4ZUXA

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 97
sequence length 97
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxA00
4M6BA 3UTAD 3LZ1C 3AZHD 1P3FC 3KWQC 3AZGB 3AV2C 1ID3D 1F66A 4Z5TC 1KX5A 1M19A 1TZYB 5AVBC 3NQJA 1HQ3D 3AZFC 4NE5A 2HIOB 3REHB 3B0BA 5B1LB 5B24B 5CPKB 4J8UC 3UT9B 3W96B 2BYKB 3MGSB 5B1MA 4WZSB 5B0YC 1EQZD 1P3GA 5GSUA 3C1CA 3MGQC 5GXQD 4XUJA 1P3KC 5DNNA 3UT9D 3MGPB 3A6NA 5F99D 3X1TA 4EO5C 5AV8B 4XZQD 4H9PB 4HGAB 5BS7C 2FJ7D 3W97A 3REKD 1BFMA 5B33B 3WAAB 1P3LB 5B2JA 5AVCC 1BH8B 4R8PB 5E5AB 4Z66C 1P3MB 2NZDA 1Q9CA 3MGPD 4WU9B 5AV9D 4QLCD 5B31G 3REID 2IO5C 3B0DB 5B31C 5AV5C 1F66B 3MNNA 3MVDD 3VH6W 1KX5B 3C1BD 1P3OD 3TU4D 5FUGA 1M19B 5BNVA 3AZED 3NQJB 4KGCA 5GT0C 2BYMA 3KUYA 2F8NA 3O62A 3AFAB 3WA9C 1ULYA 4WU8D 5AV6C 5B32A 1P3BA 5BT1C 1P34D 3W98D 4NE6A 3LZ0C 1WWIA 3MGRC 3C1CB 1U35C 3AYWD 5DNNB 3AZJA 5DNMD 5AY8C 3AZMC 4E45A 4J8VC 3X1TB 2CV5B 1M18D 5B1MD 2RVQC 3AZHA 1P3GD 3W97B 5GSUD 4ZUXA 5CP6C 4AWLC 1BH9A 5B2JB 4YS3D 4X23D 4XUJD 1ID3A 4E44A 3VH5A 4Z2MH 5B2ID 3RELC 5C3IB 3AZND 2NZDB 2AROB 3VH5T 3A6ND 1P3PA 1HQ3A 5JA4A 3AZKA 5FUGB 1P3AA 5BNVB 1S32D 2F8NG 4J8WD 3AZID 2BYMB 3KUYB 2F8NB 3O62B 3LJAD 5CPJC 1EQZA 5B32G 3MNND 5B32B 4LD9D 3B6GD 1P3BB 3WKJC 3VH6T 4J8XB 3UTBD 3X1VD 5B0ZC 1KX4B 4KUDD 2F8NH 3AV1C 1ZLAC 5F99A 4XZQA 4KGCD 2NQBC 1AOID 2FJ7A 3WTPC 3REKA 4YM6D 1KX3C 3AZJB 3V9RA 3AN2C 4JJNB 3LELC 3UTAB 3AZHB 4ZBJB 4QLCA 5AV9A 3KXBD 3REIA 1ID3B 1JFIA 3AZFA 3MVDA 3REJC 3C1BA 3X1UC 4H9RA 1P3OA 3X1SC 3AZEA 1HQ3B 5CPID 4WNNA 5JA4B 4ZUXD 3AZGC 4WU8A 3W99D 1P3KA 1P34A 3W98A 1EQZB 1TZYC 1P3PD 4DRBA 5GXQB 2HIOC 3REHC 5BS7A 5B1LC 5B24C 3AYWA 5CPKC 4H9SC 3UT9C 3W96C 3AZKD 5DNMA 3MGSC 1P3AD 5F99B 1M18A 4XZQB 2FJ7B 3REKB 5JRGD 3KSYA 4YS3A 4X23A 3V9RB 1P3ID 5B2IA 3AZNA 3B6FD 3MGPC 2PYOD 3VH5W 5AV9B 4QLCB 3AZLD 3WTPE 5AV8C 3REIB 4HGAC 5GT3D 5B40D 1JFIB 3MVDB 3LZ1D 5B33C 3WAAC 1P3FD 1P3LC 3KWQD 3C1BB 4R8PC 4H9RB 1P3OB 5E5AC 3TU4B 4Z5TD 1P3MC 3AZEB 1S32A 4J8WA 3AZIA 4WU9C 1WWSA 3LJAA 4WNNB 5AVBD 3B0DC 4WU8B 1F66C 3AZFD 4LD9A 3B6GA 1KX5C 4UUZA 3UTBA 4J8UD 3X1VA 1P34B 4KUDA 3W98B 2YFVA 1M19C 3AFAC 1AOIA 5B0YD 4YM6A 3AYWB 5CP6A 3MGQD 5DNMB 4G92B 1P3KD 1M18B 3RELA 5CHLB 2HUEB 5B1MB 1A7WA 1P3GB 3KXBA 3C1CC 5GSUB 4YS3B 4X23B 4XUJB 5KDMA 5B2IB 4Z2MG 5DNNC 3AZNB 5AVCD 3X1TC 2CV5C 3A6NB 4Z66D 5CPIA 3W97C 1M1AA 5B2JC 5B31D 3W99A 5AV5D 5C3IC 1S32B 2NZDC 4J8WB 3AZIB 2AROC 3LJAB 2F8NK 5GT0D 3MNNB 4LD9B 3B6GB 3WA9D 4UUZB 3UTBB 3X1VB 5AV6D 4KUDB 2YFVB 5BT1D 4KGCB 3KUYC 3O62C 1AOIB 4YM6B 1H3OA 5JRGA 3LZ0D 3MGRD 5B32C 1U35D 1P3BC 1P3IA 4J8XC 3B6FA 1KX4C 2PYOA 5AY8D 3AZMD 3KXBB 3AZLA 4J8VD 5GT3A 5B40A 2RVQD 3LZ1A 1P3FA 5CP6D 3KWQA 3AZJC 3AV2A 4JJNC 4NFTA 2YFWA 4Z5TA 3RELD 4G91B 3UTAC 3AZHC 4ZBJC 5CPIB 1M1AB 4ZUXB 5AVBA 4H9OA 1BH9B 1ID3C 3W99B 4J8UA 1P3PB 1HQ3C 5B0YA 5CPJD 1M1AD 4H9NA 3R45A 3MGQA 5BNXA 3AZKB 1P3AB 3WKJD 5B0ZD 1EQZC 3AV1D 1ZLAD 1H3OB 5JRGB 4H9PA 5GXQC 2NQBD 1P3IB 1KX3D 3B6FB 5AVCA 2PYOB 5F99C 3AN2D 3AZLB 2L5AA 4XZQC 4Z66A 3LELD 4NE3A 5GT3B 5B40B 2FJ7C 4WU9A 3REKC 3LZ1B 1P3FB 3KWQB 3AV2B 5B31A 1N1JA 5AV5A 3REJD 2YFWB 4Z5TB 3X1UD 5AV9C 4QLCC 3X1SD 3REIC 5AVBB 4H9OB 5GT0A 3AFAA 3MVDC 3AZFB 3C1BC 3AZGD 3WA9A 3AV2D 4J8UB 1P3OC 5AV6A 3TU4C 1R4VA 3AZEC 1TAFA 5B0YB 1TZYD 4WV4B 3LZ0A 3MGRA 4H9NB 3R45B 4WU8C 3MGQB 5BNXB 1U35A 2HIOD 3NQUA 3REHD 5B24D 5B1LD 5CPKD 1P3KB 1P34C 3W98C 3W96D 2JSSA 5AY8A 5G49A 3AZMA 3MGSD 4J8VA 2CV5A 4EO5B 4CSRA 4KHAA 3AYWC 5AVCB 5DNMC 4G92C 1M18C 4Z66B 2HUEC 5B1MC 1P3GC 2AROA 5GSUC 5AV8D 4DRAA 4YS3C 4X23C 2IO5B 4XUJC 5B31B 1N1JB 1HTAA 5AV5B 3B0CW 5B2IC 5B33D 3WAAD 3AZNC 1P3LD 4R8PD 3A6NC 5E5AD 1P3MD 5GT0B 4WU9D 5CPJA 3WA9B 1F66D 1F1EA 5AV6B 1KX5D 3WKJA 1S32C 4J8WC 4J8XA 3AZIC 5B0ZA 1KX4A 3LJAC 1TAFB 3AV1A 1M19D 1ZLAA 3LZ0B 3MGRB 3MNNC 1U35B 2NQBA 3AFAD 3B6GC 4LD9C 3NQUB 3WTPA 3X1VC 3UTBC 1KX3A 4H9QA 4KUDC 5AY8B 5G49B 3AZMB 4JJNA 3AN2A 3LELA 4J8VB 4KGCC 1AOIC 4CSRB 3UTAA 4KHAB 4YM6C 3C1CD 5CP6B 4AWLB 5BO0A 4CAYA 3REJA 3RELB 5DNND 3X1UA 3KXBC 3X1TD 3X1SA 2CV5D 5B40C 1B67A 2CWEA 5KDMB 3W97D 3AZGA 5B2JD 4G91C 2NZDD 5CPIC 2AROD 1M1AC 4ZUXC 1TZYA 3VH6A 5CPJB 3W99C 5GXQA 2HIOA 1B6WA 3REHA 5B1LA 5B24A 3B0CT 5CPKA 3WKJB 4H9SA 3UT9A 3W96A 5B0ZB 1P3PC 3AV1B 2BYKA 3MGSA 1ZLAB 3KUYD 2F8ND 2NQBB 3O62D 3WTPB 3AZKC 1KX3B 4H9QB 5B32D 1P3BD 1P3AC 3AN2B 3LELB 4J8XD 1KX4D 3MGPA 5JRGC 5AV8A 5BO0B 2LY8A 4CAYB 1P3IC 3WTPD 5B33A 3REJB 3WAAA 1P3LA 3B6FC 3AZJD 1BH8A 2PYOC 4R8PA 3X1UB 1KU5A 3TU4A 5E5AA 4JJND 3AZLC 3X1SB 1P3MA 5GT3C
