3REHC

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehC00
1TZYA 3RELA 3WA9C 3MGRC 5GSUA 4JJNC 1ZLAC 1B67A 2YFVB 5AV5D 3AV2D 5GSUC 4LD9B 5B2ID 3LZ0A 1P3PB 3X1TD 4ZUXA 3W97A 4XUJC 2F8NB 5B31B 3W98B 2AROA 1P34D 3W97C 3WKJB 3REIC 3C1BD 3C1CD 3KXBB 2AROC 5CPKB 4E44A 3O62D 5B0ZA 1P3KD 5CPKC 3AZKC 5B1LD 5AVBA 3REJC 1P3AB 3B0CT 3B0DB 3AZFA 5BO0A 1P3AC 5AVBC 1KX5C 5B40A 2NZDC 3AZGB 2CV5B 4Z5TA 5B33A 4J8VA 5GT3A 5JRGA 1P3IA 5B33C 4R8PA 3AV1D 3UTBA 3AZEB 4UUZA 3UTBC 3MVDD 3AZLB 3W96B 4WU8B 3LELD 3REHA 3MGSD 2PYOC 5BNXA 3KUYC 4Z66C 5GXQA 4J8WA 1P3GB 4ZBJB 4KUDD 5CHLB 1HQ3C 3VH6W 3B6GA 1P3MB 1P3GC 3AZIB 3AZMD 1KX3C 3X1VD 4QLCA 3MNNC 5G49B 4J8UA 3AYWB 1P3MC 5B1MC 4NE5A 5C3IB 3V9RB 5B2JA 5B24B 4KGCA 1TZYD 3RELD 5E5AB 5GSUD 2BYKB 3AFAB 4X23A 4WU9A 1P3FA 1M18A 1P3BB 4H9PA 4CAYA 4YM6B 3LZ0D 5BS7C 4HGAB 4ZUXD 1WWIA 4WU9C 1M19A 3W97D 4HGAC 3WAAB 5B32B 3WAAC 1M1AA 3B6FB 5B32C 2AROD 5CPJB 5DNMB 5KDMB 5FUGA 5B0ZD 1ID3C 4J8XA 3X1UA 5AVBD 5AY8A 3AZFD 5B40D 3MGPA 1U35C 4Z5TD 5B33D 3TU4B 3LZ1C 4J8VD 5GT3D 2NQBA 3A6NA 5JRGD 3AZHA 4R8PD 5CPIC 3UTBD 4NFTA 3VH6A 1S32C 5B2IB 3AN2C 5AVCC 5AV6C 5GT0A 5AV9B 1AOIA 1H3OB 1P34B 3REHD 3C1BB 3X1SB 1BH9A 5GXQD 4J8WD 4YS3A 5CP6C 4H9QB 3UTAC 1R4VA 3B6GD 3LELA 3MGSA 3W99A 5B1LB 4EO5C 4QLCD 4DRBA 4J8UD 3W99C 1EQZA 3AZJA 3WTPC 4H9SC 5B2JD 2FJ7B 4KGCD 2FJ7C 4WZSB 3AZNC 3WA9A 4G91C 1TAFA 2HUEB 5B0YC 4WU9D 2BYMA 4X23D 3MGRA 3AV1B 4JJNA 1P3FD 1M18D 1ZLAA 1WWSA 2IO5B 1M19D 3MVDB 5AV8B 4LD9A 4XZQB 4XUJA 1M1AD 3UT9B 5F99B 4LD9C 1P3PC 3REIA 4KUDB 5B31C 4NE6A 3X1UD 1N1JB 2YFWA 3MGQB 4J8XD 3AZMB 3W98C 3WKJC 5CPKA 5AY8D 3AZKA 3VH5T 3KXBC 3REJA 1P3LB 1KX4B 3MGPD 2HIOB 1P3AA 4WNNB 4Z2MG 3B0BA 1TZYB 1KX5A 2NZDA 2NQBD 3A6ND 3LJAB 