3AZJB

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVQRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjB00
3WA9A 1M18C 4ZUXD 4QLCC 1AOIC 4YM6B 3MVDD 3REIB 3LZ0C 3REHC 1ULYA 5JA4B 4WU9C 4XZQD 2HUEC 3AYWB 5AV8A 3WKJD 3VH5W 5B2ID 3O62B 5AV8C 1KX5B 5G49B 5E5AA 3AZIB 1P3KB 2LY8A 5AV9D 5CPJA 4X23A 2NZDD 3C1BD 5B31A 1M1AB 4KUDB 3W99C 4H9QA 3MGRD 3AN2C 1P34A 3AZMD 1P3AD 2PYOD 4YM6C 3MGRC 5CP6B 3AZEC 5GSUB 5AV5C 1P3KA 2YFVB 3AYWC 2BYMA 3LJAB 2FJ7A 1KX4C 1P3BD 1S32A 5B0ZA 5B32A 3UTBA 3MNND 3KWQA 3REJB 3AYWA 1KX3D 3B0DB 2CV5A 3UTAB 5GT3A 4ZBJB 2IO5C 1EQZA 4KUDC 5B2JB 3X1UD 1S32B 2L5AA 4R8PD 3X1UC 3MGRB 5BNVA 5AV9A 3AZKC 3LZ1A 5B0YD 4X23D 3AZHD 4YS3D 1P3LA 5B2JA 3TU4B 3AZMA 1B6WA 3WTPE 2AROD 5B24D 1ZLAD 1TZYA 5B1LB 1F66C 3R45A 2AROC 5AY8C 3B6FA 4ZBJC 5F99D 3W98A 3MGQB 1B67A 4J8XA 1N1JA 3V9RB 3AZJB 1P3BA 4QLCA 1HQ3B 5B0ZD 1U35A 4UUZB 1P3PA 3X1UB 1S32D 5AV6B 4H9SC 5B32D 2CV5D 4J8UB 4G91B 3C1BC 3B6FB 1TAFA 2CV5C 3UT9A 3AV1C 3VH6T 3WKJB 3AZGC 4Z2MG 5GXQB 5KDMA 1P34D 4JJND 1P3AA 1M18B 1EQZD 2F8NB 3LELA 1KX5D 2NQBC 5B1MA 2AROB 4XUJC 5AVCA 1P3IA 4J8VC 3MGQC 5B40C 3UT9B 1M1AD 4XZQC 3WAAA 4CSRB 5B2IA 5F99B 1P3MA 5B24A 1ZLAA 5AV8B 1U35C 3MGPC 5KDMB 4WU8D 3NQJB 5CP6D 1HQ3A 3AZJA 4J8XC 2CV5B 4HGAB 3LZ0A 3B6FD 5FUGB 5BNXA 5AV6A 4J8XD 3A6NC 3X1TA 3X1UA 3B6GD 3MGSB 4NE5A 4G92C 4LD9A 4WZSB 5DNMA 5GT0D 3RELD 3AZMC 4JJNB 5JRGA 4AWLB 3AZFC 1P3LC 3AZNA 5B40B 4J8VB 1AOIB 2BYKB 4WNNB 2NZDC 2FJ7D 1P3LD 3REIC 2CWEA 3LJAC 4KHAA 1P3FA 5B2JD 3UT9D 3AN2D 4H9PA 4Z66D 1BFMA 4R8PB 5BS7C 4JJNA 3REJC 1ID3D 3X1SA 4X23B 4WU8B 3AZIC 4H9RA 5GT3C 2IO5B 5AV5A 5DNNB 5CPID 3NQJA 5CPIC 4J8WD 5B32C 4H9PB 1Q9CA 5AVBD 3AZGA 4CSRA 5B2IB 5BT1C 3AZLB 4H9NA 3REIA 2YFVA 3AZEA 5BT1D 3AZJD 5GSUC 5AV5B 5BNVB 5AV9B 3VH6W 3C1CB 4LD9C 2RVQC 5FUGA 5BNXB 5GT0A 5B0YC 3RELA 5GT3B 3W98C 4H9NB 2NZDA 4KGCD 1HQ3C 5DNND 5CPIB 2F8ND 3X1SB 1F66D 5C3IB 1P3BB 4UUZA 2HIOB 3NQUA 4KGCB 4Z5TA 4XZQA 1KX3B 3REKB 4J8UA 3WKJC 5CPKD 1P3GD 5B31G 5AV9C 2YFWB 1EQZB 1TZYB 3KWQC 3KWQD 3TU4C 4M6BA 4XUJB 3C1CD 3WAAC 3AFAB 3UT9C 3AV1A 2BYKA 4WNNA 3MNNA 3B6GB 3AYWD 1KX3A 5G49A 1P3PB 5AVCB 1P3IB 2PYOA 1U35B 5GT0B 3RELB 3O62D 4WV4B 3LELC 2NQBA 3X1SD 3W97B 5B40D 3O62C 4J8VD 5B24B 1ZLAB 1KX3C 3MVDC 3KUYD 5JA4A 1P3KC 4J8UC 3WKJA 5AY8A 3C1BB 3B6FC 1M19D 2HIOA 5DNMD 3KUYC 4H9SA 1F66A 5JRGC 3TU4A 3AZMB 5DNMC 1TZYD 3B0BA 3AZND 3AZFB 3W99A 2BYMB 3VH5T 2NQBB 5CPJD 3W96B 1P3FD 3LJAA 5F99A 4E45A 3AZEB 5CPKA 4YS3C 1P3GA 1AOIA 5GT0C 3RELC 3AFAA 1ID3A 1P3PD 1BH9B 4H9QB 5GXQD 4DRBA 3REJD 1P34B 1P3MC 1M18D 1ID3C 4QLCD 4CAYA 4E44A 3AZHA 4YS3A 3UTAD 5GSUA 3W97D 4WU9A 3X1TB 1TAFB 2F8NH 3REHA 3UTAC 4H9RB 3KUYB 4HGAC 5B33D 3LZ1B 3UTBD 4J8WC 5DNMB 5B1MD 1S32C 4G92B 5GT3D 4ZUXB 4Z2MH 3REHB 1M19A 3W96D 4EO5C 3R45B 5B1LA 4R8PA 1P34C 5B31B 1M1AA 3WAAD 3WTPA 4R8PC 2PYOC 3AV1D 5B1LC 4KGCA 5CPKB 1P3GB 3X1TD 3B6GA 3LELD 1KX5A 2AROA 3X1SC 4LD9D 3LZ0D 1KX4D 4Z5TD 3AN2B 4H9OA 4XUJD 3KXBA 5AV6D 5B32B 4J8UD 3W98D 5GXQA 4ZUXC 1P3AB 5AV6C 5CP6C 5AY8D 3UTAA 5JRGD 4WU9D 3REHD 1U35D 4ZUXA 3KSYA 5B31D 3AFAC 1BH8A 3WA9D 3WAAB 5CPKC 1P3GC 5AVBB 3A6ND 3B6GC 3AZLD 5AVCC 1P3IC 3WTPB 3AZNB 3LELB 5AV5D 3AZFD 1M18A 3KXBC 5B24C 1ZLAC 1P3AC 4KHAB 1P3FB 2FJ7C 3MGSA 3AV2C 3MVDB 3REID 3X1VC 2HIOC 2YFWA 3AZED 5AVBA 3MNNC 3MGQA 4J8XB 3X1VA 5JRGB 3MGRA 1P3OA 5BO0A 5BS7A 4QLCB 1KX4A 1A7WA 1JFIB 1F66B 3W96C 1P3KD 1P3LB 2NZDB 4NE3A 1KU5A 4YM6A 5E5AC 1P3PC 3WTPD 1ID3B 5B0ZB 2F8NA 3AV2B 3A6NA 3X1TC 3W97C 5B33A 4X23C 3LZ1C 5DNNC 4J8WB 5B33C 3AZLA 5CHLB 3AZFA 3W99B 5GXQC 4Z66C 3MGPA 1H3OA 1WWSA 4KUDA 5B2IC 1P3OB 5DNNA 3B0CT 5CP6A 5F99C 3LZ0B 3NQUB 1KX4B 1JFIA 4Z5TB 3O62A 5B32G 3MGPB 5B0ZC 3C1CC 3VH6A 5AV8D 1EQZC 5B0YB 3KUYA 1KX5C 2NQBD 5CPJB 1WWIA 5B40A 4YM6D 4J8VA 4XUJA 3KXBD 3TU4D 3MGSC 3AV2A 3C1CA 3W99D 2HIOD 1M1AC 3WA9B 3MGSD 2RVQD 1P3BC 3REKD 1P3OC 3MGQD 2F8NG 1R4VA 3AZID 1M19C 3REKC 1P3OD 1AOID 1HQ3D 4Z5TC 1H3OB 4EO5B 1TZYC 4NFTA 3KWQB 3B0CW 3REJA 3UTBB 4KUDD 3MGPD 5B31C 3AFAD 4J8WA 4WU8C 2F8NK 2PYOB 5CPJC 5E5AD 4DRAA 3B0DC 5AVCD 3AZJC 3AZKA 1P3ID 3VH5A 3AZNC 3W97A 5GSUD 4WU8A 3AZHC 4H9OB 3KXBB 3WA9C 3LJAD 1P3MD 5B2JC 4G91C 4NE6A 4Z66A 3AZLC 3X1VD 3MNNB 3AV1B 1M19B 3AZKB 3MVDA 3AZGB 4KGCC 5B0YA 3W96A 1BH8B 5B1MC 3UTBC 3AV2D 4LD9B 5BO0B 1N1JB 3V9RA 3W98B 3REKA 4XZQB 5AVBC 5E5AB 5AY8B 3C1BA 3AZIA 4WU9B 4CAYB 3AZHB 4YS3B 2HUEB 3WTPC 3AN2A 5C3IC 2JSSA 5CPIA 1P3MB 1HTAA 1P3FC 2FJ7B 5B1LD 5B33B 3X1VB 3LZ1D 3A6NB 4Z66B 1F1EA 3AZKD 5B1MB 1BH9A 3AZGD 4JJNC 4AWLC
