3REHC

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehC00
4Z66D 5B24D 3AZGD 4EO5B 1AOIC 2CV5A 3LZ0D 5BO0B 5KDMA 4G92C 3TU4B 1M19D 1P3PC 3AZIB 3O62D 3VH6A 3LELA 5B33C 2AROB 5G49A 3MVDD 3UTAB 3WKJB 1P3AA 3X1SB 5E5AA 3KWQB 3AZHA 1KX3A 4R8PA 3REIB 3AV2B 5CP6B 4CSRA 3X1VA 1P3LC 5C3IB 1F66B 3TU4D 3AV1C 2PYOA 2L5AA 3VH5A 3AZID 4XZQC 4H9QA 4J8XC 2IO5C 3C1CB 2AROD 3AZMA 3AZLA 5AV8B 5B1LA 4ZUXC 3UTAD 3WKJD 3WA9B 3KXBC 3KWQD 3W99A 1P34A 3REID 3UT9B 5AV5B 3W97B 3AV2D 5BS7C 5JA4A 5B40B 1KX4B 4YS3C 1F66D 3LZ1B 1BFMA 1P3MB 3UTBC 5GSUB 1P3GB 5B24A 5B2JB 4WU8A 3AYWB 4LD9B 3C1CD 4CAYB 5AV8D 3AZEA 2FJ7C 5F99B 3AZJB 4Z5TC 3WA9D 2F8NB 3UT9D 5AV5D 4WU9C 3W97D 1P3OB 5B0ZC 5B40D 1KX4D 1TZYB 3MGQC 3LZ1D 1P3MD 5GSUD 3WAAB 1P3GD 3WTPC 5BNXA 5B2JD 3AYWD 1P3IB 4LD9D 1EQZB 1KU5A 3A6NC 4X23A 2CV5B 3MNNB 5F99D 3B0DC 3AZJD 5KDMB 4UUZB 3WTPE 1KX5C 2F8ND 4WNNB 2BYKA 3AZIA 1S32B 3MGSB 5CPKC 4J8VC 1HTAA 3LELB 1P3OD 2NQBB 3AZFA 1TZYD 3B6FA 3UTAA 3WKJA 4H9NA 5DNNA 3WAAD 1HQ3B 3X1SA 3B6GC 3AZHB 1P3ID 3REIA 3AV2A 1EQZD 4J8UB 1P3AC 2CV5D 5CP6A 3MNND 1KX3C 4R8PC 4CSRB 5B32A 5AVCA 2HUEB 3X1UA 3MGSD 4H9QB 4ZBJC 3C1CA 2NQBD 3LELD 1B6WA 3AZMB 2PYOC 5BNVB 5AV8A 5AV9A 5AY8C 3AZLB 5B1LB 3B0CW 3WA9A 1HQ3D 4G91C 5E5AD 3LJAA 3AZHD 1M18C 3UT9A 3W99B 3REJC 3RELC 1KX4A 5JA4B 1P34C 3AZNC 5B31B 1P3GA 3W96A 3AYWA 1WWIA 4WU8B 4CAYA 4Z66C 3AZMD 5B24C 3AZLD 3AZGC 5F99A 3AZEB 5B1LD 3AZJA 3AFAB 3LZ0C 3W99D 3KSYA 1M19C 3O62C 5B31D 3REHB 3WAAA 4J8WA 5BNXB 5B2IB 4H9SA 3VH6T 3MVDC 4WU8D 5CPIB 1U35B 1P3IA 1EQZA 5GXQB 3MNNA 4X23B 3AZED 4EO5C 3KUYB 4UUZA 3AFAD 5GT3B 4JJNC 4WNNA 2BYKB 3NQJB 1S32A 3MGSA 3TU4C 2NQBA 3AZIC 3AZFB 3B6FB 3REHD 4H9NB 2AROC 3VH5T 1HQ3A 5DNNB 5BT1D 5CPID 3WKJC 1U35D 4J8UA 1AOIB 1P3BA 2CWEA 3KWQC 4X23D 5CPJA 3REIC 3AV2C 1ZLAB 4NE5A 5AVCB 5B32B 4G92B 5GT3D 1P3FA 2F8NH 4NE6A 1F66C 3X1UB 3X1TB 5BNVA 4M6BA 5AV9B 3AZFD 5DNMB 3B6FD 4XUJA 5AVBB 5DNND 3X1SD 5AV8C 2F8NG 3LJAB 5GT0B 4KGCA 2NZDA 1AOID 3WA9C 4QLCB 5CP6D 5AV5C 3AZKB 3W97C 5B31A 1ZLAD 5B32D 5AVCD 2BYMA 5B40C 3AV1B 3REKA 3W96B 3X1UD 3LZ1C 1P3MC 3X1TD 5GSUC 1P3GC 5B2JC 5AV9D 3AYWC 4LD9C 5DNMD 5AV6A 3AFAA 5AVBD 3MGRB 2YFVB 5F99C 3LJAD 5GT0D 3C1BA 4QLCD 4H9OA 1TAFB 4AWLB 3AZKD 3REHA 4NFTA 1P3OC 4WZSB 3AV1D 4J8WB 1M1AB 3W96D 1TZYC 5B2IA 5CPIA 1U35A 3WAAC 5GXQA 5B0YB 1EQZC 3KUYA 2CV5C 5GT3A 3MGRD 3MNNC 4KUDA 5JRGB 3NQJA 2JSSA 4WU9B 3R45A 2NQBC 3LELC 4J8WD 1M1AD 3AN2B 1AOIA 1HQ3C 3A6NB 3MGPB 1P3BB 5E5AC 3AZHC 5B0YD 5CPJB 1ZLAA 3NQUB 5B31G 5JRGD 1P3PA 2HIOB 1P3FB 3X1VC 1S32D 3X1TA 5CPKB 2HUEC 5DNMA 4XUJB 5AVBA 3AZMC 3AZLC 3AN2D 5B1LC 5GT0A 1H3OB 4J8UD 4QLCA 3A6ND 3MGPD 1P3BD 4KGCB 2NZDB 3W99C 5FUGA 2YFWA 3AZKA 5CPJD 1P3LA 1ID3B 3AV1A 2BYMB 2HIOD 1P3FD 3REKB 4XZQA 4J8XA 4ZBJB 4ZUXA 5AY8B 4WU8C 1BH8A 5AV6B 4XUJD 3MGRA 1F1EA 3KXBA 2YFVA 3AZEC 3REJB 1B67A 3C1BB 5BS7A 3AFAC 4KGCD 2NZDD 4YS3A 1TAFA 3AZNB 4H9OB 1ID3D 3UTBA 1M1AA 3REKD 3REHC 4YM6B 5BT1C 2FJ7A 5CPIC 5B0YA 1U35C 5AV6D 3W98B 1Q9CA 1BH9A 4HGAB 5B1MB 4Z5TA 5B32G 5JRGA 4X23C 4KUDB 1R4VA 1P3KB 3REJD 4WU9A 3C1BD 5CHLB 4H9RB 5GT3C 3R45B 3WTPA 3AN2A 3AZFC 5B2ID 3B6FC 3UTAC 4YM6D 5DNNC 3A6NA 3MGPA 3X1SC 5GXQD 4H9PA 1ULYA 3W98D 3NQUA 4Z2MH 5B1MD 3KUYD 1KX5A 4JJNB 2HIOA 5CP6C 1P3KD 1P3PB 4KUDD 4NE3A 5C3IC 1ZLAC 2RVQD 5B32C 5AVCC 4J8VA 5CPKA 5B33B 3X1UC 3X1TC 4Z2MG 4DRAA 3C1CC 3B6GA 5AV9C 5DNMC 1H3OA 5AVBC 1A7WA 3LJAC 5GT0C 5FUGB 2YFWB 3UT9C 1ID3A 1P3LB 4QLCC 4KHAB 4JJND 1P3PD 1KX4C 3AZKC 4XZQB 4J8XB 2IO5B 5B33D 3W96C 2F8NK 5AY8A 4ZUXB 4E44A 1BH8B 3VH6W 4WV4B 1M18A 3KXBB 3REJA 3AZJC 3RELA 3MGRC 3AZNA 4YS3B 1P3LD 4DRBA 3UTBB 4AWLC 4XZQD 4J8XD 4YM6A 4Z66A 4J8WC 1M1AC 3VH5W 3AZGA 3B0CT 4ZUXD 4H9SC 1P3IC 2FJ7B 3W98A 5B1MA 3LZ0A 4Z5TB 1BH9B 3KXBD 1P3KA 5B0YC 3V9RA 4H9RA 1M19A 5JRGC 5B0ZB 3O62A 4YS3D 3MGQB 1S32C 3MGSC 1JFIA 3UTBD 3WTPB 3MVDA 1N1JB 1WWSA 3AN2C 4H9PB 2FJ7D 3B0DB 4E45A 4J8UC 3MGPC 4Z5TD 1P3BC 4JJNA 1KX5B 5BO0A 5CPJC 4WU9D 3TU4A 5B33A 4J8VB 2HIOC 5B0ZD 1P3FC 3MGQD 2AROA 3B6GB 3WTPD 5G49B 4XUJC 1P3AB 3KWQA 5E5AB 1KX3B 4R8PB 4KGCC 2NZDC 4KHAA 1KX5D 1F66A 3X1VB 1ID3C 5B31C 5CPKD 4J8VD 2PYOB 3REKC 3B6GD 4G91B 1M18B 5AV6C 1P3AD 3RELB 1KX3D 3W97A 5AV5A 1P34B 4R8PD 3C1BC 5B40A 3B0BA 3LZ1A 3X1VD 1P3MA 5GSUA 4Z66B 2PYOD 5B2JA 4LD9A 5B24B 5AY8D 5B2IC 3AZGB 4YM6C 2LY8A 5GXQC 3LZ0B 1M18D 3W98C 4HGAC 5B1MC 3KUYC 2F8NA 3V9RB 3RELD 1M19B 4KUDC 5B0ZA 1P3KC 1P34D 3O62B 3MGQA 2RVQC 3AZND 1P3OA 1JFIB 1TZYA 3MVDB 1N1JA
