3REHC

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehC00
4XUJD 3AZED 3WKJA 1BFMA 3AFAB 5GT0D 4WU8A 1P3IB 5GXQB 3MNNC 3TU4B 3A6NB 3W98D 5G49B 3WTPD 3W96B 3B6FD 5B31A 3X1UD 5E5AD 4ZUXB 4G92C 3REHA 4KUDC 1KX5C 4YS3B 3B0CT 4XUJC 4LD9D 1P3KA 3KWQB 3AZEC 3R45B 1P3OB 5GT0C 2BYKA 3REID 5JRGD 3MGQB 3UTBB 1U35A 3W97B 3W98C 3WTPC 4AWLB 3REKA 1HTAA 5B40D 1P3GB 3X1SB 3B6FC 5AV9B 3AZHA 4J8XC 3X1UC 5E5AC 1S32A 3MGRD 3WA9C 3AZKD 3O62A 2BYMB 1H3OB 4LD9C 2NZDA 5CPKA 4X23A 3AZJA 5B31G 5B2ID 1KX5B 3REIC 3AZLB 5B32D 3AZFA 1M1AD 5B0YD 5AV6B 5B2JB 4XUJB 3AZND 1KX4C 3A6NA 4CSRA 1P34A 5B40C 4Z2MG 1P3FB 5GT0B 1AOIA 3WAAD 3W99A 4CAYB 3KXBD 3LZ1A 3MGSB 3AZKC 5BS7A 1TAFA 5AVCD 5B1MA 4DRAA 5B2IC 5AV5B 3B0DC 4ZBJC 5BT1C 5B32C 5B0YC 5B1LA 3AZNC 3X1TA 5AV8C 4Z5TD 3AZGB 5F99B 3REHD 5JRGB 3MGPB 1P3MB 3MNNA 1ULYA 3AZID 4HGAC 5AVCC 5C3IC 4J8UD 1ID3B 1ZLAB 3MGRB 3AZKB 1P3PD 4KUDA 5CP6D 3AZMC 2CWEA 4Z5TC 5GT3D 3MVDD 3AZEA 1M1AB 1BH9A 3UT9D 5AY8D 3W98A 3AZIC 5CPKD 3WTPA 2YFWB 1R4VA 5AVBB 3LZ0D 4J8UC 3B6FA 3WAAB 3KXBB 3WTPE 4J8XA 3X1UA 5E5AA 5CP6C 1P3PC 2F8NA 3WA9A 3WKJB 5GT3C 4UUZA 4WU8B 3MVDC 4KGCD 4LD9A 3REIA 3UT9C 5AY8C 1M19D 5B31B 1KX4A 3REHB 4WU9C 3LZ0C 5B40A 1P3KB 4KHAA 2BYKB 4KGCC 2IO5C 3LELD 3AV2C 1U35B 5B2IA 3REKB 5B32A 5B0YA 1M19C 3AZNA 3AZHB 4XZQC 1S32B 5AV8A 4M6BA 2CV5C 3O62B 2FJ7D 2JSSA 2NZDB 5CPKB 4X23B 3AZJB 4H9PA 3LELC 3AZFB 5AVCA 4NE3A 4CSRB 1P34B 2NQBD 3AZMA 3V9RA 1AOIB 3W99B 5CPID 4Z5TA 3LZ1B 4J8XD 2F8ND 2FJ7C 1TAFB 3WA9D 5B1MB 2PYOD 3B6GD 3AZIA 3KSYA 5FUGA 4J8UA 2L5AA 5B1LB 3X1TB 3C1CD 5GSUD 1P3PA 2NQBC 5CP6A 3C1BD 1KX4D 5CPIC 5GT3A 3MVDA 3MNNB 4QLCD 3UT9A 5DNND 2RVQC 5AY8A 5KDMA 2PYOC 3B6GC 4G92B 4KUDB 4WU9A 4J8VA 3LZ0A 2HUEC 4J8WD 1HQ3C 5BT1D 3LJAC 3C1CC 5GSUC 3C1BC 5AV8D 3AZEB 4H9RA 1BH9B 4KGCA 1F1EA 1P3LA 1KU5A 4QLCC 3AV2A 3W98B 3AN2C 3WTPB 5DNNC 1WWIA 3B6FB 5B24D 1M19A 4J8XB 3X1UB 5E5AB 4XZQA 2F8NB 4JJNC 3WA9B 2CV5A 4J8WC 3AYWD 4UUZB 3AZMD 4LD9B 5BNXA 4WV4B 3REJA 4NFTA 3REIB 1P3AD 1EQZD 3LELA 4Z66C 1WWSA 2AROD 1KX3A 4Z2MH 1KX4B 1M18D 5B40B 5B24C 4E45A 4EO5C 4H9OA 4R8PC 2FJ7A 3AYWC 4KHAB 1JFIA 5DNMD 1P3BC 3RELD 5B2IB 3B0DB 4ZBJB 1P3AC 5B32B 1EQZC 2AROC 5B0YB 3AZNB 4DRBA 1M18C 5AV8B 2NQBA 1F66D 4WU9D 4J8VD 5CPJD 5CPIA 3KUYA 5BNVA 4H9PB 4HGAB 5DNMC 2HIOD 5AVCB 5C3IB 3RELC 1P3LD 1TZYD 3AV1D 4WNNA 2PYOA 3B6GA 3AV2D 4G91C 3AZMB 3V9RB 1HQ3A 3LJAA 4Z5TB 5GSUA 3C1CA 3X1VD 1F66C 3C1BA 3UTAD 4XZQD 4J8VC 5CPJC 2CV5D 4QLCA 3AZIB 3REJD 4H9SC 3NQJA 2HIOC 5FUGB 3AFAD 3AN2A 5DNNA 4J8UB 1P3ID 1P3LC 1TZYC 5B33C 3AV1C 4H9NA 1P3PB 2F8NG 1KX3D 5CP6B 4JJNA 4J8WA 3X1VC 5GT3B 1BH8A 3MVDB 4ZUXD 3UTAC 4YS3D 3UT9B 4Z66A 3KWQD 5AY8B 5KDMB 3REJC 3AFAC 1P3IC 4WU9B 4J8VB 5GXQC 3LZ0B 3MGQD 5B24A 3TU4C 3W97D 1KX3C 4R8PA 3W96C 1P3GD 3AYWA 4H9RB 4KGCB 4ZUXC 1P3LB 1P3BA 2IO5B 3AV1B 3KUYD 3AV2B 4YS3C 1P3AA 1EQZA 5B32G 4WZSB 2AROA 3KWQC 1M19B 2YFVA 4H9QA 1P3OC 2RVQD 4NE5A 3VH5A 4XZQB 1M18A 3MGQC 2CV5B 4YM6D 3NQUA 5AV6D 3W97C 1HQ3D 5BNXB 4AWLC 5JA4A 3LJAD 1P3GC 3REJB 3X1SC 1P3FD 5AV9C 5DNMA 3LELB 3MGSD 3KUYC 3VH6A 4E44A 3RELA 1KX3B 3AN2D 5AV5D 4H9OB 3AZLC 4YM6C 1F66A 2FJ7B 5AV6C 5B2JC 4JJND 5B0ZA 5CPJA 1JFIB 5BO0A 3AZGD 5F99D 1P3FC 3MGPD 4H9SA 1P3MD 2HIOA 3MGSC 1N1JA 5B33A 1TZYA 4Z66D 3AV1A 2NQBB 1ID3D 1ZLAD 5AV5C 5CPIB 3KUYB 3X1VA 3UTAA 5BNVB 4R8PD 3VH5W 3AZGC 5F99C 1P3BD 5JRGC 3MGPC 2PYOB 4WNNB 3B6GB 4YM6B 3AFAA 1P3MC 1P3IA 5GXQA 2HUEB 3TU4A 1HQ3B 3LJAB 3C1CB 5G49A 5GSUB 3C1BB 5AVBD 3W96A 1ID3C 3VH6W 1ZLAC 3MGRC 4ZUXA 3WKJD 4QLCB 2F8NK 4YS3A 3NQJB 3AN2B 4WU8D 5DNNB 3KWQA 3R45A 4H9NB 1P3OA 1M1AC 3MGQA 4JJNB 4J8WB 3UTBA 3W97A 1BH8B 5B31D 3WAAC 5AVBC 1P3GA 3X1SA 3KXBC 5AV9A 5B0ZD 4Z66B 1P3KD 3WKJC 2BYMA 4WU8C 1Q9CA 1H3OA 5B24B 4EO5B 1U35D 1KX5A 5B33D 4R8PB 3REKD 3AZLA 4YM6A 3AYWB 5AV6A 5B2JA 4XUJA 3AZHD 5B31C 1S32D 3REHC 1P3BB 1P3FA 5GT0A 3O62D 4CAYA 3B0CW 5B0ZC 1P3AB 2AROB 3MGSA 1P3KC 1EQZB 4NE6A 2NZDD 2YFVB 4X23D 3AZJD 4H9QB 1M18B 3AZFD 3NQUB 1U35C 5GXQD 5AV5A 3TU4D 3A6ND 3B0BA 3REKC 5JA4B 1P34D 1AOID 3AZHC 1B67A 3W99D 3W96D 1S32C 3VH5T 5DNMB 3AZGA 3LZ1D 5F99A 3RELB 3O62C 5JRGA 3MGPA 1P3MA 2NZDC 4G91B 5CPKC 4X23C 3AZJC 5B1MD 3AZFC 1P3OD 1F66B 3VH6T 5B1LD 1ID3A 3X1TD 5B0ZB 3MGRA 5CPJB 1ZLAA 3A6NC 5BO0B 3UTBD 3AZKA 1P34C 1AOIC 3W99C 3X1SD 2HIOB 3LZ1C 5AV9D 1N1JB 5BS7C 3MNND 2F8NH 1A7WA 1TZYB 5B33B 1M1AA 5CHLB 5B1MC 3X1VB 1B6WA 4KUDD 2YFWA 5AVBA 3UTAB 1KX5D 3WAAA 5B1LC 3X1TC 3AZLD 3KXBA 2LY8A 3UTBC 5B2JD