chains in the Genus database with same CATH superfamily
3WA9A 1M18C 4ZUXD 4QLCC 2F2AC 1AOIC 4YM6B 3MVDD 3REIB 3LZ0C 3EPJA 3REHC 1ULYA 5JA4B 4WU9C 2G5HC 4XZQD 2HUEC 3AYWB 5AV8A 3WKJD 3VH5W 5B2ID 3O62B 5AV8C 1KX5B 5G49B 5E5AA 3AZIB 2Y2IA 1P3KB 2LY8A 5AV9D 5CPJA 4X23A 2NZDD 3C1BD 5B31A 1M1AB 4KUDB 3W99C 4H9QA 3MGRD 3AN2C 1P34A 3AZMD 1P3AD 2PYOD 4YM6C 3MGRC 5CP6B 3AZEC 5GSUB 5AV5C 1P3KA 1T3UA 2YFVB 3H0LC 3AYWC 2BYMA 3LJAB 2FJ7A 1KX4C 1P3BD 1S32A 5B0ZA 5B32A 3UTBA 3MNND 3KWQA 3REJB 3AYWA 1KX3D 3B0DB 2CV5A 3UTAB 5GT3A 4ZBJB 2IO5C 1EQZA 4KUDC 5B2JB 3X1UD 1S32B 2L5AA 4R8PD 3X1UC 3MGRB 5BNVA 5AV9A 3AZKC 3LZ1A 5B0YD 4X23D 3AZHD 4YS3D 2JE5A 1P3LA 5B2JA 3TU4B 3AZMA 1B6WA 3WTPE 2AROD 5B24D 1ZLAD 1TZYA 5B1LB 1F66C 3R45A 2AROC 5AY8C 3B6FA 2VQRA 4ZBJC 5F99D 3W98A 3MGQB 1B67A 4J8XA 1N1JA 3V9RB 3KFUG 3AZJB 1P3BA 4QLCA 1HQ3B 5B0ZD 1U35A 4UUZB 1P3PA 3X1UB 1S32D 5AV6B 4H9SC 5B32D 2CV5D 4J8UB 4G91B 3C1BC 3B6FB 1TAFA 2CV5C 3UT9A 3AV1C 3VH6T 3WKJB 3AZGC 4Z2MG 5GXQB 5KDMA 1P34D 4JJND 1P3AA 1M18B 1EQZD 2F8NB 3LELA 1KX5D 2NQBC 5B1MA 2AROB 4XUJC 5AVCA 1P3IA 2Y2LA 3MGQC 4J8VC 5B40C 3UT9B 1M1AD 4XZQC 3WAAA 4CSRB 5F99B 5B2IA 1P3MA 5B24A 1ZLAA 5AV8B 1U35C 3MGPC 5KDMB 4WU8D 3NQJB 5CP6D 1HQ3A 3IP4C 3EPLA 3AZJA 3H0RC 4J8XC 2CV5B 4HGAB 3LZ0A 3B6FD 5FUGB 5BNXA 5AV6A 4J8XD 3A6NC 3X1TA 3X1UA 3B6GD 3MGSB 4NE5A 4G92C 4LD9A 3EPHA 4WZSB 5DNMA 5GT0D 3RELD 3AZMC 4JJNB 5JRGA 4AWLB 3AZFC 1P3LC 3AZNA 5B40B 4J8VB 1AOIB 2BYKB 4WNNB 2NZDC 2FJ7D 1P3LD 3REIC 2CWEA 3LJAC 2UWXA 4KHAA 1P3FA 5B2JD 3UT9D 3AN2D 4H9PA 4Z66D 1BFMA 4R8PB 5BS7C 4JJNA 3REJC 1ID3D 3X1SA 4X23B 4WU8B 3AZIC 4H9RA 5GT3C 2IO5B 5AV5A 5DNNB 5CPID 3NQJA 5CPIC 4J8WD 5B32C 4H9PB 1Q9CA 5AVBD 3AZGA 4CSRA 5B2IB 5BT1C 3AZLB 4H9NA 3REIA 2YFVA 3AZEA 5BT1D 3P5JB 3AZJD 5AV5B 5GSUC 5BNVB 5AV9B 3VH6W 3C1CB 4LD9C 2RVQC 5FUGA 5BNXB 5GT0A 5B0YC 3RELA 2ZY3A 5GT3B 3W98C 4H9NB 2NZDA 4KGCD 1HQ3C 5DNND 5CPIB 2F8ND 3X1SB 1F66D 5C3IB 1P3BB 4UUZA 2HIOB 3NQUA 4KGCB 4Z5TA 4XZQA 1KX3B 3REKB 4J8UA 3WKJC 5CPKD 1P3GD 5B31G 5AV9C 1W2EA 2YFWB 2Y2KA 1EQZB 1TZYB 3KWQC 3KWQD 3TU4C 4M6BA 4XUJB 3C1CD 3WAAC 3AFAB 3UT9C 3AV1A 2BYKA 3A1IA 4WNNA 3MNNA 3B6GB 3AYWD 1KX3A 2Y2MA 5G49A 1P3PB 5AVCB 1P3IB 2PYOA 3EG5B 1U35B 5GT0B 3RELB 3O62D 4WV4B 3LELC 2NQBA 3X1SD 3W97B 5B40D 3O62C 4J8VD 5B24B 1ZLAB 1KX3C 3MVDC 2ZY4A 5JA4A 3KUYD 1P3KC 4J8UC 3WKJA 5AY8A 3C1BB 3B6FC 1M19D 2HIOA 5DNMD 3KUYC 4H9SA 1F66A 5JRGC 3TU4A 3AZMB 5DNMC 1TZYD 3B0BA 3AZND 3AZFB 3W99A 2BYMB 3VH5T 2NQBB 4DQYB 5CPJD 2DF4C 3W96B 1P3FD 3LJAA 5F99A 4E45A 3AZEB 5CPKA 4YS3C 1P3GA 1AOIA 5GT0C 3RELC 3AFAA 1ID3A 1P3PD 1BH9B 4H9QB 5GXQD 4DRBA 3EPKA 3REJD 1P34B 1P3MC 1M18D 4QLCD 4CAYA 4E44A 3AZHA 1ID3C 4YS3A 3UTAD 5GSUA 3W97D 4WU9A 3X1TB 1TAFB 2F8NH 3REHA 3UTAC 4H9RB 3KUYB 3F6TA 4HGAC 5B33D 3LZ1B 3UTBD 1Z2CB 4J8WC 2ZY2A 5DNMB 5B1MD 2JCHA 1S32C 4G92B 5GT3D 4ZUXB 4Z2MH 3REHB 1M19A 3W96D 4EO5C 3R45B 5B1LA 4R8PA 2Y2HA 1P34C 5B31B 1M1AA 3WAAD 3WTPA 4R8PC 2PYOC 3AV1D 5B1LC 4KGCA 5CPKB 1P3GB 3X1TD 3B6GA 3AL0C 3LELD 1KX5A 2AROA 2Y2QA 3X1SC 4LD9D 3LZ0D 1KX4D 4Z5TD 3AN2B 2Y2NA 4H9OA 4XUJD 5AV6D 3KXBA 5B32B 4J8UD 3W98D 5GXQA 4ZUXC 1P3AB 5AV6C 2Y2GA 5CP6C 2ZM5A 5AY8D 3UTAA 5JRGD 4WU9D 3REHD 1U35D 4ZUXA 3KSYA 5B31D 3AFAC 1BH8A 3WA9D 3WAAB 2W8SA 5CPKC 1P3GC 5AVBB 3A6ND 3B6GC 3AZLD 5AVCC 1P3IC 3WTPB 3AZNB 3LELB 5AV5D 3AZFD 1M18A 3KXBC 5B24C 1ZLAC 1P3AC 4KHAB 1P3FB 2Y2PA 2FJ7C 3MGSA 3AV2C 3MVDB 3REID 3X1VC 2HIOC 2YFWA 3AZED 5AVBA 3MNNC 3MGQA 4J8XB 4UPKA 3X1VA 5JRGB 3MGRA 1P3OA 5BO0A 5BS7A 4QLCB 1KX4A 1A7WA 1JFIB 1F66B 3W96C 1P3KD 4WJ3C 1P3LB 2NZDB 4NE3A 1KU5A 2XD1A 4YM6A 5E5AC 1P3PC 3WTPD 2DQNC 1ID3B 5B0ZB 2F8NA 3AV2B 3A6NA 3X1TC 3W97C 5B33A 4X23C 3LZ1C 2XD5A 5DNNC 4J8WB 5B33C 3AZLA 5CHLB 3AZFA 3W99B 5GXQC 4Z66C 3MGPA 2Y2OA 1H3OA 1PZRA 1WWSA 4KUDA 5B2IC 2J8PA 1P3OB 5DNNA 3B0CT 5CP6A 5F99C 3LZ0B 3NQUB 1KX4B 1JFIA 4Z5TB 3A1KA 5B32G 3O62A 3MGPB 5B0ZC 3C1CC 3VH6A 5AV8D 1EQZC 5B0YB 3KUYA 1KX5C 2NQBD 5CPJB 1WWIA 5B40A 4YM6D 4J8VA 4XUJA 3KXBD 3TU4D 3MGSC 3AV2A 3C1CA 3W99D 2HIOD 1M1AC 3WA9B 3MGSD 2RVQD 1P3BC 3REKD 1P3OC 2FFFB 3MGQD 2F8NG 1R4VA 3AZID 1M19C 3REKC 1P3OD 1AOID 2G5IC 1HQ3D 4Z5TC 1H3OB 4EO5B 2BG1A 1TZYC 4NFTA 3KWQB 3B0CW 3REJA 3UTBB 4KUDD 3H0MC 3MGPD 5B31C 3AFAD 4J8WA 4WU8C 2F8NK 2PYOB 5CPJC 5E5AD 4DRAA 3B0DC 5AVCD 3AZJC 3AZKA 1P3ID 3VH5A 3AZNC 3W97A 5GSUD 4WU8A 3AZHC 4H9OB 3KXBB 3WA9C 3LJAD 1P3MD 2RIQA 5B2JC 4G91C 4NE6A 4Z66A 3AZLC 3X1VD 3MNNB 3AV1B 1M19B 3FDDA 3AZKB 3MVDA 3AZGB 4KGCC 2Y2JA 5B0YA 3W96A 1BH8B 5B1MC 3UTBC 3AV2D 4LD9B 5BO0B 1N1JB 3V9RA 3W98B 3REKA 4XZQB 5AVBC 5E5AB 5AY8B 3C1BA 3AZIA 4WU9B 4CAYB 3AZHB 4YS3B 2HUEB 3WTPC 3AN2A 5C3IC 2JSSA 5CPIA 1P3MB 1HTAA 1P3FC 2FJ7B 5B1LD 5B33B 3X1VB 3LZ1D 3A6NB 4Z66B 1F1EA 3AZKD 5B1MB 1BH9A 3AZGD 2ZY5A 4JJNC 4AWLC
