JJNA 2NZDB 4H9QB 5CP6A 5GSUD 3MVDB 3AV1D 5B2IB 3MGQB 5B0ZD 4LD9A 1TAFA 3AZMC 1KX3A 3AN2A 3KXBA 1ID3A 3UTBA 5E5AD 1P3GA 4XUJC 1KX5A 2F8NA 3WKJB 4J8WB 4H9PA 5BNXA 3MVDD 3MGPD 5GT3C 3RELA 3WTPB 3MGQD 2CWEA 3A6NB 1EQZC 1U35B 5BO0A 1N1JB 1M1AC 2NZDA 3WKJD 4X23C 4R8PD 3VH6W 4ZUXC 2CV5C 3KUYB 3W97A 3MGSB 5B2IA 5AY8C 1H3OA 1HTAA 5CPKD 3W99C 3X1UA 1U35D 5GXQA 1HQ3A 4Z5TD 1P3OC 4J8WA 2RVQC 3EPJA 5CPJB 5CPIB 1M18B 3LELC 3WTPA 3MGSD 3KUYD 5DNMB 1P34B 2G5IC 1AOIB 2J8PA 3EPHA 2JE5A 3H0LC 2IO5C 3A6NA 3AZHA 1P3FB 3AZIB 3AZMD 5CPJD 3AV2C 2Y2GA 3EPKA 5CPID 1EQZB 1M18D 2ZY4A 2HIOB 5JRGA 1M1AB 3AZNA 1AOID 3B6GB 3AZKB 3W98A 3KFUG 4J8VB 3X1TC 5C3IC 3C1CB 1P3FD 3REKB 3AZID 3X1VA 2NQBB 3UTAB 2YFWB 4H9SC 2YFVA 5GT0C 4J8UB 3B0CW 1EQZD 4HGAC 5DNMA 3NQUB 3UT9C 5B32G 3EPLA 5B24A 1M1AD 1P34A 3WAAC 4X23D 5B2JC 3MGRC 3B6GD 5AV5B 2CV5D 1PZRA 3C1CD 3AZIA 3REKD 1BFMA 2NQBD 3UTAD 5DNNB 4J8XC 4ZBJC 3AZLA 4J8UD 4E44A 2FJ7B 2HIOA 4JJNC 1M19C 1R4VA 4KUDA 4WU9C 5AVCC 3AZKA 3LZ0A 4J8VA 5CP6C 1P3MB 1P3BC 5FUGB 5F99C 2YFWA 5DNND 3REJB 3REIB 4LD9C 4KHAB 1S32B 1KX3C 3KXBC 3C1BC 3R45A 1ID3C 4G91C 5B31B 1T3UA 4WU8A 5BNVB 1KX5C 3AYWB 2VQRA 5GT0B 3O62A 3AV2D 5AV5A 1KX4B 3FDDA 4UUZA 1P3MD 3REHB 1F66A 4CSRB 3IP4C 5AV8C 3MGRB 3MNNA 3REID 4DQYB 3WA9A 3X1TD 3X1SA 2FJ7A 1Z2CB 5B40C 5B31D 1P3PC 3AZJB 4AWLC 3AYWD 3NQJA 5GT0D 1P3AA 1KX4D 3V9RB 3W97C 3REHD 3REJA 5B32C 3MGRD 1P3IB 1S32A 3KWQA 2HUEC 4QLCB 3X1UC 5GXQC 5F99B 5JA4A 3AZEA 3W96C 3AZJD 5AVBA 4WZSB 3MGPB 1KX4A 4G91B 5B1MA 5AV9A 4Z66C 4YS3A 3AZFA 4CSRA 3LJAC 1P3KC 5AVCD 3LZ1A 4G92C 1P3ID 5KDMA 1ZLAB 4QLCD 1P3BD 2BYMB 5F99D 5AV8B 4R8PB 4YM6B 2BYKB 4H9NA 5GSUA 5B33B 3V9RA 3C1BD 3AV1A 3AL0C 3TU4B 5BS7A 4DRAA 5B0ZA 2ZM5A 1P3LB 5CPKB 1A7WA 3AZNC 3W98C 4XZQB 5CHLB 1ZLAD 5E5AA 4Z5TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V C;  2ARO C;  5B32 B;  5AV8 D;  4H9Q A;  4YM6 D;  3AZG C;  5BT1 D;  5B33 D;  3MVD A;  3MGP A;  1TZY C;  5B40 D;  3MGQ A;  3TU4 D;  3B0C T;  5G49 B;  1P3P D;  3B0D C;  5B24 C;  1P3L D;  3W96 B;  4XZQ D;  1F1E A;  2PYO C;  3WKJ A;  5B32 D;  4R8P A;  3AZM B;  3AZL C;  2L5A A;  2LY8 A;  4DRB A;  4XUJ B;  1BH8 B;  5CPK A;  3W96 D;  3LZ0 C;  5GT3 B;  1U35 A;  5B1L C;  4Z5T A;  1N1J A;  2F8N G;  3LJA D;  1P3K D;  3KUY A;  3MGS A;  4XUJ D;  5G49 A;  3B6F C;  4X23 B;  4ZUX B;  4KGC C;  2CV5 B;  3O62 C;  1TZY B;  5GT3 D;  5AY8 B;  3VH5 T;  5B0Y C;  3B0D B;  3AZM A;  1F66 C;  5CPJ A;  3W99 B;  3MNN C;  5CPI A;  3WA9 C;  1M18 A;  1P3O B;  2PYO B;  2ARO D;  1AOI A;  4ZUX D;  3AZG D;  4H9O B;  4Z2M H;  1TZY D;  3LEL B;  1P3F A;  5AY8 D;  3W99 D;  2IO5 B;  1EQZ A;  5AV6 C;  3AFA C;  5B1L B;  1P3O D;  1M1A A;  2PYO D;  4X23 A;  3B6G A;  2RVQ D;  3AV2 B;  2CV5 A;  5AVB C;  3C1C A;  3LEL D;  3REK A;  1Q9C A;  5B1M C;  4YS3 C;  5AV9 C;  2NQB A;  3UTA A;  3AZF