chains in the Genus database with same CATH superfamily
4Z66D 5B24D 3AZGD 4EO5B 1AOIC 2CV5A 3LZ0D 5BO0B 5KDMA 4G92C 3TU4B 1M19D 1P3PC 3AZIB 3O62D 3VH6A 3LELA 5B33C 2AROB 2ZY2A 5G49A 3MVDD 3UTAB 3WKJB 1P3AA 3X1SB 5E5AA 3KWQB 3AZHA 1KX3A 4R8PA 3REIB 3AV2B 2Y2IA 5CP6B 4CSRA 3X1VA 1P3LC 5C3IB 1F66B 3TU4D 3AV1C 2PYOA 2L5AA 3VH5A 3AZID 2JE5A 4XZQC 4H9QA 4J8XC 2IO5C 3C1CB 2AROD 3AZMA 3AZLA 2FFFB 5AV8B 5B1LA 4ZUXC 3UTAD 3WKJD 3WA9B 3KXBC 3KWQD 3W99A 1P34A 3REID 3UT9B 5AV5B 3W97B 3AV2D 5BS7C 5JA4A 5B40B 1KX4B 4YS3C 1F66D 3LZ1B 1BFMA 1P3MB 3UTBC 3IP4C 5GSUB 3F6TA 1P3GB 5B24A 2XD1A 5B2JB 4WU8A 3AYWB 4LD9B 3C1CD 4CAYB 5AV8D 3AZEA 2FJ7C 5F99B 3AZJB 4Z5TC 3WA9D 2F8NB 2DQNC 3UT9D 5AV5D 4WU9C 3W97D 1P3OB 5B40D 5B0ZC 1KX4D 1TZYB 3A1KA 3LZ1D 3MGQC 1P3MD 5GSUD 3WAAB 1P3GD 3WTPC 5BNXA 5B2JD 3AYWD 1P3IB 4LD9D 3EPLA 1EQZB 1KU5A 3A6NC 2W8SA 4X23A 2CV5B 3MNNB 5F99D 3B0DC 3AZJD 5KDMB 4UUZB 3WTPE 1KX5C 2F8ND 4WNNB 2BYKA 3AZIA 1S32B 3MGSB 5CPKC 4J8VC 1HTAA 3LELB 1P3OD 2NQBB 3AZFA 1TZYD 3B6FA 3UTAA 3WKJA 4H9NA 5DNNA 3WAAD 1HQ3B 3X1SA 3B6GC 2ZM5A 3AZHB 1P3ID 3REIA 3AV2A 1EQZD 4J8UB 1P3AC 2CV5D 5CP6A 3MNND 1KX3C 4R8PC 4CSRB 5B32A 5AVCA 2Y2LA 2HUEB 3X1UA 3MGSD 4H9QB 4ZBJC 3C1CA 2NQBD 3LELD 1B6WA 3AZMB 2PYOC 5BNVB 5AV8A 5AV9A 5AY8C 3AZLB 5B1LB 3B0CW 3WA9A 1HQ3D 4G91C 5E5AD 3LJAA 3AZHD 1M18C 3UT9A 3W99B 3REJC 3H0RC 3RELC 1KX4A 5JA4B 1P34C 3AZNC 5B31B 1P3GA 3W96A 3AYWA 1WWIA 4WU8B 4CAYA 4Z66C 3AZMD 5B24C 3AZLD 3AZGC 5F99A 3AZEB 5B1LD 3AZJA 3AFAB 3LZ0C 3W99D 3KSYA 1M19C 3O62C 5B31D 3REHB 3WAAA 4J8WA 5BNXB 5B2IB 4H9SA 3VH6T 3MVDC 4WU8D 2Y2MA 5CPIB 1U35B 1P3IA 1EQZA 5GXQB 3MNNA 4X23B 3AZED 4EO5C 3KUYB 4UUZA 3AFAD 5GT3B 3FDDA 4JJNC 4WNNA 2BYKB 3NQJB 1S32A 3MGSA 3TU4C 2NQBA 2Y2OA 3AZIC 3AZFB 3B6FB 3REHD 4H9NB 2AROC 3VH5T 1HQ3A 2ZY5A 5DNNB 5BT1D 5CPID 3WKJC 1U35D 4J8UA 1AOIB 1P3BA 2CWEA 3KWQC 4X23D 5CPJA 3REIC 3AV2C 1ZLAB 4NE5A 5AVCB 5B32B 4G92B 5GT3D 1P3FA 2F8NH 4NE6A 1F66C 3X1UB 3X1TB 2ZY4A 1W2EA 5BNVA 4M6BA 5AV9B 3AZFD 5DNMB 3B6FD 2VQRA 4XUJA 5AVBB 5DNND 3X1SD 5AV8C 2F8NG 3H0MC 3LJAB 5GT0B 4KGCA 2NZDA 1AOID 3WA9C 4QLCB 5CP6D 5AV5C 3AZKB 3W97C 5B31A 1ZLAD 5B32D 5AVCD 4UPKA 2BYMA 5B40C 3AV1B 3REKA 3W96B 3X1UD 3LZ1C 1P3MC 3X1TD 5GSUC 2G5IC 1P3GC 5B2JC 5AV9D 3AYWC 4LD9C 5DNMD 5AV6A 3AFAA 5AVBD 3MGRB 2YFVB 5F99C 3LJAD 5GT0D 3C1BA 3KFUG 4QLCD 2BG1A 4H9OA 1TAFB 4AWLB 3AZKD 3REHA 4NFTA 1P3OC 4WZSB 3AV1D 4J8WB 1M1AB 3W96D 1TZYC 5B2IA 3EPJA 5CPIA 1U35A 3WAAC 5GXQA 2Y2HA 5B0YB 1EQZC 3KUYA 2CV5C 5GT3A 3MGRD 3MNNC 3A1IA 5JRGB 4KUDA 3NQJA 2JSSA 4WU9B 3R45A 3EPKA 1T3UA 3LELC 2NQBC 4J8WD 1M1AD 3AN2B 1AOIA 1HQ3C 3A6NB 3MGPB 1P3BB 2Y2KA 5E5AC 3AZHC 5B0YD 5CPJB 1ZLAA 3NQUB 5B31G 5JRGD 1P3PA 2HIOB 1P3FB 3X1VC 1S32D 3X1TA 5CPKB 4WJ3C 2JCHA 2HUEC 5DNMA 4XUJB 5AVBA 3AZMC 3AZLC 3AN2D 5B1LC 5GT0A 1H3OB 2XD5A 4J8UD 4QLCA 3A6ND 3MGPD 1P3BD 4KGCB 2NZDB 3W99C 5FUGA 2YFWA 3AZKA 5CPJD 1P3LA 1ID3B 3AV1A 2RIQA 2BYMB 2HIOD 1P3FD 3REKB 4XZQA 1Z2CB 4J8XA 4ZBJB 4ZUXA 5AY8B 4WU8C 1BH8A 5AV6B 4XUJD 3MGRA 1F1EA 3KXBA 2Y2PA 2YFVA 3AZEC 3REJB 1B67A 3C1BB 5BS7A 3AFAC 4KGCD 2NZDD 4YS3A 1TAFA 3AZNB 4H9OB 1ID3D 3UTBA 1M1AA 3REKD 3REHC 4YM6B 5BT1C 2FJ7A 5CPIC 5B0YA 1U35C 5AV6D 2J8PA 3W98B 1Q9CA 1BH9A 4HGAB 5B1MB 4Z5TA 3AL0C 5B32G 5JRGA 4X23C 4KUDB 1R4VA 1P3KB 3REJD 4WU9A 3C1BD 5CHLB 4H9RB 5GT3C 3EPHA 3R45B 3WTPA 3AN2A 3AZFC 5B2ID 3B6FC 3UTAC 4YM6D 5DNNC 3A6NA 3MGPA 3X1SC 5GXQD 4H9PA 1ULYA 3W98D 3NQUA 4Z2MH 5B1MD 3KUYD 1KX5A 4JJNB 2HIOA 5CP6C 1P3KD 1P3PB 4KUDD 4NE3A 5C3IC 2Y2QA 2RVQD 1ZLAC 5B32C 5AVCC 4J8VA 5CPKA 5B33B 3X1UC 3X1TC 3EG5B 4DRAA 4Z2MG 3C1CC 3B6GA 5AV9C 5DNMC 1H3OA 5AVBC 1A7WA 3LJAC 5GT0C 5FUGB 2YFWB 3UT9C 1ID3A 1P3LB 4QLCC 4KHAB 4JJND 1P3PD 1KX4C 3AZKC 4XZQB 4J8XB 2IO5B 2ZY3A 5B33D 3W96C 2F8NK 5AY8A 4ZUXB 4E44A 1BH8B 2Y2NA 3VH6W 4WV4B 1M18A 3KXBB 4DQYB 3REJA 2DF4C 3AZJC 3RELA 3MGRC 3AZNA 4YS3B 1P3LD 4DRBA 3UTBB 4AWLC 2G5HC 4XZQD 2F2AC 4J8XD 4YM6A 4Z66A 4J8WC 1M1AC 3VH5W 3AZGA 3B0CT 4ZUXD 4H9SC 1P3IC 2FJ7B 3W98A 5B1MA 3LZ0A 4Z5TB 1BH9B 2Y2GA 3KXBD 1P3KA 5B0YC 3V9RA 4H9RA 1M19A 5JRGC 5B0ZB 3O62A 2UWXA 4YS3D 3MGQB 1S32C 3P5JB 3MGSC 1JFIA 3UTBD 1PZRA 3WTPB 3MVDA 1N1JB 1WWSA 3AN2C 4H9PB 2FJ7D 3B0DB 4E45A 4J8UC 3MGPC 4Z5TD 1P3BC 4JJNA 1KX5B 5BO0A 5CPJC 4WU9D 3TU4A 5B33A 4J8VB 2HIOC 5B0ZD 1P3FC 3MGQD 2AROA 3B6GB 3WTPD 5G49B 4XUJC 1P3AB 3KWQA 5E5AB 1KX3B 4R8PB 4KGCC 2NZDC 4KHAA 1KX5D 1F66A 3X1VB 1ID3C 5B31C 5CPKD 4J8VD 2PYOB 3REKC 3B6GD 4G91B 1M18B 5AV6C 1P3AD 3RELB 1KX3D 3W97A 5AV5A 1P34B 4R8PD 3C1BC 5B40A 3B0BA 3LZ1A 3X1VD 1P3MA 5GSUA 4Z66B 2PYOD 5B2JA 4LD9A 5B24B 5AY8D 5B2IC 3AZGB 4YM6C 2LY8A 5GXQC 3LZ0B 1M18D 3W98C 3H0LC 4HGAC 5B1MC 3KUYC 2F8NA 3V9RB 3RELD 1M19B 4KUDC 5B0ZA 1P3KC 1P34D 3O62B 3MGQA 2RVQC 3AZND 1P3OA 1JFIB 1TZYA 3MVDB 2Y2JA 1N1JA