chains in the Genus database with same CATH topology
3WA9A 1M18C 4ZUXD 4QLCC 2F2AC 1AOIC 4YM6B 3MVDD 3REIB 3LZ0C 3EPJA 3REHC 1ULYA 5JA4B 4WU9C 2G5HC 4XZQD 2HUEC 3AYWB 5AV8A 3WKJD 3VH5W 5B2ID 3O62B 5AV8C 1KX5B 5G49B 5E5AA 3AZIB 2Y2IA 1P3KB 2LY8A 5AV9D 5CPJA 4X23A 2NZDD 3C1BD 5B31A 1M1AB 4KUDB 3W99C 4H9QA 3MGRD 3AN2C 1P34A 3AZMD 1P3AD 2PYOD 4YM6C 3MGRC 5CP6B 3AZEC 5GSUB 5AV5C 1P3KA 1T3UA 2YFVB 3H0LC 3AYWC 2BYMA 3LJAB 2FJ7A 1KX4C 1P3BD 1S32A 5B0ZA 5B32A 3UTBA 3MNND 3KWQA 3REJB 3AYWA 1KX3D 3B0DB 2CV5A 3UTAB 5GT3A 4ZBJB 2IO5C 1EQZA 4KUDC 5B2JB 3X1UD 1S32B 2L5AA 4R8PD 3X1UC 3MGRB 5BNVA 5AV9A 3AZKC 3LZ1A 5B0YD 4X23D 3AZHD 4YS3D 2JE5A 1P3LA 5B2JA 3TU4B 3AZMA 1B6WA 3WTPE 2AROD 5B24D 1ZLAD 1TZYA 5B1LB 1F66C 3R45A 2AROC 5AY8C 3B6FA 2VQRA 4ZBJC 5F99D 3W98A 3MGQB 1B67A 4J8XA 1N1JA 3V9RB 3KFUG 3AZJB 1P3BA 4QLCA 1HQ3B 5B0ZD 1U35A 4UUZB 1P3PA 3X1UB 1S32D 5AV6B 4H9SC 5B32D 2CV5D 4J8UB 4G91B 3C1BC 3B6FB 1TAFA 2CV5C 3UT9A 3AV1C 3VH6T 3WKJB 3AZGC 4Z2MG 5GXQB 5KDMA 1P34D 4JJND 1P3AA 1M18B 1EQZD 2F8NB 3LELA 1KX5D 2NQBC 5B1MA 2AROB 4XUJC 5AVCA 1P3IA 2Y2LA 3MGQC 4J8VC 5B40C 3UT9B 1M1AD 4XZQC 3WAAA 4CSRB 5F99B 5B2IA 1P3MA 5B24A 1ZLAA 5AV8B 1U35C 3MGPC 5KDMB 4WU8D 3NQJB 5CP6D 1HQ3A 3IP4C 3EPLA 3AZJA 3H0RC 4J8XC 2CV5B 4HGAB 3LZ0A 3B6FD 5FUGB 5BNXA 5AV6A 4J8XD 3A6NC 3X1TA 3X1UA 3B6GD 3MGSB 4NE5A 4G92C 4LD9A 3EPHA 4WZSB 5DNMA 5GT0D 3RELD 3AZMC 4JJNB 5JRGA 4AWLB 3AZFC 1P3LC 3AZNA 5B40B 4J8VB 1AOIB 2BYKB 4WNNB 2NZDC 2FJ7D 1P3LD 3REIC 2CWEA 3LJAC 2UWXA 4KHAA 1P3FA 5B2JD 3UT9D 3AN2D 4H9PA 4Z66D 1BFMA 4R8PB 5BS7C 4JJNA 3REJC 1ID3D 3X1SA 4X23B 4WU8B 3AZIC 4H9RA 5GT3C 2IO5B 5AV5A 5DNNB 5CPID 3NQJA 5CPIC 4J8WD 5B32C 4H9PB 1Q9CA 5AVBD 3AZGA 4CSRA 5B2IB 5BT1C 3AZLB 4H9NA 3REIA 2YFVA 3AZEA 5BT1D 3P5JB 3AZJD 5AV5B 5GSUC 5BNVB 5AV9B 3VH6W 3C1CB 4LD9C 2RVQC 5FUGA 5BNXB 5GT0A 5B0YC 3RELA 2ZY3A 5GT3B 3W98C 4H9NB 2NZDA 4KGCD 1HQ3C 5DNND 5CPIB 2F8ND 3X1SB 1F66D 5C3IB 1P3BB 4UUZA 2HIOB 3NQUA 4KGCB 4Z5TA 4XZQA 1KX3B 3REKB 4J8UA 3WKJC 5CPKD 1P3GD 5B31G 5AV9C 1W2EA 2YFWB 2Y2KA 1EQZB 1TZYB 3KWQC 3KWQD 3TU4C 4M6BA 4XUJB 3C1CD 3WAAC 3AFAB 3UT9C 3AV1A 2BYKA 3A1IA 4WNNA 3MNNA 3B6GB 3AYWD 1KX3A 2Y2MA 5G49A 1P3PB 5AVCB 1P3IB 2PYOA 3EG5B 1U35B 5GT0B 3RELB 3O62D 4WV4B 3LELC 2NQBA 3X1SD 3W97B 5B40D 3O62C 4J8VD 5B24B 1ZLAB 1KX3C 3MVDC 2ZY4A 5JA4A 3KUYD 1P3KC 4J8UC 3WKJA 5AY8A 3C1BB 3B6FC 1M19D 2HIOA 5DNMD 3KUYC 4H9SA 1F66A 5JRGC 3TU4A 3AZMB 5DNMC 1TZYD 3B0BA 3AZND 3AZFB 3W99A 2BYMB 3VH5T 2NQBB 4DQYB 5CPJD 2DF4C 3W96B 1P3FD 3LJAA 5F99A 4E45A 3AZEB 5CPKA 4YS3C 1P3GA 1AOIA 5GT0C 3RELC 3AFAA 1ID3A 1P3PD 1BH9B 4H9QB 5GXQD 4DRBA 3EPKA 3REJD 1P34B 1P3MC 1M18D 4QLCD 4CAYA 4E44A 3AZHA 1ID3C 4YS3A 3UTAD 5GSUA 3W97D 4WU9A 3X1TB 1TAFB 2F8NH 3REHA 3UTAC 4H9RB 3KUYB 3F6TA 4HGAC 5B33D 3LZ1B 3UTBD 1Z2CB 4J8WC 2ZY2A 5DNMB 5B1MD 2JCHA 1S32C 4G92B 5GT3D 4ZUXB 4Z2MH 3REHB 1M19A 3W96D 4EO5C 3R45B 5B1LA 4R8PA 2Y2HA 1P34C 5B31B 1M1AA 3WAAD 3WTPA 4R8PC 2PYOC 3AV1D 5B1LC 4KGCA 5CPKB 1P3GB 3X1TD 3B6GA 3AL0C 3LELD 1KX5A 2AROA 2Y2QA 3X1SC 4LD9D 3LZ0D 1KX4D 4Z5TD 3AN2B 2Y2NA 4H9OA 4XUJD 5AV6D 3KXBA 5B32B 4J8UD 3W98D 5GXQA 4ZUXC 1P3AB 5AV6C 2Y2GA 5CP6C 2ZM5A 5AY8D 3UTAA 5JRGD 4WU9D 3REHD 1U35D 4ZUXA 3KSYA 5B31D 3AFAC 1BH8A 3WA9D 3WAAB 2W8SA 5CPKC 1P3GC 5AVBB 3A6ND 3B6GC 3AZLD 5AVCC 1P3IC 3WTPB 3AZNB 3LELB 5AV5D 3AZFD 1M18A 3KXBC 5B24C 1ZLAC 1P3AC 4KHAB 1P3FB 2Y2PA 2FJ7C 3MGSA 3AV2C 3MVDB 3REID 3X1VC 2HIOC 2YFWA 3AZED 5AVBA 3MNNC 3MGQA 4J8XB 4UPKA 3X1VA 5JRGB 3MGRA 1P3OA 5BO0A 5BS7A 4QLCB 1KX4A 1A7WA 1JFIB 1F66B 3W96C 1P3KD 4WJ3C 1P3LB 2NZDB 4NE3A 1KU5A 2XD1A 4YM6A 5E5AC 1P3PC 3WTPD 2DQNC 1ID3B 5B0ZB 2F8NA 3AV2B 3A6NA 3X1TC 3W97C 5B33A 4X23C 3LZ1C 2XD5A 5DNNC 4J8WB 5B33C 3AZLA 5CHLB 3AZFA 3W99B 5GXQC 4Z66C 3MGPA 2Y2OA 1H3OA 1PZRA 1WWSA 4KUDA 5B2IC 2J8PA 1P3OB 5DNNA 3B0CT 5CP6A 5F99C 3LZ0B 