chains in the Genus database with same CATH superfamily
4XUJD 3AZED 3WKJA 1BFMA 1Z2CB 3AFAB 5GT0D 4WU8A 1P3IB 5GXQB 3MNNC 2J8PA 3TU4B 2FFFB 3A6NB 3W98D 5G49B 3WTPD 2JCHA 2XD1A 3B6FD 3W96B 5B31A 3X1UD 5E5AD 4ZUXB 4G92C 3REHA 4KUDC 1KX5C 2BG1A 4YS3B 3B0CT 4XUJC 4LD9D 1P3KA 3KWQB 3AZEC 3R45B 1P3OB 5GT0C 2BYKA 3REID 5JRGD 3MGQB 3UTBB 1U35A 3W97B 3W98C 2ZY4A 3WTPC 4AWLB 3REKA 1HTAA 5B40D 1P3GB 3X1SB 3B6FC 5AV9B 3AZHA 4J8XC 3X1UC 5E5AC 1S32A 3MGRD 3WA9C 3AZKD 3O62A 2Y2LA 2BYMB 1H3OB 4LD9C 2NZDA 3H0MC 5CPKA 4X23A 3AZJA 5B31G 2F2AC 5B2ID 1KX5B 3REIC 3AZLB 5B32D 3AZFA 1M1AD 5B0YD 5AV6B 5B2JB 4XUJB 3AZND 1KX4C 3A6NA 4CSRA 1P34A 5B40C 4Z2MG 1P3FB 5GT0B 1AOIA 3WAAD 3W99A 4CAYB 2Y2OA 3KXBD 3LZ1A 3MGSB 5BS7A 3AZKC 2JE5A 1TAFA 5AVCD 5B1MA 4DRAA 5B2IC 5AV5B 3B0DC 4ZBJC 5BT1C 5B32C 5B0YC 5B1LA 3AZNC 3X1TA 5AV8C 4Z5TD 3AZGB 5F99B 3REHD 5JRGB 3MGPB 1P3MB 3MNNA 1ULYA 3AZID 4HGAC 5AVCC 5C3IC 4J8UD 1ID3B 1ZLAB 3MGRB 3AZKB 1P3PD 4KUDA 5CP6D 3AZMC 2CWEA 4Z5TC 5GT3D 3MVDD 3AZEA 1M1AB 1BH9A 3UT9D 5AY8D 3W98A 3AZIC 5CPKD 3EPLA 3WTPA 1W2EA 1R4VA 2YFWB 5AVBB 3LZ0D 4J8UC 3B6FA 3WAAB 3KXBB 3WTPE 4J8XA 3X1UA 5E5AA 5CP6C 2ZM5A 1P3PC 2F8NA 3WA9A 3WKJB 5GT3C 4UUZA 4WU8B 3MVDC 4KGCD 4LD9A 3P5JB 3REIA 3UT9C 5AY8C 1M19D 3KFUG 5B31B 1KX4A 3REHB 4WU9C 3LZ0C 2RIQA 5B40A 2Y2MA 1P3KB 4KHAA 2BYKB 4KGCC 2IO5C 3LELD 2Y2QA 3AV2C 1U35B 5B2IA 3REKB 5B32A 3EPHA 5B0YA 1M19C 3AZNA 3AZHB 4XZQC 1S32B 5AV8A 4M6BA 2CV5C 3O62B 2FJ7D 2JSSA 2NZDB 5CPKB 4X23B 3AZJB 4H9PA 3LELC 3AZFB 5AVCA 3F6TA 4NE3A 4CSRB 1P34B 2NQBD 2Y2NA 3AZMA 3V9RA 1AOIB 3W99B 5CPID 4Z5TA 3LZ1B 4J8XD 3EPKA 2F8ND 2FJ7C 1TAFB 3WA9D 5B1MB 2PYOD 3B6GD 3AZIA 3KSYA 5FUGA 4J8UA 2L5AA 5B1LB 3X1TB 3C1CD 5GSUD 1P3PA 2NQBC 5CP6A 3C1BD 1KX4D 5CPIC 2Y2PA 5GT3A 3MVDA 3MNNB 4QLCD 3UT9A 5DNND 2RVQC 5AY8A 5KDMA 2PYOC 3B6GC 4G92B 4KUDB 4WU9A 4J8VA 3LZ0A 2HUEC 4J8WD 1HQ3C 5BT1D 3LJAC 3C1CC 5GSUC 3C1BC 5AV8D 3AZEB 4H9RA 1BH9B 4KGCA 1F1EA 1P3LA 1KU5A 4QLCC 3AV2A 3W98B 3AN2C 3WTPB 5DNNC 1WWIA 3B6FB 5B24D 1M19A 4J8XB 3X1UB 5E5AB 4XZQA 2F8NB 4JJNC 2DF4C 3WA9B 2CV5A 4J8WC 3AYWD 4UUZB 3AZMD 4LD9B 5BNXA 4WV4B 3REJA 4NFTA 3REIB 1P3AD 1EQZD 3LELA 4Z66C 1WWSA 2AROD 2ZY2A 1KX3A 2XD5A 4Z2MH 1KX4B 1M18D 5B40B 5B24C 4E45A 4EO5C 4H9OA 4R8PC 2FJ7A 3AYWC 4KHAB 1JFIA 5DNMD 1P3BC 3RELD 5B2IB 3B0DB 4ZBJB 1P3AC 2ZY3A 5B32B 2AROC 5B0YB 4DQYB 1EQZC 3AZNB 4DRBA 1M18C 5AV8B 2NQBA 1F66D 4WU9D 4J8VD 5CPJD 5CPIA 3KUYA 5BNVA 4H9PB 4HGAB 5DNMC 2Y2JA 2HIOD 5AVCB 5C3IB 3RELC 1P3LD 3A1IA 1TZYD 3AV1D 4WNNA 2PYOA 3B6GA 3AV2D 3H0LC 4G91C 3AZMB 3V9RB 1HQ3A 3LJAA 4Z5TB 5GSUA 3C1CA 2DQNC 3EPJA 3X1VD 1F66C 3C1BA 3UTAD 4XZQD 4J8VC 5CPJC 2CV5D 4QLCA 3AZIB 3REJD 4H9SC 3NQJA 2HIOC 5FUGB 3AFAD 3AN2A 5DNNA 4J8UB 1P3ID 1P3LC 1TZYC 5B33C 3AV1C 4H9NA 2ZY5A 1P3PB 1KX3D 5CP6B 3IP4C 2W8SA 4JJNA 2F8NG 2VQRA 4J8WA 3A1KA 3X1VC 5GT3B 1BH8A 3MVDB 4ZUXD 3UTAC 4YS3D 3UT9B 4Z66A 3KWQD 2Y2GA 5AY8B 5KDMB 3REJC 3AFAC 1P3IC 4WU9B 4J8VB 5GXQC 3LZ0B 3MGQD 5B24A 3TU4C 4UPKA 3W97D 1KX3C 4R8PA 3W96C 1P3GD 3AYWA 4H9RB 4KGCB 4ZUXC 1P3LB 1P3BA 2IO5B 3AV1B 3KUYD 3AV2B 4YS3C 1P3AA 1EQZA 5B32G 4WZSB 2AROA 3KWQC 1M19B 2YFVA 4H9QA 1P3OC 2RVQD 4NE5A 3VH5A 4XZQB 1M18A 3MGQC 2CV5B 4YM6D 3NQUA 5AV6D 3W97C 1HQ3D 5BNXB 4AWLC 5JA4A 3LJAD 1P3GC 3REJB 3X1SC 1P3FD 5AV9C 5DNMA 3LELB 3MGSD 3KUYC 3VH6A 4E44A 3RELA 1KX3B 3AN2D 5AV5D 4H9OB 3AZLC 4YM6C 1F66A 2FJ7B 5AV6C 5B2JC 2Y2KA 4JJND 5B0ZA 5CPJA 1JFIB 5BO0A 3AZGD 5F99D 1P3FC 3MGPD 4H9SA 1P3MD 2HIOA 3MGSC 1N1JA 4WJ3C 5B33A 1TZYA 4Z66D 3EG5B 3AV1A 2NQBB 1ID3D 1ZLAD 5AV5C 5CPIB 3KUYB 3X1VA 3UTAA 5BNVB 4R8PD 3AL0C 3VH5W 3AZGC 5F99C 3FDDA 1P3BD 5JRGC 3MGPC 2PYOB 4WNNB 3B6GB 4YM6B 3AFAA 1P3MC 1P3IA 5GXQA 2HUEB 3TU4A 1HQ3B 3LJAB 3C1CB 5G49A 5GSUB 3C1BB 5AVBD 1PZRA 3W96A 1ID3C 3VH6W 1ZLAC 3MGRC 4ZUXA 3WKJD 4QLCB 3H0RC 2F8NK 4YS3A 3NQJB 3AN2B 4WU8D 5DNNB 3KWQA 3R45A 4H9NB 1P3OA 1M1AC 3MGQA 4JJNB 4J8WB 3UTBA 3W97A 1BH8B 5B31D 2UWXA 3WAAC 5AVBC 1P3GA 3X1SA 3KXBC 5AV9A 5B0ZD 4Z66B 1P3KD 3WKJC 2BYMA 4WU8C 1Q9CA 1H3OA 5B24B 4EO5B 1U35D 1KX5A 5B33D 4R8PB 3REKD 3AZLA 4YM6A 3AYWB 5AV6A 5B2JA 4XUJA 3AZHD 5B31C 1S32D 3REHC 1P3BB 1P3FA 5GT0A 3O62D 4CAYA 3B0CW 5B0ZC 1P3AB 2AROB 3MGSA 1P3KC 1EQZB 4NE6A 2NZDD 2YFVB 4X23D 3AZJD 4H9QB 1M18B 3AZFD 3NQUB 1U35C 5GXQD 5AV5A 3TU4D 3A6ND 3B0BA 3REKC 5JA4B 1P34D 2G5HC 1AOID 3AZHC 1B67A 3W99D 3W96D 1S32C 3VH5T 5DNMB 3AZGA 3LZ1D 5F99A 3RELB 3O62C 5JRGA 3MGPA 2G5IC 1P3MA 2NZDC 4G91B 5CPKC 4X23C 3AZJC 5B1MD 3AZFC 1P3OD 1F66B 3VH6T 5B1LD 1ID3A 3X1TD 5B0ZB 3MGRA 5CPJB 1ZLAA 3A6NC 5BO0B 2Y2IA 3UTBD 3AZKA 1P34C 1AOIC 3W99C 3X1SD 2HIOB 3LZ1C 5AV9D 1N1JB 5BS7C 3MNND 2F8NH 1A7WA 1TZYB 5B33B 1M1AA 1T3UA 5CHLB 5B1MC 2Y2HA 3X1VB 1B6WA 4KUDD 2YFWA 5AVBA 3UTAB 1KX5D 3WAAA 5B1LC 3X1TC 3AZLD 3KXBA 2LY8A 3UTBC 5B2JD