chains in the Genus database with same CATH topology
4Z66D 5B24D 3AZGD 4EO5B 1AOIC 2CV5A 3LZ0D 5BO0B 5KDMA 4G92C 3TU4B 1M19D 1P3PC 3AZIB 3O62D 3VH6A 3LELA 5B33C 2AROB 2ZY2A 5G49A 3MVDD 3UTAB 3WKJB 1P3AA 3X1SB 5E5AA 3KWQB 3AZHA 1KX3A 4R8PA 3REIB 3AV2B 2Y2IA 5CP6B 4CSRA 3X1VA 1P3LC 5C3IB 1F66B 3TU4D 3AV1C 2PYOA 2L5AA 3VH5A 3AZID 2JE5A 4XZQC 4H9QA 4J8XC 2IO5C 3C1CB 2AROD 3AZMA 3AZLA 2FFFB 5AV8B 5B1LA 4ZUXC 3UTAD 3WKJD 3WA9B 3KXBC 3KWQD 3W99A 1P34A 3REID 3UT9B 5AV5B 3W97B 3AV2D 5BS7C 5JA4A 5B40B 1KX4B 4YS3C 1F66D 3LZ1B 1BFMA 1P3MB 3UTBC 3IP4C 5GSUB 3F6TA 1P3GB 5B24A 2XD1A 5B2JB 4WU8A 3AYWB 4LD9B 3C1CD 4CAYB 5AV8D 3AZEA 2FJ7C 5F99B 3AZJB 4Z5TC 3WA9D 2F8NB 2DQNC 3UT9D 5AV5D 4WU9C 3W97D 1P3OB 5B40D 5B0ZC 1KX4D 1TZYB 3A1KA 3LZ1D 3MGQC 1P3MD 5GSUD 3WAAB 1P3GD 3WTPC 5BNXA 5B2JD 3AYWD 1P3IB 4LD9D 3EPLA 1EQZB 1KU5A 3A6NC 2W8SA 4X23A 2CV5B 3MNNB 5F99D 3B0DC 3AZJD 5KDMB 4UUZB 3WTPE 1KX5C 2F8ND 4WNNB 2BYKA 3AZIA 1S32B 3MGSB 5CPKC 4J8VC 1HTAA 3LELB 1P3OD 2NQBB 3AZFA 1TZYD 3B6FA 3UTAA 3WKJA 4H9NA 5DNNA 3WAAD 1HQ3B 3X1SA 3B6GC 2ZM5A 3AZHB 1P3ID 3REIA 3AV2A 1EQZD 4J8UB 1P3AC 2CV5D 5CP6A 3MNND 1KX3C 4R8PC 4CSRB 5B32A 5AVCA 2Y2LA 2HUEB 3X1UA 3MGSD 4H9QB 4ZBJC 3C1CA 2NQBD 3LELD 1B6WA 3AZMB 2PYOC 5BNVB 5AV8A 5AV9A 5AY8C 3AZLB 5B1LB 3B0CW 3WA9A 1HQ3D 4G91C 5E5AD 3LJAA 3AZHD 1M18C 3UT9A 3W99B 3REJC 3H0RC 3RELC 1KX4A 5JA4B 1P34C 3AZNC 5B31B 1P3GA 3W96A 3AYWA 1WWIA 4WU8B 4CAYA 4Z66C 3AZMD 5B24C 3AZLD 3AZGC 5F99A 3AZEB 5B1LD 3AZJA 3AFAB 3LZ0C 3W99D 3KSYA 1M19C 3O62C 5B31D 3REHB 3WAAA 4J8WA 5BNXB 5B2IB 4H9SA 3VH6T 3MVDC 4WU8D 2Y2MA 5CPIB 1U35B 1P3IA 1EQZA 5GXQB 3MNNA 4X23B 3AZED 4EO5C 3KUYB 4UUZA 3AFAD 5GT3B 3FDDA 4JJNC 4WNNA 2BYKB 3NQJB 1S32A 3MGSA 3TU4C 2NQBA 2Y2OA 3AZIC 3AZFB 3B6FB 3REHD 4H9NB 2AROC 3VH5T 1HQ3A 2ZY5A 5DNNB 5BT1D 5CPID 3WKJC 1U35D 4J8UA 1AOIB 1P3BA 2CWEA 3KWQC 4X23D 5CPJA 3REIC 3AV2C 1ZLAB 4NE5A 5AVCB 5B32B 4G92B 5GT3D 1P3FA 2F8NH 4NE6A 1F66C 3X1UB 3X1TB 2ZY4A 1W2EA 5BNVA 4M6BA 5AV9B 3AZFD 5DNMB 3B6FD 2VQRA 4XUJA 5AVBB 5DNND 3X1SD 5AV8C 2F8NG 3H0MC 3LJAB 5GT0B 4KGCA 2NZDA 1AOID 3WA9C 4QLCB 5CP6D 5AV5C 3AZKB 3W97C 5B31A 1ZLAD 5B32D 5AVCD 4UPKA 2BYMA 5B40C 3AV1B 3REKA 3W96B 3X1UD 3LZ1C 1P3MC 3X1TD 5GSUC 2G5IC 1P3GC 5B2JC 5AV9D 3AYWC 4LD9C 5DNMD 5AV6A 3AFAA 5AVBD 3MGRB 2YFVB 5F99C 3LJAD 5GT0D 3C1BA 3KFUG 4QLCD 2BG1A 4H9OA 1TAFB 4AWLB 3AZKD 3REHA 4NFTA 1P3OC 4WZSB 3AV1D 4J8WB 1M1AB 3W96D 1TZYC 5B2IA 3EPJA 5CPIA 1U35A 3WAAC 5GXQA 2Y2HA 5B0YB 1EQZC 3KUYA 2CV5C 5GT3A 3MGRD 3MNNC 3A1IA 5JRGB 4KUDA 3NQJA 2JSSA 4WU9B 3R45A 3EPKA 1T3UA 3LELC 2NQBC 4J8WD 1M1AD 3AN2B 1AOIA 1HQ3C 3A6NB 3MGPB 1P3BB 2Y2KA 5E5AC 3AZHC 5B0YD 5CPJB 1ZLAA 3NQUB 5B31G 5JRGD 1P3PA 2HIOB 1P3FB 3X1VC 1S32D 3X1TA 5CPKB 4WJ3C 2JCHA 2HUEC 5DNMA 4XUJB 5AVBA 3AZMC 3AZLC 3AN2D 5B1LC 5GT0A 1H3OB 2XD5A 4J8UD 4QLCA 3A6ND 3MGPD 1P3BD 4KGCB 2NZDB 3W99C 5FUGA 2YFWA 3AZKA 5CPJD 1P3LA 1ID3B 3AV1A 2RIQA 2BYMB 2HIOD 1P3FD 3REKB 4XZQA 1Z2CB 4J8XA 4ZBJB 4ZUXA 5AY8B 4WU8C 1BH8A 5AV6B 4XUJD 3MGRA 1F1EA 3KXBA 2Y2PA 2YFVA 3AZEC 3REJB 1B67A 3C1BB 5BS7A 3AFAC 4KGCD 2NZDD 4YS3A 1TAFA 3AZNB 4H9OB 1ID3D 3UTBA 1M1AA 3REKD 3REHC 4YM6B 5BT1C 2FJ7A 5CPIC 5B0YA 1U35C 5AV6D 2J8PA 3W98B 1Q9CA 1BH9A 4HGAB 5B1MB 4Z5TA 3AL0C 5B32G 5JRGA 4X23C 4KUDB 1R4VA 1P3KB 3REJD 4WU9A 3C1BD 5CHLB 4H9RB 5GT3C 3EPHA 3R45B 3WTPA 3AN2A 3AZFC 5B2ID 3B6FC 3UTAC 4YM6D 5DNNC 3A6NA 3MGPA 3X1SC 5GXQD 4H9PA 1ULYA 3W98D 3NQUA 4Z2MH 5B1MD 3KUYD 1KX5A 4JJNB 2HIOA 5CP6C 1P3KD 1P3PB 4KUDD 4NE3A 5C3IC 2Y2QA 2RVQD 1ZLAC 5B32C 5AVCC 4J8VA 5CPKA 5B33B 3X1UC 3X1TC 3EG5B 4DRAA 4Z2MG 3C1CC 3B6GA 5AV9C 5DNMC 1H3OA 5AVBC 1A7WA 3LJAC 5GT0C 5FUGB 2YFWB 3UT9C 1ID3A 1P3LB 4QLCC 4KHAB 4JJND 1P3PD 1KX4C 3AZKC 4XZQB 4J8XB 2IO5B 2ZY3A 5B33D 3W96C 2F8NK 5AY8A 4ZUXB 4E44A 1BH8B 2Y2NA 3VH6W 4WV4B 1M18A 3KXBB 4DQYB 3REJA 2DF4C 3AZJC 3RELA 3MGRC 3AZNA 4YS3B 1P3LD 