3NQUB 1KX4B 1JFIA 4Z5TB 3A1KA 5B32G 3O62A 3MGPB 5B0ZC 3C1CC 3VH6A 5AV8D 1EQZC 5B0YB 3KUYA 1KX5C 2NQBD 5CPJB 1WWIA 5B40A 4YM6D 4J8VA 4XUJA 3KXBD 3TU4D 3MGSC 3AV2A 3C1CA 3W99D 2HIOD 1M1AC 3WA9B 3MGSD 2RVQD 1P3BC 3REKD 1P3OC 2FFFB 3MGQD 2F8NG 1R4VA 3AZID 1M19C 3REKC 1P3OD 1AOID 2G5IC 1HQ3D 4Z5TC 1H3OB 4EO5B 2BG1A 1TZYC 4NFTA 3KWQB 3B0CW 3REJA 3UTBB 4KUDD 3H0MC 3MGPD 5B31C 3AFAD 4J8WA 4WU8C 2F8NK 2PYOB 5CPJC 5E5AD 4DRAA 3B0DC 5AVCD 3AZJC 3AZKA 1P3ID 3VH5A 3AZNC 3W97A 5GSUD 4WU8A 3AZHC 4H9OB 3KXBB 3WA9C 3LJAD 1P3MD 2RIQA 5B2JC 4G91C 4NE6A 4Z66A 3AZLC 3X1VD 3MNNB 3AV1B 1M19B 3FDDA 3AZKB 3MVDA 3AZGB 4KGCC 2Y2JA 5B0YA 3W96A 1BH8B 5B1MC 3UTBC 3AV2D 4LD9B 5BO0B 1N1JB 3V9RA 3W98B 3REKA 4XZQB 5AVBC 5E5AB 5AY8B 3C1BA 3AZIA 4WU9B 4CAYB 3AZHB 4YS3B 2HUEB 3WTPC 3AN2A 5C3IC 2JSSA 5CPIA 1P3MB 1HTAA 1P3FC 2FJ7B 5B1LD 5B33B 3X1VB 3LZ1D 3A6NB 4Z66B 1F1EA 3AZKD 5B1MB 1BH9A 3AZGD 2ZY5A 4JJNC 4AWLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 A;  1M18 C;  4ZUX D;  4QLC C;  1AOI C;  4YM6 B;  3MVD D;  3REI B;  3LZ0 C;  3REH C;  1ULY A;  5JA4 B;  4WU9 C;  4XZQ D;  2HUE C;  3AYW B;  5AV8 A;  3WKJ D;  3VH5 W;  5B2I D;  3O62 B;  5AV8 C;  1KX5 B;  5G49 B;  5E5A A;  3AZI B;  1P3K B;  2LY8 A;  5AV9 D;  5CPJ A;  4X23 A;  2NZD D;  3C1B D;  5B31 A;  1M1A B;  4KUD B;  3W99 C;  4H9Q A;  3MGR D;  3AN2 C;  1P34 A;  3AZM D;  1P3A D;  2PYO D;  4YM6 C;  3MGR C;  5CP6 B;  3AZE C;  5GSU B;  5AV5 C;  1P3K A;  2YFV B;  3AYW C;  2BYM A;  3LJA B;  2FJ7 A;  1KX4 C;  1P3B D;  1S32 A;  5B0Z A;  5B32 A;  3UTB A;  3MNN D;  3KWQ A;  3REJ B;  3AYW A;  1KX3 D;  3B0D B;  2CV5 A;  3UTA B;  5GT3 A;  4ZBJ B;  2IO5 C;  1EQZ A;  4KUD C;  5B2J B;  3X1U D;  1S32 B;  2L5A A;  4R8P D;  3X1U C;  3MGR B;  5BNV A;  5AV9 A;  3AZK C;  3LZ1 A;  5B0Y D;  4X23 D;  3AZH D;  4YS3 D;  1P3L A;  5B2J A;  3TU4 B;  3AZM A;  1B6W A;  3WTP E;  2ARO D;  5B24 D;  1ZLA D;  1TZY A;  5B1L B;  1F66 C;  3R45 A;  2ARO C;  5AY8 C;  3B6F A;  4ZBJ C;  5F99 D;  3W98 A;  3MGQ B;  1B67 A;  4J8X A;  1N1J A;  3V9R B;  3AZJ B;  1P3B A;  4QLC A;  1HQ3 B;  5B0Z D;  1U35 A;  4UUZ B;  1P3P A;  3X1U B;  1S32 D;  5AV6 B;  4H9S C;  5B32 D;  2CV5 D;  4J8U B;  4G91 B;  3C1B C;  3B6F B;  1TAF A;  2CV5 C;  3UT9 A;  3AV1 C;  3VH6 T;  3WKJ B;  3AZG C;  4Z2M G;  5GXQ B;  5KDM A;  1P34 D;  4JJN D;  1P3A A;  1M18 B;  1EQZ D;  2F8N B;  3LEL A;  1KX5 D;  2NQB C;  5B1M A;  2ARO B;  4XUJ C;  5AVC A;  1P3I A;  4J8V C;  3MGQ C;  5B40 C;  3UT9 B;  1M1A D;  4XZQ C;  3WAA A;  4CSR B;  5B2I A;  5F99 B;  1P3M A;  5B24 A;  1ZLA A;  5AV8 B;  1U35 C;  3MGP C;  5KDM B;  4WU8 D;  3NQJ B;  5CP6 D;  1HQ3 A;  3AZJ A;  4J8X C;  2CV5 B;  4HGA B;  3LZ0 A;  3B6F D;  5FUG B;  5BNX A;  5AV6 A;  4J8X D;  3A6N C;  3X1T A;  3X1U A;  3B6G D;  3MGS B;  4NE5 A;  4G92 C;  4LD9 A;  4WZS B;  5DNM A;  5GT0 D;  3REL D;  3AZM C;  4JJN B;  5JRG A;  4AWL B;  3AZF C;  1P3L C;  3AZN A;  5B40 B;  4J8V B;  1AOI B;  2BYK B;  4WNN B;  2NZD C;  2FJ7 D;  1P3L D;  3REI C;  2CWE A;  3LJA C;  4KHA A;  1P3F A;  5B2J D;  3UT9 D;  3AN2 D;  4H9P A;  4Z66 D;  1BFM A;  4R8P B;  5BS7 C;  4JJN A;  3REJ C;  1ID3 D;  3X1S A;  4X23 B;  4WU8 B;  3AZI C;  4H9R A;  5GT3 C;  2IO5 B;  5AV5 A;  5DNN B;  5CPI D;  3NQJ A;  5CPI C;  4J8W D;  5B32 C;  4H9P B;  1Q9C A;  5AVB D;  3AZG A;  4CSR A;  5B2I B;  5BT1 C;  3AZL B;  4H9N A;  3REI A;  2YFV A;  3AZE A;  5BT1 D;  3AZJ D;  5GSU C;  5AV5 B;  5BNV B;  5AV9 B;  3VH6 W;  3C1C B;  4LD9 C;  2RVQ C;  5FUG A;  5BNX B;  5GT0 A;  5B0Y C;  3REL A;  5GT3 B;  3W98 C;  4H9N B;  2NZD A;  4KGC D;  1HQ3 C;  5DNN D;  5CPI B;  2F8N D;  3X1S B;  1F66 D;  5C3I B;  1P3B B;  4UUZ A;  2HIO B;  3NQU A;  4KGC B;  4Z5T A;  4XZQ A;  1KX3 B;  3REK B;  4J8U A;  3WKJ C;  5CPK D;  1P3G D;  5B31 G;  5AV9 C;  2YFW B;  1EQZ B;  1TZY B;  3KWQ C;  3KWQ D;  3TU4 C;  4M6B A;  4XUJ B;  3C1C D;  3WAA C;  3AFA B;  3UT9 C;  3AV1 A;  2BYK A;  4WNN A;  3MNN A;  3B6G B;  3AYW D;  1KX3 A;  5G49 A;  1P3P B;  5AVC B;  1P3I B;  2PYO A;  1U35 B;  5GT0 B;  3REL B;  3O62 D;  4WV4 B;  3LEL C;  2NQB A;  3X1S D;  3W97 B;  5B40 D;  3O62 C;  4J8V D;  5B24 B;  1ZLA B;  1KX3 C;  3MVD C;  3KUY D;  5JA4 A;  1P3K C;  4J8U C;  3WKJ A;  5AY8 A;  3C1B B;  3B6F C;  1M19 D;  2HIO A;  5DNM D;  3KUY C;  4H9S A;  1F66 A;  5JRG C;  3TU4 A;  3AZM B;  5DNM C;  1TZY D;  3B0B A;  3AZN D;  3AZF