chains in the Genus database with same CATH topology
4XUJD 3AZED 3WKJA 1BFMA 1Z2CB 3AFAB 5GT0D 4WU8A 1P3IB 5GXQB 3MNNC 2J8PA 3TU4B 2FFFB 3A6NB 3W98D 5G49B 3WTPD 2JCHA 2XD1A 3B6FD 3W96B 5B31A 3X1UD 5E5AD 4ZUXB 4G92C 3REHA 4KUDC 1KX5C 2BG1A 4YS3B 3B0CT 4XUJC 4LD9D 1P3KA 3KWQB 3AZEC 3R45B 1P3OB 5GT0C 2BYKA 3REID 5JRGD 3MGQB 3UTBB 1U35A 3W97B 3W98C 2ZY4A 3WTPC 4AWLB 3REKA 1HTAA 5B40D 1P3GB 3X1SB 3B6FC 5AV9B 3AZHA 4J8XC 3X1UC 5E5AC 1S32A 3MGRD 3WA9C 3AZKD 3O62A 2Y2LA 2BYMB 1H3OB 4LD9C 2NZDA 3H0MC 5CPKA 4X23A 3AZJA 5B31G 2F2AC 5B2ID 1KX5B 3REIC 3AZLB 5B32D 3AZFA 1M1AD 5B0YD 5AV6B 5B2JB 4XUJB 3AZND 1KX4C 3A6NA 4CSRA 1P34A 5B40C 4Z2MG 1P3FB 5GT0B 1AOIA 3WAAD 3W99A 4CAYB 2Y2OA 3KXBD 3LZ1A 3MGSB 5BS7A 3AZKC 2JE5A 1TAFA 5AVCD 5B1MA 4DRAA 5B2IC 5AV5B 3B0DC 4ZBJC 5BT1C 5B32C 5B0YC 5B1LA 3AZNC 3X1TA 5AV8C 4Z5TD 3AZGB 5F99B 3REHD 5JRGB 3MGPB 1P3MB 3MNNA 1ULYA 3AZID 4HGAC 5AVCC 5C3IC 4J8UD 1ID3B 1ZLAB 3MGRB 3AZKB 1P3PD 4KUDA 5CP6D 3AZMC 2CWEA 4Z5TC 5GT3D 3MVDD 3AZEA 1M1AB 1BH9A 3UT9D 5AY8D 3W98A 3AZIC 5CPKD 3EPLA 3WTPA 1W2EA 1R4VA 2YFWB 5AVBB 3LZ0D 4J8UC 3B6FA 3WAAB 3KXBB 3WTPE 4J8XA 3X1UA 5E5AA 5CP6C 2ZM5A 1P3PC 2F8NA 3WA9A 3WKJB 5GT3C 4UUZA 4WU8B 3MVDC 4KGCD 4LD9A 3P5JB 3REIA 3UT9C 5AY8C 1M19D 3KFUG 5B31B 1KX4A 3REHB 4WU9C 3LZ0C 2RIQA 5B40A 2Y2MA 1P3KB 4KHAA 2BYKB 4KGCC 2IO5C 3LELD 2Y2QA 3AV2C 1U35B 5B2IA 3REKB 5B32A 3EPHA 5B0YA 1M19C 3AZNA 3AZHB 4XZQC 1S32B 5AV8A 4M6BA 2CV5C 3O62B 2FJ7D 2JSSA 2NZDB 5CPKB 4X23B 3AZJB 4H9PA 3LELC 3AZFB 5AVCA 3F6TA 4NE3A 4CSRB 1P34B 2NQBD 2Y2NA 3AZMA 3V9RA 1AOIB 3W99B 5CPID 4Z5TA 3LZ1B 4J8XD 3EPKA 2F8ND 2FJ7C 1TAFB 3WA9D 5B1MB 2PYOD 3B6GD 3AZIA 3KSYA 5FUGA 4J8UA 2L5AA 5B1LB 3X1TB 3C1CD 5GSUD 1P3PA 2NQBC 5CP6A 3C1BD 1KX4D 5CPIC 2Y2PA 5GT3A 3MVDA 3MNNB 4QLCD 3UT9A 5DNND 2RVQC 5AY8A 5KDMA 2PYOC 3B6GC 4G92B 4KUDB 4WU9A 4J8VA 3LZ0A 2HUEC 4J8WD 1HQ3C 5BT1D 3LJAC 3C1CC 5GSUC 3C1BC 5AV8D 3AZEB 4H9RA 1BH9B 4KGCA 1F1EA 1P3LA 1KU5A 4QLCC 3AV2A 3W98B 3AN2C 3WTPB 5DNNC 1WWIA 3B6FB 5B24D 1M19A 4J8XB 3X1UB 5E5AB 4XZQA 2F8NB 4JJNC 2DF4C 3WA9B 2CV5A 4J8WC 3AYWD 4UUZB 3AZMD 4LD9B 5BNXA 4WV4B 3REJA 4NFTA 3REIB 1P3AD 1EQZD 3LELA 4Z66C 1WWSA 2AROD 2ZY2A 1KX3A 2XD5A 4Z2MH 1KX4B 1M18D 5B40B 5B24C 4E45A 4EO5C 4H9OA 4R8PC 2FJ7A 3AYWC 4KHAB 1JFIA 5DNMD 1P3BC 3RELD 5B2IB 3B0DB 4ZBJB 1P3AC 2ZY3A 5B32B 2AROC 5B0YB 4DQYB 1EQZC 3AZNB 4DRBA 1M18C 5AV8B 2NQBA 1F66D 4WU9D 4J8VD 5CPJD 5CPIA 3KUYA 5BNVA 4H9PB 4HGAB 5DNMC 2Y2JA 2HIOD 5AVCB 5C3IB 3RELC 1P3LD 3A1IA 1TZYD 3AV1D 4WNNA 2PYOA 3B6GA 3AV2D 3H0LC 4G91C 3AZMB 3V9RB 1HQ3A 3LJAA 4Z5TB 5GSUA 3C1CA 2DQNC 3EPJA 3X1VD 1F66C 3C1BA 3UTAD 4XZQD 4J8VC 5CPJC 2CV5D 4QLCA 3AZIB 3REJD 4H9SC 3NQJA 2HIOC 5FUGB 3AFAD 3AN2A 5DNNA 4J8UB 1P3ID 1P3LC 1TZYC 5B33C 3AV1C 4H9NA 2ZY5A 1P3PB 1KX3D 5CP6B 3IP4C 2W8SA 4JJNA 2F8NG 2VQRA 4J8WA 3A1KA 3X1VC 5GT3B 1BH8A 3MVDB 4ZUXD 3UTAC 4YS3D 3UT9B 4Z66A 3KWQD 2Y2GA 5AY8B 5KDMB 3REJC 3AFAC 1P3IC 4WU9B 4J8VB 5GXQC 3LZ0B 3MGQD 5B24A 3TU4C 4UPKA 3W97D 1KX3C 4R8PA 3W96C 1P3GD 3AYWA 4H9RB 4KGCB 4ZUXC 1P3LB 1P3BA 2IO5B 3AV1B 3KUYD 3AV2B 4YS3C 1P3AA 1EQZA 5B32G 4WZSB 2AROA 3KWQC 1M19B 2YFVA 4H9QA 1P3OC 2RVQD 4NE5A 3VH5A 4XZQB 1M18A 3MGQC 2CV5B 4YM6D 3NQUA 5AV6D 3W97C 1HQ3D 5BNXB 4AWLC 5JA4A 3LJAD 1P3GC 3REJB 3X1SC 1P3FD 5AV9C 5DNMA 3LELB 3MGSD 3KUYC 3VH6A 4E44A 3RELA 1KX3B 3AN2D 5AV5D 4H9OB 3AZLC 4YM6C 1F66A 2FJ7B 5AV6C 5B2JC 2Y2KA 4JJND 5B0ZA 5CPJA 1JFIB 5BO0A 3AZGD 5F99D 1P3FC 3MGPD 4H9SA 1P3MD 2HIOA 3MGSC 1N1JA 4WJ3C 5B33A 1TZYA 4Z66D 3EG5B 3AV1A 2NQBB 1ID3D 1ZLAD 5AV5C 5CPIB 3KUYB 3X1VA 3UTAA 5BNVB 4R8PD 3AL0C 3VH5W 3AZGC 5F99C 3FDDA 1P3BD 5JRGC 3MGPC 2PYOB 4WNNB 3B6GB 4YM6B 3AFAA 1P3MC 1P3IA 5GXQA 2HUEB 3TU4A 1HQ3B 3LJAB 3C1CB 5G49A 5GSUB 3C1BB 5AVBD 1PZRA 3W96A 1ID3C 3VH6W 1ZLAC 3MGRC 4ZUXA 3WKJD 4QLCB 3H0RC 2F8NK 4YS3A 3NQJB 3AN2B 4WU8D 5DNNB 3KWQA 3R45A 4H9NB 1P3OA 1M1AC 3MGQA 