4ZUXA

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
total genus 31
structure length 97
sequence length 97
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxA00
4X23A 3MVDB 5GXQB 1KX5D 5B2IC 3MVDD 3MGPC 3X1UA 3AV2D 3REJD 2AROD 2YFVA 4J8UD 5B31G 4YM6C 4WU9D 5C3IB 3AZGC 1P3OD 4WNNA 5B1LC 4XZQA 1BH9B 2F8NH 4Z5TD 2L5AA 4NE6A 5GT0D 3LELD 3UTBB 3B6FB 3REHA 4KGCB 1BH8A 4WU9B 1KX3D 2FJ7A 1P3GA 3B6FD 4J8UA 3X1UC 4Z5TB 3REJB 3X1UB 4XUJA 4AWLC 3KXBA 1P3LB 3B6FA 5B0ZC 2JSSA 4KHAA 5B40B 4XZQD 5AY8C 5B31D 3MNNA 3R45B 4WNNB 3KWQD 3NQUA 5AV5A 3AZNC 3AV2B 3B6GB 3W98B 1P3AD 5AV6A 3WTPA 2YFWA 5B24D 2IO5C 1TZYA 5G49B 5B1LB 4H9PA 5AV5D 2CV5C 1P3GD 3B6GC 1JFIA 2LY8A 4NE5A 4G91B 1M1AA 5JRGD 3C1CD 1AOIA 1TZYD 4XUJD 4YM6A 5DNMB 5AV5B 4WU8D 1M19D 1H3OA 5B32G 1P3KC 2HUEC 5DNMD 1TZYB 3VH5A 4YM6D 2PYOD 4LD9D 4WU8A 4WU9C 1P3MC 3R45A 4WZSB 3KUYC 3REKC 1P3LD 3WTPB 5AV6B 4YS3D 3LZ1A 5B32B 3C1BA 3KXBB 3KWQB 4J8WA 4J8UC 1P3BC 2BYMA 5B2JA 5AV8C 3AZMA 3B0CT 5DNMA 4ZUXD 3W98A 5BO0A 1P3KA 5AVBA 2HIOD 3LELB 4J8VA 3LELC 4NFTA 4KHAB 4ZUXA 5B40A 1WWSA 4WU8B 1P3MA 3LZ0A 4J8XD 3AZND 2CV5A 3WAAD 3AV2A 3AZKA 5CP6C 1P34C 1P3OC 1P3FD 4J8WC 5KDMA 2HIOC 5CHLB 1P3OB 3AZFC 5GT3A 5DNNB 5B31C 1EQZA 4H9NA 3X1SA 1BH9A 1P3FC 3MVDA 3MGRA 5KDMB 3WA9D 3X1UD 3REKA 2FJ7D 5AV5C 3AZNA 2CV5D 3AZKC 2NQBC 5AV8B 4Z66C 5F99A 1P3IA 4KGCD 5B2JC 2PYOA 3TU4C 5BNVA 4CSRB 4KUDB 5GT0B 3O62C 3UTBD 3W99B 3KUYB 1P3AA 1P3MB 3AZEB 3WKJB 5CPKD 5B40C 1KX3A 4H9QB 5B0ZB 4CAYA 3W97A 3MGRC 3REJC 2F8NA 4R8PC 1S32C 3X1TB 3AZHC 4Z66A 4J8XC 3WAAC 5E5AA 4LD9C 4G91C 3LJAA 1P3BA 5JA4B 4JJNC 2IO5B 3W99C 4H9OB 1M19B 3LJAD 4JJNB 1JFIB 1ZLAA 5B2JB 5B1LA 3AYWD 4Z66B 3AZLA 4ZBJC 3C1CB 1A7WA 1M1AB 3REIB 3AZGD 3AN2C 4EO5C 1H3OB 4AWLB 5B1LD 4KUDA 2F8NG 4Z5TC 3TU4A 5GXQC 5FUGB 3UTAB 3AZFD 3MGPD 3W98D 5AY8D 3REHB 5AV8A 5F99B 1P3IB 5DNNC 5B31B 3MGQA 4NE3A 5B1MC 3AZFA 5CPID 3MGPA 1P34D 5CPJD 5CP6D 5AVBC 1ZLAD 5AVCB 3X1VC 3AFAC 5FUGA 3AV1A 5CPIA 1P3PA 4WV4B 3AZGA 1KX3B 3AZJD 2NQBB 3AZKB 5B40D 3REIA 3A6ND 3TU4D 3MGSA 4H9SA 5GXQA 4J8VD 5AVCA 4JJNA 1N1JA 3W97D 5GSUC 3AZIA 3AV1B 2NZDD 4UUZB 2FJ7C 5DNNA 1EQZC 4QLCA 3REKD 3AZFB 3AZLC 3AZID 1Q9CA 2NZDA 3W96A 5AV9A 3RELB 1ID3C 3KXBC 5BNXA 3WTPE 3AFAB 4J8UB 3X1VB 1P3PD 2F8NK 1P3BD 5AVBB 3LZ1B 3LELA 4QLCD 1ID3B 3RELC 2RVQD 3A6NA 1TAFB 3MGSD 5B1MB 5GT3D 1KX4B 3LZ0C 5F99C 3AZMB 1P3IC 1M18C 1F66B 4M6BA 3AYWA 1TZYC 3AZLD 5BO0B 1P3KB 5B32A 5DNMC 3AN2B 5BS7A 3V9RA 5AV9D 3W96D 5GT3C 3MGQB 1HQ3B 5B0ZA 1KX3C 5B0YB 5CPIC 3MNND 1AOIB 3C1CA 1ZLAC 4ZUXC 4X23B 2F8NB 5B2ID 1M19A 1HTAA 5AV6C 3WTPC 3AV2C 1P34A 1TAFA 2BYKA 3WKJA 3UT9D 4LD9A 5B33D 3AZEA 3MNNB 4Z2MG 3AV1D 5B0YA 1F66A 3W97B 1HQ3D 1U35D 5AV9B 3W96B 4HGAB 1KX5A 5BT1C 4J8WD 2NZDC 4H9RB 3AZJB 2NQBD 3C1CC 4KGCC 3X1SB 1BH8B 4WU9A 2CV5B 1P3PC 1KX4D 5B1MD 3MGSB 1M19C 3O62D 3UTBC 3B0CW 4Z5TA 5CPJC 3REJA 5AVBD 3C1BD 5GT0A 4X23C 3MGSC 3AFAD 3X1VD 1N1JB 1P3PB 1U35A 3LZ0D 1KX4A 5CP6A 5B0YC 4J8XA 5AY8B 3REHD 5GT3B 3MGQC 5BS7C 3AZHB 1P3LC 4R8PB 1S32B 2NZDB 4R8PD 1S32D 1P3FB 2YFWB 3REID 3MGRB 4H9OA 3W96C 5AV9C 1ID3A 3W97C 3MNNC 3LZ0B 3X1SD 4H9NB 4JJND 3LJAB 4G92C 3AZHA 5GT0C 3O62B 4J8VB 4KUDC 4UUZA 4ZUXB 3TU4B 3AYWC 5CP6B 1AOIC 5CPIB 1HQ3C 3B0BA 5JRGA 1EQZB 5B31A 1BFMA 5GSUB 3UT9A 3MGPB 2CWEA 4YS3C 3VH6A 5AVCD 5B24A 5B2IB 5AV6D 3WTPD 3MGRD 4YS3B 5G49A 3MVDC 4XZQC 2AROC 3X1TA 3AZHD 5B33C 1AOID 1M18A 1M1AD 1KX4C 1U35C 5CPKA 3AN2D 1R4VA 3LZ1C 5B32C 3C1BC 2F8ND 5AVCC 3C1BB 3B0DB 5B1MA 4XUJB 4G92B 4H9RA 2BYKB 5JRGC 3LJAC 3AZMD 1P3GB 4H9QA 4WU8C 4CAYB 5BNVB 3AV1C 3UTAC 1P3KD 3LZ1D 1F66D 1KU5A 3V9RB 3VH6W 1B67A 3AN2A 5CPKC 5B0ZD 5E5AC 3WAAA 4QLCB 3NQUB 1ID3D 3B6GA 1P3BB 3UT9B 3KWQC 5BNXB 2RVQC 3AZIB 3REKB 3AZNB 5GSUD 3WKJD 5AY8A 3X1SC 1EQZD 1P3MD 3AZKD 4Z2MH 5B0YD 3VH6T 3AZJC 3KUYD 4E45A 3AFAA 3X1VA 3A6NC 3VH5W 2HUEB 5CPJA 3KSYA 1P3OA 3A6NB 4DRBA 4EO5B 3KUYA 3REIC 5AV8D 1M1AC 3WKJC 4ZBJB 1B6WA 3AZEC 5F99D 4E44A 1P3ID 3O62A 5GSUA 3AZIC 1KX5C 5CPJB 5GXQD 1KX5B 3UTAA 3WA9A 3W98C 3UT9C 2BYMB 4QLCC 3RELD 5C3IC 3AZGB 5DNND 3AZJA 4LD9B 4KGCA 3WAAB 4YM6B 4J8XB 3UTAD 2AROA 3X1TC 3RELA 1F1EA 4R8PA 3UTBA 1S32A 4H9SC 3NQJA 4HGAC 4Z66D 3AZMC 1M18B 1ULYA 1P3AC 3B6FC 3X1TD 5B24C 4YS3A 2HIOB 3WA9C 4J8WB 5B32D 3B6GD 5BT1D 1ZLAB 4H9PB 1P34B 1U35B 5E5AB 3VH5T 5CPKB 5E5AD 5B33B 3KXBD 1WWIA 2PYOB 2HIOA 3NQJB 4DRAA 2PYOC 5B2IA 4X23D 3W99A 3KWQA 1F66C 1P3LA 1P3GC 3AZED 1M18D 1HQ3A 3MGQD 5JA4A 5JRGB 3W99D 3AYWB 4XUJC 4KUDD 5B2JD 3B0DC 4CSRA 1P3FA 3WA9B 4J8VC 5B24B 2YFVB 3AZLB 1P3AB 2NQBA 5B33A 2AROB 3REHC 2FJ7B 4XZQB