B;  3W99 A;  2BYM B;  3VH5 T;  2NQB B;  5CPJ D;  3W96 B;  1P3F D;  3LJA A;  5F99 A;  4E45 A;  3AZE B;  5CPK A;  4YS3 C;  1P3G A;  1AOI A;  5GT0 C;  3REL C;  3AFA A;  1ID3 A;  1P3P D;  1BH9 B;  4H9Q B;  5GXQ D;  4DRB A;  3REJ D;  1P34 B;  1P3M C;  1M18 D;  1ID3 C;  4QLC D;  4CAY A;  4E44 A;  3AZH A;  4YS3 A;  3UTA D;  5GSU A;  3W97 D;  4WU9 A;  3X1T B;  1TAF B;  2F8N H;  3REH A;  3UTA C;  4H9R B;  3KUY B;  4HGA C;  5B33 D;  3LZ1 B;  3UTB D;  4J8W C;  5DNM B;  5B1M D;  1S32 C;  4G92 B;  5GT3 D;  4ZUX B;  4Z2M H;  3REH B;  1M19 A;  3W96 D;  4EO5 C;  3R45 B;  5B1L A;  4R8P A;  1P34 C;  5B31 B;  1M1A A;  3WAA D;  3WTP A;  4R8P C;  2PYO C;  3AV1 D;  5B1L C;  4KGC A;  5CPK B;  1P3G B;  3X1T D;  3B6G A;  3LEL D;  1KX5 A;  2ARO A;  3X1S C;  4LD9 D;  3LZ0 D;  1KX4 D;  4Z5T D;  3AN2 B;  4H9O A;  4XUJ D;  3KXB A;  5AV6 D;  5B32 B;  4J8U D;  3W98 D;  5GXQ A;  4ZUX C;  1P3A B;  5AV6 C;  5CP6 C;  5AY8 D;  3UTA A;  5JRG D;  4WU9 D;  3REH D;  1U35 D;  4ZUX A;  3KSY A;  5B31 D;  3AFA C;  1BH8 A;  3WA9 D;  3WAA B;  5CPK C;  1P3G C;  5AVB B;  3A6N D;  3B6G C;  3AZL D;  5AVC C;  1P3I C;  3WTP B;  3AZN B;  3LEL B;  5AV5 D;  3AZF D;  1M18 A;  3KXB C;  5B24 C;  1ZLA C;  1P3A C;  4KHA B;  1P3F B;  2FJ7 C;  3MGS A;  3AV2 C;  3MVD B;  3REI D;  3X1V C;  2HIO C;  2YFW A;  3AZE D;  5AVB A;  3MNN C;  3MGQ A;  4J8X B;  3X1V A;  5JRG B;  3MGR A;  1P3O A;  5BO0 A;  5BS7 A;  4QLC B;  1KX4 A;  1A7W A;  1JFI B;  1F66 B;  3W96 C;  1P3K D;  1P3L B;  2NZD B;  4NE3 A;  1KU5 A;  4YM6 A;  5E5A C;  1P3P C;  3WTP D;  1ID3 B;  5B0Z B;  2F8N A;  3AV2 B;  3A6N A;  3X1T C;  3W97 C;  5B33 A;  4X23 C;  3LZ1 C;  5DNN C;  4J8W B;  5B33 C;  3AZL A;  5CHL B;  3AZF A;  3W99 B;  5GXQ C;  4Z66 C;  3MGP A;  1H3O A;  1WWS A;  4KUD A;  5B2I C;  1P3O B;  5DNN A;  3B0C T;  5CP6 A;  5F99 C;  3LZ0 B;  3NQU B;  1KX4 B;  1JFI A;  4Z5T B;  3O62 A;  5B32 G;  3MGP B;  5B0Z C;  3C1C C;  3VH6 A;  5AV8 D;  1EQZ C;  5B0Y B;  3KUY A;  1KX5 C;  2NQB D;  5CPJ B;  1WWI A;  5B40 A;  4YM6 D;  4J8V A;  4XUJ A;  3KXB D;  3TU4 D;  3MGS C;  3AV2 A;  3C1C A;  3W99 D;  2HIO D;  1M1A C;  3WA9 B;  3MGS D;  2RVQ D;  1P3B C;  3REK D;  1P3O C;  3MGQ D;  2F8N G;  1R4V A;  3AZI D;  1M19 C;  3REK C;  1P3O D;  1AOI D;  1HQ3 D;  4Z5T C;  1H3O B;  4EO5 B;  1TZY C;  4NFT A;  3KWQ B;  3B0C W;  3REJ A;  3UTB B;  4KUD D;  3MGP D;  5B31 C;  3AFA D;  4J8W A;  4WU8 C;  2F8N K;  2PYO B;  5CPJ C;  5E5A D;  4DRA A;  3B0D C;  5AVC D;  3AZJ C;  3AZK A;  1P3I D;  3VH5 A;  3AZN C;  3W97 A;  5GSU D;  4WU8 A;  3AZH C;  4H9O B;  3KXB B;  3WA9 C;  3LJA D;  1P3M D;  5B2J C;  4G91 C;  4NE6 A;  4Z66 A;  3AZL C;  3X1V D;  3MNN B;  3AV1 B;  1M19 B;  3AZK B;  3MVD A;  3AZG B;  4KGC C;  5B0Y A;  3W96 A;  1BH8 B;  5B1M C;  3UTB C;  3AV2 D;  4LD9 B;  5BO0 B;  1N1J B;  3V9R A;  3W98 B;  3REK A;  4XZQ B;  5AVB C;  5E5A B;  5AY8 B;  3C1B A;  3AZI A;  4WU9 B;  4CAY B;  3AZH B;  4YS3 B;  2HUE B;  3WTP C;  3AN2 A;  5C3I C;  2JSS A;  5CPI A;  1P3M B;  1HTA A;  1P3F C;  2FJ7 B;  5B1L D;  5B33 B;  3X1V B;  3LZ1 D;  3A6N B;  4Z66 B;  1F1E A;  3AZK D;  5B1M B;  1BH9 A;  3AZG D;  4JJN C;  4AWL C; 
#chains in the Genus database with same CATH topology
 3WA9 A;  1M18 C;  4ZUX D;  4QLC C;  2F2A C;  1AOI C;  4YM6 B;  3MVD D;  3REI B;  3LZ0 C;  3EPJ A;  3REH C;  1ULY A;  5JA4 B;  4WU9 C;  2G5H C;  4XZQ D;  2HUE C;  3AYW B;  5AV8 A;  3WKJ D;  3VH5 W;  5B2I D;  3O62 B;  5AV8 C;  1KX5 B;  5G49 B;  5E5A A;  3AZI B;  2Y2I A;  1P3K B;  2LY8 A;  5AV9 D;  5CPJ A;  4X23 A;  2NZD D;  3C1B D;  5B31 A;  1M1A B;  4KUD B;  3W99 C;  4H9Q A;  3MGR D;  3AN2 C;  1P34 A;  3AZM D;  1P3A D;  2PYO D;  4YM6 C;  3MGR C;  5CP6 B;  3AZE C;  5GSU B;  5AV5 C;  1P3K A;  1T3U A;  2YFV B;  3H0L C;  3AYW C;  2BYM A;  3LJA B;  2FJ7 A;  1KX4 C;  1P3B D;  1S32 A;  5B0Z A;  5B32 A;  3UTB A;  3MNN D;  3KWQ A;  3REJ B;  3AYW A;  1KX3 D;  3B0D B;  2CV5 A;  3UTA B;  5GT3 A;  4ZBJ B;  2IO5 C;  1EQZ A;  4KUD C;  5B2J B;  3X1U D;  1S32 B;  2L5A A;  4R8P D;  3X1U C;  3MGR B;  5BNV A;  5AV9 A;  3AZK C;  3LZ1 A;  5B0Y D;  4X23 D;  3AZH D;  4YS3 D;  2JE5 A;  1P3L A;  5B2J A;  3TU4 B;  3AZM A;  1B6W A;  3WTP E;  2ARO D;  5B24 D;  1ZLA D;  1TZY A;  5B1L B;  1F66 C;  3R45 A;  2ARO C;  5AY8 C;  3B6F A;  2VQR A;  4ZBJ C;  5F99 D;  3W98 A;  3MGQ B;  1B67 A;  4J8X A;  1N1J A;  3V9R