4JJNB 4J8WB 3UTBA 3W97A 1BH8B 5B31D 2UWXA 3WAAC 5AVBC 1P3GA 3X1SA 3KXBC 5AV9A 5B0ZD 4Z66B 1P3KD 3WKJC 2BYMA 4WU8C 1Q9CA 1H3OA 5B24B 4EO5B 1U35D 1KX5A 5B33D 4R8PB 3REKD 3AZLA 4YM6A 3AYWB 5AV6A 5B2JA 4XUJA 3AZHD 5B31C 1S32D 3REHC 1P3BB 1P3FA 5GT0A 3O62D 4CAYA 3B0CW 5B0ZC 1P3AB 2AROB 3MGSA 1P3KC 1EQZB 4NE6A 2NZDD 2YFVB 4X23D 3AZJD 4H9QB 1M18B 3AZFD 3NQUB 1U35C 5GXQD 5AV5A 3TU4D 3A6ND 3B0BA 3REKC 5JA4B 1P34D 2G5HC 1AOID 3AZHC 1B67A 3W99D 3W96D 1S32C 3VH5T 5DNMB 3AZGA 3LZ1D 5F99A 3RELB 3O62C 5JRGA 3MGPA 2G5IC 1P3MA 2NZDC 4G91B 5CPKC 4X23C 3AZJC 5B1MD 3AZFC 1P3OD 1F66B 3VH6T 5B1LD 1ID3A 3X1TD 5B0ZB 3MGRA 5CPJB 1ZLAA 3A6NC 5BO0B 2Y2IA 3UTBD 3AZKA 1P34C 1AOIC 3W99C 3X1SD 2HIOB 3LZ1C 5AV9D 1N1JB 5BS7C 3MNND 2F8NH 1A7WA 1TZYB 5B33B 1M1AA 1T3UA 5CHLB 5B1MC 2Y2HA 3X1VB 1B6WA 4KUDD 2YFWA 5AVBA 3UTAB 1KX5D 3WAAA 5B1LC 3X1TC 3AZLD 3KXBA 2LY8A 3UTBC 5B2JD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ D;  3AZE D;  3WKJ A;  1BFM A;  3AFA B;  5GT0 D;  4WU8 A;  1P3I B;  5GXQ B;  3MNN C;  3TU4 B;  3A6N B;  3W98 D;  5G49 B;  3WTP D;  3W96 B;  3B6F D;  5B31 A;  3X1U D;  5E5A D;  4ZUX B;  4G92 C;  3REH A;  4KUD C;  1KX5 C;  4YS3 B;  3B0C T;  4XUJ C;  4LD9 D;  1P3K A;  3KWQ B;  3AZE C;  3R45 B;  1P3O B;  5GT0 C;  2BYK A;  3REI D;  5JRG D;  3MGQ B;  3UTB B;  1U35 A;  3W97 B;  3W98 C;  3WTP C;  4AWL B;  3REK A;  1HTA A;  5B40 D;  1P3G B;  3X1S B;  3B6F C;  5AV9 B;  3AZH A;  4J8X C;  3X1U C;  5E5A C;  1S32 A;  3MGR D;  3WA9 C;  3AZK D;  3O62 A;  2BYM B;  1H3O B;  4LD9 C;  2NZD A;  5CPK A;  4X23 A;  3AZJ A;  5B31 G;  5B2I D;  1KX5 B;  3REI C;  3AZL B;  5B32 D;  3AZF A;  1M1A D;  5B0Y D;  5AV6 B;  5B2J B;  4XUJ B;  3AZN D;  1KX4 C;  3A6N A;  4CSR A;  1P34 A;  5B40 C;  4Z2M G;  1P3F B;  5GT0 B;  1AOI A;  3WAA D;  3W99 A;  4CAY B;  3KXB D;  3LZ1 A;  3MGS B;  3AZK C;  5BS7 A;  1TAF A;  5AVC D;  5B1M A;  4DRA A;  5B2I C;  5AV5 B;  3B0D C;  4ZBJ C;  5BT1 C;  5B32 C;  5B0Y C;  5B1L A;  3AZN C;  3X1T A;  5AV8 C;  4Z5T D;  3AZG B;  5F99 B;  3REH D;  5JRG B;  3MGP B;  1P3M B;  3MNN A;  1ULY A;  3AZI D;  4HGA C;  5AVC C;  5C3I C;  4J8U D;  1ID3 B;  1ZLA B;  3MGR B;  3AZK B;  1P3P D;  4KUD A;  5CP6 D;  3AZM C;  2CWE A;  4Z5T C;  5GT3 D;  3MVD D;  3AZE A;  1M1A B;  1BH9 A;  3UT9 D;  5AY8 D;  3W98 A;  3AZI C;  5CPK D;  3WTP A;  2YFW B;  1R4V A;  5AVB B;  3LZ0 D;  4J8U C;  3B6F A;  3WAA B;  3KXB B;  3WTP E;  4J8X A;  3X1U A;  5E5A A;  5CP6 C;  1P3P C;  2F8N A;  3WA9 A;  3WKJ B;  5GT3 C;  4UUZ A;  4WU8 B;  3MVD C;  4KGC D;  4LD9 A;  3REI A;  3UT9 C;  5AY8 C;  1M19 D;  5B31 B;  1KX4 A;  3REH B;  4WU9 C;  3LZ0 C;  5B40 A;  1P3K B;  4KHA A;  2BYK B;  4KGC C;  2IO5 C;  3LEL D;  3AV2 C;  1U35 B;  5B2I A;  3REK B;  5B32 A;  5B0Y A;  1M19 C;  3AZN A;  3AZH B;  4XZQ C;  1S32 B;  5AV8 A;  4M6B A;  2CV5 C;  3O62 B;  2FJ7 D;  2JSS A;  2NZD B;  5CPK B;  4X23 B;  3AZJ B;  4H9P A;  3LEL C;  3AZF B;  5AVC A;  4NE3 A;  4CSR B;  1P34 B;  2NQB D;  3AZM A;  3V9R A;  1AOI B;  3W99 B;  5CPI D;  4Z5T A;  3LZ1 B;  4J8X D;  2F8N D;  2FJ7 C;  1TAF B;  3WA9 D;  5B1M B;  2PYO D;  3B6G D;  3AZI A;  3KSY A;  5FUG A;  4J8U A;  2L5A A;  5B1L B;  3X1T B;  3C1C D;  5GSU D;  1P3P A;  2NQB C;  5CP6 A;  3C1B D;  1KX4 D;  5CPI C;  5GT3 A;  3MVD A;  3MNN B;  4QLC D;  3UT9 A;  5DNN D;  2RVQ C;  5AY8 A;  5KDM A;  2PYO C;  3B6G C;  4G92 B;  4KUD B;  4WU9 A;  4J8V A;  3LZ0 A;  2HUE C;  4J8W D;  1HQ3 C;  5BT1 D;  3LJA C;  3C1C C;  5GSU C;  3C1B C;  5AV8 D;  3AZE B;  4H9R A;  1BH9 B;  4KGC A;  1F1E A;  1P3L A;  1KU5 A;  4QLC C;  3AV2 A;  3W98 B;  3AN2 C;  3WTP B;  5DNN C;  1WWI A;  3B6F B;  5B24 D;  1M19 A;  4J8X B;  3X1U B;  5E5A B;  4XZQ A;  2F8N B;  4JJN C;  3WA9 B;  2CV5 A;  4J8W C;  3AYW D;  4UUZ B;  3AZM D;  4LD9 B;  5BNX A;  4WV4 B;  3REJ A;  4NFT A;  3REI B;  1P3A D;  1EQZ D;  3LEL A;  4Z66 C;  1WWS A;  2ARO D;  1KX3 A;  4Z2M H;  1KX4 B;  1M18 D;  5B40 B;  5B24 C;  4E45 A;  4EO5 C;  4H9O A;  4R8P C;  2FJ7 A;  3AYW C;  4KHA B;  1JFI A;  5DNM D;  1P3B C;  3REL D;  5B2I B;  3B0D B;  4ZBJ B;  1P3A C;  5B32 B;  1EQZ C;  2ARO C;  5B0Y B;  3AZN B;  4DRB A;  1M18 C;  5AV8 B;  2NQB A;  1F66 D;  4WU9 D;  4J8V D;  5CPJ D;  5CPI A;  3KUY A;  5BNV A;  4H9P B;  4HGA B;  5DNM C;  2HIO D;  5AVC B;  5C3I B;  3REL C;  1P3L D;  1TZY D;  3AV1 D;  4WNN A;  2PYO A;  3B6G A;  3AV2 