4DRBA 3UTBB 4AWLC 2G5HC 4XZQD 2F2AC 4J8XD 4YM6A 4Z66A 4J8WC 1M1AC 3VH5W 3AZGA 3B0CT 4ZUXD 4H9SC 1P3IC 2FJ7B 3W98A 5B1MA 3LZ0A 4Z5TB 1BH9B 2Y2GA 3KXBD 1P3KA 5B0YC 3V9RA 4H9RA 1M19A 5JRGC 5B0ZB 3O62A 2UWXA 4YS3D 3MGQB 1S32C 3P5JB 3MGSC 1JFIA 3UTBD 1PZRA 3WTPB 3MVDA 1N1JB 1WWSA 3AN2C 4H9PB 2FJ7D 3B0DB 4E45A 4J8UC 3MGPC 4Z5TD 1P3BC 4JJNA 1KX5B 5BO0A 5CPJC 4WU9D 3TU4A 5B33A 4J8VB 2HIOC 5B0ZD 1P3FC 3MGQD 2AROA 3B6GB 3WTPD 5G49B 4XUJC 1P3AB 3KWQA 5E5AB 1KX3B 4R8PB 4KGCC 2NZDC 4KHAA 1KX5D 1F66A 3X1VB 1ID3C 5B31C 5CPKD 4J8VD 2PYOB 3REKC 3B6GD 4G91B 1M18B 5AV6C 1P3AD 3RELB 1KX3D 3W97A 5AV5A 1P34B 4R8PD 3C1BC 5B40A 3B0BA 3LZ1A 3X1VD 1P3MA 5GSUA 4Z66B 2PYOD 5B2JA 4LD9A 5B24B 5AY8D 5B2IC 3AZGB 4YM6C 2LY8A 5GXQC 3LZ0B 1M18D 3W98C 3H0LC 4HGAC 5B1MC 3KUYC 2F8NA 3V9RB 3RELD 1M19B 4KUDC 5B0ZA 1P3KC 1P34D 3O62B 3MGQA 2RVQC 3AZND 1P3OA 1JFIB 1TZYA 3MVDB 2Y2JA 1N1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 D;  5B24 D;  3AZG D;  4EO5 B;  1AOI C;  2CV5 A;  3LZ0 D;  5BO0 B;  5KDM A;  4G92 C;  3TU4 B;  1M19 D;  1P3P C;  3AZI B;  3O62 D;  3VH6 A;  3LEL A;  5B33 C;  2ARO B;  5G49 A;  3MVD D;  3UTA B;  3WKJ B;  1P3A A;  3X1S B;  5E5A A;  3KWQ B;  3AZH A;  1KX3 A;  4R8P A;  3REI B;  3AV2 B;  5CP6 B;  4CSR A;  3X1V A;  1P3L C;  5C3I B;  1F66 B;  3TU4 D;  3AV1 C;  2PYO A;  2L5A A;  3VH5 A;  3AZI D;  4XZQ C;  4H9Q A;  4J8X C;  2IO5 C;  3C1C B;  2ARO D;  3AZM A;  3AZL A;  5AV8 B;  5B1L A;  4ZUX C;  3UTA D;  3WKJ D;  3WA9 B;  3KXB C;  3KWQ D;  3W99 A;  1P34 A;  3REI D;  3UT9 B;  5AV5 B;  3W97 B;  3AV2 D;  5BS7 C;  5JA4 A;  5B40 B;  1KX4 B;  4YS3 C;  1F66 D;  3LZ1 B;  1BFM A;  1P3M B;  3UTB C;  5GSU B;  1P3G B;  5B24 A;  5B2J B;  4WU8 A;  3AYW B;  4LD9 B;  3C1C D;  4CAY B;  5AV8 D;  3AZE A;  2FJ7 C;  5F99 B;  3AZJ B;  4Z5T C;  3WA9 D;  2F8N B;  3UT9 D;  5AV5 D;  4WU9 C;  3W97 D;  1P3O B;  5B0Z C;  5B40 D;  1KX4 D;  1TZY B;  3MGQ C;  3LZ1 D;  1P3M D;  5GSU D;  3WAA B;  1P3G D;  3WTP C;  5BNX A;  5B2J D;  3AYW D;  1P3I B;  4LD9 D;  1EQZ B;  1KU5 A;  3A6N C;  4X23 A;  2CV5 B;  3MNN B;  5F99 D;  3B0D C;  3AZJ D;  5KDM B;  4UUZ B;  3WTP E;  1KX5 C;  2F8N D;  4WNN B;  2BYK A;  3AZI A;  1S32 B;  3MGS B;  5CPK C;  4J8V C;  1HTA A;  3LEL B;  1P3O D;  2NQB B;  3AZF A;  1TZY D;  3B6F A;  3UTA A;  3WKJ A;  4H9N A;  5DNN A;  3WAA D;  1HQ3 B;  3X1S A;  3B6G C;  3AZH B;  1P3I D;  3REI A;  3AV2 A;  1EQZ D;  4J8U B;  1P3A C;  2CV5 D;  5CP6 A;  3MNN D;  1KX3 C;  4R8P C;  4CSR B;  5B32 A;  5AVC A;  2HUE B;  3X1U A;  3MGS D;  4H9Q B;  4ZBJ C;  3C1C A;  2NQB D;  3LEL D;  1B6W A;  3AZM B;  2PYO C;  5BNV B;  5AV8 A;  5AV9 A;  5AY8 C;  3AZL B;  5B1L B;  3B0C W;  3WA9 A;  1HQ3 D;  4G91 C;  5E5A D;  3LJA A;  3AZH D;  1M18 C;  3UT9 A;  3W99 B;  3REJ C;  3REL C;  1KX4 A;  5JA4 B;  1P34 C;  3AZN C;  5B31 B;  1P3G A;  3W96 A;  3AYW A;  1WWI A;  4WU8 B;  4CAY A;  4Z66 C;  3AZM D;  5B24 C;  3AZL D;  3AZG C;  5F99 A;  3AZE B;  5B1L D;  3AZJ A;  3AFA B;  3LZ0 C;  3W99 D;  3KSY A;  1M19 C;  3O62 C;  5B31 D;  3REH B;  3WAA A;  4J8W A;  5BNX B;  5B2I B;  4H9S A;  3VH6 T;  3MVD C;  4WU8 D;  5CPI B;  1U35 B;  1P3I A;  1EQZ A;  5GXQ B;  3MNN A;  4X23 B;  3AZE D;  4EO5 C;  3KUY B;  4UUZ A;  3AFA D;  5GT3 B;  4JJN C;  4WNN A;  2BYK B;  3NQJ B;  1S32 A;  3MGS A;  3TU4 C;  2NQB A;  3AZI C;  3AZF B;  3B6F B;  3REH D;  4H9N B;  2ARO C;  3VH5 T;  1HQ3 A;  5DNN B;  5BT1 D;  5CPI D;  3WKJ C;  1U35 D;  4J8U A;  1AOI B;  1P3B A;  2CWE A;  3KWQ C;  4X23 D;  5CPJ A;  3REI C;  3AV2 C;  1ZLA B;  4NE5 A;  5AVC B;  5B32 B;  4G92 B;  5GT3 D;  1P3F A;  2F8N H;  4NE6 A;  1F66 C;  3X1U B;  3X1T B;  5BNV A;  4M6B A;  5AV9 B;  3AZF D;  5DNM B;  3B6F D;  4XUJ A;  5AVB B;  5DNN D;  3X1S D;  5AV8 C;  2F8N G;  3LJA B;  5GT0 B;  4KGC A;  2NZD A;  1AOI D;  3WA9 C;  4QLC B;  5CP6 D;  5AV5 C;  3AZK B;  3W97 C;  5B31 A;  1ZLA D;  5B32 D;  5AVC D;  2BYM A;  5B40 C;  3AV1 B;  3REK A;  3W96 B;  3X1U D;  3LZ1 C;  1P3M C;  3X1T D;  5GSU C;  1P3G C;  5B2J C;  5AV9 D;  3AYW C;  4LD9 C;  5DNM D;  5AV6 A;  3AFA A;  5AVB D;  3MGR B;  2YFV B;  5F99 C;  3LJA D;  5GT0 D;  3C1B A;  4QLC D;  4H9O A;  1TAF B;  4AWL B;  3AZK D;  3REH A;  4NFT A;  1P3O C;  4WZS B;  3AV1 D;  4J8W B;  1M1A B;  3W96 D;  1TZY C;  5B2I A;  5CPI A;  1U35 A;  3WAA C;  5GXQ A;  5B0Y B;  1EQZ C;  3KUY A;  2CV5 C;  5GT3 A;  3MGR