B;  3KFU G;  3AZJ B;  1P3B A;  4QLC A;  1HQ3 B;  5B0Z D;  1U35 A;  4UUZ B;  1P3P A;  3X1U B;  1S32 D;  5AV6 B;  4H9S C;  5B32 D;  2CV5 D;  4J8U B;  4G91 B;  3C1B C;  3B6F B;  1TAF A;  2CV5 C;  3UT9 A;  3AV1 C;  3VH6 T;  3WKJ B;  3AZG C;  4Z2M G;  5GXQ B;  5KDM A;  1P34 D;  4JJN D;  1P3A A;  1M18 B;  1EQZ D;  2F8N B;  3LEL A;  1KX5 D;  2NQB C;  5B1M A;  2ARO B;  4XUJ C;  5AVC A;  1P3I A;  2Y2L A;  3MGQ C;  4J8V C;  5B40 C;  3UT9 B;  1M1A D;  4XZQ C;  3WAA A;  4CSR B;  5F99 B;  5B2I A;  1P3M A;  5B24 A;  1ZLA A;  5AV8 B;  1U35 C;  3MGP C;  5KDM B;  4WU8 D;  3NQJ B;  5CP6 D;  1HQ3 A;  3IP4 C;  3EPL A;  3AZJ A;  3H0R C;  4J8X C;  2CV5 B;  4HGA B;  3LZ0 A;  3B6F D;  5FUG B;  5BNX A;  5AV6 A;  4J8X D;  3A6N C;  3X1T A;  3X1U A;  3B6G D;  3MGS B;  4NE5 A;  4G92 C;  4LD9 A;  3EPH A;  4WZS B;  5DNM A;  5GT0 D;  3REL D;  3AZM C;  4JJN B;  5JRG A;  4AWL B;  3AZF C;  1P3L C;  3AZN A;  5B40 B;  4J8V B;  1AOI B;  2BYK B;  4WNN B;  2NZD C;  2FJ7 D;  1P3L D;  3REI C;  2CWE A;  3LJA C;  2UWX A;  4KHA A;  1P3F A;  5B2J D;  3UT9 D;  3AN2 D;  4H9P A;  4Z66 D;  1BFM A;  4R8P B;  5BS7 C;  4JJN A;  3REJ C;  1ID3 D;  3X1S A;  4X23 B;  4WU8 B;  3AZI C;  4H9R A;  5GT3 C;  2IO5 B;  5AV5 A;  5DNN B;  5CPI D;  3NQJ A;  5CPI C;  4J8W D;  5B32 C;  4H9P B;  1Q9C A;  5AVB D;  3AZG A;  4CSR A;  5B2I B;  5BT1 C;  3AZL B;  4H9N A;  3REI A;  2YFV A;  3AZE A;  5BT1 D;  3P5J B;  3AZJ D;  5AV5 B;  5GSU C;  5BNV B;  5AV9 B;  3VH6 W;  3C1C B;  4LD9 C;  2RVQ C;  5FUG A;  5BNX B;  5GT0 A;  5B0Y C;  3REL A;  2ZY3 A;  5GT3 B;  3W98 C;  4H9N B;  2NZD A;  4KGC D;  1HQ3 C;  5DNN D;  5CPI B;  2F8N D;  3X1S B;  1F66 D;  5C3I B;  1P3B B;  4UUZ A;  2HIO B;  3NQU A;  4KGC B;  4Z5T A;  4XZQ A;  1KX3 B;  3REK B;  4J8U A;  3WKJ C;  5CPK D;  1P3G D;  5B31 G;  5AV9 C;  1W2E A;  2YFW B;  2Y2K A;  1EQZ B;  1TZY B;  3KWQ C;  3KWQ D;  3TU4 C;  4M6B A;  4XUJ B;  3C1C D;  3WAA C;  3AFA B;  3UT9 C;  3AV1 A;  2BYK A;  3A1I A;  4WNN A;  3MNN A;  3B6G B;  3AYW D;  1KX3 A;  2Y2M A;  5G49 A;  1P3P B;  5AVC B;  1P3I B;  2PYO A;  3EG5 B;  1U35 B;  5GT0 B;  3REL B;  3O62 D;  4WV4 B;  3LEL C;  2NQB A;  3X1S D;  3W97 B;  5B40 D;  3O62 C;  4J8V D;  5B24 B;  1ZLA B;  1KX3 C;  3MVD C;  2ZY4 A;  5JA4 A;  3KUY D;  1P3K C;  4J8U C;  3WKJ A;  5AY8 A;  3C1B B;  3B6F C;  1M19 D;  2HIO A;  5DNM D;  3KUY C;  4H9S A;  1F66 A;  5JRG C;  3TU4 A;  3AZM B;  5DNM C;  1TZY D;  3B0B A;  3AZN D;  3AZF B;  3W99 A;  2BYM B;  3VH5 T;  2NQB B;  4DQY B;  5CPJ D;  2DF4 C;  3W96 B;  1P3F D;  3LJA A;  5F99 A;  4E45 A;  3AZE B;  5CPK A;  4YS3 C;  1P3G A;  1AOI A;  5GT0 C;  3REL C;  3AFA A;  1ID3 A;  1P3P D;  1BH9 B;  4H9Q B;  5GXQ D;  4DRB A;  3EPK A;  3REJ D;  1P34 B;  1P3M C;  1M18 D;  4QLC D;  4CAY A;  4E44 A;  3AZH A;  1ID3 C;  4YS3 A;  3UTA D;  5GSU A;  3W97 D;  4WU9 A;  3X1T B;  1TAF B;  2F8N H;  3REH A;  3UTA C;  4H9R B;  3KUY B;  3F6T A;  4HGA C;  5B33 D;  3LZ1 B;  3UTB D;  1Z2C B;  4J8W C;  2ZY2 A;  5DNM B;  5B1M D;  2JCH A;  1S32 C;  4G92 B;  5GT3 D;  4ZUX B;  4Z2M H;  3REH B;  1M19 A;  3W96 D;  4EO5 C;  3R45 B;  5B1L A;  4R8P A;  2Y2H A;  1P34 C;  5B31 B;  1M1A A;  3WAA D;  3WTP A;  4R8P C;  2PYO C;  3AV1 D;  5B1L C;  4KGC A;  5CPK B;  1P3G B;  3X1T D;  3B6G A;  3AL0 C;  3LEL D;  1KX5 A;  2ARO A;  2Y2Q A;  3X1S C;  4LD9 D;  3LZ0 D;  1KX4 D;  4Z5T D;  3AN2 B;  2Y2N A;  4H9O A;  4XUJ D;  5AV6 D;  3KXB A;  5B32 B;  4J8U D;  3W98 D;  5GXQ A;  4ZUX C;  1P3A B;  5AV6 C;  2Y2G A;  5CP6 C;  2ZM5 A;  5AY8 D;  3UTA A;  5JRG D;  4WU9 D;  3REH D;  1U35 D;  4ZUX A;  3KSY A;  5B31 D;  3AFA C;  1BH8 A;  3WA9 D;  3WAA B;  2W8S A;  5CPK C;  1P3G C;  5AVB B;  3A6N D;  3B6G C;  3AZL D;  5AVC C;  1P3I C;  3WTP B;  3AZN B;  3LEL B;  5AV5 D;  3AZF D;  1M18 A;  3KXB C;  5B24 C;  1ZLA C;  1P3A C;  4KHA B;  1P3F B;  2Y2P A;  2FJ7 C;  3MGS A;  3AV2 C;  3MVD B;  3REI D;  3X1V C;  2HIO C;  2YFW A;  3AZE D;  5AVB A;  3MNN C;  3MGQ A;  4J8X B;  4UPK A;  3X1V A;  5JRG B;  3MGR A;  1P3O A;  5BO0 A;  5BS7 A;  4QLC B;  1KX4 A;  1A7W A;  1JFI B;  1F66 B;  3W96 C;  1P3K D;  4WJ3 C;  1P3L B;  2NZD B;  4NE3 A;  1KU5 A;  2XD1 A;  4YM6 A;  5E5A C;  1P3P C;  3WTP D;  2DQN C;  1ID3 B;  5B0Z B;  2F8N A;  3AV2 B;  3A6N A;  3X1T C;  3W97 C;  5B33 A;  4X23 C;  3LZ1 C;  2XD5 A;  5DNN C;  4J8W B;  5B33 C;  3AZL A;  5CHL B;  3AZF A;  