D;  4G91 C;  3AZM B;  3V9R B;  1HQ3 A;  3LJA A;  4Z5T B;  5GSU A;  3C1C A;  3X1V D;  1F66 C;  3C1B A;  3UTA D;  4XZQ D;  4J8V C;  5CPJ C;  2CV5 D;  4QLC A;  3AZI B;  3REJ D;  4H9S C;  3NQJ A;  2HIO C;  5FUG B;  3AFA D;  3AN2 A;  5DNN A;  4J8U B;  1P3I D;  1P3L C;  1TZY C;  5B33 C;  3AV1 C;  4H9N A;  1P3P B;  2F8N G;  1KX3 D;  5CP6 B;  4JJN A;  4J8W A;  3X1V C;  5GT3 B;  1BH8 A;  3MVD B;  4ZUX D;  3UTA C;  4YS3 D;  3UT9 B;  4Z66 A;  3KWQ D;  5AY8 B;  5KDM B;  3REJ C;  3AFA C;  1P3I C;  4WU9 B;  4J8V B;  5GXQ C;  3LZ0 B;  3MGQ D;  5B24 A;  3TU4 C;  3W97 D;  1KX3 C;  4R8P A;  3W96 C;  1P3G D;  3AYW A;  4H9R B;  4KGC B;  4ZUX C;  1P3L B;  1P3B A;  2IO5 B;  3AV1 B;  3KUY D;  3AV2 B;  4YS3 C;  1P3A A;  1EQZ A;  5B32 G;  4WZS B;  2ARO A;  3KWQ C;  1M19 B;  2YFV A;  4H9Q A;  1P3O C;  2RVQ D;  4NE5 A;  3VH5 A;  4XZQ B;  1M18 A;  3MGQ C;  2CV5 B;  4YM6 D;  3NQU A;  5AV6 D;  3W97 C;  1HQ3 D;  5BNX B;  4AWL C;  5JA4 A;  3LJA D;  1P3G C;  3REJ B;  3X1S C;  1P3F D;  5AV9 C;  5DNM A;  3LEL B;  3MGS D;  3KUY C;  3VH6 A;  4E44 A;  3REL A;  1KX3 B;  3AN2 D;  5AV5 D;  4H9O B;  3AZL C;  4YM6 C;  1F66 A;  2FJ7 B;  5AV6 C;  5B2J C;  4JJN D;  5B0Z A;  5CPJ A;  1JFI B;  5BO0 A;  3AZG D;  5F99 D;  1P3F C;  3MGP D;  4H9S A;  1P3M D;  2HIO A;  3MGS C;  1N1J A;  5B33 A;  1TZY A;  4Z66 D;  3AV1 A;  2NQB B;  1ID3 D;  1ZLA D;  5AV5 C;  5CPI B;  3KUY B;  3X1V A;  3UTA A;  5BNV B;  4R8P D;  3VH5 W;  3AZG C;  5F99 C;  1P3B D;  5JRG C;  3MGP C;  2PYO B;  4WNN B;  3B6G B;  4YM6 B;  3AFA A;  1P3M C;  1P3I A;  5GXQ A;  2HUE B;  3TU4 A;  1HQ3 B;  3LJA B;  3C1C B;  5G49 A;  5GSU B;  3C1B B;  5AVB D;  3W96 A;  1ID3 C;  3VH6 W;  1ZLA C;  3MGR C;  4ZUX A;  3WKJ D;  4QLC B;  2F8N K;  4YS3 A;  3NQJ B;  3AN2 B;  4WU8 D;  5DNN B;  3KWQ A;  3R45 A;  4H9N B;  1P3O A;  1M1A C;  3MGQ A;  4JJN B;  4J8W B;  3UTB A;  3W97 A;  1BH8 B;  5B31 D;  3WAA C;  5AVB C;  1P3G A;  3X1S A;  3KXB C;  5AV9 A;  5B0Z D;  4Z66 B;  1P3K D;  3WKJ C;  2BYM A;  4WU8 C;  1Q9C A;  1H3O A;  5B24 B;  4EO5 B;  1U35 D;  1KX5 A;  5B33 D;  4R8P B;  3REK D;  3AZL A;  4YM6 A;  3AYW B;  5AV6 A;  5B2J A;  4XUJ A;  3AZH D;  5B31 C;  1S32 D;  3REH C;  1P3B B;  1P3F A;  5GT0 A;  3O62 D;  4CAY A;  3B0C W;  5B0Z C;  1P3A B;  2ARO B;  3MGS A;  1P3K C;  1EQZ B;  4NE6 A;  2NZD D;  2YFV B;  4X23 D;  3AZJ D;  4H9Q B;  1M18 B;  3AZF D;  3NQU B;  1U35 C;  5GXQ D;  5AV5 A;  3TU4 D;  3A6N D;  3B0B A;  3REK C;  5JA4 B;  1P34 D;  1AOI D;  3AZH C;  1B67 A;  3W99 D;  3W96 D;  1S32 C;  3VH5 T;  5DNM B;  3AZG A;  3LZ1 D;  5F99 A;  3REL B;  3O62 C;  5JRG A;  3MGP A;  1P3M A;  2NZD C;  4G91 B;  5CPK C;  4X23 C;  3AZJ C;  5B1M D;  3AZF C;  1P3O D;  1F66 B;  3VH6 T;  5B1L D;  1ID3 A;  3X1T D;  5B0Z B;  3MGR A;  5CPJ B;  1ZLA A;  3A6N C;  5BO0 B;  3UTB D;  3AZK A;  1P34 C;  1AOI C;  3W99 C;  3X1S D;  2HIO B;  3LZ1 C;  5AV9 D;  1N1J B;  5BS7 C;  3MNN D;  2F8N H;  1A7W A;  1TZY B;  5B33 B;  1M1A A;  5CHL B;  5B1M C;  3X1V B;  1B6W A;  4KUD D;  2YFW A;  5AVB A;  3UTA B;  1KX5 D;  3WAA A;  5B1L C;  3X1T C;  3AZL D;  3KXB A;  2LY8 A;  3UTB C;  5B2J D; 
#chains in the Genus database with same CATH topology
 4XUJ D;  3AZE D;  3WKJ A;  1BFM A;  1Z2C B;  3AFA B;  5GT0 D;  4WU8 A;  1P3I B;  5GXQ B;  3MNN C;  2J8P A;  3TU4 B;  2FFF B;  3A6N B;  3W98 D;  5G49 B;  3WTP D;  2JCH A;  2XD1 A;  3B6F D;  3W96 B;  5B31 A;  3X1U D;  5E5A D;  4ZUX B;  4G92 C;  3REH A;  4KUD C;  1KX5 C;  2BG1 A;  4YS3 B;  3B0C T;  4XUJ C;  4LD9 D;  1P3K A;  3KWQ B;  3AZE C;  3R45 B;  1P3O B;  5GT0 C;  2BYK A;  3REI D;  5JRG D;  3MGQ B;  3UTB B;  1U35 A;  3W97 B;  3W98 C;  2ZY4 A;  3WTP C;  4AWL B;  3REK A;  1HTA A;  5B40 D;  1P3G B;  3X1S B;  3B6F C;  5AV9 B;  3AZH A;  4J8X C;  3X1U C;  5E5A C;  1S32 A;  3MGR D;  3WA9 C;  3AZK D;  3O62 A;  2Y2L A;  2BYM B;  1H3O B;  4LD9 C;  2NZD A;  3H0M C;  5CPK A;  4X23 A;  3AZJ A;  5B31 G;  2F2A C;  5B2I D;  1KX5 B;  3REI C;  3AZL B;  5B32 D;  3AZF A;  1M1A D;  5B0Y D;  5AV6 B;  5B2J B;  4XUJ B;  3AZN D;  1KX4 C;  3A6N A;  4CSR A;  1P34 A;  5B40 C;  4Z2M G;  1P3F B;  5GT0 B;  1AOI A;  3WAA D;  3W99 A;  4CAY B;  2Y2O A;  3KXB D;  3LZ1 A;  3MGS B;  5BS7 A;  3AZK C;  2JE5 A;  1TAF A;  5AVC D;  5B1M A;  4DRA A;  5B2I C;  5AV5 B;  3B0D C;  4ZBJ C;  5BT1 C;  5B32 C;  5B0Y C;  5B1L A;  3AZN C;  3X1T A;  