chains in the Genus database with same CATH superfamily
4M6BA 3UTAD 3LZ1C 3AZHD 1P3FC 2Y2KA 3KWQC 3AZGB 3AV2C 1ID3D 1F66A 4Z5TC 1KX5A 2XD1A 3KFUG 1M19A 1TZYB 5AVBC 3NQJA 1HQ3D 3AZFC 4NE5A 2HIOB 3REHB 3B0BA 5B1LB 5B24B 5CPKB 4J8UC 3UT9B 3W96B 2BYKB 3MGSB 5B1MA 3P5JB 4WZSB 5B0YC 1EQZD 2Y2OA 1P3GA 5GSUA 3C1CA 3MGQC 5GXQD 4XUJA 1P3KC 2Y2IA 5DNNA 3UT9D 3MGPB 3A6NA 5F99D 3X1TA 4EO5C 5AV8B 4XZQD 4H9PB 4HGAB 5BS7C 2FJ7D 3W97A 3REKD 1BFMA 5B33B 3WAAB 1P3LB 5B2JA 5AVCC 1BH8B 4R8PB 5E5AB 4Z66C 1P3MB 2NZDA 1Q9CA 2Y2NA 3MGPD 4WU9B 2W8SA 5AV9D 4QLCD 5B31G 3REID 2IO5C 3B0DB 5B31C 5AV5C 1F66B 3MNNA 3MVDD 3VH6W 1KX5B 3C1BD 3H0MC 1P3OD 3TU4D 5FUGA 1M19B 5BNVA 3AZED 3NQJB 4KGCA 5GT0C 2BYMA 3KUYA 2F8NA 3O62A 3AFAB 3WA9C 1ULYA 4WU8D 5AV6C 5B32A 1P3BA 5BT1C 1P34D 1Z2CB 3W98D 4NE6A 3LZ0C 1WWIA 3MGRC 3C1CB 1U35C 3AYWD 5DNNB 3AZJA 5DNMD 5AY8C 3AZMC 4E45A 2BG1A 4J8VC 3X1TB 2CV5B 1M18D 2UWXA 5B1MD 2RVQC 3AZHA 1P3GD 3W97B 5GSUD 4ZUXA 1W2EA 5CP6C 4AWLC 1BH9A 2F2AC 5B2JB 4YS3D 4X23D 4XUJD 1ID3A 4E44A 3VH5A 4Z2MH 5B2ID 3RELC 5C3IB 3AZND 2NZDB 2AROB 3VH5T 3A6ND 1P3PA 1HQ3A 5JA4A 3AZKA 2J8PA 2ZY3A 5FUGB 1P3AA 5BNVB 1S32D 2F8NG 4J8WD 3AZID 2BYMB 3KUYB 2F8NB 3O62B 3LJAD 5CPJC 1EQZA 2Y2MA 5B32G 3MNND 5B32B 4LD9D 3B6GD 1P3BB 3WKJC 3VH6T 4J8XB 3UTBD 3X1VD 5B0ZC 1KX4B 4KUDD 2F8NH 3AV1C 1ZLAC 5F99A 4XZQA 4KGCD 1PZRA 2NQBC 1AOID 2FJ7A 3WTPC 3REKA 4YM6D 1KX3C 3AZJB 3V9RA 2Y2GA 3AN2C 4JJNB 3LELC 3F6TA 2Y2LA 3UTAB 3AZHB 4ZBJB 4QLCA 5AV9A 3KXBD 3REIA 4WJ3C 1ID3B 1JFIA 3AZFA 3MVDA 3REJC 2ZY4A 3C1BA 3X1UC 4H9RA 1P3OA 3X1SC 3AZEA 2VQRA 1HQ3B 5CPID 4WNNA 5JA4B 4ZUXD 3AZGC 4WU8A 3W99D 1P3KA 2ZY5A 1P34A 3W98A 1EQZB 1TZYC 1P3PD 4DRBA 5GXQB 2HIOC 3REHC 5BS7A 5B1LC 5B24C 3AYWA 5CPKC 4H9SC 3UT9C 3W96C 3AZKD 5DNMA 3MGSC 1P3AD 5F99B 1M18A 4UPKA 4XZQB 2FJ7B 3REKB 5JRGD 3KSYA 4YS3A 4X23A 3V9RB 1P3ID 5B2IA 2G5HC 3AZNA 3B6FD 3MGPC 2PYOD 3VH5W 5AV9B 4QLCB 3AZLD 3WTPE 5AV8C 3REIB 4HGAC 5GT3D 5B40D 1JFIB 2G5IC 3MVDB 3LZ1D 5B33C 3WAAC 1P3FD 1P3LC 2Y2HA 3KWQD 3C1BB 4R8PC 4H9RB 1P3OB 5E5AC 3TU4B 4Z5TD 1P3MC 3AZEB 1S32A 4J8WA 3AZIA 4WU9C 1WWSA 2Y2QA 3LJAA 4WNNB 5AVBD 3B0DC 4WU8B 1F66C 3AZFD 4LD9A 3B6GA 1KX5C 4UUZA 3UTBA 4J8UD 3X1VA 3AL0C 1P34B 4KUDA 3W98B 1T3UA 2YFVA 1M19C 3AFAC 1AOIA 5B0YD 4YM6A 3AYWB 5CP6A 3MGQD 3H0LC 5DNMB 4G92B 1P3KD 1M18B 3RELA 5CHLB 3H0RC 2HUEB 5B1MB 1A7WA 1P3GB 3KXBA 3C1CC 5GSUB 4YS3B 4X23B 4XUJB 5KDMA 5B2IB 4Z2MG 5DNNC 3AZNB 5AVCD 3X1TC 2CV5C 3A6NB 4Z66D 5CPIA 3W97C 1M1AA 5B2JC 5B31D 3W99A 5AV5D 5C3IC 1S32B 2NZDC 4J8WB 3AZIB 2AROC 3LJAB 2F8NK 2ZM5A 5GT0D 3MNNB 4LD9B 3B6GB 3WA9D 4UUZB 3UTBB 3X1VB 5AV6D 4KUDB 2YFVB 5BT1D 4KGCB 3KUYC 3EG5B 3O62C 1AOIB 4YM6B 1H3OA 5JRGA 2JCHA 3LZ0D 3MGRD 4DQYB 5B32C 1U35D 1P3BC 1P3IA 4J8XC 3B6FA 1KX4C 2PYOA 5AY8D 3AZMD 3KXBB 3AZLA 4J8VD 5GT3A 5B40A 2RVQD 3LZ1A 1P3FA 5CP6D 3KWQA 3AZJC 3AV2A 4JJNC 4NFTA 2YFWA 4Z5TA 3RELD 4G91B 3UTAC 3AZHC 4ZBJC 5CPIB 1M1AB 4ZUXB 5AVBA 4H9OA 3A1IA 1BH9B 1ID3C 3W99B 4J8UA 1P3PB 1HQ3C 5B0YA 5CPJD 1M1AD 4H9NA 3R45A 3MGQA 5BNXA 3AZKB 3EPHA 1P3AB 3WKJD 5B0ZD 1EQZC 3AV1D 1ZLAD 1H3OB 5JRGB 4H9PA 5GXQC 2NQBD 1P3IB 1KX3D 3B6FB 5AVCA 2PYOB 5F99C 2Y2JA 3AN2D 3AZLB 2L5AA 4XZQC 4Z66A 3LELD 4NE3A 5GT3B 5B40B 2FJ7C 4WU9A 3REKC 3LZ1B 1P3FB 2DF4C 3KWQB 3AV2B 5B31A 1N1JA 5AV5A 3REJD 2YFWB 4Z5TB 3X1UD 5AV9C 4QLCC 3X1SD 3REIC 5AVBB 4H9OB 3EPLA 5GT0A 3AFAA 3MVDC 3AZFB 3C1BC 3AZGD 3WA9A 3AV2D 4J8UB 1P3OC 5AV6A 3TU4C 1R4VA 3AZEC 2Y2PA 1TAFA 5B0YB 1TZYD 4WV4B 3LZ0A 3MGRA 4H9NB 3R45B 4WU8C 3MGQB 5BNXB 1U35A 3NQUA 2HIOD 3REHD 5B1LD 5B24D 5CPKD 1P3KB 1P34C 3W98C 3W96D 2JSSA 5AY8A 5G49A 3AZMA 3MGSD 4J8VA 2CV5A 4EO5B 4CSRA 4KHAA 3AYWC 5AVCB 5DNMC 4G92C 3A1KA 1M18C 4Z66B 2HUEC 5B1MC 1P3GC 2AROA 5GSUC 2RIQA 5AV8D 4DRAA 4YS3C 4X23C 2IO5B 4XUJC 5B31B 1N1JB 1HTAA 5AV5B 3B0CW 2XD5A 5B2IC 5B33D 3WAAD 3AZNC 1P3LD 4R8PD 3A6NC 5E5AD 1P3MD 5GT0B 4WU9D 5CPJA 2JE5A 3WA9B 1F66D 1F1EA 5AV6B 1KX5D 3WKJA 1S32C 4J8WC 4J8XA 3AZIC 3EPKA 5B0ZA 1KX4A 3LJAC 1TAFB 3AV1A 1M19D 1ZLAA 3LZ0B 3MGRB 3MNNC 1U35B 2NQBA 3AFAD 3B6GC 4LD9C 3NQUB 3WTPA 3X1VC 3UTBC 1KX3A 4H9QA 4KUDC 5AY8B 5G49B 3AZMB 4JJNA 3AN2A 3LELA 4J8VB 4KGCC 1AOIC 4CSRB 3UTAA 4KHAB 2DQNC 3FDDA 4YM6C 3C1CD 5CP6B 4AWLB 5BO0A 4CAYA 3REJA 3RELB 5DNND 3X1UA 3KXBC 3X1TD 3X1SA 2CV5D 5B40C 1B67A 2CWEA 5KDMB 3W97D 3AZGA 5B2JD 2FFFB 4G91C 2NZDD 5CPIC 2AROD 1M1AC 4ZUXC 1TZYA 3VH6A 5CPJB 3W99C 5GXQA 2HIOA 1B6WA 3REHA 5B1LA 5B24A 3B0CT 5CPKA 3WKJB 4H9SA 3UT9A 3W96A 5B0ZB 1P3PC 3AV1B 2BYKA 3MGSA 1ZLAB 3KUYD 2F8ND 2NQBB 3O62D 3EPJA 3WTPB 3AZKC 1KX3B 4H9QB 5B32D 1P3BD 1P3AC 3AN2B 3LELB 4J8XD 1KX4D 3IP4C 3MGPA 5JRGC 5AV8A 5BO0B 2LY8A 4CAYB 1P3IC 3WTPD 2ZY2A 5B33A 3REJB 3WAAA 1P3LA 3B6FC 3AZJD 1BH8A 2PYOC 4R8PA 3X1UB 1KU5A 3TU4A 5E5AA 4JJND 3AZLC 3X1SB 1P3MA 5GT3C