3W99 B;  5GXQ C;  4Z66 C;  3MGP A;  2Y2O A;  1H3O A;  1PZR A;  1WWS A;  4KUD A;  5B2I C;  2J8P A;  1P3O B;  5DNN A;  3B0C T;  5CP6 A;  5F99 C;  3LZ0 B;  3NQU B;  1KX4 B;  1JFI A;  4Z5T B;  3A1K A;  5B32 G;  3O62 A;  3MGP B;  5B0Z C;  3C1C C;  3VH6 A;  5AV8 D;  1EQZ C;  5B0Y B;  3KUY A;  1KX5 C;  2NQB D;  5CPJ B;  1WWI A;  5B40 A;  4YM6 D;  4J8V A;  4XUJ A;  3KXB D;  3TU4 D;  3MGS C;  3AV2 A;  3C1C A;  3W99 D;  2HIO D;  1M1A C;  3WA9 B;  3MGS D;  2RVQ D;  1P3B C;  3REK D;  1P3O C;  2FFF B;  3MGQ D;  2F8N G;  1R4V A;  3AZI D;  1M19 C;  3REK C;  1P3O D;  1AOI D;  2G5I C;  1HQ3 D;  4Z5T C;  1H3O B;  4EO5 B;  2BG1 A;  1TZY C;  4NFT A;  3KWQ B;  3B0C W;  3REJ A;  3UTB B;  4KUD D;  3H0M C;  3MGP D;  5B31 C;  3AFA D;  4J8W A;  4WU8 C;  2F8N K;  2PYO B;  5CPJ C;  5E5A D;  4DRA A;  3B0D C;  5AVC D;  3AZJ C;  3AZK A;  1P3I D;  3VH5 A;  3AZN C;  3W97 A;  5GSU D;  4WU8 A;  3AZH C;  4H9O B;  3KXB B;  3WA9 C;  3LJA D;  1P3M D;  2RIQ A;  5B2J C;  4G91 C;  4NE6 A;  4Z66 A;  3AZL C;  3X1V D;  3MNN B;  3AV1 B;  1M19 B;  3FDD A;  3AZK B;  3MVD A;  3AZG B;  4KGC C;  2Y2J A;  5B0Y A;  3W96 A;  1BH8 B;  5B1M C;  3UTB C;  3AV2 D;  4LD9 B;  5BO0 B;  1N1J B;  3V9R A;  3W98 B;  3REK A;  4XZQ B;  5AVB C;  5E5A B;  5AY8 B;  3C1B A;  3AZI A;  4WU9 B;  4CAY B;  3AZH B;  4YS3 B;  2HUE B;  3WTP C;  3AN2 A;  5C3I C;  2JSS A;  5CPI A;  1P3M B;  1HTA A;  1P3F C;  2FJ7 B;  5B1L D;  5B33 B;  3X1V B;  3LZ1 D;  3A6N B;  4Z66 B;  1F1E A;  3AZK D;  5B1M B;  1BH9 A;  3AZG D;  2ZY5 A;  4JJN C;  4AWL C; 
#chains in the Genus database with same CATH homology
 3WA9 A;  1M18 C;  4ZUX D;  4QLC C;  2F2A C;  1AOI C;  4YM6 B;  3MVD D;  3REI B;  3LZ0 C;  3EPJ A;  3REH C;  1ULY A;  5JA4 B;  4WU9 C;  2G5H C;  4XZQ D;  2HUE C;  3AYW B;  5AV8 A;  3WKJ D;  3VH5 W;  5B2I D;  3O62 B;  5AV8 C;  1KX5 B;  5G49 B;  5E5A A;  3AZI B;  2Y2I A;  1P3K B;  2LY8 A;  5AV9 D;  5CPJ A;  4X23 A;  2NZD D;  3C1B D;  5B31 A;  1M1A B;  4KUD B;  3W99 C;  4H9Q A;  3MGR D;  3AN2 C;  1P34 A;  3AZM D;  1P3A D;  2PYO D;  4YM6 C;  3MGR C;  5CP6 B;  3AZE C;  5GSU B;  5AV5 C;  1P3K A;  1T3U A;  2YFV B;  3H0L C;  3AYW C;  2BYM A;  3LJA B;  2FJ7 A;  1KX4 C;  1P3B D;  1S32 A;  5B0Z A;  5B32 A;  3UTB A;  3MNN D;  3KWQ A;  3REJ B;  3AYW A;  1KX3 D;  3B0D B;  2CV5 A;  3UTA B;  5GT3 A;  4ZBJ B;  2IO5 C;  1EQZ A;  4KUD C;  5B2J B;  3X1U D;  1S32 B;  2L5A A;  4R8P D;  3X1U C;  3MGR B;  5BNV A;  5AV9 A;  3AZK C;  3LZ1 A;  5B0Y D;  4X23 D;  3AZH D;  4YS3 D;  2JE5 A;  1P3L A;  5B2J A;  3TU4 B;  3AZM A;  1B6W A;  3WTP E;  2ARO D;  5B24 D;  1ZLA D;  1TZY A;  5B1L B;  1F66 C;  3R45 A;  2ARO C;  5AY8 C;  3B6F A;  2VQR A;  4ZBJ C;  5F99 D;  3W98 A;  3MGQ B;  1B67 A;  4J8X A;  1N1J A;  3V9R B;  3KFU G;  3AZJ B;  1P3B A;  4QLC A;  1HQ3 B;  5B0Z D;  1U35 A;  4UUZ B;  1P3P A;  3X1U B;  1S32 D;  5AV6 B;  4H9S C;  5B32 D;  2CV5 D;  4J8U B;  4G91 B;  3C1B C;  3B6F B;  1TAF A;  2CV5 C;  3UT9 A;  3AV1 C;  3VH6 T;  3WKJ B;  3AZG C;  4Z2M G;  5GXQ B;  5KDM A;  1P34 D;  4JJN D;  1P3A A;  1M18 B;  1EQZ D;  2F8N B;  3LEL A;  1KX5 D;  2NQB C;  5B1M A;  2ARO B;  4XUJ C;  5AVC A;  1P3I A;  2Y2L A;  3MGQ C;  4J8V C;  5B40 C;  3UT9 B;  1M1A D;  4XZQ C;  3WAA A;  4CSR B;  5F99 B;  5B2I A;  1P3M A;  5B24 A;  1ZLA A;  5AV8 B;  1U35 C;  3MGP C;  5KDM B;  4WU8 D;  3NQJ B;  5CP6 D;  1HQ3 A;  3IP4 C;  3EPL A;  3AZJ A;  3H0R C;  4J8X C;  2CV5 B;  4HGA B;  3LZ0 A;  3B6F D;  5FUG B;  5BNX A;  5AV6 A;  4J8X D;  3A6N C;  3X1T A;  3X1U A;  3B6G D;  3MGS B;  4NE5 A;  4G92 C;  4LD9 A;  3EPH A;  4WZS B;  5DNM A;  5GT0 D;  3REL D;  3AZM C;  4JJN B;  5JRG A;  4AWL B;  3AZF C;  1P3L C;  3AZN A;  5B40 B;  4J8V B;  1AOI B;  2BYK B;  4WNN B;  2NZD C;  2FJ7 D;  1P3L D;  3REI C;  2CWE A;  3LJA C;  2UWX A;  4KHA A;  1P3F A;  5B2J D;  3UT9 D;  3AN2 D;  4H9P A;  4Z66 D;  1BFM A;  4R8P B;  5BS7 C;  4JJN A;  3REJ C;  1ID3 D;  3X1S A;  4X23 B;  4WU8 B;  3AZI C;  4H9R A;  5GT3 C;  2IO5 B;  5AV5 A;  5DNN B;  5CPI D;  3NQJ A;  5CPI C;  4J8W D;  5B32 C;  4H9P B;  1Q9C A;  5AVB D;  3AZG A;  4CSR A;  5B2I B;  5BT1 C;  3AZL B;  4H9N A;  3REI A;  2YFV A;  3AZE A;  5BT1 D;  3P5J B;  3AZJ D;  5AV5 B;  5GSU C;  5BNV B;  5AV9 B;  3VH6 W;  3C1C B;  4LD9 C;  2RVQ C;  5FUG A;  5BNX B;  5GT0 A;  5B0Y C;  3REL A;  2ZY3 A;  5GT3 B;  3W98 C;  4H9N B;  2NZD A;  4KGC