5AV8 C;  4Z5T D;  3AZG B;  5F99 B;  3REH D;  5JRG B;  3MGP B;  1P3M B;  3MNN A;  1ULY A;  3AZI D;  4HGA C;  5AVC C;  5C3I C;  4J8U D;  1ID3 B;  1ZLA B;  3MGR B;  3AZK B;  1P3P D;  4KUD A;  5CP6 D;  3AZM C;  2CWE A;  4Z5T C;  5GT3 D;  3MVD D;  3AZE A;  1M1A B;  1BH9 A;  3UT9 D;  5AY8 D;  3W98 A;  3AZI C;  5CPK D;  3EPL A;  3WTP A;  1W2E A;  1R4V A;  2YFW B;  5AVB B;  3LZ0 D;  4J8U C;  3B6F A;  3WAA B;  3KXB B;  3WTP E;  4J8X A;  3X1U A;  5E5A A;  5CP6 C;  2ZM5 A;  1P3P C;  2F8N A;  3WA9 A;  3WKJ B;  5GT3 C;  4UUZ A;  4WU8 B;  3MVD C;  4KGC D;  4LD9 A;  3P5J B;  3REI A;  3UT9 C;  5AY8 C;  1M19 D;  3KFU G;  5B31 B;  1KX4 A;  3REH B;  4WU9 C;  3LZ0 C;  2RIQ A;  5B40 A;  2Y2M A;  1P3K B;  4KHA A;  2BYK B;  4KGC C;  2IO5 C;  3LEL D;  2Y2Q A;  3AV2 C;  1U35 B;  5B2I A;  3REK B;  5B32 A;  3EPH A;  5B0Y A;  1M19 C;  3AZN A;  3AZH B;  4XZQ C;  1S32 B;  5AV8 A;  4M6B A;  2CV5 C;  3O62 B;  2FJ7 D;  2JSS A;  2NZD B;  5CPK B;  4X23 B;  3AZJ B;  4H9P A;  3LEL C;  3AZF B;  5AVC A;  3F6T A;  4NE3 A;  4CSR B;  1P34 B;  2NQB D;  2Y2N A;  3AZM A;  3V9R A;  1AOI B;  3W99 B;  5CPI D;  4Z5T A;  3LZ1 B;  4J8X D;  3EPK A;  2F8N D;  2FJ7 C;  1TAF B;  3WA9 D;  5B1M B;  2PYO D;  3B6G D;  3AZI A;  3KSY A;  5FUG A;  4J8U A;  2L5A A;  5B1L B;  3X1T B;  3C1C D;  5GSU D;  1P3P A;  2NQB C;  5CP6 A;  3C1B D;  1KX4 D;  5CPI C;  2Y2P A;  5GT3 A;  3MVD A;  3MNN B;  4QLC D;  3UT9 A;  5DNN D;  2RVQ C;  5AY8 A;  5KDM A;  2PYO C;  3B6G C;  4G92 B;  4KUD B;  4WU9 A;  4J8V A;  3LZ0 A;  2HUE C;  4J8W D;  1HQ3 C;  5BT1 D;  3LJA C;  3C1C C;  5GSU C;  3C1B C;  5AV8 D;  3AZE B;  4H9R A;  1BH9 B;  4KGC A;  1F1E A;  1P3L A;  1KU5 A;  4QLC C;  3AV2 A;  3W98 B;  3AN2 C;  3WTP B;  5DNN C;  1WWI A;  3B6F B;  5B24 D;  1M19 A;  4J8X B;  3X1U B;  5E5A B;  4XZQ A;  2F8N B;  4JJN C;  2DF4 C;  3WA9 B;  2CV5 A;  4J8W C;  3AYW D;  4UUZ B;  3AZM D;  4LD9 B;  5BNX A;  4WV4 B;  3REJ A;  4NFT A;  3REI B;  1P3A D;  1EQZ D;  3LEL A;  4Z66 C;  1WWS A;  2ARO D;  2ZY2 A;  1KX3 A;  2XD5 A;  4Z2M H;  1KX4 B;  1M18 D;  5B40 B;  5B24 C;  4E45 A;  4EO5 C;  4H9O A;  4R8P C;  2FJ7 A;  3AYW C;  4KHA B;  1JFI A;  5DNM D;  1P3B C;  3REL D;  5B2I B;  3B0D B;  4ZBJ B;  1P3A C;  2ZY3 A;  5B32 B;  2ARO C;  5B0Y B;  4DQY B;  1EQZ C;  3AZN B;  4DRB A;  1M18 C;  5AV8 B;  2NQB A;  1F66 D;  4WU9 D;  4J8V D;  5CPJ D;  5CPI A;  3KUY A;  5BNV A;  4H9P B;  4HGA B;  5DNM C;  2Y2J A;  2HIO D;  5AVC B;  5C3I B;  3REL C;  1P3L D;  3A1I A;  1TZY D;  3AV1 D;  4WNN A;  2PYO A;  3B6G A;  3AV2 D;  3H0L C;  4G91 C;  3AZM B;  3V9R B;  1HQ3 A;  3LJA A;  4Z5T B;  5GSU A;  3C1C A;  2DQN C;  3EPJ A;  3X1V D;  1F66 C;  3C1B A;  3UTA D;  4XZQ D;  4J8V C;  5CPJ C;  2CV5 D;  4QLC A;  3AZI B;  3REJ D;  4H9S C;  3NQJ A;  2HIO C;  5FUG B;  3AFA D;  3AN2 A;  5DNN A;  4J8U B;  1P3I D;  1P3L C;  1TZY C;  5B33 C;  3AV1 C;  4H9N A;  2ZY5 A;  1P3P B;  1KX3 D;  5CP6 B;  3IP4 C;  2W8S A;  4JJN A;  2F8N G;  2VQR A;  4J8W A;  3A1K A;  3X1V C;  5GT3 B;  1BH8 A;  3MVD B;  4ZUX D;  3UTA C;  4YS3 D;  3UT9 B;  4Z66 A;  3KWQ D;  2Y2G A;  5AY8 B;  5KDM B;  3REJ C;  3AFA C;  1P3I C;  4WU9 B;  4J8V B;  5GXQ C;  3LZ0 B;  3MGQ D;  5B24 A;  3TU4 C;  4UPK A;  3W97 D;  1KX3 C;  4R8P A;  3W96 C;  1P3G D;  3AYW A;  4H9R B;  4KGC B;  4ZUX C;  1P3L B;  1P3B A;  2IO5 B;  3AV1 B;  3KUY D;  3AV2 B;  4YS3 C;  1P3A A;  1EQZ A;  5B32 G;  4WZS B;  2ARO A;  3KWQ C;  1M19 B;  2YFV A;  4H9Q A;  1P3O C;  2RVQ D;  4NE5 A;  3VH5 A;  4XZQ B;  1M18 A;  3MGQ C;  2CV5 B;  4YM6 D;  3NQU A;  5AV6 D;  3W97 C;  1HQ3 D;  5BNX B;  4AWL C;  5JA4 A;  3LJA D;  1P3G C;  3REJ B;  3X1S C;  1P3F D;  5AV9 C;  5DNM A;  3LEL B;  3MGS D;  3KUY C;  3VH6 A;  4E44 A;  3REL A;  1KX3 B;  3AN2 D;  5AV5 D;  4H9O B;  3AZL C;  4YM6 C;  1F66 A;  2FJ7 B;  5AV6 C;  5B2J C;  2Y2K A;  4JJN D;  5B0Z A;  5CPJ A;  1JFI B;  5BO0 A;  3AZG D;  5F99 D;  1P3F C;  3MGP D;  4H9S A;  1P3M D;  2HIO A;  3MGS C;  1N1J A;  4WJ3 C;  5B33 A;  1TZY A;  4Z66 D;  3EG5 B;  3AV1 A;  2NQB B;  1ID3 D;  1ZLA D;  5AV5 C;  5CPI B;  3KUY B;  3X1V A;  3UTA A;  5BNV B;  4R8P D;  3AL0 C;  3VH5 W;  3AZG C;  5F99 C;  3FDD A;  1P3B D;  5JRG C;  3MGP C;  2PYO B;  4WNN B;  3B6G B;  4YM6 B;  3AFA A;  1P3M C;  1P3I A;  5GXQ A;  2HUE B;  3TU4 A;  1HQ3 B;  3LJA B;  3C1C B;  5G49 A;  5GSU B;  3C1B B;  5AVB D;  1PZR