D;  3MNN C;  4KUD A;  5JRG B;  3NQJ A;  2JSS A;  4WU9 B;  3R45 A;  2NQB C;  3LEL C;  4J8W D;  1M1A D;  3AN2 B;  1AOI A;  1HQ3 C;  3A6N B;  3MGP B;  1P3B B;  5E5A C;  3AZH C;  5B0Y D;  5CPJ B;  1ZLA A;  3NQU B;  5B31 G;  5JRG D;  1P3P A;  2HIO B;  1P3F B;  3X1V C;  1S32 D;  3X1T A;  5CPK B;  2HUE C;  5DNM A;  4XUJ B;  5AVB A;  3AZM C;  3AZL C;  3AN2 D;  5B1L C;  5GT0 A;  1H3O B;  4J8U D;  4QLC A;  3A6N D;  3MGP D;  1P3B D;  4KGC B;  2NZD B;  3W99 C;  5FUG A;  2YFW A;  3AZK A;  5CPJ D;  1P3L A;  1ID3 B;  3AV1 A;  2BYM B;  2HIO D;  1P3F D;  3REK B;  4XZQ A;  4J8X A;  4ZBJ B;  4ZUX A;  5AY8 B;  4WU8 C;  1BH8 A;  5AV6 B;  4XUJ D;  3MGR A;  1F1E A;  3KXB A;  2YFV A;  3AZE C;  3REJ B;  1B67 A;  3C1B B;  5BS7 A;  3AFA C;  4KGC D;  2NZD D;  4YS3 A;  1TAF A;  3AZN B;  4H9O B;  1ID3 D;  3UTB A;  1M1A A;  3REK D;  3REH C;  4YM6 B;  5BT1 C;  2FJ7 A;  5CPI C;  5B0Y A;  1U35 C;  5AV6 D;  3W98 B;  1Q9C A;  1BH9 A;  4HGA B;  5B1M B;  4Z5T A;  5B32 G;  5JRG A;  4X23 C;  4KUD B;  1R4V A;  1P3K B;  3REJ D;  4WU9 A;  3C1B D;  5CHL B;  4H9R B;  5GT3 C;  3R45 B;  3WTP A;  3AN2 A;  3AZF C;  5B2I D;  3B6F C;  3UTA C;  4YM6 D;  5DNN C;  3A6N A;  3MGP A;  3X1S C;  5GXQ D;  4H9P A;  1ULY A;  3W98 D;  3NQU A;  4Z2M H;  5B1M D;  3KUY D;  1KX5 A;  4JJN B;  2HIO A;  5CP6 C;  1P3K D;  1P3P B;  4KUD D;  4NE3 A;  5C3I C;  1ZLA C;  2RVQ D;  5B32 C;  5AVC C;  4J8V A;  5CPK A;  5B33 B;  3X1U C;  3X1T C;  4Z2M G;  4DRA A;  3C1C C;  3B6G A;  5AV9 C;  5DNM C;  1H3O A;  5AVB C;  1A7W A;  3LJA C;  5GT0 C;  5FUG B;  2YFW B;  3UT9 C;  1ID3 A;  1P3L B;  4QLC C;  4KHA B;  4JJN D;  1P3P D;  1KX4 C;  3AZK C;  4XZQ B;  4J8X B;  2IO5 B;  5B33 D;  3W96 C;  2F8N K;  5AY8 A;  4ZUX B;  4E44 A;  1BH8 B;  3VH6 W;  4WV4 B;  1M18 A;  3KXB B;  3REJ A;  3AZJ C;  3REL A;  3MGR C;  3AZN A;  4YS3 B;  1P3L D;  4DRB A;  3UTB B;  4AWL C;  4XZQ D;  4J8X D;  4YM6 A;  4Z66 A;  4J8W C;  1M1A C;  3VH5 W;  3AZG A;  3B0C T;  4ZUX D;  4H9S C;  1P3I C;  2FJ7 B;  3W98 A;  5B1M A;  3LZ0 A;  4Z5T B;  1BH9 B;  3KXB D;  1P3K A;  5B0Y C;  3V9R A;  4H9R A;  1M19 A;  5JRG C;  5B0Z B;  3O62 A;  4YS3 D;  3MGQ B;  1S32 C;  3MGS C;  1JFI A;  3UTB D;  3WTP B;  3MVD A;  1N1J B;  1WWS A;  3AN2 C;  4H9P B;  2FJ7 D;  3B0D B;  4E45 A;  4J8U C;  3MGP C;  4Z5T D;  1P3B C;  4JJN A;  1KX5 B;  5BO0 A;  5CPJ C;  4WU9 D;  3TU4 A;  5B33 A;  4J8V B;  2HIO C;  5B0Z D;  1P3F C;  3MGQ D;  2ARO A;  3B6G B;  3WTP D;  5G49 B;  4XUJ C;  1P3A B;  3KWQ A;  5E5A B;  1KX3 B;  4R8P B;  4KGC C;  2NZD C;  4KHA A;  1KX5 D;  1F66 A;  3X1V B;  1ID3 C;  5B31 C;  5CPK D;  4J8V D;  2PYO B;  3REK C;  3B6G D;  4G91 B;  1M18 B;  5AV6 C;  1P3A D;  3REL B;  1KX3 D;  3W97 A;  5AV5 A;  1P34 B;  4R8P D;  3C1B C;  5B40 A;  3B0B A;  3LZ1 A;  3X1V D;  1P3M A;  5GSU A;  4Z66 B;  2PYO D;  5B2J A;  4LD9 A;  5B24 B;  5AY8 D;  5B2I C;  3AZG B;  4YM6 C;  2LY8 A;  5GXQ C;  3LZ0 B;  1M18 D;  3W98 C;  4HGA C;  5B1M C;  3KUY C;  2F8N A;  3V9R B;  3REL D;  1M19 B;  4KUD C;  5B0Z A;  1P3K C;  1P34 D;  3O62 B;  3MGQ A;  2RVQ C;  3AZN D;  1P3O A;  1JFI B;  1TZY A;  3MVD B;  1N1J A; 
#chains in the Genus database with same CATH topology
 4Z66 D;  5B24 D;  3AZG D;  4EO5 B;  1AOI C;  2CV5 A;  3LZ0 D;  5BO0 B;  5KDM A;  4G92 C;  3TU4 B;  1M19 D;  1P3P C;  3AZI B;  3O62 D;  3VH6 A;  3LEL A;  5B33 C;  2ARO B;  2ZY2 A;  5G49 A;  3MVD D;  3UTA B;  3WKJ B;  1P3A A;  3X1S B;  5E5A A;  3KWQ B;  3AZH A;  1KX3 A;  4R8P A;  3REI B;  3AV2 B;  2Y2I A;  5CP6 B;  4CSR A;  3X1V A;  1P3L C;  5C3I B;  1F66 B;  3TU4 D;  3AV1 C;  2PYO A;  2L5A A;  3VH5 A;  3AZI D;  2JE5 A;  4XZQ C;  4H9Q A;  4J8X C;  2IO5 C;  3C1C B;  2ARO D;  3AZM A;  3AZL A;  2FFF B;  5AV8 B;  5B1L A;  4ZUX C;  3UTA D;  3WKJ D;  3WA9 B;  3KXB C;  3KWQ D;  3W99 A;  1P34 A;  3REI D;  3UT9 B;  5AV5 B;  3W97 B;  3AV2 D;  5BS7 C;  5JA4 A;  5B40 B;  1KX4 B;  4YS3 C;  1F66 D;  3LZ1 B;  1BFM A;  1P3M B;  3UTB C;  3IP4 C;  5GSU B;  3F6T A;  1P3G B;  5B24 A;  2XD1 A;  5B2J B;  4WU8 A;  3AYW B;  4LD9 B;  3C1C D;  4CAY B;  5AV8 D;  3AZE A;  2FJ7 C;  5F99 B;  3AZJ B;  4Z5T C;  3WA9 D;  2F8N B;  2DQN C;  3UT9 D;  5AV5 D;  4WU9 C;  3W97 D;  1P3O B;  5B40 D;  5B0Z C;  1KX4 D;  1TZY B;  3A1K A;  3LZ1 D;  3MGQ C;  1P3M D;  5GSU D;  3WAA B;  1P3G D;  3WTP C;  5BNX A;  5B2J D;  3AYW D;  1P3I B;  4LD9 D;  