chains in the Genus database with same CATH superfamily
4X23A 3MVDB 5GXQB 1KX5D 2DF4C 5B2IC 3MVDD 3MGPC 3X1UA 3AV2D 3REJD 2AROD 2YFVA 4J8UD 2Y2IA 5B31G 4YM6C 4WU9D 5C3IB 3AZGC 1P3OD 4WNNA 2ZY3A 3FDDA 5B1LC 4XZQA 1BH9B 2UWXA 2F8NH 4Z5TD 2L5AA 4NE6A 5GT0D 3LELD 3UTBB 3B6FB 2XD5A 3REHA 4KGCB 1BH8A 4WU9B 1KX3D 2FJ7A 1P3GA 3B6FD 4J8UA 3X1UC 4Z5TB 3REJB 1Z2CB 3X1UB 4XUJA 4AWLC 3KXBA 1P3LB 3B6FA 5B0ZC 2JSSA 4KHAA 4WJ3C 5B40B 4XZQD 5AY8C 5B31D 3MNNA 3EPHA 3R45B 2Y2LA 4WNNB 3KWQD 3NQUA 5AV5A 3AZNC 3AV2B 3B6GB 3W98B 1P3AD 5AV6A 3WTPA 2YFWA 5B24D 2IO5C 1TZYA 5G49B 5B1LB 4H9PA 5AV5D 2CV5C 1P3GD 3B6GC 1JFIA 2LY8A 4NE5A 3A1IA 4G91B 1M1AA 5JRGD 3C1CD 1AOIA 1TZYD 4XUJD 4YM6A 5DNMB 5AV5B 4WU8D 1M19D 1H3OA 5B32G 1P3KC 2HUEC 5DNMD 1TZYB 3VH5A 4YM6D 2PYOD 4LD9D 4WU8A 4WU9C 1P3MC 3R45A 4WZSB 3KUYC 3REKC 1P3LD 3WTPB 5AV6B 4YS3D 3LZ1A 5B32B 3C1BA 3KXBB 3KWQB 4J8WA 4J8UC 2Y2QA 1P3BC 2BYMA 3H0RC 5B2JA 5AV8C 3AZMA 3B0CT 5DNMA 4ZUXD 3W98A 5BO0A 1P3KA 5AVBA 2HIOD 3LELB 4J8VA 3LELC 4NFTA 4KHAB 4ZUXA 5B40A 1WWSA 4WU8B 3EPLA 1P3MA 3LZ0A 2Y2MA 4J8XD 3AZND 2CV5A 3WAAD 3AV2A 3AZKA 5CP6C 1P34C 3EPJA 1P3OC 1P3FD 4J8WC 5KDMA 2HIOC 5CHLB 1P3OB 3AZFC 5GT3A 2G5HC 5DNNB 5B31C 1EQZA 4H9NA 3X1SA 1BH9A 1P3FC 3MVDA 3MGRA 5KDMB 3WA9D 3X1UD 3REKA 2FJ7D 5AV5C 3AZNA 2CV5D 3AZKC 3AL0C 2NQBC 5AV8B 4Z66C 5F99A 1P3IA 4KGCD 5B2JC 2F2AC 2PYOA 3TU4C 5BNVA 4CSRB 4KUDB 5GT0B 3O62C 3UTBD 3W99B 2VQRA 3KUYB 1P3AA 1P3MB 3AZEB 3WKJB 5CPKD 5B40C 1KX3A 4H9QB 5B0ZB 4CAYA 2XD1A 3W97A 3MGRC 3REJC 2F8NA 4R8PC 1S32C 3X1TB 3AZHC 4Z66A 4J8XC 3WAAC 5E5AA 3H0LC 4LD9C 4G91C 3LJAA 1P3BA 5JA4B 4JJNC 2IO5B 3W99C 4H9OB 1M19B 3LJAD 4JJNB 1JFIB 1ZLAA 5B2JB 5B1LA 3AYWD 4Z66B 3AZLA 4ZBJC 3C1CB 1A7WA 1M1AB 3REIB 3AZGD 3AN2C 4EO5C 1H3OB 4AWLB 5B1LD 4KUDA 2F8NG 4Z5TC 3TU4A 5GXQC 5FUGB 3UTAB 3AZFD 3MGPD 3W98D 5AY8D 3REHB 2J8PA 5AV8A 5F99B 1P3IB 5DNNC 5B31B 3MGQA 4NE3A 5B1MC 3AZFA 5CPID 3MGPA 1P34D 5CPJD 5CP6D 5AVBC 1ZLAD 5AVCB 3X1VC 3AFAC 5FUGA 3AV1A 5CPIA 1P3PA 3P5JB 4WV4B 3AZGA 1KX3B 3AZJD 2NQBB 3AZKB 5B40D 3REIA 2Y2PA 3A6ND 3TU4D 3MGSA 4H9SA 5GXQA 4J8VD 5AVCA 2Y2HA 4JJNA 1N1JA 3W97D 5GSUC 3AZIA 3AV1B 2NZDD 4UUZB 2FJ7C 5DNNA 1EQZC 2Y2GA 4QLCA 3REKD 3AZFB 3AZLC 3AZID 1Q9CA 2NZDA 3W96A 5AV9A 3RELB 1ID3C 3KXBC 5BNXA 3WTPE 3AFAB 4J8UB 3X1VB 1P3PD 2F8NK 2Y2KA 1P3BD 5AVBB 3LZ1B 3LELA 4QLCD 1ID3B 3RELC 2RVQD 3A6NA 1TAFB 3MGSD 5B1MB 5GT3D 1KX4B 3LZ0C 5F99C 3AZMB 1P3IC 1M18C 1F66B 4M6BA 3AYWA 1TZYC 3AZLD 5BO0B 1P3KB 5B32A 3EPKA 5DNMC 3AN2B 5BS7A 3V9RA 5AV9D 3W96D 5GT3C 3MGQB 1HQ3B 5B0ZA 1KX3C 5B0YB 5CPIC 3MNND 1AOIB 2W8SA 3C1CA 1ZLAC 4ZUXC 4X23B 2F8NB 3EG5B 5B2ID 1M19A 1HTAA 5AV6C 3WTPC 2JE5A 3AV2C 1P34A 1TAFA 2BYKA 3WKJA 3UT9D 4LD9A 5B33D 3AZEA 4Z2MG 3MNNB 3AV1D 5B0YA 1F66A 3W97B 1HQ3D 1U35D 5AV9B 3W96B 4HGAB 1KX5A 5BT1C 4J8WD 2NZDC 4H9RB 3AZJB 2NQBD 3C1CC 4KGCC 3X1SB 1BH8B 4WU9A 2CV5B 1P3PC 1KX4D 5B1MD 3MGSB 1M19C 3O62D 3UTBC 3B0CW 4Z5TA 5CPJC 3REJA 5AVBD 3C1BD 5GT0A 4X23C 3MGSC 3AFAD 3X1VD 1N1JB 4DQYB 1U35A 3LZ0D 1P3PB 5CP6A 1KX4A 5B0YC 4J8XA 5AY8B 3REHD 5GT3B 3MGQC 5BS7C 3AZHB 1P3LC 4R8PB 1S32B 2NZDB 4R8PD 1S32D 3KFUG 1P3FB 2YFWB 3REID 3MGRB 4H9OA 3W96C 5AV9C 1ID3A 3W97C 3MNNC 3LZ0B 2ZY4A 3X1SD 4H9NB 4JJND 3LJAB 4G92C 3AZHA 5GT0C 3O62B 4J8VB 4KUDC 4UUZA 4ZUXB 3TU4B 3AYWC 5CP6B 1AOIC 5CPIB 1HQ3C 3B0BA 5JRGA 1EQZB 1T3UA 5B31A 4UPKA 1BFMA 5GSUB 3UT9A 3MGPB 2CWEA 4YS3C 3VH6A 5AVCD 5B24A 5B2IB 5AV6D 3WTPD 3MGRD 4YS3B 5G49A 3MVDC 4XZQC 2AROC 3X1TA 3AZHD 5B33C 1AOID 1M18A 3A1KA 1M1AD 1KX4C 2JCHA 1U35C 5CPKA 3AN2D 1R4VA 3LZ1C 5B32C 3C1BC 2F8ND 5AVCC 3C1BB 3B0DB 5B1MA 4XUJB 4G92B 4H9RA 2BYKB 5JRGC 3LJAC 3IP4C 2ZM5A 3AZMD 1P3GB 4H9QA 4WU8C 4CAYB 5BNVB 3AV1C 3UTAC 1P3KD 3LZ1D 2Y2JA 1F66D 2G5IC 1KU5A 3V9RB 3VH6W 1B67A 3AN2A 5CPKC 5B0ZD 5E5AC 3WAAA 4QLCB 3NQUB 1ID3D 3B6GA 1P3BB 3UT9B 2Y2NA 3KWQC 5BNXB 2RVQC 3AZIB 3REKB 3AZNB 5GSUD 3WKJD 5AY8A 3X1SC 1EQZD 1P3MD 3AZKD 4Z2MH 5B0YD 3VH6T 3AZJC 3KUYD 4E45A 3AFAA 3X1VA 3A6NC 3VH5W 2HUEB 5CPJA 3KSYA 1P3OA 3A6NB 4DRBA 4EO5B 3KUYA 3REIC 5AV8D 1M1AC 3WKJC 4ZBJB 1B6WA 3AZEC 5F99D 4E44A 1P3ID 3O62A 5GSUA 3AZIC 1KX5C 5CPJB 1PZRA 5GXQD 1KX5B 2RIQA 3UTAA 3WA9A 3W98C 3UT9C 2BYMB 4QLCC 2ZY5A 5C3IC 3RELD 3AZGB 5DNND 3AZJA 4LD9B 4KGCA 3WAAB 4YM6B 4J8XB 3UTAD 2AROA 3X1TC 3RELA 1F1EA 4R8PA 3UTBA 1S32A 4H9SC 3NQJA 4HGAC 4Z66D 3AZMC 1M18B 1ULYA 2BG1A 1P3AC 3B6FC 3X1TD 5B24C 4YS3A 1W2EA 2HIOB 3WA9C 4J8WB 5B32D 3B6GD 5BT1D 1ZLAB 2ZY2A 2Y2OA 4H9PB 1P34B 1U35B 5E5AB 3VH5T 3H0MC 5E5AD 5B33B 5CPKB 3KXBD 1WWIA 2PYOB 2DQNC 2HIOA 3NQJB 4DRAA 2PYOC 5B2IA 4X23D 3W99A 3KWQA 1F66C 1P3LA 1P3GC 3AZED 3F6TA 1M18D 1HQ3A 3MGQD 5JA4A 5JRGB 3W99D 3AYWB 4XUJC 4KUDD 5B2JD 3B0DC 4CSRA 1P3FA 3WA9B 4J8VC 5B24B 2YFVB 3AZLB 1P3AB 2FFFB 2NQBA 5B33A 2AROB 3REHC 2FJ7B 4XZQB