A;  3W96 A;  1ID3 C;  3VH6 W;  1ZLA C;  3MGR C;  4ZUX A;  3WKJ D;  4QLC B;  3H0R C;  2F8N K;  4YS3 A;  3NQJ B;  3AN2 B;  4WU8 D;  5DNN B;  3KWQ A;  3R45 A;  4H9N B;  1P3O A;  1M1A C;  3MGQ A;  4JJN B;  4J8W B;  3UTB A;  3W97 A;  1BH8 B;  5B31 D;  2UWX A;  3WAA C;  5AVB C;  1P3G A;  3X1S A;  3KXB C;  5AV9 A;  5B0Z D;  4Z66 B;  1P3K D;  3WKJ C;  2BYM A;  4WU8 C;  1Q9C A;  1H3O A;  5B24 B;  4EO5 B;  1U35 D;  1KX5 A;  5B33 D;  4R8P B;  3REK D;  3AZL A;  4YM6 A;  3AYW B;  5AV6 A;  5B2J A;  4XUJ A;  3AZH D;  5B31 C;  1S32 D;  3REH C;  1P3B B;  1P3F A;  5GT0 A;  3O62 D;  4CAY A;  3B0C W;  5B0Z C;  1P3A B;  2ARO B;  3MGS A;  1P3K C;  1EQZ B;  4NE6 A;  2NZD D;  2YFV B;  4X23 D;  3AZJ D;  4H9Q B;  1M18 B;  3AZF D;  3NQU B;  1U35 C;  5GXQ D;  5AV5 A;  3TU4 D;  3A6N D;  3B0B A;  3REK C;  5JA4 B;  1P34 D;  2G5H C;  1AOI D;  3AZH C;  1B67 A;  3W99 D;  3W96 D;  1S32 C;  3VH5 T;  5DNM B;  3AZG A;  3LZ1 D;  5F99 A;  3REL B;  3O62 C;  5JRG A;  3MGP A;  2G5I C;  1P3M A;  2NZD C;  4G91 B;  5CPK C;  4X23 C;  3AZJ C;  5B1M D;  3AZF C;  1P3O D;  1F66 B;  3VH6 T;  5B1L D;  1ID3 A;  3X1T D;  5B0Z B;  3MGR A;  5CPJ B;  1ZLA A;  3A6N C;  5BO0 B;  2Y2I A;  3UTB D;  3AZK A;  1P34 C;  1AOI C;  3W99 C;  3X1S D;  2HIO B;  3LZ1 C;  5AV9 D;  1N1J B;  5BS7 C;  3MNN D;  2F8N H;  1A7W A;  1TZY B;  5B33 B;  1M1A A;  1T3U A;  5CHL B;  5B1M C;  2Y2H A;  3X1V B;  1B6W A;  4KUD D;  2YFW A;  5AVB A;  3UTA B;  1KX5 D;  3WAA A;  5B1L C;  3X1T C;  3AZL D;  3KXB A;  2LY8 A;  3UTB C;  5B2J D; 
#chains in the Genus database with same CATH homology
 4XUJ D;  3AZE D;  3WKJ A;  1BFM A;  1Z2C B;  3AFA B;  5GT0 D;  4WU8 A;  1P3I B;  5GXQ B;  3MNN C;  2J8P A;  3TU4 B;  2FFF B;  3A6N B;  3W98 D;  5G49 B;  3WTP D;  2JCH A;  2XD1 A;  3B6F D;  3W96 B;  5B31 A;  3X1U D;  5E5A D;  4ZUX B;  4G92 C;  3REH A;  4KUD C;  1KX5 C;  2BG1 A;  4YS3 B;  3B0C T;  4XUJ C;  4LD9 D;  1P3K A;  3KWQ B;  3AZE C;  3R45 B;  1P3O B;  5GT0 C;  2BYK A;  3REI D;  5JRG D;  3MGQ B;  3UTB B;  1U35 A;  3W97 B;  3W98 C;  2ZY4 A;  3WTP C;  4AWL B;  3REK A;  1HTA A;  5B40 D;  1P3G B;  3X1S B;  3B6F C;  5AV9 B;  3AZH A;  4J8X C;  3X1U C;  5E5A C;  1S32 A;  3MGR D;  3WA9 C;  3AZK D;  3O62 A;  2Y2L A;  2BYM B;  1H3O B;  4LD9 C;  2NZD A;  3H0M C;  5CPK A;  4X23 A;  3AZJ A;  5B31 G;  2F2A C;  5B2I D;  1KX5 B;  3REI C;  3AZL B;  5B32 D;  3AZF A;  1M1A D;  5B0Y D;  5AV6 B;  5B2J B;  4XUJ B;  3AZN D;  1KX4 C;  3A6N A;  4CSR A;  1P34 A;  5B40 C;  4Z2M G;  1P3F B;  5GT0 B;  1AOI A;  3WAA D;  3W99 A;  4CAY B;  2Y2O A;  3KXB D;  3LZ1 A;  3MGS B;  5BS7 A;  3AZK C;  2JE5 A;  1TAF A;  5AVC D;  5B1M A;  4DRA A;  5B2I C;  5AV5 B;  3B0D C;  4ZBJ C;  5BT1 C;  5B32 C;  5B0Y C;  5B1L A;  3AZN C;  3X1T A;  5AV8 C;  4Z5T D;  3AZG B;  5F99 B;  3REH D;  5JRG B;  3MGP B;  1P3M B;  3MNN A;  1ULY A;  3AZI D;  4HGA C;  5AVC C;  5C3I C;  4J8U D;  1ID3 B;  1ZLA B;  3MGR B;  3AZK B;  1P3P D;  4KUD A;  5CP6 D;  3AZM C;  2CWE A;  4Z5T C;  5GT3 D;  3MVD D;  3AZE A;  1M1A B;  1BH9 A;  3UT9 D;  5AY8 D;  3W98 A;  3AZI C;  5CPK D;  3EPL A;  3WTP A;  1W2E A;  1R4V A;  2YFW B;  5AVB B;  3LZ0 D;  4J8U C;  3B6F A;  3WAA B;  3KXB B;  3WTP E;  4J8X A;  3X1U A;  5E5A A;  5CP6 C;  2ZM5 A;  1P3P C;  2F8N A;  3WA9 A;  3WKJ B;  5GT3 C;  4UUZ A;  4WU8 B;  3MVD C;  4KGC D;  4LD9 A;  3P5J B;  3REI A;  3UT9 C;  5AY8 C;  1M19 D;  3KFU G;  5B31 B;  1KX4 A;  3REH B;  4WU9 C;  3LZ0 C;  2RIQ A;  5B40 A;  2Y2M A;  1P3K B;  4KHA A;  2BYK B;  4KGC C;  2IO5 C;  3LEL D;  2Y2Q A;  3AV2 C;  1U35 B;  5B2I A;  3REK B;  5B32 A;  3EPH A;  5B0Y A;  1M19 C;  3AZN A;  3AZH B;  4XZQ C;  1S32 B;  5AV8 A;  4M6B A;  2CV5 C;  3O62 B;  2FJ7 D;  2JSS A;  2NZD B;  5CPK B;  4X23 B;  3AZJ B;  4H9P A;  3LEL C;  3AZF B;  5AVC A;  3F6T A;  4NE3 A;  4CSR B;  1P34 B;  2NQB D;  2Y2N A;  3AZM A;  3V9R A;  1AOI B;  3W99 B;  5CPI D;  4Z5T A;  3LZ1 B;  4J8X D;  3EPK A;  2F8N D;  2FJ7 C;  1TAF B;  3WA9 D;  5B1M B;  2PYO D;  3B6G D;  3AZI A;  3KSY A;  5FUG A;  4J8U A;  2L5A A;  5B1L B;  3X1T B;  3C1C D;  5GSU D;  1P3P A;  2NQB C;  5CP6 A;  3C1B D;  1KX4 D;  5CPI C;  2Y2P A;  5GT3 A;  3MVD A;  3MNN B;  4QLC D;  3UT9 A;  5DNN D;  2RVQ C;  5AY8 A;  5KDM A;  2PYO C;  3B6G C;  4G92 B;  4KUD B;  4WU9 A;  4J8V A;  3LZ0 A;  2HUE C;  4J8W D;  1HQ3 C;  5BT1 D;  3LJA C;  3C1C C;  