3EPL A;  1EQZ B;  1KU5 A;  3A6N C;  2W8S A;  4X23 A;  2CV5 B;  3MNN B;  5F99 D;  3B0D C;  3AZJ D;  5KDM B;  4UUZ B;  3WTP E;  1KX5 C;  2F8N D;  4WNN B;  2BYK A;  3AZI A;  1S32 B;  3MGS B;  5CPK C;  4J8V C;  1HTA A;  3LEL B;  1P3O D;  2NQB B;  3AZF A;  1TZY D;  3B6F A;  3UTA A;  3WKJ A;  4H9N A;  5DNN A;  3WAA D;  1HQ3 B;  3X1S A;  3B6G C;  2ZM5 A;  3AZH B;  1P3I D;  3REI A;  3AV2 A;  1EQZ D;  4J8U B;  1P3A C;  2CV5 D;  5CP6 A;  3MNN D;  1KX3 C;  4R8P C;  4CSR B;  5B32 A;  5AVC A;  2Y2L A;  2HUE B;  3X1U A;  3MGS D;  4H9Q B;  4ZBJ C;  3C1C A;  2NQB D;  3LEL D;  1B6W A;  3AZM B;  2PYO C;  5BNV B;  5AV8 A;  5AV9 A;  5AY8 C;  3AZL B;  5B1L B;  3B0C W;  3WA9 A;  1HQ3 D;  4G91 C;  5E5A D;  3LJA A;  3AZH D;  1M18 C;  3UT9 A;  3W99 B;  3REJ C;  3H0R C;  3REL C;  1KX4 A;  5JA4 B;  1P34 C;  3AZN C;  5B31 B;  1P3G A;  3W96 A;  3AYW A;  1WWI A;  4WU8 B;  4CAY A;  4Z66 C;  3AZM D;  5B24 C;  3AZL D;  3AZG C;  5F99 A;  3AZE B;  5B1L D;  3AZJ A;  3AFA B;  3LZ0 C;  3W99 D;  3KSY A;  1M19 C;  3O62 C;  5B31 D;  3REH B;  3WAA A;  4J8W A;  5BNX B;  5B2I B;  4H9S A;  3VH6 T;  3MVD C;  4WU8 D;  2Y2M A;  5CPI B;  1U35 B;  1P3I A;  1EQZ A;  5GXQ B;  3MNN A;  4X23 B;  3AZE D;  4EO5 C;  3KUY B;  4UUZ A;  3AFA D;  5GT3 B;  3FDD A;  4JJN C;  4WNN A;  2BYK B;  3NQJ B;  1S32 A;  3MGS A;  3TU4 C;  2NQB A;  2Y2O A;  3AZI C;  3AZF B;  3B6F B;  3REH D;  4H9N B;  2ARO C;  3VH5 T;  1HQ3 A;  2ZY5 A;  5DNN B;  5BT1 D;  5CPI D;  3WKJ C;  1U35 D;  4J8U A;  1AOI B;  1P3B A;  2CWE A;  3KWQ C;  4X23 D;  5CPJ A;  3REI C;  3AV2 C;  1ZLA B;  4NE5 A;  5AVC B;  5B32 B;  4G92 B;  5GT3 D;  1P3F A;  2F8N H;  4NE6 A;  1F66 C;  3X1U B;  3X1T B;  2ZY4 A;  1W2E A;  5BNV A;  4M6B A;  5AV9 B;  3AZF D;  5DNM B;  3B6F D;  2VQR A;  4XUJ A;  5AVB B;  5DNN D;  3X1S D;  5AV8 C;  2F8N G;  3H0M C;  3LJA B;  5GT0 B;  4KGC A;  2NZD A;  1AOI D;  3WA9 C;  4QLC B;  5CP6 D;  5AV5 C;  3AZK B;  3W97 C;  5B31 A;  1ZLA D;  5B32 D;  5AVC D;  4UPK A;  2BYM A;  5B40 C;  3AV1 B;  3REK A;  3W96 B;  3X1U D;  3LZ1 C;  1P3M C;  3X1T D;  5GSU C;  2G5I C;  1P3G C;  5B2J C;  5AV9 D;  3AYW C;  4LD9 C;  5DNM D;  5AV6 A;  3AFA A;  5AVB D;  3MGR B;  2YFV B;  5F99 C;  3LJA D;  5GT0 D;  3C1B A;  3KFU G;  4QLC D;  2BG1 A;  4H9O A;  1TAF B;  4AWL B;  3AZK D;  3REH A;  4NFT A;  1P3O C;  4WZS B;  3AV1 D;  4J8W B;  1M1A B;  3W96 D;  1TZY C;  5B2I A;  3EPJ A;  5CPI A;  1U35 A;  3WAA C;  5GXQ A;  2Y2H A;  5B0Y B;  1EQZ C;  3KUY A;  2CV5 C;  5GT3 A;  3MGR D;  3MNN C;  3A1I A;  5JRG B;  4KUD A;  3NQJ A;  2JSS A;  4WU9 B;  3R45 A;  3EPK A;  1T3U A;  3LEL C;  2NQB C;  4J8W D;  1M1A D;  3AN2 B;  1AOI A;  1HQ3 C;  3A6N B;  3MGP B;  1P3B B;  2Y2K A;  5E5A C;  3AZH C;  5B0Y D;  5CPJ B;  1ZLA A;  3NQU B;  5B31 G;  5JRG D;  1P3P A;  2HIO B;  1P3F B;  3X1V C;  1S32 D;  3X1T A;  5CPK B;  4WJ3 C;  2JCH A;  2HUE C;  5DNM A;  4XUJ B;  5AVB A;  3AZM C;  3AZL C;  3AN2 D;  5B1L C;  5GT0 A;  1H3O B;  2XD5 A;  4J8U D;  4QLC A;  3A6N D;  3MGP D;  1P3B D;  4KGC B;  2NZD B;  3W99 C;  5FUG A;  2YFW A;  3AZK A;  5CPJ D;  1P3L A;  1ID3 B;  3AV1 A;  2RIQ A;  2BYM B;  2HIO D;  1P3F D;  3REK B;  4XZQ A;  1Z2C B;  4J8X A;  4ZBJ B;  4ZUX A;  5AY8 B;  4WU8 C;  1BH8 A;  5AV6 B;  4XUJ D;  3MGR A;  1F1E A;  3KXB A;  2Y2P A;  2YFV A;  3AZE C;  3REJ B;  1B67 A;  3C1B B;  5BS7 A;  3AFA C;  4KGC D;  2NZD D;  4YS3 A;  1TAF A;  3AZN B;  4H9O B;  1ID3 D;  3UTB A;  1M1A A;  3REK D;  3REH C;  4YM6 B;  5BT1 C;  2FJ7 A;  5CPI C;  5B0Y A;  1U35 C;  5AV6 D;  2J8P A;  3W98 B;  1Q9C A;  1BH9 A;  4HGA B;  5B1M B;  4Z5T A;  3AL0 C;  5B32 G;  5JRG A;  4X23 C;  4KUD B;  1R4V A;  1P3K B;  3REJ D;  4WU9 A;  3C1B D;  5CHL B;  4H9R B;  5GT3 C;  3EPH A;  3R45 B;  3WTP A;  3AN2 A;  3AZF C;  5B2I D;  3B6F C;  3UTA C;  4YM6 D;  5DNN C;  3A6N A;  3MGP A;  3X1S C;  5GXQ D;  4H9P A;  1ULY A;  3W98 D;  3NQU A;  4Z2M H;  5B1M D;  3KUY D;  1KX5 A;  4JJN B;  2HIO A;  5CP6 C;  1P3K D;  1P3P B;  4KUD D;  4NE3 A;  5C3I C;  2Y2Q A;  2RVQ D;  1ZLA C;  5B32 C;  5AVC C;  4J8V A;  5CPK A;  5B33 B;  3X1U C;  3X1T C;  3EG5 B;  4DRA A;  4Z2M G;  3C1C C;  3B6G A;  5AV9 C;  5DNM C;  1H3O A;  5AVB C;  1A7W A;  3LJA C;  5GT0 C;  5FUG B;  2YFW B;  3UT9 C;  1ID3 A;  1P3L B;  4QLC C;  4KHA B;  4JJN D;  1P3P D;  1KX4 C;  3AZK C;  4XZQ B;  4J8X B;  2IO5 B;  2ZY3 A;  5B33 