chains in the Genus database with same CATH topology
4X23A 3MVDB 5GXQB 1KX5D 2DF4C 5B2IC 3MVDD 3MGPC 3X1UA 3AV2D 3REJD 2AROD 2YFVA 4J8UD 2Y2IA 5B31G 4YM6C 4WU9D 5C3IB 3AZGC 1P3OD 4WNNA 2ZY3A 3FDDA 5B1LC 4XZQA 1BH9B 2UWXA 2F8NH 4Z5TD 2L5AA 4NE6A 5GT0D 3LELD 3UTBB 3B6FB 2XD5A 3REHA 4KGCB 1BH8A 4WU9B 1KX3D 2FJ7A 1P3GA 3B6FD 4J8UA 3X1UC 4Z5TB 3REJB 1Z2CB 3X1UB 4XUJA 4AWLC 3KXBA 1P3LB 3B6FA 5B0ZC 2JSSA 4KHAA 4WJ3C 5B40B 4XZQD 5AY8C 5B31D 3MNNA 3EPHA 3R45B 2Y2LA 4WNNB 3KWQD 3NQUA 5AV5A 3AZNC 3AV2B 3B6GB 3W98B 1P3AD 5AV6A 3WTPA 2YFWA 5B24D 2IO5C 1TZYA 5G49B 5B1LB 4H9PA 5AV5D 2CV5C 1P3GD 3B6GC 1JFIA 2LY8A 4NE5A 3A1IA 4G91B 1M1AA 5JRGD 3C1CD 1AOIA 1TZYD 4XUJD 4YM6A 5DNMB 5AV5B 4WU8D 1M19D 1H3OA 5B32G 1P3KC 2HUEC 5DNMD 1TZYB 3VH5A 4YM6D 2PYOD 4LD9D 4WU8A 4WU9C 1P3MC 3R45A 4WZSB 3KUYC 3REKC 1P3LD 3WTPB 5AV6B 4YS3D 3LZ1A 5B32B 3C1BA 3KXBB 3KWQB 4J8WA 4J8UC 2Y2QA 1P3BC 2BYMA 3H0RC 5B2JA 5AV8C 3AZMA 3B0CT 5DNMA 4ZUXD 3W98A 5BO0A 1P3KA 5AVBA 2HIOD 3LELB 4J8VA 3LELC 4NFTA 4KHAB 4ZUXA 5B40A 1WWSA 4WU8B 3EPLA 1P3MA 3LZ0A 2Y2MA 4J8XD 3AZND 2CV5A 3WAAD 3AV2A 3AZKA 5CP6C 1P34C 3EPJA 1P3OC 1P3FD 4J8WC 5KDMA 2HIOC 5CHLB 1P3OB 3AZFC 5GT3A 2G5HC 5DNNB 5B31C 1EQZA 4H9NA 3X1SA 1BH9A 1P3FC 3MVDA 3MGRA 5KDMB 3WA9D 3X1UD 3REKA 2FJ7D 5AV5C 3AZNA 2CV5D 3AZKC 3AL0C 2NQBC 5AV8B 4Z66C 5F99A 1P3IA 4KGCD 5B2JC 2F2AC 2PYOA 3TU4C 5BNVA 4CSRB 4KUDB 5GT0B 3O62C 3UTBD 3W99B 2VQRA 3KUYB 1P3AA 1P3MB 3AZEB 3WKJB 5CPKD 5B40C 1KX3A 4H9QB 5B0ZB 4CAYA 2XD1A 3W97A 3MGRC 3REJC 2F8NA 4R8PC 1S32C 3X1TB 3AZHC 4Z66A 4J8XC 3WAAC 5E5AA 3H0LC 4LD9C 4G91C 3LJAA 1P3BA 5JA4B 4JJNC 2IO5B 3W99C 4H9OB 1M19B 3LJAD 4JJNB 1JFIB 1ZLAA 5B2JB 5B1LA 3AYWD 4Z66B 3AZLA 4ZBJC 3C1CB 1A7WA 1M1AB 3REIB 3AZGD 3AN2C 4EO5C 1H3OB 4AWLB 5B1LD 4KUDA 2F8NG 4Z5TC 3TU4A 5GXQC 5FUGB 3UTAB 3AZFD 3MGPD 3W98D 5AY8D 3REHB 2J8PA 5AV8A 5F99B 1P3IB 5DNNC 5B31B 3MGQA 4NE3A 5B1MC 3AZFA 5CPID 3MGPA 1P34D 5CPJD 5CP6D 5AVBC 1ZLAD 5AVCB 3X1VC 3AFAC 5FUGA 3AV1A 5CPIA 1P3PA 3P5JB 4WV4B 3AZGA 1KX3B 3AZJD 2NQBB 3AZKB 5B40D 3REIA 2Y2PA 3A6ND 3TU4D 3MGSA 4H9SA 5GXQA 4J8VD 5AVCA 2Y2HA 4JJNA 1N1JA 3W97D 5GSUC 3AZIA 3AV1B 2NZDD 4UUZB 2FJ7C 5DNNA 1EQZC 2Y2GA 4QLCA 3REKD 3AZFB 3AZLC 3AZID 1Q9CA 2NZDA 3W96A 5AV9A 3RELB 1ID3C 3KXBC 5BNXA 3WTPE 3AFAB 4J8UB 3X1VB 1P3PD 2F8NK 2Y2KA 1P3BD 5AVBB 3LZ1B 3LELA 4QLCD 1ID3B 3RELC 2RVQD 3A6NA 1TAFB 3MGSD 5B1MB 5GT3D 1KX4B 3LZ0C 5F99C 3AZMB 1P3IC 1M18C 1F66B 4M6BA 3AYWA 1TZYC 3AZLD 5BO0B 1P3KB 5B32A 3EPKA 5DNMC 3AN2B 5BS7A 3V9RA 5AV9D 3W96D 5GT3C 3MGQB 1HQ3B 5B0ZA 1KX3C 5B0YB 5CPIC 3MNND 1AOIB 2W8SA 3C1CA 1ZLAC 4ZUXC 4X23B 2F8NB 3EG5B 5B2ID 1M19A 1HTAA 5AV6C 3WTPC 2JE5A 3AV2C 1P34A 1TAFA 2BYKA 3WKJA 3UT9D 4LD9A 5B33D 3AZEA 4Z2MG 3MNNB 3AV1D 5B0YA 1F66A 3W97B 1HQ3D 1U35D 5AV9B 3W96B 4HGAB 1KX5A 5BT1C 4J8WD 2NZDC 4H9RB 3AZJB 2NQBD 3C1CC 4KGCC 3X1SB 1BH8B 4WU9A 2CV5B 1P3PC 1KX4D 5B1MD 3MGSB 1M19C 3O62D 3UTBC 3B0CW 4Z5TA 5CPJC 3REJA 5AVBD 3C1BD 5GT0A 4X23C 3MGSC 3AFAD 3X1VD 1N1JB 4DQYB 1U35A 3LZ0D 1P3PB 5CP6A 1KX4A 5B0YC 4J8XA 5AY8B 3REHD 5GT3B 3MGQC 5BS7C 3AZHB 1P3LC 4R8PB 1S32B 2NZDB 4R8PD 1S32D 3KFUG 1P3FB 2YFWB 3REID 3MGRB 4H9OA 3W96C 5AV9C 1ID3A 3W97C 3MNNC 3LZ0B 2ZY4A 3X1SD 4H9NB 4JJND 3LJAB 4G92C 3AZHA 5GT0C 3O62B 4J8VB 4KUDC 4UUZA 4ZUXB 3TU4B 3AYWC 5CP6B 1AOIC 5CPIB 1HQ3C 3B0BA 5JRGA 1EQZB 1T3UA 5B31A 4UPKA 1BFMA 5GSUB 3UT9A 3MGPB 2CWEA 4YS3C 3VH6A 5AVCD 5B24A 5B2IB 5AV6D 3WTPD 3MGRD 4YS3B 5G49A 3MVDC 4XZQC 2AROC 3X1TA 3AZHD 5B33C 1AOID 1M18A 3A1KA 1M1AD 1KX4C 2JCHA 1U35C 5CPKA 3AN2D 1R4VA 3LZ1C 5B32C 3C1BC 2F8ND 5AVCC 3C1BB 3B0DB 5B1MA 4XUJB 4G92B 4H9RA 2BYKB 5JRGC 3LJAC 3IP4C 2ZM5A 3AZMD 1P3GB 4H9QA 4WU8C 4CAYB 5BNVB 3AV1C 3UTAC 1P3KD 3LZ1D 2Y2JA 1F66D 2G5IC 1KU5A 3V9RB 3VH6W 1B67A 3AN2A 5CPKC 5B0ZD 5E5AC 3WAAA 4QLCB 3NQUB 1ID3D 