chains in the Genus database with same CATH topology
4M6BA 3UTAD 3LZ1C 3AZHD 1P3FC 2Y2KA 3KWQC 3AZGB 3AV2C 1ID3D 1F66A 4Z5TC 1KX5A 2XD1A 3KFUG 1M19A 1TZYB 5AVBC 3NQJA 1HQ3D 3AZFC 4NE5A 2HIOB 3REHB 3B0BA 5B1LB 5B24B 5CPKB 4J8UC 3UT9B 3W96B 2BYKB 3MGSB 5B1MA 3P5JB 4WZSB 5B0YC 1EQZD 2Y2OA 1P3GA 5GSUA 3C1CA 3MGQC 5GXQD 4XUJA 1P3KC 2Y2IA 5DNNA 3UT9D 3MGPB 3A6NA 5F99D 3X1TA 4EO5C 5AV8B 4XZQD 4H9PB 4HGAB 5BS7C 2FJ7D 3W97A 3REKD 1BFMA 5B33B 3WAAB 1P3LB 5B2JA 5AVCC 1BH8B 4R8PB 5E5AB 4Z66C 1P3MB 2NZDA 1Q9CA 2Y2NA 3MGPD 4WU9B 2W8SA 5AV9D 4QLCD 5B31G 3REID 2IO5C 3B0DB 5B31C 5AV5C 1F66B 3MNNA 3MVDD 3VH6W 1KX5B 3C1BD 3H0MC 1P3OD 3TU4D 5FUGA 1M19B 5BNVA 3AZED 3NQJB 4KGCA 5GT0C 2BYMA 3KUYA 2F8NA 3O62A 3AFAB 3WA9C 1ULYA 4WU8D 5AV6C 5B32A 1P3BA 5BT1C 1P34D 1Z2CB 3W98D 4NE6A 3LZ0C 1WWIA 3MGRC 3C1CB 1U35C 3AYWD 5DNNB 3AZJA 5DNMD 5AY8C 3AZMC 4E45A 2BG1A 4J8VC 3X1TB 2CV5B 1M18D 2UWXA 5B1MD 2RVQC 3AZHA 1P3GD 3W97B 5GSUD 4ZUXA 1W2EA 5CP6C 4AWLC 1BH9A 2F2AC 5B2JB 4YS3D 4X23D 4XUJD 1ID3A 4E44A 3VH5A 4Z2MH 5B2ID 3RELC 5C3IB 3AZND 2NZDB 2AROB 3VH5T 3A6ND 1P3PA 1HQ3A 5JA4A 3AZKA 2J8PA 2ZY3A 5FUGB 1P3AA 5BNVB 1S32D 2F8NG 4J8WD 3AZID 2BYMB 3KUYB 2F8NB 3O62B 3LJAD 5CPJC 1EQZA 2Y2MA 5B32G 3MNND 5B32B 4LD9D 3B6GD 1P3BB 3WKJC 3VH6T 4J8XB 3UTBD 3X1VD 5B0ZC 1KX4B 4KUDD 2F8NH 3AV1C 1ZLAC 5F99A 4XZQA 4KGCD 1PZRA 2NQBC 1AOID 2FJ7A 3WTPC 3REKA 4YM6D 1KX3C 3AZJB 3V9RA 2Y2GA 3AN2C 4JJNB 3LELC 3F6TA 2Y2LA 3UTAB 3AZHB 4ZBJB 4QLCA 5AV9A 3KXBD 3REIA 4WJ3C 1ID3B 1JFIA 3AZFA 3MVDA 3REJC 2ZY4A 3C1BA 3X1UC 4H9RA 1P3OA 3X1SC 3AZEA 2VQRA 1HQ3B 5CPID 4WNNA 5JA4B 4ZUXD 3AZGC 4WU8A 3W99D 1P3KA 2ZY5A 1P34A 3W98A 1EQZB 1TZYC 1P3PD 4DRBA 5GXQB 2HIOC 3REHC 5BS7A 5B1LC 5B24C 3AYWA 5CPKC 4H9SC 3UT9C 3W96C 3AZKD 5DNMA 3MGSC 1P3AD 5F99B 1M18A 4UPKA 4XZQB 2FJ7B 3REKB 5JRGD 3KSYA 4YS3A 4X23A 3V9RB 1P3ID 5B2IA 2G5HC 3AZNA 3B6FD 3MGPC 2PYOD 3VH5W 5AV9B 4QLCB 3AZLD 3WTPE 5AV8C 3REIB 4HGAC 5GT3D 5B40D 1JFIB 2G5IC 3MVDB 3LZ1D 5B33C 3WAAC 1P3FD 1P3LC 2Y2HA 3KWQD 3C1BB 4R8PC 4H9RB 1P3OB 5E5AC 3TU4B 4Z5TD 1P3MC 3AZEB 1S32A 4J8WA 3AZIA 4WU9C 1WWSA 2Y2QA 3LJAA 4WNNB 5AVBD 3B0DC 4WU8B 1F66C 3AZFD 4LD9A 3B6GA 1KX5C 4UUZA 3UTBA 4J8UD 3X1VA 3AL0C 1P34B 4KUDA 3W98B 1T3UA 2YFVA 1M19C 3AFAC 1AOIA 5B0YD 4YM6A 3AYWB 5CP6A 3MGQD 3H0LC 5DNMB 4G92B 1P3KD 1M18B 3RELA 5CHLB 3H0RC 2HUEB 5B1MB 1A7WA 1P3GB 3KXBA 3C1CC 5GSUB 4YS3B 4X23B 4XUJB 5KDMA 5B2IB 4Z2MG 5DNNC 3AZNB 5AVCD 3X1TC 2CV5C 3A6NB 4Z66D 5CPIA 3W97C 1M1AA 5B2JC 5B31D 3W99A 5AV5D 5C3IC 1S32B 2NZDC 4J8WB 3AZIB 2AROC 3LJAB 2F8NK 2ZM5A 5GT0D 3MNNB 4LD9B 3B6GB 3WA9D 4UUZB 3UTBB 3X1VB 5AV6D 4KUDB 2YFVB 5BT1D 4KGCB 3KUYC 3EG5B 3O62C 1AOIB 4YM6B 1H3OA 5JRGA 2JCHA 3LZ0D 3MGRD 4DQYB 5B32C 1U35D 1P3BC 1P3IA 4J8XC 3B6FA 1KX4C 2PYOA 5AY8D 3AZMD 3KXBB 3AZLA 4J8VD 5GT3A 5B40A 2RVQD 3LZ1A 1P3FA 5CP6D 3KWQA 3AZJC 3AV2A 4JJNC 4NFTA 2YFWA 4Z5TA 3RELD 4G91B 3UTAC 3AZHC 4ZBJC 5CPIB 1M1AB 4ZUXB 5AVBA 4H9OA 3A1IA 1BH9B 1ID3C 3W99B 4J8UA 1P3PB 1HQ3C 5B0YA 5CPJD 1M1AD 4H9NA 3R45A 3MGQA 5BNXA 3AZKB 3EPHA 1P3AB 3WKJD 5B0ZD 1EQZC 3AV1D 1ZLAD 1H3OB 5JRGB 4H9PA 5GXQC 2NQBD 1P3IB 1KX3D 3B6FB 5AVCA 2PYOB 5F99C 2Y2JA 3AN2D 3AZLB 2L5AA 4XZQC 4Z66A 3LELD 4NE3A 5GT3B 5B40B 2FJ7C 4WU9A 3REKC 3LZ1B 1P3FB 2DF4C 3KWQB 3AV2B 5B31A 1N1JA 5AV5A 3REJD 2YFWB 4Z5TB 3X1UD 5AV9C 4QLCC 3X1SD 3REIC 5AVBB 4H9OB 3EPLA 5GT0A 3AFAA 3MVDC 3AZFB 3C1BC 3AZGD 3WA9A 3AV2D 4J8UB 1P3OC 5AV6A 3TU4C 1R4VA 3AZEC 2Y2PA 1TAFA 5B0YB 1TZYD 4WV4B 3LZ0A 3MGRA 4H9NB 3R45B 4WU8C 3MGQB 5BNXB 1U35A 3NQUA 2HIOD 3REHD 5B1LD 5B24D 5CPKD 1P3KB 1P34C 3W98C 3W96D 2JSSA 5AY8A 5G49A 3AZMA 3MGSD 4J8VA 2CV5A 4EO5B 4CSRA 4KHAA 3AYWC 5AVCB 5DNMC 4G92C 3A1KA 1M18C 4Z66B 2HUEC 5B1MC 1P3GC 2AROA 5GSUC 2RIQA 5AV8D 4DRAA 4YS3C 4X23C 2IO5B 4XUJC 5B31B 1N1JB 1HTAA 5AV5B 3B0CW 2XD5A 5B2IC 5B33D 3WAAD 3AZNC 