D;  3W96 C;  2F8N K;  5AY8 A;  4ZUX B;  4E44 A;  1BH8 B;  2Y2N A;  3VH6 W;  4WV4 B;  1M18 A;  3KXB B;  4DQY B;  3REJ A;  2DF4 C;  3AZJ C;  3REL A;  3MGR C;  3AZN A;  4YS3 B;  1P3L D;  4DRB A;  3UTB B;  4AWL C;  2G5H C;  4XZQ D;  2F2A C;  4J8X D;  4YM6 A;  4Z66 A;  4J8W C;  1M1A C;  3VH5 W;  3AZG A;  3B0C T;  4ZUX D;  4H9S C;  1P3I C;  2FJ7 B;  3W98 A;  5B1M A;  3LZ0 A;  4Z5T B;  1BH9 B;  2Y2G A;  3KXB D;  1P3K A;  5B0Y C;  3V9R A;  4H9R A;  1M19 A;  5JRG C;  5B0Z B;  3O62 A;  2UWX A;  4YS3 D;  3MGQ B;  1S32 C;  3P5J B;  3MGS C;  1JFI A;  3UTB D;  1PZR A;  3WTP B;  3MVD A;  1N1J B;  1WWS A;  3AN2 C;  4H9P B;  2FJ7 D;  3B0D B;  4E45 A;  4J8U C;  3MGP C;  4Z5T D;  1P3B C;  4JJN A;  1KX5 B;  5BO0 A;  5CPJ C;  4WU9 D;  3TU4 A;  5B33 A;  4J8V B;  2HIO C;  5B0Z D;  1P3F C;  3MGQ D;  2ARO A;  3B6G B;  3WTP D;  5G49 B;  4XUJ C;  1P3A B;  3KWQ A;  5E5A B;  1KX3 B;  4R8P B;  4KGC C;  2NZD C;  4KHA A;  1KX5 D;  1F66 A;  3X1V B;  1ID3 C;  5B31 C;  5CPK D;  4J8V D;  2PYO B;  3REK C;  3B6G D;  4G91 B;  1M18 B;  5AV6 C;  1P3A D;  3REL B;  1KX3 D;  3W97 A;  5AV5 A;  1P34 B;  4R8P D;  3C1B C;  5B40 A;  3B0B A;  3LZ1 A;  3X1V D;  1P3M A;  5GSU A;  4Z66 B;  2PYO D;  5B2J A;  4LD9 A;  5B24 B;  5AY8 D;  5B2I C;  3AZG B;  4YM6 C;  2LY8 A;  5GXQ C;  3LZ0 B;  1M18 D;  3W98 C;  3H0L C;  4HGA C;  5B1M C;  3KUY C;  2F8N A;  3V9R B;  3REL D;  1M19 B;  4KUD C;  5B0Z A;  1P3K C;  1P34 D;  3O62 B;  3MGQ A;  2RVQ C;  3AZN D;  1P3O A;  1JFI B;  1TZY A;  3MVD B;  2Y2J A;  1N1J A; 
#chains in the Genus database with same CATH homology
 4Z66 D;  5B24 D;  3AZG D;  4EO5 B;  1AOI C;  2CV5 A;  3LZ0 D;  5BO0 B;  5KDM A;  4G92 C;  3TU4 B;  1M19 D;  1P3P C;  3AZI B;  3O62 D;  3VH6 A;  3LEL A;  5B33 C;  2ARO B;  2ZY2 A;  5G49 A;  3MVD D;  3UTA B;  3WKJ B;  1P3A A;  3X1S B;  5E5A A;  3KWQ B;  3AZH A;  1KX3 A;  4R8P A;  3REI B;  3AV2 B;  2Y2I A;  5CP6 B;  4CSR A;  3X1V A;  1P3L C;  5C3I B;  1F66 B;  3TU4 D;  3AV1 C;  2PYO A;  2L5A A;  3VH5 A;  3AZI D;  2JE5 A;  4XZQ C;  4H9Q A;  4J8X C;  2IO5 C;  3C1C B;  2ARO D;  3AZM A;  3AZL A;  2FFF B;  5AV8 B;  5B1L A;  4ZUX C;  3UTA D;  3WKJ D;  3WA9 B;  3KXB C;  3KWQ D;  3W99 A;  1P34 A;  3REI D;  3UT9 B;  5AV5 B;  3W97 B;  3AV2 D;  5BS7 C;  5JA4 A;  5B40 B;  1KX4 B;  4YS3 C;  1F66 D;  3LZ1 B;  1BFM A;  1P3M B;  3UTB C;  3IP4 C;  5GSU B;  3F6T A;  1P3G B;  5B24 A;  2XD1 A;  5B2J B;  4WU8 A;  3AYW B;  4LD9 B;  3C1C D;  4CAY B;  5AV8 D;  3AZE A;  2FJ7 C;  5F99 B;  3AZJ B;  4Z5T C;  3WA9 D;  2F8N B;  2DQN C;  3UT9 D;  5AV5 D;  4WU9 C;  3W97 D;  1P3O B;  5B40 D;  5B0Z C;  1KX4 D;  1TZY B;  3A1K A;  3LZ1 D;  3MGQ C;  1P3M D;  5GSU D;  3WAA B;  1P3G D;  3WTP C;  5BNX A;  5B2J D;  3AYW D;  1P3I B;  4LD9 D;  3EPL A;  1EQZ B;  1KU5 A;  3A6N C;  2W8S A;  4X23 A;  2CV5 B;  3MNN B;  5F99 D;  3B0D C;  3AZJ D;  5KDM B;  4UUZ B;  3WTP E;  1KX5 C;  2F8N D;  4WNN B;  2BYK A;  3AZI A;  1S32 B;  3MGS B;  5CPK C;  4J8V C;  1HTA A;  3LEL B;  1P3O D;  2NQB B;  3AZF A;  1TZY D;  3B6F A;  3UTA A;  3WKJ A;  4H9N A;  5DNN A;  3WAA D;  1HQ3 B;  3X1S A;  3B6G C;  2ZM5 A;  3AZH B;  1P3I D;  3REI A;  3AV2 A;  1EQZ D;  4J8U B;  1P3A C;  2CV5 D;  5CP6 A;  3MNN D;  1KX3 C;  4R8P C;  4CSR B;  5B32 A;  5AVC A;  2Y2L A;  2HUE B;  3X1U A;  3MGS D;  4H9Q B;  4ZBJ C;  3C1C A;  2NQB D;  3LEL D;  1B6W A;  3AZM B;  2PYO C;  5BNV B;  5AV8 A;  5AV9 A;  5AY8 C;  3AZL B;  5B1L B;  3B0C W;  3WA9 A;  1HQ3 D;  4G91 C;  5E5A D;  3LJA A;  3AZH D;  1M18 C;  3UT9 A;  3W99 B;  3REJ C;  3H0R C;  3REL C;  1KX4 A;  5JA4 B;  1P34 C;  3AZN C;  5B31 B;  1P3G A;  3W96 A;  3AYW A;  1WWI A;  4WU8 B;  4CAY A;  4Z66 C;  3AZM D;  5B24 C;  3AZL D;  3AZG C;  5F99 A;  3AZE B;  5B1L D;  3AZJ A;  3AFA B;  3LZ0 C;  3W99 D;  3KSY A;  1M19 C;  3O62 C;  5B31 D;  3REH B;  3WAA A;  4J8W A;  5BNX B;  5B2I B;  4H9S A;  3VH6 T;  3MVD C;  4WU8 D;  2Y2M A;  5CPI B;  1U35 B;  1P3I A;  1EQZ A;  5GXQ B;  3MNN A;  4X23 B;  3AZE D;  4EO5 C;  3KUY B;  4UUZ A;  3AFA D;  5GT3 B;  3FDD A;  4JJN C;  4WNN A;  2BYK B;  3NQJ B;  1S32 A;  3MGS A;  3TU4 C;  2NQB A;  2Y2O A;  3AZI C;  3AZF B;  3B6F B;  3REH D;  4H9N B;  2ARO C;  3VH5 T;  1HQ3 A;  2ZY5 A;  5DNN B;  5BT1 D;  5CPI D;  3WKJ C;  1U35 D;  4J8U A;  1AOI B;  1P3B A;  2CWE A;  3KWQ C;  4X23 D;  5CPJ A;  3REI C;  3AV2 C;  1ZLA B;  