3B6GA 1P3BB 3UT9B 2Y2NA 3KWQC 5BNXB 2RVQC 3AZIB 3REKB 3AZNB 5GSUD 3WKJD 5AY8A 3X1SC 1EQZD 1P3MD 3AZKD 4Z2MH 5B0YD 3VH6T 3AZJC 3KUYD 4E45A 3AFAA 3X1VA 3A6NC 3VH5W 2HUEB 5CPJA 3KSYA 1P3OA 3A6NB 4DRBA 4EO5B 3KUYA 3REIC 5AV8D 1M1AC 3WKJC 4ZBJB 1B6WA 3AZEC 5F99D 4E44A 1P3ID 3O62A 5GSUA 3AZIC 1KX5C 5CPJB 1PZRA 5GXQD 1KX5B 2RIQA 3UTAA 3WA9A 3W98C 3UT9C 2BYMB 4QLCC 2ZY5A 5C3IC 3RELD 3AZGB 5DNND 3AZJA 4LD9B 4KGCA 3WAAB 4YM6B 4J8XB 3UTAD 2AROA 3X1TC 3RELA 1F1EA 4R8PA 3UTBA 1S32A 4H9SC 3NQJA 4HGAC 4Z66D 3AZMC 1M18B 1ULYA 2BG1A 1P3AC 3B6FC 3X1TD 5B24C 4YS3A 1W2EA 2HIOB 3WA9C 4J8WB 5B32D 3B6GD 5BT1D 1ZLAB 2ZY2A 2Y2OA 4H9PB 1P34B 1U35B 5E5AB 3VH5T 3H0MC 5E5AD 5B33B 5CPKB 3KXBD 1WWIA 2PYOB 2DQNC 2HIOA 3NQJB 4DRAA 2PYOC 5B2IA 4X23D 3W99A 3KWQA 1F66C 1P3LA 1P3GC 3AZED 3F6TA 1M18D 1HQ3A 3MGQD 5JA4A 5JRGB 3W99D 3AYWB 4XUJC 4KUDD 5B2JD 3B0DC 4CSRA 1P3FA 3WA9B 4J8VC 5B24B 2YFVB 3AZLB 1P3AB 2FFFB 2NQBA 5B33A 2AROB 3REHC 2FJ7B 4XZQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 A;  3MVD B;  5GXQ B;  1KX5 D;  5B2I C;  3MVD D;  3MGP C;  3X1U A;  3AV2 D;  3REJ D;  2ARO D;  2YFV A;  4J8U D;  5B31 G;  4YM6 C;  4WU9 D;  5C3I B;  3AZG C;  1P3O D;  4WNN A;  5B1L C;  4XZQ A;  1BH9 B;  2F8N H;  4Z5T D;  2L5A A;  4NE6 A;  5GT0 D;  3LEL D;  3UTB B;  3B6F B;  3REH A;  4KGC B;  1BH8 A;  4WU9 B;  1KX3 D;  2FJ7 A;  1P3G A;  3B6F D;  4J8U A;  3X1U C;  4Z5T B;  3REJ B;  3X1U B;  4XUJ A;  4AWL C;  3KXB A;  1P3L B;  3B6F A;  5B0Z C;  2JSS A;  4KHA A;  5B40 B;  4XZQ D;  5AY8 C;  5B31 D;  3MNN A;  3R45 B;  4WNN B;  3KWQ D;  3NQU A;  5AV5 A;  3AZN C;  3AV2 B;  3B6G B;  3W98 B;  1P3A D;  5AV6 A;  3WTP A;  2YFW A;  5B24 D;  2IO5 C;  1TZY A;  5G49 B;  5B1L B;  4H9P A;  5AV5 D;  2CV5 C;  1P3G D;  3B6G C;  1JFI A;  2LY8 A;  4NE5 A;  4G91 B;  1M1A A;  5JRG D;  3C1C D;  1AOI A;  1TZY D;  4XUJ D;  4YM6 A;  5DNM B;  5AV5 B;  4WU8 D;  1M19 D;  1H3O A;  5B32 G;  1P3K C;  2HUE C;  5DNM D;  1TZY B;  3VH5 A;  4YM6 D;  2PYO D;  4LD9 D;  4WU8 A;  4WU9 C;  1P3M C;  3R45 A;  4WZS B;  3KUY C;  3REK C;  1P3L D;  3WTP B;  5AV6 B;  4YS3 D;  3LZ1 A;  5B32 B;  3C1B A;  3KXB B;  3KWQ B;  4J8W A;  4J8U C;  1P3B C;  2BYM A;  5B2J A;  5AV8 C;  3AZM A;  3B0C T;  5DNM A;  4ZUX D;  3W98 A;  5BO0 A;  1P3K A;  5AVB A;  2HIO D;  3LEL B;  4J8V A;  3LEL C;  4NFT A;  4KHA B;  4ZUX A;  5B40 A;  1WWS A;  4WU8 B;  1P3M A;  3LZ0 A;  4J8X D;  3AZN D;  2CV5 A;  3WAA D;  3AV2 A;  3AZK A;  5CP6 C;  1P34 C;  1P3O C;  1P3F D;  4J8W C;  5KDM A;  2HIO C;  5CHL B;  1P3O B;  3AZF C;  5GT3 A;  5DNN B;  5B31 C;  1EQZ A;  4H9N A;  3X1S A;  1BH9 A;  1P3F C;  3MVD A;  3MGR A;  5KDM B;  3WA9 D;  3X1U D;  3REK A;  2FJ7 D;  5AV5 C;  3AZN A;  2CV5 D;  3AZK C;  2NQB C;  5AV8 B;  4Z66 C;  5F99 A;  1P3I A;  4KGC D;  5B2J C;  2PYO A;  3TU4 C;  5BNV A;  4CSR B;  4KUD B;  5GT0 B;  3O62 C;  3UTB D;  3W99 B;  3KUY B;  1P3A A;  1P3M B;  3AZE B;  3WKJ B;  5CPK D;  5B40 C;  1KX3 A;  4H9Q B;  5B0Z B;  4CAY A;  3W97 A;  3MGR C;  3REJ C;  2F8N A;  4R8P C;  1S32 C;  3X1T B;  3AZH C;  4Z66 A;  4J8X C;  3WAA C;  5E5A A;  4LD9 C;  4G91 C;  3LJA A;  1P3B A;  5JA4 B;  4JJN C;  2IO5 B;  3W99 C;  4H9O B;  1M19 B;  3LJA D;  4JJN B;  1JFI B;  1ZLA A;  5B2J B;  5B1L A;  3AYW D;  4Z66 B;  3AZL A;  4ZBJ C;  3C1C B;  1A7W A;  1M1A B;  3REI B;  3AZG D;  3AN2 C;  4EO5 C;  1H3O B;  4AWL B;  5B1L D;  4KUD A;  2F8N G;  4Z5T C;  3TU4 A;  5GXQ C;  5FUG B;  3UTA B;  3AZF D;  3MGP D;  3W98 D;  5AY8 D;  3REH B;  5AV8 A;  5F99 B;  1P3I B;  5DNN C;  5B31 B;  3MGQ A;  4NE3 A;  5B1M C;  3AZF A;  5CPI D;  3MGP A;  1P34 D;  5CPJ D;  5CP6 D;  5AVB C;  1ZLA D;  5AVC B;  3X1V C;  3AFA C;  5FUG A;  3AV1 A;  5CPI A;  1P3P A;  4WV4 B;  3AZG A;  1KX3 B;  3AZJ D;  2NQB B;  3AZK B;  5B40 D;  3REI A;  3A6N D;  3TU4 D;  3MGS A;  4H9S A;  5GXQ A;  4J8V D;  5AVC A;  4JJN A;  1N1J A;  3W97 D;  5GSU C;  3AZI A;  3AV1 B;  2NZD D;  4UUZ B;  2FJ7 C;  5DNN A;  1EQZ C;  4QLC A;  3REK D;  3AZF B;  3AZL C;  3AZI D;  1Q9C A;  2NZD A;  3W96 A;  5AV9 A;  3REL B;  1ID3 C;  3KXB C;  5BNX A;  3WTP E;  3AFA B;  4J8U B;  3X1V B;  1P3P D;  2F8N K;  1P3B D;  5AVB B;  3LZ1 B;  3LEL A;  4QLC D;  1ID3 B;  3REL C;  2RVQ D;  3A6N A;  1TAF B;  3MGS D;  5B1M B;  5GT3 D;  1KX4 B;  3LZ0 C;  5F99 C;  3AZM B;  1P3I C;  1M18 C;  1F66 B;  4M6B A;  3AYW A;  1TZY C;  3AZL D;  5BO0 B;  1P3K