C;  2F8N K;  1JFI B;  3LZ1 C;  4KGC B;  3AN2 C;  4J8U A;  3X1T B;  5C3I B;  1B67 A;  5B1L D;  3NQU A;  3UTB C;  5B0Y B;  1P3G C;  3B0B A;  4NE5 A;  4EO5 C;  4HGA B;  5GSU C;  3UT9 B;  3AV1 C;  3REL C;  3B6F D;  5DNN A;  3WAA B;  5BS7 C;  5B2J B;  5B0Z C;  4KGC D;  5E5A C;  4M6B A;  5B0Y D;  4NE3 A;  4J8X B;  4ZBJ B;  2NZD C;  3AV2 A;  3VH6 T;  3AFA B;  1P3M A;  3MVD C;  5FUG A;  3UT9 D;  4JJN B;  1M19 B;  5B2I C;  3MGQ C;  5AVC B;  5B2J D;  3REI A;  4WU9 B;  3WAA D;  4KHA A;  5CP6 B;  3X1T A;  1P3B B;  5B31 A;  1HQ3 C;  4J8X D;  4H9S A;  5BNV A;  3VH6 A;  4LD9 B;  3AYW A;  3WKJ C;  1TAF B;  1KX3 B;  5GT0 A;  4J8W C;  5AV6 D;  3KXB B;  3C1B B;  1ID3 B;  3AFA D;  4JJN D;  4NE6 A;  3WTP C;  3REH A;  1P3G B;  1M19 D;  1KU5 A;  4WU9 D;  3MGR A;  1KX5 B;  2F8N B;  4WV4 B;  5CP6 D;  3A6N C;  4H9P B;  5BNX B;  3AZH C;  3REL B;  1U35 C;  3AZJ A;  4LD9 D;  1KX3 D;  3AN2 D;  3KXB D;  1B6W A;  1ID3 D;  5B40 B;  3UTB D;  5BO0 B;  3KUY C;  3MGS C;  1M19 A;  1P3G D;  1P3P B;  5JRG C;  5AVC A;  4WU9 A;  4AWL B;  1KX5 D;  2F8N D;  1P3I A;  4QLC A;  1P3B A;  3REL D;  3W97 B;  5F99 A;  1H3O B;  5CPJ C;  2HUE B;  3C1B A;  5CPI C;  3X1U B;  1M18 C;  5GXQ B;  5DNM C;  1HQ3 B;  2NZD D;  1P34 C;  1AOI C;  4NFT A;  1ZLA A;  4Z66 B;  5B31 G;  4H9R B;  3AZI C;  1P3F C;  3W97 D;  2BYM A;  5B2I D;  5AV8 A;  1WWI A;  3LJA B;  4G92 B;  1P3K B;  4YM6 A;  2BYK A;  5B33 A;  5B40 A;  3X1U D;  3AZH B;  3TU4 A;  5GXQ D;  2HIO C;  1HQ3 D;  1P3P A;  1P3L A;  4KUD C;  4J8W D;  3B6G C;  4XZQ A;  3AZK C;  4J8V C;  4Z66 D;  3C1C C;  3REK C;  3WTP D;  5JRG B;  5B32 A;  2NQB C;  3UTA C;  3AZN B;  3W98 B;  3A6N D;  4J8U C;  3AZH D;  3X1V B;  2ARO B;  4Z2M G;  3W96 A;  4WU8 C;  2YFV B;  1BH9 B;  3AZG B;  5AV5 C;  4Z66 A;  4H9R A;  3LJA A;  1P3K A;  5JRG D;  5B24 B;  5DNN C;  3AZN D;  3W98 D;  4WNN B;  3X1S C;  4XUJ A;  2FJ7 C;  3X1V D;  1BH8 A;  3AZL B;  3VH5 A;  5GT3 A;  1P3A C;  1P3M C;  5DNM D;  5B24 D;  3REJ C;  1P34 D;  4KUD B;  3REI C;  1S32 C;  3LZ0 B;  1WWS A;  3KWQ C;  1ULY A;  5B31 C;  2ARO A;  4ZUX A;  3AZE C;  3AZL D;  1BH9 A;  3AZG A;  3AYW C;  2F8N H;  1TZY A;  1KX4 C;  3R45 B;  5AY8 A;  2HIO D;  3B6F B;  3REH C;  4WU8 B;  4KUD D;  3KSY A;  3W99 A;  3AZK D;  3O62 B;  4WNN A;  4CAY B;  3LZ0 D;  4J8V D;  1P3O A;  4UUZ B;  2PYO A;  1F66 B;  3MNN B;  3AZJ C;  4H9O A;  3WA9 B;  3X1S B;  3LEL A;  4WU8 D;  1P3I C;  3NQJ B;  3O62 D;  5AV5 D;  1P3A B;  5B1L A;  4QLC C;  1F66 D;  3MNN D;  5AV6 B;  3WA9 D;  3KWQ B;  3X1S D;  3MGP C;  2FJ7 D;  3B6F A;  1JFI A;  5JA4 B;  3AZE B;  4KGC A;  4CAY A;  5AVB B;  3VH5 W;  1P3A D;  3WTP E;  1ZLA C;  5B1M B;  4YS3 B;  5AV9 B;  5B0Y A;  3AZF B;  3REJ D;  4R8P C;  3LZ1 B;  3AN2 B;  4YM6 C;  1S32 D;  3KWQ D;  5KDM B;  5BT1 C;  5B33 C;  3UTB B;  3UT9 A;  3TU4 C;  3WAA