4NE5 A;  5AVC B;  5B32 B;  4G92 B;  5GT3 D;  1P3F A;  2F8N H;  4NE6 A;  1F66 C;  3X1U B;  3X1T B;  2ZY4 A;  1W2E A;  5BNV A;  4M6B A;  5AV9 B;  3AZF D;  5DNM B;  3B6F D;  2VQR A;  4XUJ A;  5AVB B;  5DNN D;  3X1S D;  5AV8 C;  2F8N G;  3H0M C;  3LJA B;  5GT0 B;  4KGC A;  2NZD A;  1AOI D;  3WA9 C;  4QLC B;  5CP6 D;  5AV5 C;  3AZK B;  3W97 C;  5B31 A;  1ZLA D;  5B32 D;  5AVC D;  4UPK A;  2BYM A;  5B40 C;  3AV1 B;  3REK A;  3W96 B;  3X1U D;  3LZ1 C;  1P3M C;  3X1T D;  5GSU C;  2G5I C;  1P3G C;  5B2J C;  5AV9 D;  3AYW C;  4LD9 C;  5DNM D;  5AV6 A;  3AFA A;  5AVB D;  3MGR B;  2YFV B;  5F99 C;  3LJA D;  5GT0 D;  3C1B A;  3KFU G;  4QLC D;  2BG1 A;  4H9O A;  1TAF B;  4AWL B;  3AZK D;  3REH A;  4NFT A;  1P3O C;  4WZS B;  3AV1 D;  4J8W B;  1M1A B;  3W96 D;  1TZY C;  5B2I A;  3EPJ A;  5CPI A;  1U35 A;  3WAA C;  5GXQ A;  2Y2H A;  5B0Y B;  1EQZ C;  3KUY A;  2CV5 C;  5GT3 A;  3MGR D;  3MNN C;  3A1I A;  5JRG B;  4KUD A;  3NQJ A;  2JSS A;  4WU9 B;  3R45 A;  3EPK A;  1T3U A;  3LEL C;  2NQB C;  4J8W D;  1M1A D;  3AN2 B;  1AOI A;  1HQ3 C;  3A6N B;  3MGP B;  1P3B B;  2Y2K A;  5E5A C;  3AZH C;  5B0Y D;  5CPJ B;  1ZLA A;  3NQU B;  5B31 G;  5JRG D;  1P3P A;  2HIO B;  1P3F B;  3X1V C;  1S32 D;  3X1T A;  5CPK B;  4WJ3 C;  2JCH A;  2HUE C;  5DNM A;  4XUJ B;  5AVB A;  3AZM C;  3AZL C;  3AN2 D;  5B1L C;  5GT0 A;  1H3O B;  2XD5 A;  4J8U D;  4QLC A;  3A6N D;  3MGP D;  1P3B D;  4KGC B;  2NZD B;  3W99 C;  5FUG A;  2YFW A;  3AZK A;  5CPJ D;  1P3L A;  1ID3 B;  3AV1 A;  2RIQ A;  2BYM B;  2HIO D;  1P3F D;  3REK B;  4XZQ A;  1Z2C B;  4J8X A;  4ZBJ B;  4ZUX A;  5AY8 B;  4WU8 C;  1BH8 A;  5AV6 B;  4XUJ D;  3MGR A;  1F1E A;  3KXB A;  2Y2P A;  2YFV A;  3AZE C;  3REJ B;  1B67 A;  3C1B B;  5BS7 A;  3AFA C;  4KGC D;  2NZD D;  4YS3 A;  1TAF A;  3AZN B;  4H9O B;  1ID3 D;  3UTB A;  1M1A A;  3REK D;  3REH C;  4YM6 B;  5BT1 C;  2FJ7 A;  5CPI C;  5B0Y A;  1U35 C;  5AV6 D;  2J8P A;  3W98 B;  1Q9C A;  1BH9 A;  4HGA B;  5B1M B;  4Z5T A;  3AL0 C;  5B32 G;  5JRG A;  4X23 C;  4KUD B;  1R4V A;  1P3K B;  3REJ D;  4WU9 A;  3C1B D;  5CHL B;  4H9R B;  5GT3 C;  3EPH A;  3R45 B;  3WTP A;  3AN2 A;  3AZF C;  5B2I D;  3B6F C;  3UTA C;  4YM6 D;  5DNN C;  3A6N A;  3MGP A;  3X1S C;  5GXQ D;  4H9P A;  1ULY A;  3W98 D;  3NQU A;  4Z2M H;  5B1M D;  3KUY D;  1KX5 A;  4JJN B;  2HIO A;  5CP6 C;  1P3K D;  1P3P B;  4KUD D;  4NE3 A;  5C3I C;  2Y2Q A;  2RVQ D;  1ZLA C;  5B32 C;  5AVC C;  4J8V A;  5CPK A;  5B33 B;  3X1U C;  3X1T C;  3EG5 B;  4DRA A;  4Z2M G;  3C1C C;  3B6G A;  5AV9 C;  5DNM C;  1H3O A;  5AVB C;  1A7W A;  3LJA C;  5GT0 C;  5FUG B;  2YFW B;  3UT9 C;  1ID3 A;  1P3L B;  4QLC C;  4KHA B;  4JJN D;  1P3P D;  1KX4 C;  3AZK C;  4XZQ B;  4J8X B;  2IO5 B;  2ZY3 A;  5B33 D;  3W96 C;  2F8N K;  5AY8 A;  4ZUX B;  4E44 A;  1BH8 B;  2Y2N A;  3VH6 W;  4WV4 B;  1M18 A;  3KXB B;  4DQY B;  3REJ A;  2DF4 C;  3AZJ C;  3REL A;  3MGR C;  3AZN A;  4YS3 B;  1P3L D;  4DRB A;  3UTB B;  4AWL C;  2G5H C;  4XZQ D;  2F2A C;  4J8X D;  4YM6 A;  4Z66 A;  4J8W C;  1M1A C;  3VH5 W;  3AZG A;  3B0C T;  4ZUX D;  4H9S C;  1P3I C;  2FJ7 B;  3W98 A;  5B1M A;  3LZ0 A;  4Z5T B;  1BH9 B;  2Y2G A;  3KXB D;  1P3K A;  5B0Y C;  3V9R A;  4H9R A;  1M19 A;  5JRG C;  5B0Z B;  3O62 A;  2UWX A;  4YS3 D;  3MGQ B;  1S32 C;  3P5J B;  3MGS C;  1JFI A;  3UTB D;  1PZR A;  3WTP B;  3MVD A;  1N1J B;  1WWS A;  3AN2 C;  4H9P B;  2FJ7 D;  3B0D B;  4E45 A;  4J8U C;  3MGP C;  4Z5T D;  1P3B C;  4JJN A;  1KX5 B;  5BO0 A;  5CPJ C;  4WU9 D;  3TU4 A;  5B33 A;  4J8V B;  2HIO C;  5B0Z D;  1P3F C;  3MGQ D;  2ARO A;  3B6G B;  3WTP D;  5G49 B;  4XUJ C;  1P3A B;  3KWQ A;  5E5A B;  1KX3 B;  4R8P B;  4KGC C;  2NZD C;  4KHA A;  1KX5 D;  1F66 A;  3X1V B;  1ID3 C;  5B31 C;  5CPK D;  4J8V D;  2PYO B;  3REK C;  3B6G D;  4G91 B;  1M18 B;  5AV6 C;  1P3A D;  3REL B;  1KX3 D;  3W97 A;  5AV5 A;  1P34 B;  4R8P D;  3C1B C;  5B40 A;  3B0B A;  3LZ1 A;  3X1V D;  1P3M A;  5GSU A;  4Z66 B;  2PYO D;  5B2J A;  4LD9 A;  5B24 B;  5AY8 D;  5B2I C;  3AZG B;  4YM6 C;  2LY8 A;  5GXQ C;  3LZ0 B;  1M18 D;  3W98 C;  3H0L C;  4HGA C;  5B1M C;  3KUY C;  2F8N A;  3V9R B;  3REL D;  1M19 B;  4KUD C;  5B0Z A;  1P3K C;  1P34 D;  3O62 B;  3MGQ A;  2RVQ C;  3AZN D;  1P3O A;  1JFI B;  1TZY A;  3MVD B;  2Y2J A;  1N1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...