D;  1HQ3 C;  5DNN D;  5CPI B;  2F8N D;  3X1S B;  1F66 D;  5C3I B;  1P3B B;  4UUZ A;  2HIO B;  3NQU A;  4KGC B;  4Z5T A;  4XZQ A;  1KX3 B;  3REK B;  4J8U A;  3WKJ C;  5CPK D;  1P3G D;  5B31 G;  5AV9 C;  1W2E A;  2YFW B;  2Y2K A;  1EQZ B;  1TZY B;  3KWQ C;  3KWQ D;  3TU4 C;  4M6B A;  4XUJ B;  3C1C D;  3WAA C;  3AFA B;  3UT9 C;  3AV1 A;  2BYK A;  3A1I A;  4WNN A;  3MNN A;  3B6G B;  3AYW D;  1KX3 A;  2Y2M A;  5G49 A;  1P3P B;  5AVC B;  1P3I B;  2PYO A;  3EG5 B;  1U35 B;  5GT0 B;  3REL B;  3O62 D;  4WV4 B;  3LEL C;  2NQB A;  3X1S D;  3W97 B;  5B40 D;  3O62 C;  4J8V D;  5B24 B;  1ZLA B;  1KX3 C;  3MVD C;  2ZY4 A;  5JA4 A;  3KUY D;  1P3K C;  4J8U C;  3WKJ A;  5AY8 A;  3C1B B;  3B6F C;  1M19 D;  2HIO A;  5DNM D;  3KUY C;  4H9S A;  1F66 A;  5JRG C;  3TU4 A;  3AZM B;  5DNM C;  1TZY D;  3B0B A;  3AZN D;  3AZF B;  3W99 A;  2BYM B;  3VH5 T;  2NQB B;  4DQY B;  5CPJ D;  2DF4 C;  3W96 B;  1P3F D;  3LJA A;  5F99 A;  4E45 A;  3AZE B;  5CPK A;  4YS3 C;  1P3G A;  1AOI A;  5GT0 C;  3REL C;  3AFA A;  1ID3 A;  1P3P D;  1BH9 B;  4H9Q B;  5GXQ D;  4DRB A;  3EPK A;  3REJ D;  1P34 B;  1P3M C;  1M18 D;  4QLC D;  4CAY A;  4E44 A;  3AZH A;  1ID3 C;  4YS3 A;  3UTA D;  5GSU A;  3W97 D;  4WU9 A;  3X1T B;  1TAF B;  2F8N H;  3REH A;  3UTA C;  4H9R B;  3KUY B;  3F6T A;  4HGA C;  5B33 D;  3LZ1 B;  3UTB D;  1Z2C B;  4J8W C;  2ZY2 A;  5DNM B;  5B1M D;  2JCH A;  1S32 C;  4G92 B;  5GT3 D;  4ZUX B;  4Z2M H;  3REH B;  1M19 A;  3W96 D;  4EO5 C;  3R45 B;  5B1L A;  4R8P A;  2Y2H A;  1P34 C;  5B31 B;  1M1A A;  3WAA D;  3WTP A;  4R8P C;  2PYO C;  3AV1 D;  5B1L C;  4KGC A;  5CPK B;  1P3G B;  3X1T D;  3B6G A;  3AL0 C;  3LEL D;  1KX5 A;  2ARO A;  2Y2Q A;  3X1S C;  4LD9 D;  3LZ0 D;  1KX4 D;  4Z5T D;  3AN2 B;  2Y2N A;  4H9O A;  4XUJ D;  5AV6 D;  3KXB A;  5B32 B;  4J8U D;  3W98 D;  5GXQ A;  4ZUX C;  1P3A B;  5AV6 C;  2Y2G A;  5CP6 C;  2ZM5 A;  5AY8 D;  3UTA A;  5JRG D;  4WU9 D;  3REH D;  1U35 D;  4ZUX A;  3KSY A;  5B31 D;  3AFA C;  1BH8 A;  3WA9 D;  3WAA B;  2W8S A;  5CPK C;  1P3G C;  5AVB B;  3A6N D;  3B6G C;  3AZL D;  5AVC C;  1P3I C;  3WTP B;  3AZN B;  3LEL B;  5AV5 D;  3AZF D;  1M18 A;  3KXB C;  5B24 C;  1ZLA C;  1P3A C;  4KHA B;  1P3F B;  2Y2P A;  2FJ7 C;  3MGS A;  3AV2 C;  3MVD B;  3REI D;  3X1V C;  2HIO C;  2YFW A;  3AZE D;  5AVB A;  3MNN C;  3MGQ A;  4J8X B;  4UPK A;  3X1V A;  5JRG B;  3MGR A;  1P3O A;  5BO0 A;  5BS7 A;  4QLC B;  1KX4 A;  1A7W A;  1JFI B;  1F66 B;  3W96 C;  1P3K D;  4WJ3 C;  1P3L B;  2NZD B;  4NE3 A;  1KU5 A;  2XD1 A;  4YM6 A;  5E5A C;  1P3P C;  3WTP D;  2DQN C;  1ID3 B;  5B0Z B;  2F8N A;  3AV2 B;  3A6N A;  3X1T C;  3W97 C;  5B33 A;  4X23 C;  3LZ1 C;  2XD5 A;  5DNN C;  4J8W B;  5B33 C;  3AZL A;  5CHL B;  3AZF A;  3W99 B;  5GXQ C;  4Z66 C;  3MGP A;  2Y2O A;  1H3O A;  1PZR A;  1WWS A;  4KUD A;  5B2I C;  2J8P A;  1P3O B;  5DNN A;  3B0C T;  5CP6 A;  5F99 C;  3LZ0 B;  3NQU B;  1KX4 B;  1JFI A;  4Z5T B;  3A1K A;  5B32 G;  3O62 A;  3MGP B;  5B0Z C;  3C1C C;  3VH6 A;  5AV8 D;  1EQZ C;  5B0Y B;  3KUY A;  1KX5 C;  2NQB D;  5CPJ B;  1WWI A;  5B40 A;  4YM6 D;  4J8V A;  4XUJ A;  3KXB D;  3TU4 D;  3MGS C;  3AV2 A;  3C1C A;  3W99 D;  2HIO D;  1M1A C;  3WA9 B;  3MGS D;  2RVQ D;  1P3B C;  3REK D;  1P3O C;  2FFF B;  3MGQ D;  2F8N G;  1R4V A;  3AZI D;  1M19 C;  3REK C;  1P3O D;  1AOI D;  2G5I C;  1HQ3 D;  4Z5T C;  1H3O B;  4EO5 B;  2BG1 A;  1TZY C;  4NFT A;  3KWQ B;  3B0C W;  3REJ A;  3UTB B;  4KUD D;  3H0M C;  3MGP D;  5B31 C;  3AFA D;  4J8W A;  4WU8 C;  2F8N K;  2PYO B;  5CPJ C;  5E5A D;  4DRA A;  3B0D C;  5AVC D;  3AZJ C;  3AZK A;  1P3I D;  3VH5 A;  3AZN C;  3W97 A;  5GSU D;  4WU8 A;  3AZH C;  4H9O B;  3KXB B;  3WA9 C;  3LJA D;  1P3M D;  2RIQ A;  5B2J C;  4G91 C;  4NE6 A;  4Z66 A;  3AZL C;  3X1V D;  3MNN B;  3AV1 B;  1M19 B;  3FDD A;  3AZK B;  3MVD A;  3AZG B;  4KGC C;  2Y2J A;  5B0Y A;  3W96 A;  1BH8 B;  5B1M C;  3UTB C;  3AV2 D;  4LD9 B;  5BO0 B;  1N1J B;  3V9R A;  3W98 B;  3REK A;  4XZQ B;  5AVB C;  5E5A B;  5AY8 B;  3C1B A;  3AZI A;  4WU9 B;  4CAY B;  3AZH B;  4YS3 B;  2HUE B;  3WTP C;  3AN2 A;  5C3I C;  2JSS A;  5CPI A;  1P3M B;  1HTA A;  1P3F C;  2FJ7 B;  5B1L D;  5B33 B;  3X1V B;  3LZ1 D;  3A6N B;  4Z66 B;  1F1E A;  3AZK D;  5B1M B;  1BH9 A;  3AZG D;  2ZY5 A;  4JJN C;  4AWL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...