1P3LD 4R8PD 3A6NC 5E5AD 1P3MD 5GT0B 4WU9D 5CPJA 2JE5A 3WA9B 1F66D 1F1EA 5AV6B 1KX5D 3WKJA 1S32C 4J8WC 4J8XA 3AZIC 3EPKA 5B0ZA 1KX4A 3LJAC 1TAFB 3AV1A 1M19D 1ZLAA 3LZ0B 3MGRB 3MNNC 1U35B 2NQBA 3AFAD 3B6GC 4LD9C 3NQUB 3WTPA 3X1VC 3UTBC 1KX3A 4H9QA 4KUDC 5AY8B 5G49B 3AZMB 4JJNA 3AN2A 3LELA 4J8VB 4KGCC 1AOIC 4CSRB 3UTAA 4KHAB 2DQNC 3FDDA 4YM6C 3C1CD 5CP6B 4AWLB 5BO0A 4CAYA 3REJA 3RELB 5DNND 3X1UA 3KXBC 3X1TD 3X1SA 2CV5D 5B40C 1B67A 2CWEA 5KDMB 3W97D 3AZGA 5B2JD 2FFFB 4G91C 2NZDD 5CPIC 2AROD 1M1AC 4ZUXC 1TZYA 3VH6A 5CPJB 3W99C 5GXQA 2HIOA 1B6WA 3REHA 5B1LA 5B24A 3B0CT 5CPKA 3WKJB 4H9SA 3UT9A 3W96A 5B0ZB 1P3PC 3AV1B 2BYKA 3MGSA 1ZLAB 3KUYD 2F8ND 2NQBB 3O62D 3EPJA 3WTPB 3AZKC 1KX3B 4H9QB 5B32D 1P3BD 1P3AC 3AN2B 3LELB 4J8XD 1KX4D 3IP4C 3MGPA 5JRGC 5AV8A 5BO0B 2LY8A 4CAYB 1P3IC 3WTPD 2ZY2A 5B33A 3REJB 3WAAA 1P3LA 3B6FC 3AZJD 1BH8A 2PYOC 4R8PA 3X1UB 1KU5A 3TU4A 5E5AA 4JJND 3AZLC 3X1SB 1P3MA 5GT3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  3UTA D;  3LZ1 C;  3AZH D;  1P3F C;  3KWQ C;  3AZG B;  3AV2 C;  1ID3 D;  1F66 A;  4Z5T C;  1KX5 A;  1M19 A;  1TZY B;  5AVB C;  3NQJ A;  1HQ3 D;  3AZF C;  4NE5 A;  2HIO B;  3REH B;  3B0B A;  5B1L B;  5B24 B;  5CPK B;  4J8U C;  3UT9 B;  3W96 B;  2BYK B;  3MGS B;  5B1M A;  4WZS B;  5B0Y C;  1EQZ D;  1P3G A;  5GSU A;  3C1C A;  3MGQ C;  5GXQ D;  4XUJ A;  1P3K C;  5DNN A;  3UT9 D;  3MGP B;  3A6N A;  5F99 D;  3X1T A;  4EO5 C;  5AV8 B;  4XZQ D;  4H9P B;  4HGA B;  5BS7 C;  2FJ7 D;  3W97 A;  3REK D;  1BFM A;  5B33 B;  3WAA B;  1P3L B;  5B2J A;  5AVC C;  1BH8 B;  4R8P B;  5E5A B;  4Z66 C;  1P3M B;  2NZD A;  1Q9C A;  3MGP D;  4WU9 B;  5AV9 D;  4QLC D;  5B31 G;  3REI D;  2IO5 C;  3B0D B;  5B31 C;  5AV5 C;  1F66 B;  3MNN A;  3MVD D;  3VH6 W;  1KX5 B;  3C1B D;  1P3O D;  3TU4 D;  5FUG A;  1M19 B;  5BNV A;  3AZE D;  3NQJ B;  4KGC A;  5GT0 C;  2BYM A;  3KUY A;  2F8N A;  3O62 A;  3AFA B;  3WA9 C;  1ULY A;  4WU8 D;  5AV6 C;  5B32 A;  1P3B A;  5BT1 C;  1P34 D;  3W98 D;  4NE6 A;  3LZ0 C;  1WWI A;  3MGR C;  3C1C B;  1U35 C;  3AYW D;  5DNN B;  3AZJ A;  5DNM D;  5AY8 C;  3AZM C;  4E45 A;  4J8V C;  3X1T B;  2CV5 B;  1M18 D;  5B1M D;  2RVQ C;  3AZH A;  1P3G D;  3W97 B;  5GSU D;  4ZUX A;  5CP6 C;  4AWL C;  1BH9 A;  5B2J B;  4YS3 D;  4X23 D;  4XUJ D;  1ID3 A;  4E44 A;  3VH5 A;  4Z2M H;  5B2I D;  3REL C;  5C3I B;  3AZN D;  2NZD B;  2ARO B;  3VH5 T;  3A6N D;  1P3P A;  1HQ3 A;  5JA4 A;  3AZK A;  5FUG B;  1P3A A;  5BNV B;  1S32 D;  2F8N G;  4J8W D;  3AZI D;  2BYM B;  3KUY B;  2F8N B;  3O62 B;  3LJA D;  5CPJ C;  1EQZ A;  5B32 G;  3MNN D;  5B32 B;  4LD9 D;  3B6G D;  1P3B B;  3WKJ C;  3VH6 T;  4J8X B;  3UTB D;  3X1V D;  5B0Z C;  1KX4 B;  4KUD D;  2F8N H;  3AV1 C;  1ZLA C;  5F99 A;  4XZQ A;  4KGC D;  2NQB C;  1AOI D;  2FJ7 A;  3WTP C;  3REK A;  4YM6 D;  1KX3 C;  3AZJ B;  3V9R A;  3AN2 C;  4JJN B;  3LEL C;  3UTA B;  3AZH B;  4ZBJ B;  4QLC A;  5AV9 A;  3KXB D;  3REI A;  1ID3 B;  1JFI A;  3AZF A;  3MVD A;  3REJ C;  3C1B A;  3X1U C;  4H9R A;  1P3O A;  3X1S C;  3AZE A;  1HQ3 B;  5CPI D;  4WNN A;  5JA4 B;  4ZUX D;  3AZG C;  4WU8 A;  3W99 D;  1P3K A;  1P34 A;  3W98 A;  1EQZ B;  1TZY C;  1P3P D;  4DRB A;  5GXQ B;  2HIO C;  3REH C;  5BS7 A;  5B1L C;  5B24 C;  3AYW A;  5CPK C;  4H9S C;  3UT9 C;  3W96 C;  3AZK D;  5DNM A;  3MGS C;  1P3A D;  5F99 B;  1M18 A;  4XZQ B;  2FJ7 B;  3REK B;  5JRG D;  3KSY A;  4YS3 A;  4X23 A;  3V9R B;  1P3I D;  5B2I A;  3AZN A;  3B6F D;  3MGP C;  2PYO D;  3VH5 W;  5AV9 B;  4QLC B;  3AZL D;  3WTP E;  5AV8 C;  3REI B;  4HGA C;  5GT3 D;  5B40 D;  1JFI B;  3MVD B;  3LZ1 D;  5B33 C;  3WAA C;  1P3F D;  1P3L C;  3KWQ D;  3C1B B;  4R8P C;  4H9R B;  1P3O B;  5E5A C;  3TU4 B;  4Z5T D;  1P3M C;  3AZE B;  1S32 A;  4J8W A;  3AZI A;  4WU9 C;  1WWS A;  3LJA A;  4WNN B;  5AVB D;  3B0D C;  4WU8 B;  1F66 C;  3AZF D;  4LD9 A;  3B6G A;  1KX5 C;  4UUZ A;  3UTB A;  4J8U D;  3X1V A;  1P34 B;  4KUD A;  3W98 B;  2YFV A;  1M19 C;  3AFA C;  1AOI A;  5B0Y D;  4YM6 A;  3AYW B;  5CP6 A;  3MGQ D;  5DNM B;  4G92 B;  1P3K D;  1M18 B;  3REL A;  5CHL B;  2HUE B;  5B1M B;  1A7W A;  1P3G B;  3KXB A;  3C1C C;  5GSU B;  4YS3 B;  4X23 B;  4XUJ B;  5KDM A;  5B2I B;  4Z2M G;  5DNN C;  3AZN B;  5AVC D;  3X1T C;  2CV5 C;  3A6N B;  4Z66 D;  5CPI A;  3W97 C;  1M1A A;  5B2J C;  5B31 D;  3W99 A;  5AV5 D;  5C3I C;  1S32 B;  2NZD