A;  2JSS A;  5B2J A;  1P3L C;  3AZE D;  5CPK C;  4EO5 B;  4XZQ C;  4H9N B;  5GSU B;  5AVB D;  3AV1 B;  4YS3 D;  5B1M D;  5AV9 D;  4Z5T C;  4J8X A;  5B0Z B;  3AZF D;  3LZ1 D;  5AV6 A;  3AFA A;  4E45 A;  5E5A B;  4JJN A;  2NZD B;  4H9Q B;  5CP6 A;  5GSU D;  3MVD B;  3AV1 D;  5B2I B;  3MGQ B;  5B0Z D;  4LD9 A;  1TAF A;  3AZM C;  1KX3 A;  3AN2 A;  3KXB A;  1ID3 A;  3UTB A;  5E5A D;  1P3G A;  4XUJ C;  1KX5 A;  2F8N A;  3WKJ B;  4J8W B;  4H9P A;  5BNX A;  3MVD D;  3MGP D;  5GT3 C;  3REL A;  3WTP B;  3MGQ D;  2CWE A;  3A6N B;  1EQZ C;  1U35 B;  5BO0 A;  1N1J B;  1M1A C;  2NZD A;  3WKJ D;  4X23 C;  4R8P D;  3VH6 W;  4ZUX C;  2CV5 C;  3KUY B;  3W97 A;  3MGS B;  5B2I A;  5AY8 C;  1H3O A;  1HTA A;  5CPK D;  3W99 C;  3X1U A;  1U35 D;  5GXQ A;  1HQ3 A;  4Z5T D;  1P3O C;  4J8W A;  2RVQ C;  5CPJ B;  5CPI B;  1M18 B;  3LEL C;  3WTP A;  3MGS D;  3KUY D;  5DNM B;  1P34 B;  1AOI B;  3A6N A;  2IO5 C;  3AZH A;  1P3F B;  3AZI B;  3AZM D;  5CPJ D;  3AV2 C;  1EQZ B;  5CPI D;  1M18 D;  2HIO B;  5JRG A;  1M1A B;  3AZN A;  1AOI D;  3B6G B;  3AZK B;  3W98 A;  4J8V B;  3X1T C;  5C3I C;  3C1C B;  1P3F D;  3REK B;  3AZI D;  3X1V A;  2NQB B;  3UTA B;  2YFW B;  4H9S C;  2YFV A;  5GT0 C;  4J8U B;  3B0C W;  1EQZ D;  4HGA C;  5DNM A;  3NQU B;  3UT9 C;  5B32 G;  1M1A D;  5B24 A;  1P34 A;  3WAA C;  4X23 D;  5B2J C;  3MGR C;  3B6G D;  5AV5 B;  2CV5 D;  3C1C D;  3AZI A;  3REK D;  1BFM A;  2NQB D;  3UTA D;  5DNN B;  4J8X C;  4ZBJ C;  3AZL A;  4J8U D;  4E44 A;  2FJ7 B;  2HIO A;  4JJN C;  1M19 C;  1R4V A;  4KUD A;  4WU9 C;  5AVC C;  3AZK A;  3LZ0 A;  4J8V A;  5CP6 C;  1P3M B;  1P3B C;  5FUG B;  5F99 C;  2YFW A;  5DNN D;  3REJ B;  3REI B;  4LD9 C;  4KHA B;  1S32 B;  1KX3 C;  3KXB C;  3C1B C;  3R45 A;  1ID3 C;  4G91 C;  5B31 B;  4WU8 A;  5BNV B;  1KX5 C;  3AYW B;  5GT0 B;  3O62 A;  3AV2 D;  5AV5 A;  1KX4 B;  4UUZ A;  1P3M D;  3REH B;  1F66 A;  4CSR B;  5AV8 C;  3MGR B;  3MNN A;  3REI D;  3WA9 A;  3X1T D;  3X1S A;  2FJ7 A;  5B40 C;  5B31 D;  1P3P C;  3AZJ B;  4AWL C;  3AYW D;  3NQJ A;  5GT0 D;  1P3A A;  1KX4 D;  3V9R B;  3W97 C;  3REH D;  3REJ A;  5B32 C;  3MGR D;  1P3I B;  1S32 A;  3KWQ A;  2HUE C;  4QLC B;  3X1U C;  5GXQ C;  5F99 B;  5JA4 A;  3AZE A;  3W96 C;  3AZJ D;  5AVB A;  4WZS B;  3MGP B;  1KX4 A;  4G91 B;  5B1M A;  5AV9 A;  4Z66 C;  4YS3 A;  3AZF A;  4CSR A;  3LJA C;  1P3K C;  5AVC D;  3LZ1 A;  4G92 C;  1P3I D;  5KDM A;  1ZLA B;  4QLC D;  1P3B D;  2BYM B;  5F99 D;  5AV8 B;  4R8P B;  4YM6 B;  2BYK B;  4H9N A;  5GSU A;  5B33 B;  3V9R A;  3C1B D;  3AV1 A;  3TU4 B;  5BS7 A;  4DRA A;  5B0Z A;  1P3L B;  5CPK B;  1A7W A;  3AZN C;  3W98 C;  4XZQ B;  5CHL B;  1ZLA D;  5E5A A;  4Z5T B; 
#chains in the Genus database with same CATH topology