5GSU C;  3C1B C;  5AV8 D;  3AZE B;  4H9R A;  1BH9 B;  4KGC A;  1F1E A;  1P3L A;  1KU5 A;  4QLC C;  3AV2 A;  3W98 B;  3AN2 C;  3WTP B;  5DNN C;  1WWI A;  3B6F B;  5B24 D;  1M19 A;  4J8X B;  3X1U B;  5E5A B;  4XZQ A;  2F8N B;  4JJN C;  2DF4 C;  3WA9 B;  2CV5 A;  4J8W C;  3AYW D;  4UUZ B;  3AZM D;  4LD9 B;  5BNX A;  4WV4 B;  3REJ A;  4NFT A;  3REI B;  1P3A D;  1EQZ D;  3LEL A;  4Z66 C;  1WWS A;  2ARO D;  2ZY2 A;  1KX3 A;  2XD5 A;  4Z2M H;  1KX4 B;  1M18 D;  5B40 B;  5B24 C;  4E45 A;  4EO5 C;  4H9O A;  4R8P C;  2FJ7 A;  3AYW C;  4KHA B;  1JFI A;  5DNM D;  1P3B C;  3REL D;  5B2I B;  3B0D B;  4ZBJ B;  1P3A C;  2ZY3 A;  5B32 B;  2ARO C;  5B0Y B;  4DQY B;  1EQZ C;  3AZN B;  4DRB A;  1M18 C;  5AV8 B;  2NQB A;  1F66 D;  4WU9 D;  4J8V D;  5CPJ D;  5CPI A;  3KUY A;  5BNV A;  4H9P B;  4HGA B;  5DNM C;  2Y2J A;  2HIO D;  5AVC B;  5C3I B;  3REL C;  1P3L D;  3A1I A;  1TZY D;  3AV1 D;  4WNN A;  2PYO A;  3B6G A;  3AV2 D;  3H0L C;  4G91 C;  3AZM B;  3V9R B;  1HQ3 A;  3LJA A;  4Z5T B;  5GSU A;  3C1C A;  2DQN C;  3EPJ A;  3X1V D;  1F66 C;  3C1B A;  3UTA D;  4XZQ D;  4J8V C;  5CPJ C;  2CV5 D;  4QLC A;  3AZI B;  3REJ D;  4H9S C;  3NQJ A;  2HIO C;  5FUG B;  3AFA D;  3AN2 A;  5DNN A;  4J8U B;  1P3I D;  1P3L C;  1TZY C;  5B33 C;  3AV1 C;  4H9N A;  2ZY5 A;  1P3P B;  1KX3 D;  5CP6 B;  3IP4 C;  2W8S A;  4JJN A;  2F8N G;  2VQR A;  4J8W A;  3A1K A;  3X1V C;  5GT3 B;  1BH8 A;  3MVD B;  4ZUX D;  3UTA C;  4YS3 D;  3UT9 B;  4Z66 A;  3KWQ D;  2Y2G A;  5AY8 B;  5KDM B;  3REJ C;  3AFA C;  1P3I C;  4WU9 B;  4J8V B;  5GXQ C;  3LZ0 B;  3MGQ D;  5B24 A;  3TU4 C;  4UPK A;  3W97 D;  1KX3 C;  4R8P A;  3W96 C;  1P3G D;  3AYW A;  4H9R B;  4KGC B;  4ZUX C;  1P3L B;  1P3B A;  2IO5 B;  3AV1 B;  3KUY D;  3AV2 B;  4YS3 C;  1P3A A;  1EQZ A;  5B32 G;  4WZS B;  2ARO A;  3KWQ C;  1M19 B;  2YFV A;  4H9Q A;  1P3O C;  2RVQ D;  4NE5 A;  3VH5 A;  4XZQ B;  1M18 A;  3MGQ C;  2CV5 B;  4YM6 D;  3NQU A;  5AV6 D;  3W97 C;  1HQ3 D;  5BNX B;  4AWL C;  5JA4 A;  3LJA D;  1P3G C;  3REJ B;  3X1S C;  1P3F D;  5AV9 C;  5DNM A;  3LEL B;  3MGS D;  3KUY C;  3VH6 A;  4E44 A;  3REL A;  1KX3 B;  3AN2 D;  5AV5 D;  4H9O B;  3AZL C;  4YM6 C;  1F66 A;  2FJ7 B;  5AV6 C;  5B2J C;  2Y2K A;  4JJN D;  5B0Z A;  5CPJ A;  1JFI B;  5BO0 A;  3AZG D;  5F99 D;  1P3F C;  3MGP D;  4H9S A;  1P3M D;  2HIO A;  3MGS C;  1N1J A;  4WJ3 C;  5B33 A;  1TZY A;  4Z66 D;  3EG5 B;  3AV1 A;  2NQB B;  1ID3 D;  1ZLA D;  5AV5 C;  5CPI B;  3KUY B;  3X1V A;  3UTA A;  5BNV B;  4R8P D;  3AL0 C;  3VH5 W;  3AZG C;  5F99 C;  3FDD A;  1P3B D;  5JRG C;  3MGP C;  2PYO B;  4WNN B;  3B6G B;  4YM6 B;  3AFA A;  1P3M C;  1P3I A;  5GXQ A;  2HUE B;  3TU4 A;  1HQ3 B;  3LJA B;  3C1C B;  5G49 A;  5GSU B;  3C1B B;  5AVB D;  1PZR A;  3W96 A;  1ID3 C;  3VH6 W;  1ZLA C;  3MGR C;  4ZUX A;  3WKJ D;  4QLC B;  3H0R C;  2F8N K;  4YS3 A;  3NQJ B;  3AN2 B;  4WU8 D;  5DNN B;  3KWQ A;  3R45 A;  4H9N B;  1P3O A;  1M1A C;  3MGQ A;  4JJN B;  4J8W B;  3UTB A;  3W97 A;  1BH8 B;  5B31 D;  2UWX A;  3WAA C;  5AVB C;  1P3G A;  3X1S A;  3KXB C;  5AV9 A;  5B0Z D;  4Z66 B;  1P3K D;  3WKJ C;  2BYM A;  4WU8 C;  1Q9C A;  1H3O A;  5B24 B;  4EO5 B;  1U35 D;  1KX5 A;  5B33 D;  4R8P B;  3REK D;  3AZL A;  4YM6 A;  3AYW B;  5AV6 A;  5B2J A;  4XUJ A;  3AZH D;  5B31 C;  1S32 D;  3REH C;  1P3B B;  1P3F A;  5GT0 A;  3O62 D;  4CAY A;  3B0C W;  5B0Z C;  1P3A B;  2ARO B;  3MGS A;  1P3K C;  1EQZ B;  4NE6 A;  2NZD D;  2YFV B;  4X23 D;  3AZJ D;  4H9Q B;  1M18 B;  3AZF D;  3NQU B;  1U35 C;  5GXQ D;  5AV5 A;  3TU4 D;  3A6N D;  3B0B A;  3REK C;  5JA4 B;  1P34 D;  2G5H C;  1AOI D;  3AZH C;  1B67 A;  3W99 D;  3W96 D;  1S32 C;  3VH5 T;  5DNM B;  3AZG A;  3LZ1 D;  5F99 A;  3REL B;  3O62 C;  5JRG A;  3MGP A;  2G5I C;  1P3M A;  2NZD C;  4G91 B;  5CPK C;  4X23 C;  3AZJ C;  5B1M D;  3AZF C;  1P3O D;  1F66 B;  3VH6 T;  5B1L D;  1ID3 A;  3X1T D;  5B0Z B;  3MGR A;  5CPJ B;  1ZLA A;  3A6N C;  5BO0 B;  2Y2I A;  3UTB D;  3AZK A;  1P34 C;  1AOI C;  3W99 C;  3X1S D;  2HIO B;  3LZ1 C;  5AV9 D;  1N1J B;  5BS7 C;  3MNN D;  2F8N H;  1A7W A;  1TZY B;  5B33 B;  1M1A A;  1T3U A;  5CHL B;  5B1M C;  2Y2H A;  3X1V B;  1B6W A;  4KUD D;  2YFW A;  5AVB A;  3UTA B;  1KX5 D;  3WAA A;  5B1L C;  3X1T C;  3AZL D;  3KXB A;  2LY8 A;  3UTB C;  5B2J D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...