C;  4J8W B;  3AZI B;  2ARO C;  3LJA B;  2F8N K;  5GT0 D;  3MNN B;  4LD9 B;  3B6G B;  3WA9 D;  4UUZ B;  3UTB B;  3X1V B;  5AV6 D;  4KUD B;  2YFV B;  5BT1 D;  4KGC B;  3KUY C;  3O62 C;  1AOI B;  4YM6 B;  1H3O A;  5JRG A;  3LZ0 D;  3MGR D;  5B32 C;  1U35 D;  1P3B C;  1P3I A;  4J8X C;  3B6F A;  1KX4 C;  2PYO A;  5AY8 D;  3AZM D;  3KXB B;  3AZL A;  4J8V D;  5GT3 A;  5B40 A;  2RVQ D;  3LZ1 A;  1P3F A;  5CP6 D;  3KWQ A;  3AZJ C;  3AV2 A;  4JJN C;  4NFT A;  2YFW A;  4Z5T A;  3REL D;  4G91 B;  3UTA C;  3AZH C;  4ZBJ C;  5CPI B;  1M1A B;  4ZUX B;  5AVB A;  4H9O A;  1BH9 B;  1ID3 C;  3W99 B;  4J8U A;  1P3P B;  1HQ3 C;  5B0Y A;  5CPJ D;  1M1A D;  4H9N A;  3R45 A;  3MGQ A;  5BNX A;  3AZK B;  1P3A B;  3WKJ D;  5B0Z D;  1EQZ C;  3AV1 D;  1ZLA D;  1H3O B;  5JRG B;  4H9P A;  5GXQ C;  2NQB D;  1P3I B;  1KX3 D;  3B6F B;  5AVC A;  2PYO B;  5F99 C;  3AN2 D;  3AZL B;  2L5A A;  4XZQ C;  4Z66 A;  3LEL D;  4NE3 A;  5GT3 B;  5B40 B;  2FJ7 C;  4WU9 A;  3REK C;  3LZ1 B;  1P3F B;  3KWQ B;  3AV2 B;  5B31 A;  1N1J A;  5AV5 A;  3REJ D;  2YFW B;  4Z5T B;  3X1U D;  5AV9 C;  4QLC C;  3X1S D;  3REI C;  5AVB B;  4H9O B;  5GT0 A;  3AFA A;  3MVD C;  3AZF B;  3C1B C;  3AZG D;  3WA9 A;  3AV2 D;  4J8U B;  1P3O C;  5AV6 A;  3TU4 C;  1R4V A;  3AZE C;  1TAF A;  5B0Y B;  1TZY D;  4WV4 B;  3LZ0 A;  3MGR A;  4H9N B;  3R45 B;  4WU8 C;  3MGQ B;  5BNX B;  1U35 A;  2HIO D;  3NQU A;  3REH D;  5B24 D;  5B1L D;  5CPK D;  1P3K B;  1P34 C;  3W98 C;  3W96 D;  2JSS A;  5AY8 A;  5G49 A;  3AZM A;  3MGS D;  4J8V A;  2CV5 A;  4EO5 B;  4CSR A;  4KHA A;  3AYW C;  5AVC B;  5DNM C;  4G92 C;  1M18 C;  4Z66 B;  2HUE C;  5B1M C;  1P3G C;  2ARO A;  5GSU C;  5AV8 D;  4DRA A;  4YS3 C;  4X23 C;  2IO5 B;  4XUJ C;  5B31 B;  1N1J B;  1HTA A;  5AV5 B;  3B0C W;  5B2I C;  5B33 D;  3WAA D;  3AZN C;  1P3L D;  4R8P D;  3A6N C;  5E5A D;  1P3M D;  5GT0 B;  4WU9 D;  5CPJ A;  3WA9 B;  1F66 D;  1F1E A;  5AV6 B;  1KX5 D;  3WKJ A;  1S32 C;  4J8W C;  4J8X A;  3AZI C;  5B0Z A;  1KX4 A;  3LJA C;  1TAF B;  3AV1 A;  1M19 D;  1ZLA A;  3LZ0 B;  3MGR B;  3MNN C;  1U35 B;  2NQB A;  3AFA D;  3B6G C;  4LD9 C;  3NQU B;  3WTP A;  3X1V C;  3UTB C;  1KX3 A;  4H9Q A;  4KUD C;  5AY8 B;  5G49 B;  3AZM B;  4JJN A;  3AN2 A;  3LEL A;  4J8V B;  4KGC C;  1AOI C;  4CSR B;  3UTA A;  4KHA B;  4YM6 C;  3C1C D;  5CP6 B;  4AWL B;  5BO0 A;  4CAY A;  3REJ A;  3REL B;  5DNN D;  3X1U A;  3KXB C;  3X1T D;  3X1S A;  2CV5 D;  5B40 C;  1B67 A;  2CWE A;  5KDM B;  3W97 D;  3AZG A;  5B2J D;  4G91 C;  2NZD D;  5CPI C;  2ARO D;  1M1A C;  4ZUX C;  1TZY A;  3VH6 A;  5CPJ B;  3W99 C;  5GXQ A;  2HIO A;  1B6W A;  3REH A;  5B1L A;  5B24 A;  3B0C T;  5CPK A;  3WKJ B;  4H9S A;  3UT9 A;  3W96 A;  5B0Z B;  1P3P C;  3AV1 B;  2BYK A;  3MGS A;  1ZLA B;  3KUY D;  2F8N D;  2NQB B;  3O62 D;  3WTP B;  3AZK C;  1KX3 B;  4H9Q B;  5B32 D;  1P3B D;  1P3A C;  3AN2 B;  3LEL B;  4J8X D;  1KX4 D;  3MGP A;  5JRG C;  5AV8 A;  5BO0 B;  2LY8 A;  4CAY B;  1P3I C;  3WTP D;  5B33 A;  3REJ B;  3WAA A;  1P3L A;  3B6F C;  3AZJ D;  1BH8 A;  2PYO C;  4R8P A;  3X1U B;  1KU5 A;  3TU4 A;  5E5A A;  4JJN D;  3AZL C;  3X1S B;  1P3M A;  5GT3 C; 
#chains in the Genus database with same CATH topology
 4M6B A;  3UTA D;  3LZ1 C;  3AZH D;  1P3F C;  2Y2K A;  3KWQ C;  3AZG B;  3AV2 C;  1ID3 D;  1F66 A;  4Z5T C;  1KX5 A;  2XD1 A;  3KFU G;  1M19 A;  1TZY B;  5AVB C;  3NQJ A;  1HQ3 D;  3AZF C;  4NE5 A;  2HIO B;  3REH B;  3B0B A;  5B1L B;  5B24 B;  5CPK B;  4J8U C;  3UT9 B;  3W96 B;  2BYK B;  3MGS B;  5B1M A;  3P5J B;  4WZS B;  5B0Y C;  1EQZ D;  2Y2O A;  1P3G A;  5GSU A;  3C1C A;  3MGQ C;  5GXQ D;  4XUJ A;  1P3K C;  2Y2I A;  5DNN A;  3UT9 D;  3MGP B;  3A6N A;  5F99 D;  3X1T A;  4EO5 C;  5AV8 B;  4XZQ D;  4H9P B;  4HGA B;  5BS7 C;  2FJ7 D;  3W97 A;  3REK D;  1BFM A;  5B33 B;  3WAA B;  1P3L B;  5B2J A;  5AVC C;  1BH8 B;  4R8P B;  5E5A B;  4Z66 C;  1P3M B;  2NZD A;  1Q9C A;  2Y2N A;  3MGP D;  4WU9 B;  2W8S A;  5AV9 D;  4QLC D;  5B31 G;  3REI D;  2IO5 C;  3B0D B;  5B31 C;  5AV5 C;  1F66 B;  3MNN A;  3MVD D;  3VH6 W;  1KX5 B;  3C1B D;  3H0M C;  1P3O D;  3TU4 D;  5FUG A;  1M19 B;  5BNV A;  3AZE D;  3NQJ B;  4KGC A;  5GT0 C;  2BYM A;  3KUY A;  2F8N A;  3O62 A;  3AFA B;  3WA9 C;  1ULY A;  4WU8 D;  5AV6 C;  5B32 A;  1P3B A;  5BT1 C;  1P34 D;  1Z2C B;  3W98 D;  4NE6 A;  3LZ0 C;  1WWI A;  