 3X1V C;  2ARO C;  5B32 B;  5AV8 D;  4H9Q A;  4YM6 D;  3AZG C;  5BT1 D;  5B33 D;  3MVD A;  3MGP A;  1TZY C;  5B40 D;  3MGQ A;  3TU4 D;  3B0C T;  5G49 B;  1P3P D;  3B0D C;  5B24 C;  1P3L D;  3W96 B;  4XZQ D;  1F1E A;  2PYO C;  3WKJ A;  5B32 D;  4R8P A;  3AZM B;  2Y2M A;  3AZL C;  2L5A A;  2LY8 A;  4DRB A;  4XUJ B;  1BH8 B;  5CPK A;  3W96 D;  3LZ0 C;  5GT3 B;  1U35 A;  5B1L C;  4Z5T A;  1N1J A;  2F8N G;  3LJA D;  1P3K D;  3KUY A;  3MGS A;  4XUJ D;  5G49 A;  4UPK A;  3B6F C;  4X23 B;  4ZUX B;  4KGC C;  2CV5 B;  3O62 C;  1TZY B;  5GT3 D;  5AY8 B;  3VH5 T;  5B0Y C;  3B0D B;  3AZM A;  1F66 C;  5CPJ A;  3W99 B;  3MNN C;  5CPI A;  3WA9 C;  1M18 A;  1W2E A;  1P3O B;  2PYO B;  2Y2P A;  2ARO D;  1AOI A;  4ZUX D;  3AZG D;  4H9O B;  4Z2M H;  1TZY D;  3LEL B;  1P3F A;  5AY8 D;  2F2A C;  2UWX A;  3W99 D;  2IO5 B;  1EQZ A;  5AV6 C;  2DF4 C;  3AFA C;  5B1L B;  1P3O D;  1M1A A;  2PYO D;  4X23 A;  3B6G A;  2RVQ D;  3AV2 B;  2CV5 A;  2RIQ A;  5AVB C;  3C1C A;  3LEL D;  3REK A;  1Q9C A;  5B1M C;  4YS3 C;  5AV9 C;  2NQB A;  3UTA A;  3AZF C;  2F8N K;  1JFI B;  3LZ1 C;  4KGC B;  3AN2 C;  2XD1 A;  4J8U A;  3X1T B;  5C3I B;  1B67 A;  5B1L D;  3NQU A;  3UTB C;  5B0Y B;  1P3G C;  3A1I A;  3B0B A;  4NE5 A;  4EO5 C;  4HGA B;  5GSU C;  3UT9 B;  3AV1 C;  3REL C;  2G5H C;  3B6F D;  5DNN A;  3WAA B;  5BS7 C;  5B2J B;  5B0Z C;  4KGC D;  2XD5 A;  4M6B A;  5E5A C;  5B0Y D;  4NE3 A;  4J8X B;  4ZBJ B;  2NZD C;  3AV2 A;  3VH6 T;  3AFA B;  1P3M A;  3MVD C;  5FUG A;  3UT9 D;  4JJN B;  1M19 B;  5B2I C;  3MGQ C;  5AVC B;  5B2J D;  3REI A;  4WU9 B;  3WAA D;  4KHA A;  2Y2H A;  5CP6 B;  3X1T A;  2Y2K A;  1P3B B;  5B31 A;  1HQ3 C;  4J8X D;  4H9S A;  5BNV A;  3VH6 A;  4LD9 B;  2ZY5 A;  3AYW A;  1TAF B;  1KX3 B;  5GT0 A;  4J8W C;  3WKJ C;  5AV6 D;  3KXB B;  3C1B B;  1ID3 B;  3AFA D;  4JJN D;  4NE6 A;  3WTP C;  3REH A;  1P3G B;  1M19 D;  1KU5 A;  4WU9 D;  3MGR A;  1KX5 B;  2F8N B;  4WV4 B;  5CP6 D;  3A6N C;  4H9P B;  5BNX B;  3AZH C;  3H0R C;  3REL B;  1U35 C;  3AZJ A;  4LD9 D;  2Y2I A;  1KX3 D;  3AN2 D;  3KXB D;  1B6W A;  1ID3 D;  5B40 B;  3UTB D;  5BO0 B;  3KUY C;  3MGS C;  1M19 A;  1P3G D;  1P3P B;  5JRG C;  5AVC A;  2BG1 A;  4AWL B;  4WU9 A;  1KX5 D;  2W8S A;  1P3I A;  2F8N D;  2Y2Q A;  4QLC A;  1P3B A;  3REL D;  3W97 B;  5F99 A;  1H3O B;  3EG5 B;  5CPJ C;  2HUE B;  3C1B A;  5CPI C;  3X1U B;  1M18 C;  5GXQ B;  5DNM C;  1HQ3 B;  2NZD D;  1P34 C;  1AOI C;  3F6T A;  4NFT A;  1ZLA A;  4Z66 B;  5B31 G;  4H9R B;  3AZI C;  1P3F C;  3W97 D;  2BYM A;  5B2I D;  5AV8 A;  1WWI A;  3LJA B;  4G92 B;  1P3K B;  4YM6 A;  2BYK A;  5B33 A;  5B40 A;  3X1U D;  3AZH B;  2JCH A;  3TU4 A;  5GXQ D;  2HIO C;  1HQ3 D;  1P3P A;  1P3L A;  4KUD C;  4J8W D;  3B6G C;  4XZQ A;  3AZK C;  2DQN C;  4J8V C;  4Z66 D;  3C1C C;  3REK C;  3H0M C;  3WTP D;  5JRG B;  5B32 A;  2NQB C;  3UTA C;  3AZN B;  3W98 B;  