B;  5B32 A;  5DNM C;  3AN2 B;  5BS7 A;  3V9R A;  5AV9 D;  3W96 D;  5GT3 C;  3MGQ B;  1HQ3 B;  5B0Z A;  1KX3 C;  5B0Y B;  5CPI C;  3MNN D;  1AOI B;  3C1C A;  1ZLA C;  4ZUX C;  4X23 B;  2F8N B;  5B2I D;  1M19 A;  1HTA A;  5AV6 C;  3WTP C;  3AV2 C;  1P34 A;  1TAF A;  2BYK A;  3WKJ A;  3UT9 D;  4LD9 A;  5B33 D;  3AZE A;  3MNN B;  4Z2M G;  3AV1 D;  5B0Y A;  1F66 A;  3W97 B;  1HQ3 D;  1U35 D;  5AV9 B;  3W96 B;  4HGA B;  1KX5 A;  5BT1 C;  4J8W D;  2NZD C;  4H9R B;  3AZJ B;  2NQB D;  3C1C C;  4KGC C;  3X1S B;  1BH8 B;  4WU9 A;  2CV5 B;  1P3P C;  1KX4 D;  5B1M D;  3MGS B;  1M19 C;  3O62 D;  3UTB C;  3B0C W;  4Z5T A;  5CPJ C;  3REJ A;  5AVB D;  3C1B D;  5GT0 A;  4X23 C;  3MGS C;  3AFA D;  3X1V D;  1N1J B;  1P3P B;  1U35 A;  3LZ0 D;  1KX4 A;  5CP6 A;  5B0Y C;  4J8X A;  5AY8 B;  3REH D;  5GT3 B;  3MGQ C;  5BS7 C;  3AZH B;  1P3L C;  4R8P B;  1S32 B;  2NZD B;  4R8P D;  1S32 D;  1P3F B;  2YFW B;  3REI D;  3MGR B;  4H9O A;  3W96 C;  5AV9 C;  1ID3 A;  3W97 C;  3MNN C;  3LZ0 B;  3X1S D;  4H9N B;  4JJN D;  3LJA B;  4G92 C;  3AZH A;  5GT0 C;  3O62 B;  4J8V B;  4KUD C;  4UUZ A;  4ZUX B;  3TU4 B;  3AYW C;  5CP6 B;  1AOI C;  5CPI B;  1HQ3 C;  3B0B A;  5JRG A;  1EQZ B;  5B31 A;  1BFM A;  5GSU B;  3UT9 A;  3MGP B;  2CWE A;  4YS3 C;  3VH6 A;  5AVC D;  5B24 A;  5B2I B;  5AV6 D;  3WTP D;  3MGR D;  4YS3 B;  5G49 A;  3MVD C;  4XZQ C;  2ARO C;  3X1T A;  3AZH D;  5B33 C;  1AOI D;  1M18 A;  1M1A D;  1KX4 C;  1U35 C;  5CPK A;  3AN2 D;  1R4V A;  3LZ1 C;  5B32 C;  3C1B C;  2F8N D;  5AVC C;  3C1B B;  3B0D B;  5B1M A;  4XUJ B;  4G92 B;  4H9R A;  2BYK B;  5JRG C;  3LJA C;  3AZM D;  1P3G B;  4H9Q A;  4WU8 C;  4CAY B;  5BNV B;  3AV1 C;  3UTA C;  1P3K D;  3LZ1 D;  1F66 D;  1KU5 A;  3V9R B;  3VH6 W;  1B67 A;  3AN2 A;  5CPK C;  5B0Z D;  5E5A C;  3WAA A;  4QLC B;  3NQU B;  1ID3 D;  3B6G A;  1P3B B;  3UT9 B;  3KWQ C;  5BNX B;  2RVQ C;  3AZI B;  3REK B;  3AZN B;  5GSU D;  3WKJ D;  5AY8 A;  3X1S C;  1EQZ D;  1P3M D;  3AZK D;  4Z2M H;  5B0Y D;  3VH6 T;  3AZJ C;  3KUY D;  4E45 A;  3AFA A;  3X1V A;  3A6N C;  3VH5 W;  2HUE B;  5CPJ A;  3KSY A;  1P3O A;  3A6N B;  4DRB A;  4EO5 B;  3KUY A;  3REI C;  5AV8 D;  1M1A C;  3WKJ C;  4ZBJ B;  1B6W A;  3AZE C;  5F99 D;  4E44 A;  1P3I D;  3O62 A;  5GSU A;  3AZI C;  1KX5 C;  5CPJ B;  5GXQ D;  1KX5 B;  3UTA A;  3WA9 A;  3W98 C;  3UT9 C;  2BYM B;  4QLC C;  3REL D;  5C3I C;  3AZG B;  5DNN D;  3AZJ A;  4LD9 B;  4KGC A;  3WAA B;  4YM6 B;  4J8X B;  3UTA D;  2ARO A;  3X1T C;  3REL A;  1F1E A;  4R8P A;  3UTB A;  1S32 A;  4H9S C;  3NQJ A;  4HGA C;  4Z66 D;  3AZM C;  1M18 B;  1ULY A;  1P3A C;  3B6F C;  3X1T D;  5B24 C;  4YS3 A;  2HIO B;  3WA9 C;  4J8W B;  5B32 D;  3B6G D;  5BT1 D;  1ZLA B;  4H9P B;  1P34 B;  1U35 B;  5E5A B;  3VH5 T;  5CPK B;  5E5A D;  5B33 B;  3KXB D;  1WWI A;  2PYO B;  2HIO A;  3NQJ B;  4DRA A;  2PYO C;  5B2I A;  4X23 D;  3W99 A;  3KWQ A;  1F66 C;  1P3L A;  1P3G C;  3AZE D;  1M18 D;  1HQ3 A;  3MGQ D;  5JA4 A;  5JRG B;  3W99 D;  3AYW B;  4XUJ C;  4KUD D;  5B2J D;  3B0D C;  4CSR A;  1P3F A;  3WA9 B;  4J8V C;  5B24 B;  2YFV B;  3AZL B;  1P3A B;  2NQB A;  5B33 A;  2ARO B;  3REH C;  2FJ7 B;  4XZQ B; 
#chains in the Genus database with same CATH topology
 4X23 A;  3MVD B;  5GXQ B;  1KX5 D;  2DF4 C;  5B2I C;  3MVD D;  3MGP C;  3X1U A;  3AV2 D;  3REJ D;  2ARO D;  2YFV A;  4J8U D;  2Y2I A;  5B31 G;  4YM6 C;  4WU9 D;  5C3I B;  3AZG C;  1P3O D;  4WNN A;  2ZY3 A;  3FDD A;  5B1L C;  4XZQ A;  1BH9 B;  2UWX A;  2F8N H;  4Z5T D;  2L5A A;  4NE6 A;  5GT0 D;  3LEL D;  3UTB B;  3B6F B;  2XD5 A;  3REH A;  4KGC B;  1BH8 A;  4WU9 B;  1KX3 D;  2FJ7 A;  1P3G A;  3B6F D;  4J8U A;  3X1U C;  4Z5T B;  3REJ B;  1Z2C B;  3X1U B;  4XUJ A;  4AWL C;  3KXB A;  1P3L B;  3B6F A;  5B0Z C;  2JSS A;  4KHA A;  4WJ3 C;  5B40 B;  4XZQ D;  5AY8 C;  5B31 D;  3MNN A;  3EPH A;  3R45 B;  2Y2L A;  4WNN B;  3KWQ D;  3NQU A;  5AV5 A;  3AZN C;  3AV2 B;  3B6G B;  3W98 B;  1P3A D;  5AV6 A;  3WTP A;  2YFW A;  5B24 D;  2IO5 C;  1TZY A;  5G49 B;  5B1L B;  4H9P A;  5AV5 D;  2CV5 C;  1P3G D;  3B6G C;  1JFI A;  2LY8 A;  4NE5 A;  3A1I A;  4G91 B;  1M1A A;  5JRG D;  3C1C D;  1AOI A;  1TZY D;  4XUJ D;  4YM6 A;  5DNM B;  5AV5 B;  4WU8 D;  1M19 D;  1H3O A;  5B32 G;  1P3K C;  2HUE C;  5DNM D;  1TZY B;  3VH5 A;  4YM6 D;  2PYO D;  4LD9 D;  4WU8 A;  4WU9 C;  1P3M C;  3R45 