3MGR C;  3C1C B;  1U35 C;  3AYW D;  5DNN B;  3AZJ A;  5DNM D;  5AY8 C;  3AZM C;  4E45 A;  2BG1 A;  4J8V C;  3X1T B;  2CV5 B;  1M18 D;  2UWX A;  5B1M D;  2RVQ C;  3AZH A;  1P3G D;  3W97 B;  5GSU D;  4ZUX A;  1W2E A;  5CP6 C;  4AWL C;  1BH9 A;  2F2A C;  5B2J B;  4YS3 D;  4X23 D;  4XUJ D;  1ID3 A;  4E44 A;  3VH5 A;  4Z2M H;  5B2I D;  3REL C;  5C3I B;  3AZN D;  2NZD B;  2ARO B;  3VH5 T;  3A6N D;  1P3P A;  1HQ3 A;  5JA4 A;  3AZK A;  2J8P A;  2ZY3 A;  5FUG B;  1P3A A;  5BNV B;  1S32 D;  2F8N G;  4J8W D;  3AZI D;  2BYM B;  3KUY B;  2F8N B;  3O62 B;  3LJA D;  5CPJ C;  1EQZ A;  2Y2M A;  5B32 G;  3MNN D;  5B32 B;  4LD9 D;  3B6G D;  1P3B B;  3WKJ C;  3VH6 T;  4J8X B;  3UTB D;  3X1V D;  5B0Z C;  1KX4 B;  4KUD D;  2F8N H;  3AV1 C;  1ZLA C;  5F99 A;  4XZQ A;  4KGC D;  1PZR A;  2NQB C;  1AOI D;  2FJ7 A;  3WTP C;  3REK A;  4YM6 D;  1KX3 C;  3AZJ B;  3V9R A;  2Y2G A;  3AN2 C;  4JJN B;  3LEL C;  3F6T A;  2Y2L A;  3UTA B;  3AZH B;  4ZBJ B;  4QLC A;  5AV9 A;  3KXB D;  3REI A;  4WJ3 C;  1ID3 B;  1JFI A;  3AZF A;  3MVD A;  3REJ C;  2ZY4 A;  3C1B A;  3X1U C;  4H9R A;  1P3O A;  3X1S C;  3AZE A;  2VQR A;  1HQ3 B;  5CPI D;  4WNN A;  5JA4 B;  4ZUX D;  3AZG C;  4WU8 A;  3W99 D;  1P3K A;  2ZY5 A;  1P34 A;  3W98 A;  1EQZ B;  1TZY C;  1P3P D;  4DRB A;  5GXQ B;  2HIO C;  3REH C;  5BS7 A;  5B1L C;  5B24 C;  3AYW A;  5CPK C;  4H9S C;  3UT9 C;  3W96 C;  3AZK D;  5DNM A;  3MGS C;  1P3A D;  5F99 B;  1M18 A;  4UPK A;  4XZQ B;  2FJ7 B;  3REK B;  5JRG D;  3KSY A;  4YS3 A;  4X23 A;  3V9R B;  1P3I D;  5B2I A;  2G5H C;  3AZN A;  3B6F D;  3MGP C;  2PYO D;  3VH5 W;  5AV9 B;  4QLC B;  3AZL D;  3WTP E;  5AV8 C;  3REI B;  4HGA C;  5GT3 D;  5B40 D;  1JFI B;  2G5I C;  3MVD B;  3LZ1 D;  5B33 C;  3WAA C;  1P3F D;  1P3L C;  2Y2H A;  3KWQ D;  3C1B B;  4R8P C;  4H9R B;  1P3O B;  5E5A C;  3TU4 B;  4Z5T D;  1P3M C;  3AZE B;  1S32 A;  4J8W A;  3AZI A;  4WU9 C;  1WWS A;  2Y2Q A;  3LJA A;  4WNN B;  5AVB D;  3B0D C;  4WU8 B;  1F66 C;  3AZF D;  4LD9 A;  3B6G A;  1KX5 C;  4UUZ A;  3UTB A;  4J8U D;  3X1V A;  3AL0 C;  1P34 B;  4KUD A;  3W98 B;  1T3U A;  2YFV A;  1M19 C;  3AFA C;  1AOI A;  5B0Y D;  4YM6 A;  3AYW B;  5CP6 A;  3MGQ D;  3H0L C;  5DNM B;  4G92 B;  1P3K D;  1M18 B;  3REL A;  5CHL B;  3H0R C;  2HUE B;  5B1M B;  1A7W A;  1P3G B;  3KXB A;  3C1C C;  5GSU B;  4YS3 B;  4X23 B;  4XUJ B;  5KDM A;  5B2I B;  4Z2M G;  5DNN C;  3AZN B;  5AVC D;  3X1T C;  2CV5 C;  3A6N B;  4Z66 D;  5CPI A;  3W97 C;  1M1A A;  5B2J C;  5B31 D;  3W99 A;  5AV5 D;  5C3I C;  1S32 B;  2NZD C;  4J8W B;  3AZI B;  2ARO C;  3LJA B;  2F8N K;  2ZM5 A;  5GT0 D;  3MNN B;  4LD9 B;  3B6G B;  3WA9 D;  4UUZ B;  3UTB B;  3X1V B;  5AV6 D;  4KUD B;  2YFV B;  5BT1 D;  4KGC B;  3KUY C;  3EG5 B;  3O62 C;  1AOI B;  4YM6 B;  1H3O A;  5JRG A;  2JCH A;  3LZ0 D;  3MGR D;  4DQY B;  5B32 C;  1U35 D;  1P3B C;  1P3I A;  4J8X C;  3B6F A;  1KX4 C;  2PYO A;  5AY8 D;  3AZM D;  3KXB B;  3AZL A;  4J8V D;  5GT3 A;  5B40 A;  2RVQ D;  3LZ1 A;  1P3F A;  5CP6 D;  3KWQ A;  3AZJ C;  3AV2 A;  4JJN C;  4NFT A;  2YFW A;  4Z5T A;  3REL D;  4G91 B;  3UTA C;  3AZH C;  4ZBJ C;  5CPI B;  1M1A B;  4ZUX B;  5AVB A;  4H9O A;  3A1I A;  1BH9 B;  1ID3 C;  3W99 B;  4J8U A;  1P3P B;  1HQ3 C;  5B0Y A;  5CPJ D;  1M1A D;  4H9N A;  3R45 A;  3MGQ A;  5BNX A;  3AZK B;  3EPH A;  1P3A B;  3WKJ D;  5B0Z D;  1EQZ C;  3AV1 D;  1ZLA D;  1H3O B;  5JRG B;  4H9P A;  5GXQ C;  2NQB D;  1P3I B;  1KX3 D;  3B6F B;  5AVC A;  2PYO B;  5F99 C;  2Y2J A;  3AN2 D;  3AZL B;  2L5A A;  4XZQ C;  4Z66 A;  3LEL D;  4NE3 A;  5GT3 B;  5B40 B;  2FJ7 C;  4WU9 A;  3REK C;  3LZ1 B;  1P3F B;  2DF4 C;  3KWQ B;  3AV2 B;  5B31 A;  1N1J A;  5AV5 A;  3REJ D;  2YFW B;  4Z5T B;  3X1U D;  5AV9 C;  4QLC C;  3X1S D;  3REI C;  5AVB B;  4H9O B;  3EPL A;  5GT0 A;  3AFA A;  3MVD C;  3AZF B;  3C1B C;  3AZG D;  3WA9 A;  3AV2 D;  4J8U B;  1P3O C;  5AV6 A;  3TU4 C;  1R4V A;  3AZE C;  2Y2P A;  1TAF A;  5B0Y B;  1TZY D;  4WV4 B;  3LZ0 A;  3MGR A;  4H9N B;  3R45 B;  4WU8 C;  3MGQ B;  5BNX B;  1U35 A;  3NQU A;  2HIO D;  3REH D;  5B1L D;  5B24 D;  5CPK D;  1P3K B;  1P34 C;  3W98 C;  3W96 D;  2JSS A;  5AY8 A;  5G49 A;  3AZM A;  3MGS D;  4J8V A;  2CV5 A;  4EO5 B;  4CSR A;  4KHA A;  3AYW C;  5AVC B;  5DNM C;  4G92 C;  3A1K A;  1M18 C;  4Z66 B;  2HUE C;  5B1M C;  1P3G C;  2ARO A;  5GSU C;  2RIQ A;  5AV8 