3A6N D;  4J8U C;  3AZH D;  3X1V B;  2ARO B;  2Y2J A;  3W96 A;  4Z2M G;  4WU8 C;  2YFV B;  1BH9 B;  3AZG B;  5AV5 C;  4Z66 A;  4H9R A;  3LJA A;  1P3K A;  5JRG D;  5B24 B;  5DNN C;  3AZN D;  3W98 D;  4WNN B;  3X1S C;  4XUJ A;  2FJ7 C;  3X1V D;  1BH8 A;  3AZL B;  3VH5 A;  5GT3 A;  1P3A C;  1P3M C;  5DNM D;  5B24 D;  3REJ C;  1P34 D;  4KUD B;  3REI C;  1S32 C;  3LZ0 B;  1WWS A;  3KWQ C;  1ULY A;  5B31 C;  2ARO A;  4ZUX A;  2Y2L A;  3AZE C;  1BH9 A;  3AZG A;  3AZL D;  3AYW C;  2F8N H;  1TZY A;  1KX4 C;  3R45 B;  5AY8 A;  2HIO D;  3B6F B;  3REH C;  4WU8 B;  2ZY2 A;  3KSY A;  3W99 A;  4KUD D;  3AZK D;  3O62 B;  4WNN A;  4CAY B;  3LZ0 D;  4J8V D;  1P3O A;  4UUZ B;  2PYO A;  1F66 B;  3MNN B;  3AZJ C;  4H9O A;  3WA9 B;  2FFF B;  3X1S B;  3LEL A;  4WU8 D;  1P3I C;  3A1K A;  3NQJ B;  3O62 D;  5AV5 D;  1P3A B;  5B1L A;  4QLC C;  1F66 D;  3P5J B;  3MNN D;  5AV6 B;  3WA9 D;  3KWQ B;  2ZY3 A;  3X1S D;  2Y2N A;  3MGP C;  2FJ7 D;  3B6F A;  1JFI A;  5JA4 B;  2Y2O A;  3AZE B;  4KGC A;  4CAY A;  5AVB B;  3VH5 W;  1P3A D;  3WTP E;  1ZLA C;  5B1M B;  4YS3 B;  5AV9 B;  5B0Y A;  3AZF B;  3REJ D;  4R8P C;  3LZ1 B;  3AN2 B;  4YM6 C;  1S32 D;  3KWQ D;  5KDM B;  5BT1 C;  5B33 C;  3UTB B;  3UT9 A;  4WJ3 C;  3TU4 C;  3WAA A;  2JSS A;  5B2J A;  1P3L C;  3AZE D;  5CPK C;  4EO5 B;  4XZQ C;  4H9N B;  5GSU B;  5AVB D;  3AV1 B;  5B1M D;  4YS3 D;  5AV9 D;  4Z5T C;  4J8X A;  5B0Z B;  3AZF D;  3LZ1 D;  5AV6 A;  3AFA A;  4E45 A;  5E5A B;  4JJN A;  2NZD B;  4H9Q B;  5CP6 A;  5GSU D;  3MVD B;  3AV1 D;  5B2I B;  3MGQ B;  5B0Z D;  4LD9 A;  1TAF A;  3AZM C;  1KX3 A;  3AN2 A;  3KXB A;  1ID3 A;  3UTB A;  5E5A D;  1P3G A;  4XUJ C;  1KX5 A;  2F8N A;  3WKJ B;  4J8W B;  4H9P A;  5BNX A;  3MVD D;  3MGP D;  5GT3 C;  3REL A;  3WTP B;  3MGQ D;  2CWE A;  3A6N B;  1EQZ C;  1U35 B;  5BO0 A;  1N1J B;  1M1A C;  2NZD A;  3WKJ D;  4X23 C;  4R8P D;  3VH6 W;  4ZUX C;  2CV5 C;  3KUY B;  3W97 A;  3MGS B;  5B2I A;  5AY8 C;  1H3O A;  1HTA A;  5CPK D;  3W99 C;  3X1U A;  1U35 D;  5GXQ A;  1HQ3 A;  4Z5T D;  1P3O C;  4J8W A;  2RVQ C;  3EPJ A;  5CPJ B;  5CPI B;  1M18 B;  3LEL C;  3WTP A;  3MGS D;  3KUY D;  5DNM B;  1P34 B;  2G5I C;  1AOI B;  2J8P A;  3EPH A;  2JE5 A;  3H0L C;  2IO5 C;  3A6N A;  3AZH A;  1P3F B;  3AZI B;  3AZM D;  5CPJ D;  3AV2 C;  2Y2G A;  3EPK A;  5CPI D;  1EQZ B;  1M18 D;  2ZY4 A;  2HIO B;  5JRG A;  1M1A B;  3AZN A;  1AOI D;  3B6G B;  3AZK B;  3W98 A;  3KFU G;  4J8V B;  3X1T C;  5C3I C;  3C1C B;  1P3F D;  3REK B;  3AZI D;  3X1V A;  2NQB B;  3UTA B;  2YFW B;  4H9S C;  2YFV A;  5GT0 C;  4J8U B;  3B0C W;  1EQZ D;  4HGA C;  5DNM A;  3NQU B;  3UT9 C;  5B32 G;  3EPL A;  5B24 A;  1M1A D;  1P34 A;  3WAA C;  4X23 D;  5B2J C;  3MGR C;  3B6G D;  5AV5 B;  2CV5 D;  1PZR A;  3C1C D;  3AZI A;  3REK D;  1BFM A;  2NQB D;  3UTA D;  