A;  4WZS B;  3KUY C;  3REK C;  1P3L D;  3WTP B;  5AV6 B;  4YS3 D;  3LZ1 A;  5B32 B;  3C1B A;  3KXB B;  3KWQ B;  4J8W A;  4J8U C;  2Y2Q A;  1P3B C;  2BYM A;  3H0R C;  5B2J A;  5AV8 C;  3AZM A;  3B0C T;  5DNM A;  4ZUX D;  3W98 A;  5BO0 A;  1P3K A;  5AVB A;  2HIO D;  3LEL B;  4J8V A;  3LEL C;  4NFT A;  4KHA B;  4ZUX A;  5B40 A;  1WWS A;  4WU8 B;  3EPL A;  1P3M A;  3LZ0 A;  2Y2M A;  4J8X D;  3AZN D;  2CV5 A;  3WAA D;  3AV2 A;  3AZK A;  5CP6 C;  1P34 C;  3EPJ A;  1P3O C;  1P3F D;  4J8W C;  5KDM A;  2HIO C;  5CHL B;  1P3O B;  3AZF C;  5GT3 A;  2G5H C;  5DNN B;  5B31 C;  1EQZ A;  4H9N A;  3X1S A;  1BH9 A;  1P3F C;  3MVD A;  3MGR A;  5KDM B;  3WA9 D;  3X1U D;  3REK A;  2FJ7 D;  5AV5 C;  3AZN A;  2CV5 D;  3AZK C;  3AL0 C;  2NQB C;  5AV8 B;  4Z66 C;  5F99 A;  1P3I A;  4KGC D;  5B2J C;  2F2A C;  2PYO A;  3TU4 C;  5BNV A;  4CSR B;  4KUD B;  5GT0 B;  3O62 C;  3UTB D;  3W99 B;  2VQR A;  3KUY B;  1P3A A;  1P3M B;  3AZE B;  3WKJ B;  5CPK D;  5B40 C;  1KX3 A;  4H9Q B;  5B0Z B;  4CAY A;  2XD1 A;  3W97 A;  3MGR C;  3REJ C;  2F8N A;  4R8P C;  1S32 C;  3X1T B;  3AZH C;  4Z66 A;  4J8X C;  3WAA C;  5E5A A;  3H0L C;  4LD9 C;  4G91 C;  3LJA A;  1P3B A;  5JA4 B;  4JJN C;  2IO5 B;  3W99 C;  4H9O B;  1M19 B;  3LJA D;  4JJN B;  1JFI B;  1ZLA A;  5B2J B;  5B1L A;  3AYW D;  4Z66 B;  3AZL A;  4ZBJ C;  3C1C B;  1A7W A;  1M1A B;  3REI B;  3AZG D;  3AN2 C;  4EO5 C;  1H3O B;  4AWL B;  5B1L D;  4KUD A;  2F8N G;  4Z5T C;  3TU4 A;  5GXQ C;  5FUG B;  3UTA B;  3AZF D;  3MGP D;  3W98 D;  5AY8 D;  3REH B;  2J8P A;  5AV8 A;  5F99 B;  1P3I B;  5DNN C;  5B31 B;  3MGQ A;  4NE3 A;  5B1M C;  3AZF A;  5CPI D;  3MGP A;  1P34 D;  5CPJ D;  5CP6 D;  5AVB C;  1ZLA D;  5AVC B;  3X1V C;  3AFA C;  5FUG A;  3AV1 A;  5CPI A;  1P3P A;  3P5J B;  4WV4 B;  3AZG A;  1KX3 B;  3AZJ D;  2NQB B;  3AZK B;  5B40 D;  3REI A;  2Y2P A;  3A6N D;  3TU4 D;  3MGS A;  4H9S A;  5GXQ A;  4J8V D;  5AVC A;  2Y2H A;  4JJN A;  1N1J A;  3W97 D;  5GSU C;  3AZI A;  3AV1 B;  2NZD D;  4UUZ B;  2FJ7 C;  5DNN A;  1EQZ C;  2Y2G A;  4QLC A;  3REK D;  3AZF B;  3AZL C;  3AZI D;  1Q9C A;  2NZD A;  3W96 A;  5AV9 A;  3REL B;  1ID3 C;  3KXB C;  5BNX A;  3WTP E;  3AFA B;  4J8U B;  3X1V B;  1P3P D;  2F8N K;  2Y2K A;  1P3B D;  5AVB B;  3LZ1 B;  3LEL A;  4QLC D;  1ID3 B;  3REL C;  2RVQ D;  3A6N A;  1TAF B;  3MGS D;  5B1M B;  5GT3 D;  1KX4 B;  3LZ0 C;  5F99 C;  3AZM B;  1P3I C;  1M18 C;  1F66 B;  4M6B A;  3AYW A;  1TZY C;  3AZL D;  5BO0 B;  1P3K B;  5B32 A;  3EPK A;  5DNM C;  3AN2 B;  5BS7 A;  3V9R A;  5AV9 D;  3W96 D;  5GT3 C;  3MGQ B;  1HQ3 B;  5B0Z A;  1KX3 C;  5B0Y B;  5CPI C;  3MNN D;  1AOI B;  2W8S A;  3C1C A;  1ZLA C;  4ZUX C;  4X23 B;  2F8N B;  3EG5 B;  5B2I D;  1M19 A;  1HTA A;  5AV6 C;  3WTP C;  2JE5 A;  3AV2 C;  1P34 A;  1TAF A;  2BYK A;  3WKJ A;  3UT9 D;  4LD9 A;  5B33 D;  3AZE A;  4Z2M G;  3MNN B;  3AV1 D;  5B0Y A;  1F66 A;  3W97 B;  1HQ3 D;  1U35 D;  5AV9 B;  3W96 B;  4HGA B;  1KX5 A;  5BT1 C;  4J8W D;  2NZD C;  4H9R B;  3AZJ B;  2NQB D;  3C1C C;  4KGC C;  3X1S B;  1BH8 B;  4WU9 A;  2CV5 B;  1P3P C;  1KX4 D;  5B1M D;  3MGS B;  1M19 C;  3O62 D;  3UTB C;  3B0C W;  4Z5T A;  5CPJ C;  3REJ A;  5AVB D;  3C1B D;  5GT0 A;  4X23 C;  3MGS C;  3AFA D;  3X1V D;  1N1J B;  4DQY B;  1U35 A;  3LZ0 D;  1P3P B;  5CP6 A;  1KX4 A;  5B0Y C;  4J8X A;  5AY8 B;  3REH D;  5GT3 B;  3MGQ C;  5BS7 C;  3AZH B;  1P3L C;  4R8P B;  1S32 B;  2NZD B;  4R8P D;  1S32 D;  3KFU G;  1P3F B;  2YFW B;  3REI D;  3MGR B;  4H9O A;  3W96 C;  5AV9 C;  1ID3 A;  3W97 C;  3MNN C;  3LZ0 B;  2ZY4 A;  3X1S D;  4H9N B;  4JJN D;  3LJA B;  4G92 C;  3AZH A;  5GT0 C;  3O62 B;  4J8V B;  4KUD C;  4UUZ A;  4ZUX B;  3TU4 B;  3AYW C;  5CP6 B;  1AOI C;  5CPI B;  1HQ3 C;  3B0B A;  5JRG A;  1EQZ B;  1T3U A;  5B31 A;  4UPK A;  1BFM A;  5GSU B;  3UT9 A;  3MGP B;  2CWE A;  4YS3 C;  3VH6 A;  5AVC D;  5B24 A;  5B2I B;  5AV6 D;  3WTP D;  3MGR D;  4YS3 B;  5G49 A;  3MVD C;  4XZQ C;  2ARO C;  3X1T A;  3AZH D;  5B33 C;  1AOI D;  1M18 A;  3A1K A;  1M1A D;  1KX4 C;  2JCH A;  1U35 C;  5CPK A;  3AN2 D;  1R4V A;  3LZ1 C;  5B32 C;  3C1B C;  2F8N D;  5AVC C;  3C1B B;  3B0D B;  5B1M A;  4XUJ B;  4G92 B;  4H9R A;  2BYK B;  5JRG C;  3LJA C;  3IP4 C;  2ZM5 A;  3AZM D;  1P3G B;  4H9Q A;  4WU8 C;  4CAY B;  5BNV B;  3AV1 C;  3UTA C;  1P3K D;  3LZ1 D;  2Y2J A;  1F66 D;  2G5I