D;  4DRA A;  4YS3 C;  4X23 C;  2IO5 B;  4XUJ C;  5B31 B;  1N1J B;  1HTA A;  5AV5 B;  3B0C W;  2XD5 A;  5B2I C;  5B33 D;  3WAA D;  3AZN C;  1P3L D;  4R8P D;  3A6N C;  5E5A D;  1P3M D;  5GT0 B;  4WU9 D;  5CPJ A;  2JE5 A;  3WA9 B;  1F66 D;  1F1E A;  5AV6 B;  1KX5 D;  3WKJ A;  1S32 C;  4J8W C;  4J8X A;  3AZI C;  3EPK A;  5B0Z A;  1KX4 A;  3LJA C;  1TAF B;  3AV1 A;  1M19 D;  1ZLA A;  3LZ0 B;  3MGR B;  3MNN C;  1U35 B;  2NQB A;  3AFA D;  3B6G C;  4LD9 C;  3NQU B;  3WTP A;  3X1V C;  3UTB C;  1KX3 A;  4H9Q A;  4KUD C;  5AY8 B;  5G49 B;  3AZM B;  4JJN A;  3AN2 A;  3LEL A;  4J8V B;  4KGC C;  1AOI C;  4CSR B;  3UTA A;  4KHA B;  2DQN C;  3FDD A;  4YM6 C;  3C1C D;  5CP6 B;  4AWL B;  5BO0 A;  4CAY A;  3REJ A;  3REL B;  5DNN D;  3X1U A;  3KXB C;  3X1T D;  3X1S A;  2CV5 D;  5B40 C;  1B67 A;  2CWE A;  5KDM B;  3W97 D;  3AZG A;  5B2J D;  2FFF B;  4G91 C;  2NZD D;  5CPI C;  2ARO D;  1M1A C;  4ZUX C;  1TZY A;  3VH6 A;  5CPJ B;  3W99 C;  5GXQ A;  2HIO A;  1B6W A;  3REH A;  5B1L A;  5B24 A;  3B0C T;  5CPK A;  3WKJ B;  4H9S A;  3UT9 A;  3W96 A;  5B0Z B;  1P3P C;  3AV1 B;  2BYK A;  3MGS A;  1ZLA B;  3KUY D;  2F8N D;  2NQB B;  3O62 D;  3EPJ A;  3WTP B;  3AZK C;  1KX3 B;  4H9Q B;  5B32 D;  1P3B D;  1P3A C;  3AN2 B;  3LEL B;  4J8X D;  1KX4 D;  3IP4 C;  3MGP A;  5JRG C;  5AV8 A;  5BO0 B;  2LY8 A;  4CAY B;  1P3I C;  3WTP D;  2ZY2 A;  5B33 A;  3REJ B;  3WAA A;  1P3L A;  3B6F C;  3AZJ D;  1BH8 A;  2PYO C;  4R8P A;  3X1U B;  1KU5 A;  3TU4 A;  5E5A A;  4JJN D;  3AZL C;  3X1S B;  1P3M A;  5GT3 C; 
#chains in the Genus database with same CATH homology
 4M6B A;  3UTA D;  3LZ1 C;  3AZH D;  1P3F C;  2Y2K A;  3KWQ C;  3AZG B;  3AV2 C;  1ID3 D;  1F66 A;  4Z5T C;  1KX5 A;  2XD1 A;  3KFU G;  1M19 A;  1TZY B;  5AVB C;  3NQJ A;  1HQ3 D;  3AZF C;  4NE5 A;  2HIO B;  3REH B;  3B0B A;  5B1L B;  5B24 B;  5CPK B;  4J8U C;  3UT9 B;  3W96 B;  2BYK B;  3MGS B;  5B1M A;  3P5J B;  4WZS B;  5B0Y C;  1EQZ D;  2Y2O A;  1P3G A;  5GSU A;  3C1C A;  3MGQ C;  5GXQ D;  4XUJ A;  1P3K C;  2Y2I A;  5DNN A;  3UT9 D;  3MGP B;  3A6N A;  5F99 D;  3X1T A;  4EO5 C;  5AV8 B;  4XZQ D;  4H9P B;  4HGA B;  5BS7 C;  2FJ7 D;  3W97 A;  3REK D;  1BFM A;  5B33 B;  3WAA B;  1P3L B;  5B2J A;  5AVC C;  1BH8 B;  4R8P B;  5E5A B;  4Z66 C;  1P3M B;  2NZD A;  1Q9C A;  2Y2N A;  3MGP D;  4WU9 B;  2W8S A;  5AV9 D;  4QLC D;  5B31 G;  3REI D;  2IO5 C;  3B0D B;  5B31 C;  5AV5 C;  1F66 B;  3MNN A;  3MVD D;  3VH6 W;  1KX5 B;  3C1B D;  3H0M C;  1P3O D;  3TU4 D;  5FUG A;  1M19 B;  5BNV A;  3AZE D;  3NQJ B;  4KGC A;  5GT0 C;  2BYM A;  3KUY A;  2F8N A;  3O62 A;  3AFA B;  3WA9 C;  1ULY A;  4WU8 D;  5AV6 C;  5B32 A;  1P3B A;  5BT1 C;  1P34 D;  1Z2C B;  3W98 D;  4NE6 A;  3LZ0 C;  1WWI A;  3MGR C;  3C1C B;  1U35 C;  3AYW D;  5DNN B;  3AZJ A;  5DNM D;  5AY8 C;  3AZM C;  4E45 A;  2BG1 A;  4J8V C;  3X1T B;  2CV5 B;  1M18 D;  2UWX A;  5B1M D;  2RVQ C;  3AZH A;  1P3G D;  3W97 B;  5GSU D;  4ZUX A;  1W2E A;  5CP6 C;  4AWL C;  1BH9 A;  2F2A C;  5B2J B;  4YS3 D;  4X23 D;  4XUJ D;  1ID3 A;  4E44 A;  3VH5 A;  4Z2M H;  5B2I D;  3REL C;  5C3I B;  3AZN D;  2NZD B;  2ARO B;  3VH5 T;  3A6N D;  1P3P A;  1HQ3 A;  5JA4 A;  3AZK A;  2J8P A;  2ZY3 A;  5FUG B;  1P3A A;  5BNV B;  1S32 D;  2F8N G;  4J8W D;  3AZI D;  2BYM B;  3KUY B;  2F8N B;  3O62 B;  3LJA D;  5CPJ C;  1EQZ A;  2Y2M A;  5B32 G;  3MNN D;  5B32 B;  4LD9 D;  3B6G D;  1P3B B;  3WKJ C;  3VH6 T;  4J8X B;  3UTB D;  3X1V D;  5B0Z C;  1KX4 B;  4KUD D;  2F8N H;  3AV1 C;  1ZLA C;  5F99 A;  4XZQ A;  4KGC D;  1PZR A;  2NQB C;  1AOI D;  2FJ7 A;  3WTP C;  3REK A;  4YM6 D;  1KX3 C;  3AZJ B;  3V9R A;  2Y2G A;  3AN2 C;  4JJN B;  3LEL C;  3F6T A;  2Y2L A;  3UTA B;  3AZH B;  4ZBJ B;  4QLC A;  5AV9 A;  3KXB D;  3REI A;  4WJ3 C;  1ID3 B;  1JFI A;  3AZF A;  3MVD A;  3REJ C;  2ZY4 A;  3C1B A;  3X1U C;  4H9R A;  1P3O A;  3X1S C;  3AZE A;  2VQR A;  1HQ3 B;  5CPI D;  4WNN A;  5JA4 B;  4ZUX D;  3AZG C;  4WU8 A;  3W99 D;  1P3K A;  2ZY5 A;  1P34 A;  3W98 A;  1EQZ B;  1TZY C;  1P3P D;  4DRB A;  5GXQ B;  2HIO C;  3REH C;  5BS7 A;  5B1L C;  5B24 C;  3AYW A;  5CPK C;  4H9S C;  3UT9 C;  3W96 C;  3AZK D;  5DNM A;  3MGS C;  1P3A D;  5F99 B;  1M18 A;  4UPK A;  4XZQ B;  2FJ7 B;  3REK B;  5JRG D;  3KSY A;  4YS3 A;  4X23 A;  3V9R B;  1P3I D;  5B2I A;  2G5H C;  3AZN A;  3B6F D;  3MGP C;  2PYO D;  