5DNN B;  4J8X C;  4ZBJ C;  3AZL A;  4J8U D;  4E44 A;  2FJ7 B;  2HIO A;  4JJN C;  1M19 C;  1R4V A;  4KUD A;  4WU9 C;  5AVC C;  3AZK A;  3LZ0 A;  4J8V A;  5CP6 C;  1P3M B;  1P3B C;  5FUG B;  5F99 C;  2YFW A;  5DNN D;  3REJ B;  3REI B;  4LD9 C;  4KHA B;  1S32 B;  1KX3 C;  3KXB C;  3C1B C;  3R45 A;  1ID3 C;  4G91 C;  5B31 B;  1T3U A;  4WU8 A;  5BNV B;  1KX5 C;  3AYW B;  2VQR A;  5GT0 B;  3O62 A;  3AV2 D;  5AV5 A;  1KX4 B;  3FDD A;  4UUZ A;  1P3M D;  3REH B;  1F66 A;  4CSR B;  3IP4 C;  5AV8 C;  3MGR B;  3MNN A;  3REI D;  4DQY B;  3WA9 A;  3X1T D;  3X1S A;  2FJ7 A;  1Z2C B;  5B40 C;  5B31 D;  1P3P C;  3AZJ B;  4AWL C;  3AYW D;  3NQJ A;  5GT0 D;  1P3A A;  1KX4 D;  3V9R B;  3W97 C;  3REH D;  3REJ A;  5B32 C;  3MGR D;  1P3I B;  1S32 A;  3KWQ A;  2HUE C;  4QLC B;  3X1U C;  5GXQ C;  5F99 B;  5JA4 A;  3AZE A;  3W96 C;  3AZJ D;  5AVB A;  4WZS B;  3MGP B;  1KX4 A;  4G91 B;  5B1M A;  5AV9 A;  4Z66 C;  4YS3 A;  3AZF A;  4CSR A;  3LJA C;  1P3K C;  5AVC D;  3LZ1 A;  4G92 C;  1P3I D;  5KDM A;  1ZLA B;  4QLC D;  1P3B D;  2BYM B;  5F99 D;  5AV8 B;  4R8P B;  4YM6 B;  2BYK B;  4H9N A;  5GSU A;  5B33 B;  3V9R A;  3C1B D;  3AV1 A;  3AL0 C;  3TU4 B;  5BS7 A;  4DRA A;  5B0Z A;  2ZM5 A;  1P3L B;  5CPK B;  1A7W A;  3AZN C;  3W98 C;  4XZQ B;  5CHL B;  1ZLA D;  5E5A A;  4Z5T B; 
#chains in the Genus database with same CATH homology
 3X1V C;  2ARO C;  5B32 B;  5AV8 D;  4H9Q A;  4YM6 D;  3AZG C;  5BT1 D;  5B33 D;  3MVD A;  3MGP A;  1TZY C;  5B40 D;  3MGQ A;  3TU4 D;  3B0C T;  5G49 B;  1P3P D;  3B0D C;  5B24 C;  1P3L D;  3W96 B;  4XZQ D;  1F1E A;  2PYO C;  3WKJ A;  5B32 D;  4R8P A;  3AZM B;  2Y2M A;  3AZL C;  2L5A A;  2LY8 A;  4DRB A;  4XUJ B;  1BH8 B;  5CPK A;  3W96 D;  3LZ0 C;  5GT3 B;  1U35 A;  5B1L C;  4Z5T A;  1N1J A;  2F8N G;  3LJA D;  1P3K D;  3KUY A;  3MGS A;  4XUJ D;  5G49 A;  4UPK A;  3B6F C;  4X23 B;  4ZUX B;  4KGC C;  2CV5 B;  3O62 C;  1TZY B;  5GT3 D;  5AY8 B;  3VH5 T;  5B0Y C;  3B0D B;  3AZM A;  1F66 C;  5CPJ A;  3W99 B;  3MNN C;  5CPI A;  3WA9 C;  1M18 A;  1W2E A;  1P3O B;  2PYO B;  2Y2P A;  2ARO D;  1AOI A;  4ZUX D;  3AZG D;  4H9O B;  4Z2M H;  1TZY D;  3LEL B;  1P3F A;  5AY8 D;  2F2A C;  2UWX A;  3W99 D;  2IO5 B;  1EQZ A;  5AV6 C;  2DF4 C;  3AFA C;  5B1L B;  1P3O D;  1M1A A;  2PYO D;  4X23 A;  3B6G A;  2RVQ D;  3AV2 B;  2CV5 A;  2RIQ A;  5AVB C;  3C1C A;  3LEL D;  3REK A;  1Q9C A;  5B1M C;  4YS3 C;  5AV9 C;  2NQB A;  3UTA A;  3AZF C;  2F8N K;  1JFI B;  3LZ1 C;  4KGC B;  3AN2 C;  2XD1 A;  4J8U A;  3X1T B;  5C3I B;  1B67 A;  5B1L D;  3NQU A;  3UTB C;  5B0Y B;  1P3G C;  3A1I A;  3B0B A;  4NE5 A;  4EO5 C;  4HGA B;  5GSU C;  3UT9 B;  3AV1 C;  3REL C;  2G5H C;  3B6F D;  5DNN A;  3WAA B;  5BS7 C;  5B2J B;  5B0Z C;  4KGC D;  2XD5 A;  4M6B A;  5E5A C;  5B0Y D;  4NE3 A;  4J8X B;  4ZBJ B;  