C;  1KU5 A;  3V9R B;  3VH6 W;  1B67 A;  3AN2 A;  5CPK C;  5B0Z D;  5E5A C;  3WAA A;  4QLC B;  3NQU B;  1ID3 D;  3B6G A;  1P3B B;  3UT9 B;  2Y2N A;  3KWQ C;  5BNX B;  2RVQ C;  3AZI B;  3REK B;  3AZN B;  5GSU D;  3WKJ D;  5AY8 A;  3X1S C;  1EQZ D;  1P3M D;  3AZK D;  4Z2M H;  5B0Y D;  3VH6 T;  3AZJ C;  3KUY D;  4E45 A;  3AFA A;  3X1V A;  3A6N C;  3VH5 W;  2HUE B;  5CPJ A;  3KSY A;  1P3O A;  3A6N B;  4DRB A;  4EO5 B;  3KUY A;  3REI C;  5AV8 D;  1M1A C;  3WKJ C;  4ZBJ B;  1B6W A;  3AZE C;  5F99 D;  4E44 A;  1P3I D;  3O62 A;  5GSU A;  3AZI C;  1KX5 C;  5CPJ B;  1PZR A;  5GXQ D;  1KX5 B;  2RIQ A;  3UTA A;  3WA9 A;  3W98 C;  3UT9 C;  2BYM B;  4QLC C;  2ZY5 A;  5C3I C;  3REL D;  3AZG B;  5DNN D;  3AZJ A;  4LD9 B;  4KGC A;  3WAA B;  4YM6 B;  4J8X B;  3UTA D;  2ARO A;  3X1T C;  3REL A;  1F1E A;  4R8P A;  3UTB A;  1S32 A;  4H9S C;  3NQJ A;  4HGA C;  4Z66 D;  3AZM C;  1M18 B;  1ULY A;  2BG1 A;  1P3A C;  3B6F C;  3X1T D;  5B24 C;  4YS3 A;  1W2E A;  2HIO B;  3WA9 C;  4J8W B;  5B32 D;  3B6G D;  5BT1 D;  1ZLA B;  2ZY2 A;  2Y2O A;  4H9P B;  1P34 B;  1U35 B;  5E5A B;  3VH5 T;  3H0M C;  5E5A D;  5B33 B;  5CPK B;  3KXB D;  1WWI A;  2PYO B;  2DQN C;  2HIO A;  3NQJ B;  4DRA A;  2PYO C;  5B2I A;  4X23 D;  3W99 A;  3KWQ A;  1F66 C;  1P3L A;  1P3G C;  3AZE D;  3F6T A;  1M18 D;  1HQ3 A;  3MGQ D;  5JA4 A;  5JRG B;  3W99 D;  3AYW B;  4XUJ C;  4KUD D;  5B2J D;  3B0D C;  4CSR A;  1P3F A;  3WA9 B;  4J8V C;  5B24 B;  2YFV B;  3AZL B;  1P3A B;  2FFF B;  2NQB A;  5B33 A;  2ARO B;  3REH C;  2FJ7 B;  4XZQ B; 
#chains in the Genus database with same CATH homology
 4X23 A;  3MVD B;  5GXQ B;  1KX5 D;  2DF4 C;  5B2I C;  3MVD D;  3MGP C;  3X1U A;  3AV2 D;  3REJ D;  2ARO D;  2YFV A;  4J8U D;  2Y2I A;  5B31 G;  4YM6 C;  4WU9 D;  5C3I B;  3AZG C;  1P3O D;  4WNN A;  2ZY3 A;  3FDD A;  5B1L C;  4XZQ A;  1BH9 B;  2UWX A;  2F8N H;  4Z5T D;  2L5A A;  4NE6 A;  5GT0 D;  3LEL D;  3UTB B;  3B6F B;  2XD5 A;  3REH A;  4KGC B;  1BH8 A;  4WU9 B;  1KX3 D;  2FJ7 A;  1P3G A;  3B6F D;  4J8U A;  3X1U C;  4Z5T B;  3REJ B;  1Z2C B;  3X1U B;  4XUJ A;  4AWL C;  3KXB A;  1P3L B;  3B6F A;  5B0Z C;  2JSS A;  4KHA A;  4WJ3 C;  5B40 B;  4XZQ D;  5AY8 C;  5B31 D;  3MNN A;  3EPH A;  3R45 B;  2Y2L A;  4WNN B;  3KWQ D;  3NQU A;  5AV5 A;  3AZN C;  3AV2 B;  3B6G B;  3W98 B;  1P3A D;  5AV6 A;  3WTP A;  2YFW A;  5B24 D;  2IO5 C;  1TZY A;  5G49 B;  5B1L B;  4H9P A;  5AV5 D;  2CV5 C;  1P3G D;  3B6G C;  1JFI A;  2LY8 A;  4NE5 A;  3A1I A;  4G91 B;  1M1A A;  5JRG D;  3C1C D;  1AOI A;  1TZY D;  4XUJ D;  4YM6 A;  5DNM B;  5AV5 B;  4WU8 D;  1M19 D;  1H3O A;  5B32 G;  1P3K C;  2HUE C;  5DNM D;  1TZY B;  3VH5 A;  4YM6 D;  2PYO D;  4LD9 D;  4WU8 A;  4WU9 C;  1P3M C;  3R45 A;  4WZS B;  3KUY C;  3REK C;  1P3L D;  3WTP B;  5AV6 B;  4YS3 D;  3LZ1 A;  5B32 B;  3C1B A;  3KXB B;  3KWQ B;  4J8W A;  4J8U C;  2Y2Q A;  1P3B C;  2BYM A;  3H0R C;  5B2J A;  5AV8 C;  3AZM A;  3B0C T;  5DNM A;  4ZUX D;  3W98 A;  5BO0 A;  1P3K A;  5AVB A;  2HIO D;  3LEL B;  4J8V A;  3LEL C;  4NFT A;  4KHA B;  4ZUX A;  5B40 A;  1WWS A;  4WU8 B;  3EPL A;  1P3M A;  3LZ0 A;  2Y2M A;  4J8X D;  3AZN D;  2CV5 A;  3WAA D;  3AV2 A;  3AZK A;  5CP6 C;  1P34 C;  3EPJ A;  1P3O C;  1P3F D;  4J8W C;  5KDM A;  2HIO C;  5CHL B;  1P3O B;  3AZF C;  5GT3 A;  2G5H C;  5DNN B;  5B31 C;  1EQZ A;  4H9N A;  3X1S A;  1BH9 A;  1P3F C;  3MVD A;  3MGR A;  5KDM B;  3WA9 D;  3X1U D;  3REK A;  2FJ7 D;  5AV5 C;  3AZN A;  2CV5 D;  3AZK C;  3AL0 C;  2NQB C;  5AV8 B;  4Z66 C;  5F99 A;  1P3I A;  4KGC D;  5B2J C;  2F2A C;  2PYO A;  3TU4 C;  5BNV A;  4CSR B;  4KUD B;  5GT0 B;  3O62 C;  3UTB D;  3W99 B;  2VQR A;  3KUY B;  1P3A A;  1P3M B;  3AZE B;  3WKJ B;  5CPK D;  5B40 C;  1KX3 A;  4H9Q B;  5B0Z B;  4CAY A;  2XD1 A;  3W97 A;  3MGR C;  3REJ C;  2F8N A;  4R8P C;  1S32 C;  3X1T B;  3AZH C;  4Z66 A;  4J8X C;  3WAA C;  5E5A A;  3H0L C;  4LD9 C;  4G91 C;  3LJA A;  1P3B A;  5JA4 B;  4JJN C;  2IO5 B;  3W99 C;  4H9O B;  1M19 B;  3LJA D;  4JJN B;  1JFI B;  1ZLA A;  5B2J B;  5B1L A;  3AYW D;  4Z66 B;  3AZL A;  4ZBJ C;  3C1C B;  1A7W A;  1M1A B;  3REI B;  3AZG D;  3AN2 C;  4EO5 C;  1H3O B;  4AWL B;  5B1L D;  4KUD A;  2F8N G;  4Z5T C;  3TU4 A;  5GXQ C;  5FUG B;  3UTA B;  3AZF D;  3MGP D;  3W98 D;  5AY8 D;  3REH B;  2J8P A;  5AV8 A;  5F99 B;  1P3I B;  5DNN C;  5B31 B;  3MGQ A;  4NE3 A;  5B1M C;  3AZF A;  5CPI D;  3MGP A;  1P34 D;  5CPJ D;  5CP6 D;  5AVB C;  1ZLA D;  5AVC B;  3X1V C;  3AFA C;  5FUG A;  3AV1 A;  5CPI A;  1P3P A;  3P5J B;  4WV4 B;  3AZG A;  1KX3 B;  3AZJ D;  2NQB B;  3AZK B;  5B40 D;  3REI A;  2Y2P A;  3A6N D;  3TU4 D;  3MGS A;  4H9S A;  5GXQ A;  4J8V D;  5AVC A;  2Y2H A;  4JJN A;  1N1J A;  3W97 D;  5GSU C;  3AZI A;  3AV1 B;  2NZD D;  4UUZ B;  2FJ7 C;  5DNN A;  1EQZ C;  2Y2G A;  4QLC A;  3REK D;  3AZF B;  3AZL C;  3AZI D;  1Q9C A;  2NZD A;  3W96 A;  5AV9 A;  3REL B;  1ID3 C;  3KXB C;  5BNX A;  3WTP E;  3AFA B;  4J8U B;  3X1V B;  1P3P D;  2F8N K;  2Y2K A;  1P3B D;  5AVB B;  3LZ1 B;  3LEL A;  4QLC D;  1ID3 B;  3REL C;  2RVQ D;  3A6N A;  1TAF B;  3MGS D;  5B1M B;  5GT3 D;  1KX4 B;  3LZ0 C;  5F99 C;  3AZM B;  1P3I C;  1M18 C;  1F66 B;  4M6B A;  3AYW A;  1TZY C;  3AZL D;  5BO0 B;  1P3K B;  5B32 A;  3EPK A;  5DNM C;  3AN2 B;  5BS7 A;  3V9R A;  5AV9 D;  3W96 D;  5GT3 C;  3MGQ B;  1HQ3 B;  5B0Z A;  1KX3 C;  5B0Y B;  5CPI C;  3MNN D;  1AOI B;  2W8S A;  3C1C A;  1ZLA C;  4ZUX C;  4X23 B;  2F8N B;  3EG5 B;  5B2I D;  1M19 A;  1HTA A;  5AV6 C;  3WTP C;  2JE5 A;  3AV2 C;  1P34 A;  1TAF A;  2BYK A;  3WKJ A;  3UT9 D;  4LD9 A;  5B33 D;  3AZE A;  4Z2M G;  3MNN B;  3AV1 D;  5B0Y A;  1F66 A;  3W97 B;  1HQ3 D;  1U35 D;  5AV9 B;  3W96 B;  4HGA B;  1KX5 A;  5BT1 C;  4J8W D;  2NZD C;  4H9R B;  3AZJ B;  2NQB D;  3C1C C;  4KGC C;  3X1S B;  1BH8 B;  4WU9 A;  2CV5 B;  1P3P C;  1KX4 D;  5B1M D;  3MGS B;  1M19 C;  3O62 D;  3UTB C;  3B0C W;  4Z5T A;  5CPJ C;  3REJ A;  5AVB D;  3C1B D;  5GT0 A;  4X23 C;  3MGS C;  3AFA D;  3X1V D;  1N1J B;  4DQY B;  1U35 A;  3LZ0 D;  1P3P B;  5CP6 A;  1KX4 A;  5B0Y C;  4J8X A;  5AY8 B;  3REH D;  5GT3 B;  3MGQ C;  5BS7 C;  3AZH B;  1P3L C;  4R8P B;  1S32 B;  2NZD B;  4R8P D;  1S32 D;  3KFU G;  1P3F B;  2YFW B;  3REI D;  3MGR B;  4H9O A;  3W96 C;  5AV9 C;  1ID3 A;  3W97 C;  3MNN C;  3LZ0 B;  2ZY4 A;  3X1S D;  4H9N B;  4JJN D;  3LJA B;  4G92 C;  3AZH A;  5GT0 C;  3O62 B;  4J8V B;  4KUD C;  4UUZ A;  4ZUX B;  3TU4 B;  3AYW C;  5CP6 B;  1AOI C;  5CPI B;  1HQ3 C;  3B0B A;  5JRG A;  1EQZ B;  1T3U A;  5B31 A;  4UPK A;  1BFM A;  5GSU B;  3UT9 A;  3MGP B;  2CWE A;  4YS3 C;  3VH6 A;  5AVC D;  5B24 A;  5B2I B;  5AV6 D;  3WTP D;  3MGR D;  4YS3 B;  5G49 A;  3MVD C;  4XZQ C;  2ARO C;  3X1T A;  3AZH D;  5B33 C;  1AOI D;  1M18 A;  3A1K A;  1M1A D;  1KX4 C;  2JCH A;  1U35 C;  5CPK A;  3AN2 D;  1R4V A;  3LZ1 C;  5B32 C;  3C1B C;  2F8N D;  5AVC C;  3C1B B;  3B0D B;  5B1M A;  4XUJ B;  4G92 B;  4H9R A;  2BYK B;  5JRG C;  3LJA C;  3IP4 C;  2ZM5 A;  3AZM D;  1P3G B;  4H9Q A;  4WU8 C;  4CAY B;  5BNV B;  3AV1 C;  3UTA C;  1P3K D;  3LZ1 D;  2Y2J A;  1F66 D;  2G5I C;  1KU5 A;  3V9R B;  3VH6 W;  1B67 A;  3AN2 A;  5CPK C;  5B0Z D;  5E5A C;  3WAA A;  4QLC B;  3NQU B;  1ID3 D;  3B6G A;  1P3B B;  3UT9 B;  2Y2N A;  3KWQ C;  5BNX B;  2RVQ C;  3AZI B;  3REK B;  3AZN B;  5GSU D;  3WKJ D;  5AY8 A;  3X1S C;  1EQZ D;  1P3M D;  3AZK D;  4Z2M H;  5B0Y D;  3VH6 T;  3AZJ C;  3KUY D;  4E45 A;  3AFA A;  3X1V A;  3A6N C;  3VH5 W;  2HUE B;  5CPJ A;  3KSY A;  1P3O A;  3A6N B;  4DRB A;  4EO5 B;  3KUY A;  3REI C;  5AV8 D;  1M1A C;  3WKJ C;  4ZBJ B;  1B6W A;  3AZE C;  5F99 D;  4E44 A;  1P3I D;  3O62 A;  5GSU A;  3AZI C;  1KX5 C;  5CPJ B;  1PZR A;  5GXQ D;  1KX5 B;  2RIQ A;  3UTA A;  3WA9 A;  3W98 C;  3UT9 C;  2BYM B;  4QLC C;  2ZY5 A;  5C3I C;  3REL D;  3AZG B;  5DNN D;  3AZJ A;  4LD9 B;  4KGC A;  3WAA B;  4YM6 B;  4J8X B;  3UTA D;  2ARO A;  3X1T C;  3REL A;  1F1E A;  4R8P A;  3UTB A;  1S32 A;  4H9S C;  3NQJ A;  4HGA C;  4Z66 D;  3AZM C;  1M18 B;  1ULY A;  2BG1 A;  1P3A C;  3B6F C;  3X1T D;  5B24 C;  4YS3 A;  1W2E A;  2HIO B;  3WA9 C;  4J8W B;  5B32 D;  3B6G D;  5BT1 D;  1ZLA B;  2ZY2 A;  2Y2O A;  4H9P B;  1P34 B;  1U35 B;  5E5A B;  3VH5 T;  3H0M C;  5E5A D;  5B33 B;  5CPK B;  3KXB D;  1WWI A;  2PYO B;  2DQN C;  2HIO A;  3NQJ B;  4DRA A;  2PYO C;  5B2I A;  4X23 D;  3W99 A;  3KWQ A;  1F66 C;  1P3L A;  1P3G C;  3AZE D;  3F6T A;  1M18 D;  1HQ3 A;  3MGQ D;  5JA4 A;  5JRG B;  3W99 D;  3AYW B;  4XUJ C;  4KUD D;  5B2J D;  3B0D C;  4CSR A;  1P3F A;  3WA9 B;  4J8V C;  5B24 B;  2YFV B;  3AZL B;  1P3A B;  2FFF B;  2NQB A;  5B33 A;  2ARO B;  3REH C;  2FJ7 B;  4XZQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...