3VH5 W;  5AV9 B;  4QLC B;  3AZL D;  3WTP E;  5AV8 C;  3REI B;  4HGA C;  5GT3 D;  5B40 D;  1JFI B;  2G5I C;  3MVD B;  3LZ1 D;  5B33 C;  3WAA C;  1P3F D;  1P3L C;  2Y2H A;  3KWQ D;  3C1B B;  4R8P C;  4H9R B;  1P3O B;  5E5A C;  3TU4 B;  4Z5T D;  1P3M C;  3AZE B;  1S32 A;  4J8W A;  3AZI A;  4WU9 C;  1WWS A;  2Y2Q A;  3LJA A;  4WNN B;  5AVB D;  3B0D C;  4WU8 B;  1F66 C;  3AZF D;  4LD9 A;  3B6G A;  1KX5 C;  4UUZ A;  3UTB A;  4J8U D;  3X1V A;  3AL0 C;  1P34 B;  4KUD A;  3W98 B;  1T3U A;  2YFV A;  1M19 C;  3AFA C;  1AOI A;  5B0Y D;  4YM6 A;  3AYW B;  5CP6 A;  3MGQ D;  3H0L C;  5DNM B;  4G92 B;  1P3K D;  1M18 B;  3REL A;  5CHL B;  3H0R C;  2HUE B;  5B1M B;  1A7W A;  1P3G B;  3KXB A;  3C1C C;  5GSU B;  4YS3 B;  4X23 B;  4XUJ B;  5KDM A;  5B2I B;  4Z2M G;  5DNN C;  3AZN B;  5AVC D;  3X1T C;  2CV5 C;  3A6N B;  4Z66 D;  5CPI A;  3W97 C;  1M1A A;  5B2J C;  5B31 D;  3W99 A;  5AV5 D;  5C3I C;  1S32 B;  2NZD C;  4J8W B;  3AZI B;  2ARO C;  3LJA B;  2F8N K;  2ZM5 A;  5GT0 D;  3MNN B;  4LD9 B;  3B6G B;  3WA9 D;  4UUZ B;  3UTB B;  3X1V B;  5AV6 D;  4KUD B;  2YFV B;  5BT1 D;  4KGC B;  3KUY C;  3EG5 B;  3O62 C;  1AOI B;  4YM6 B;  1H3O A;  5JRG A;  2JCH A;  3LZ0 D;  3MGR D;  4DQY B;  5B32 C;  1U35 D;  1P3B C;  1P3I A;  4J8X C;  3B6F A;  1KX4 C;  2PYO A;  5AY8 D;  3AZM D;  3KXB B;  3AZL A;  4J8V D;  5GT3 A;  5B40 A;  2RVQ D;  3LZ1 A;  1P3F A;  5CP6 D;  3KWQ A;  3AZJ C;  3AV2 A;  4JJN C;  4NFT A;  2YFW A;  4Z5T A;  3REL D;  4G91 B;  3UTA C;  3AZH C;  4ZBJ C;  5CPI B;  1M1A B;  4ZUX B;  5AVB A;  4H9O A;  3A1I A;  1BH9 B;  1ID3 C;  3W99 B;  4J8U A;  1P3P B;  1HQ3 C;  5B0Y A;  5CPJ D;  1M1A D;  4H9N A;  3R45 A;  3MGQ A;  5BNX A;  3AZK B;  3EPH A;  1P3A B;  3WKJ D;  5B0Z D;  1EQZ C;  3AV1 D;  1ZLA D;  1H3O B;  5JRG B;  4H9P A;  5GXQ C;  2NQB D;  1P3I B;  1KX3 D;  3B6F B;  5AVC A;  2PYO B;  5F99 C;  2Y2J A;  3AN2 D;  3AZL B;  2L5A A;  4XZQ C;  4Z66 A;  3LEL D;  4NE3 A;  5GT3 B;  5B40 B;  2FJ7 C;  4WU9 A;  3REK C;  3LZ1 B;  1P3F B;  2DF4 C;  3KWQ B;  3AV2 B;  5B31 A;  1N1J A;  5AV5 A;  3REJ D;  2YFW B;  4Z5T B;  3X1U D;  5AV9 C;  4QLC C;  3X1S D;  3REI C;  5AVB B;  4H9O B;  3EPL A;  5GT0 A;  3AFA A;  3MVD C;  3AZF B;  3C1B C;  3AZG D;  3WA9 A;  3AV2 D;  4J8U B;  1P3O C;  5AV6 A;  3TU4 C;  1R4V A;  3AZE C;  2Y2P A;  1TAF A;  5B0Y B;  1TZY D;  4WV4 B;  3LZ0 A;  3MGR A;  4H9N B;  3R45 B;  4WU8 C;  3MGQ B;  5BNX B;  1U35 A;  3NQU A;  2HIO D;  3REH D;  5B1L D;  5B24 D;  5CPK D;  1P3K B;  1P34 C;  3W98 C;  3W96 D;  2JSS A;  5AY8 A;  5G49 A;  3AZM A;  3MGS D;  4J8V A;  2CV5 A;  4EO5 B;  4CSR A;  4KHA A;  3AYW C;  5AVC B;  5DNM C;  4G92 C;  3A1K A;  1M18 C;  4Z66 B;  2HUE C;  5B1M C;  1P3G C;  2ARO A;  5GSU C;  2RIQ A;  5AV8 D;  4DRA A;  4YS3 C;  4X23 C;  2IO5 B;  4XUJ C;  5B31 B;  1N1J B;  1HTA A;  5AV5 B;  3B0C W;  2XD5 A;  5B2I C;  5B33 D;  3WAA D;  3AZN C;  1P3L D;  4R8P D;  3A6N C;  5E5A D;  1P3M D;  5GT0 B;  4WU9 D;  5CPJ A;  2JE5 A;  3WA9 B;  1F66 D;  1F1E A;  5AV6 B;  1KX5 D;  3WKJ A;  1S32 C;  4J8W C;  4J8X A;  3AZI C;  3EPK A;  5B0Z A;  1KX4 A;  3LJA C;  1TAF B;  3AV1 A;  1M19 D;  1ZLA A;  3LZ0 B;  3MGR B;  3MNN C;  1U35 B;  2NQB A;  3AFA D;  3B6G C;  4LD9 C;  3NQU B;  3WTP A;  3X1V C;  3UTB C;  1KX3 A;  4H9Q A;  4KUD C;  5AY8 B;  5G49 B;  3AZM B;  4JJN A;  3AN2 A;  3LEL A;  4J8V B;  4KGC C;  1AOI C;  4CSR B;  3UTA A;  4KHA B;  2DQN C;  3FDD A;  4YM6 C;  3C1C D;  5CP6 B;  4AWL B;  5BO0 A;  4CAY A;  3REJ A;  3REL B;  5DNN D;  3X1U A;  3KXB C;  3X1T D;  3X1S A;  2CV5 D;  5B40 C;  1B67 A;  2CWE A;  5KDM B;  3W97 D;  3AZG A;  5B2J D;  2FFF B;  4G91 C;  2NZD D;  5CPI C;  2ARO D;  1M1A C;  4ZUX C;  1TZY A;  3VH6 A;  5CPJ B;  3W99 C;  5GXQ A;  2HIO A;  1B6W A;  3REH A;  5B1L A;  5B24 A;  3B0C T;  5CPK A;  3WKJ B;  4H9S A;  3UT9 A;  3W96 A;  5B0Z B;  1P3P C;  3AV1 B;  2BYK A;  3MGS A;  1ZLA B;  3KUY D;  2F8N D;  2NQB B;  3O62 D;  3EPJ A;  3WTP B;  3AZK C;  1KX3 B;  4H9Q B;  5B32 D;  1P3B D;  1P3A C;  3AN2 B;  3LEL B;  4J8X D;  1KX4 D;  3IP4 C;  3MGP A;  5JRG C;  5AV8 A;  5BO0 B;  2LY8 A;  4CAY B;  1P3I C;  3WTP D;  2ZY2 A;  5B33 A;  3REJ B;  3WAA A;  1P3L A;  3B6F C;  3AZJ D;  1BH8 A;  2PYO C;  4R8P A;  3X1U B;  1KU5 A;  3TU4 A;  5E5A A;  4JJN D;  3AZL C;  3X1S B;  1P3M A;  5GT3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...