2NZD C;  3AV2 A;  3VH6 T;  3AFA B;  1P3M A;  3MVD C;  5FUG A;  3UT9 D;  4JJN B;  1M19 B;  5B2I C;  3MGQ C;  5AVC B;  5B2J D;  3REI A;  4WU9 B;  3WAA D;  4KHA A;  2Y2H A;  5CP6 B;  3X1T A;  2Y2K A;  1P3B B;  5B31 A;  1HQ3 C;  4J8X D;  4H9S A;  5BNV A;  3VH6 A;  4LD9 B;  2ZY5 A;  3AYW A;  1TAF B;  1KX3 B;  5GT0 A;  4J8W C;  3WKJ C;  5AV6 D;  3KXB B;  3C1B B;  1ID3 B;  3AFA D;  4JJN D;  4NE6 A;  3WTP C;  3REH A;  1P3G B;  1M19 D;  1KU5 A;  4WU9 D;  3MGR A;  1KX5 B;  2F8N B;  4WV4 B;  5CP6 D;  3A6N C;  4H9P B;  5BNX B;  3AZH C;  3H0R C;  3REL B;  1U35 C;  3AZJ A;  4LD9 D;  2Y2I A;  1KX3 D;  3AN2 D;  3KXB D;  1B6W A;  1ID3 D;  5B40 B;  3UTB D;  5BO0 B;  3KUY C;  3MGS C;  1M19 A;  1P3G D;  1P3P B;  5JRG C;  5AVC A;  2BG1 A;  4AWL B;  4WU9 A;  1KX5 D;  2W8S A;  1P3I A;  2F8N D;  2Y2Q A;  4QLC A;  1P3B A;  3REL D;  3W97 B;  5F99 A;  1H3O B;  3EG5 B;  5CPJ C;  2HUE B;  3C1B A;  5CPI C;  3X1U B;  1M18 C;  5GXQ B;  5DNM C;  1HQ3 B;  2NZD D;  1P34 C;  1AOI C;  3F6T A;  4NFT A;  1ZLA A;  4Z66 B;  5B31 G;  4H9R B;  3AZI C;  1P3F C;  3W97 D;  2BYM A;  5B2I D;  5AV8 A;  1WWI A;  3LJA B;  4G92 B;  1P3K B;  4YM6 A;  2BYK A;  5B33 A;  5B40 A;  3X1U D;  3AZH B;  2JCH A;  3TU4 A;  5GXQ D;  2HIO C;  1HQ3 D;  1P3P A;  1P3L A;  4KUD C;  4J8W D;  3B6G C;  4XZQ A;  3AZK C;  2DQN C;  4J8V C;  4Z66 D;  3C1C C;  3REK C;  3H0M C;  3WTP D;  5JRG B;  5B32 A;  2NQB C;  3UTA C;  3AZN B;  3W98 B;  3A6N D;  4J8U C;  3AZH D;  3X1V B;  2ARO B;  2Y2J A;  3W96 A;  4Z2M G;  4WU8 C;  2YFV B;  1BH9 B;  3AZG B;  5AV5 C;  4Z66 A;  4H9R A;  3LJA A;  1P3K A;  5JRG D;  5B24 B;  5DNN C;  3AZN D;  3W98 D;  4WNN B;  3X1S C;  4XUJ A;  2FJ7 C;  3X1V D;  1BH8 A;  3AZL B;  3VH5 A;  5GT3 A;  1P3A C;  1P3M C;  5DNM D;  5B24 D;  3REJ C;  1P34 D;  4KUD B;  3REI C;  1S32 C;  3LZ0 B;  1WWS A;  3KWQ C;  1ULY A;  5B31 C;  2ARO A;  4ZUX A;  2Y2L A;  3AZE C;  1BH9 A;  3AZG A;  3AZL D;  3AYW C;  2F8N H;  1TZY A;  1KX4 C;  3R45 B;  5AY8 A;  2HIO D;  3B6F B;  3REH C;  4WU8 B;  2ZY2 A;  3KSY A;  3W99 A;  4KUD D;  3AZK D;  3O62 B;  4WNN A;  4CAY B;  3LZ0 D;  4J8V D;  1P3O A;  4UUZ B;  2PYO A;  1F66 B;  3MNN B;  3AZJ C;  4H9O A;  3WA9 B;  2FFF B;  3X1S B;  3LEL A;  4WU8 D;  1P3I C;  3A1K A;  3NQJ B;  3O62 D;  5AV5 D;  1P3A B;  5B1L A;  4QLC C;  1F66 D;  3P5J B;  3MNN D;  5AV6 B;  3WA9 D;  3KWQ B;  2ZY3 A;  3X1S D;  2Y2N A;  3MGP C;  2FJ7 D;  3B6F A;  1JFI A;  5JA4 B;  2Y2O A;  3AZE B;  4KGC A;  4CAY A;  5AVB B;  3VH5 W;  1P3A D;  3WTP E;  1ZLA C;  5B1M B;  4YS3 B;  5AV9 B;  5B0Y A;  3AZF B;  3REJ D;  4R8P C;  3LZ1 B;  3AN2 B;  4YM6 C;  1S32 D;  3KWQ D;  5KDM B;  5BT1 C;  5B33 C;  3UTB B;  3UT9 A;  4WJ3 C;  3TU4 C;  3WAA A;  2JSS A;  5B2J A;  1P3L C;  3AZE D;  5CPK C;  4EO5 B;  4XZQ C;  4H9N B;  5GSU B;  5AVB D;  3AV1 B;  5B1M D;  4YS3 D;  5AV9 D;  4Z5T C;  4J8X A;  5B0Z B;  3AZF D;  3LZ1 D;  5AV6 A;  3AFA A;  4E45 A;  5E5A B;  4JJN A;  2NZD B;  4H9Q B;  5CP6 A;  5GSU D;  3MVD B;  3AV1 D;  5B2I B;  3MGQ B;  5B0Z D;  4LD9 A;  1TAF A;  3AZM C;  1KX3 A;  3AN2 A;  3KXB A;  1ID3 A;  3UTB A;  5E5A D;  1P3G A;  4XUJ C;  1KX5 A;  2F8N A;  3WKJ B;  4J8W B;  4H9P A;  5BNX A;  3MVD D;  3MGP D;  5GT3 C;  3REL A;  3WTP B;  3MGQ D;  2CWE A;  3A6N B;  1EQZ C;  1U35 B;  5BO0 A;  1N1J B;  1M1A C;  2NZD A;  3WKJ D;  4X23 C;  4R8P D;  3VH6 W;  4ZUX C;  2CV5 C;  3KUY B;  3W97 A;  3MGS B;  5B2I A;  5AY8 C;  1H3O A;  1HTA A;  5CPK D;  3W99 C;  3X1U A;  1U35 D;  5GXQ A;  1HQ3 A;  4Z5T D;  1P3O C;  4J8W A;  2RVQ C;  3EPJ A;  5CPJ B;  5CPI B;  1M18 B;  3LEL C;  3WTP A;  3MGS D;  3KUY D;  5DNM B;  1P34 B;  2G5I C;  1AOI B;  2J8P A;  3EPH A;  2JE5 A;  3H0L C;  2IO5 C;  3A6N A;  3AZH A;  1P3F B;  3AZI B;  3AZM D;  5CPJ D;  3AV2 C;  2Y2G A;  3EPK A;  5CPI D;  1EQZ B;  1M18 D;  2ZY4 A;  2HIO B;  5JRG A;  1M1A B;  3AZN A;  1AOI D;  3B6G B;  3AZK B;  3W98 A;  3KFU G;  4J8V B;  3X1T C;  5C3I C;  3C1C B;  1P3F D;  3REK B;  3AZI D;  3X1V A;  2NQB B;  3UTA B;  2YFW B;  4H9S C;  2YFV A;  5GT0 C;  4J8U B;  3B0C W;  1EQZ D;  4HGA C;  5DNM A;  3NQU B;  3UT9 C;  5B32 G;  3EPL A;  5B24 A;  1M1A D;  1P34 A;  3WAA C;  4X23 D;  5B2J C;  3MGR C;  3B6G D;  5AV5 B;  2CV5 D;  1PZR A;  3C1C D;  3AZI A;  3REK D;  1BFM A;  2NQB D;  3UTA D;  5DNN B;  4J8X C;  4ZBJ C;  3AZL A;  4J8U D;  4E44 A;  2FJ7 B;  2HIO A;  4JJN C;  1M19 C;  1R4V A;  4KUD A;  4WU9 C;  5AVC C;  3AZK A;  3LZ0 A;  4J8V A;  5CP6 C;  1P3M B;  1P3B C;  5FUG B;  5F99 C;  2YFW A;  5DNN D;  3REJ B;  3REI B;  4LD9 C;  4KHA B;  1S32 B;  1KX3 C;  3KXB C;  3C1B C;  3R45 A;  1ID3 C;  4G91 C;  5B31 B;  1T3U A;  4WU8 A;  5BNV B;  1KX5 C;  3AYW B;  2VQR A;  5GT0 B;  3O62 A;  3AV2 D;  5AV5 A;  1KX4 B;  3FDD A;  4UUZ A;  1P3M D;  3REH B;  1F66 A;  4CSR B;  3IP4 C;  5AV8 C;  3MGR B;  3MNN A;  3REI D;  4DQY B;  3WA9 A;  3X1T D;  3X1S A;  2FJ7 A;  1Z2C B;  5B40 C;  5B31 D;  1P3P C;  3AZJ B;  4AWL C;  3AYW D;  3NQJ A;  5GT0 D;  1P3A A;  1KX4 D;  3V9R B;  3W97 C;  3REH D;  3REJ A;  5B32 C;  3MGR D;  1P3I B;  1S32 A;  3KWQ A;  2HUE C;  4QLC B;  3X1U C;  5GXQ C;  5F99 B;  5JA4 A;  3AZE A;  3W96 C;  3AZJ D;  5AVB A;  4WZS B;  3MGP B;  1KX4 A;  4G91 B;  5B1M A;  5AV9 A;  4Z66 C;  4YS3 A;  3AZF A;  4CSR A;  3LJA C;  1P3K C;  5AVC D;  3LZ1 A;  4G92 C;  1P3I D;  5KDM A;  1ZLA B;  4QLC D;  1P3B D;  2BYM B;  5F99 D;  5AV8 B;  4R8P B;  4YM6 B;  2BYK B;  4H9N A;  5GSU A;  5B33 B;  3V9R A;  3C1B D;  3AV1 A;  3AL0 C;  3TU4 B;  5BS7 A;  4DRA A;  5B0Z A;  2ZM5 A;  1P3L B;  5CPK B;  1A7W A;  3AZN C;  3W98 C;  4XZQ B;  5CHL B;  1ZLA D;  5E5A A;  4Z5T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...