5AVCD 3AZHD 2CV5A 3B0DC 3LJAC 3AZGC 3LZ0B 2CV5C 1JFIA 4H9NB 4ZUXB 5GT0D 2RVQD 3KSYA 1AOID 3AZEA 3AZEC 2PYOA 3KUYA 4YS3D 4Z66A 5B0ZB 3AZLC 1KU5A 3VH6T 3W96C 4WU8C 3W99D 1HQ3A 1BH8A 1P3GA 3AZFB 1KX3A 1P3MA 3MNNA 3AZIA 1EQZD 3AZJD 5B1MA 1B6WA 3B0CW 4ZBJC 3AYWA 4Z5TB 1F66B 5DNNB 4J8VB 3AZIC 5GT3B 5JRGB 4G92B 1P3IB 3AYWC 4R8PB 3WA9D 4G92C 3MGRD 4JJND 1P3OB 1ZLAD 5C3IC 5B24C 4UUZB 5E5AC 5BS7A 3REKB 1P3BA 4LD9D 4XUJD 3AFAC 3REHB 5BNXB 1P3BC 3WAAA 4H9OB 4YM6C 5B32A 4KHAA 5GXQB 3REID 4J8WB 3B6GB 3KXBD 3B6FC 4QLCB 4J8UB 1ID3A 5CPJC 5CPKD 5DNMC 3AZKD 3REJD 1P3AD 5B2JB 1KX5D 4KGCB 2NZDD 1U35A 3LZ1A 2CV5D 4X23B 3KWQB 3TU4A 1P3FB 1BFMA 4CAYB 5B32G 3NQUA 5CPIA 3TU4C 1S32A 1M19B 4NE3A 3AN2A 5AVCA 5AV6A 4CSRA 5AV5B 2JSSA 3AZED 3AV2B 1M1AB 3NQJA 5AV9A 3X1TB 5B2IC 5FUGB 2PYOD 3KUYD 1H3OA 5AV9C 4Z66D 3X1SA 4J8XB 3X1UB 3R45A 5CP6A 3UTAA 1HQ3D 3C1CB 1P34C 1P3GD 5AY8B 4H9QA 3C1BC 3X1SC 1KX3D 1P3KB 3MNND 3O62B 1P3MD 3AZID 5B1MD 3AYWD 4H9RA 3WTPA 5B1LC 2NQBB 3A6NB 4H9SA 3AZHB 2FJ7A 3AZNA 5B0YA 5GT0B 5JA4B 1P3BD 1AOIB 2HUEC 3AV1C 4AWLB 5AV8A 3WAAD 1BH9B 2YFVA 5B32D 2IO5C 4XZQA 4YS3B 3MVDC 5F99A 5AV8C 3UT9A 1P3PA 3LELB 3MGSB 4XZQC 5BNVB 2F8NA 2L5AA 3UT9C 1ULYA 5F99C 1ID3D 5B31A 3W98A 3WKJA 1N1JA 1EQZB 3AZJB 4KUDC 3KXBA 1HTAA 3X1VB 3MGQC 3AZMC 1U35D 1P3LA 3LZ1D 1KX4A 2HIOA 1TAFB 3MGRB 3TU4D 2BYMB 4M6BA 4JJNB 1ZLAB 1P3LC 1KX4C 5CPID 2HIOC 3RELB 3LJAA 5GSUB 1S32D 1TZYC 3RELC 3AZGA 3AN2D 5AV6D 4XUJB 2F8NG 4H9NA 5B31G 5AV9D 4DRAA 3LZ0C 3W97B 3REIB 4ZUXC 2AROB 3X1SD 2YFWB 5CP6D 3UTAD 3AZLA 3W96A 4WU8A 3AZKB 3REJB 5B0ZC 1Q9CA 3VH5W 5AVBB 1KX5B 2NZDB 3WTPD 5BO0B 1F66A 3AZFC 5B40B 5DNNA 2FJ7D 5G49A 5B33B 3AZND 5B40C 5B0YD 1F66C 1JFIB 4Z5TC 5DNNC 4J8VC 5GT3C 5JRGC 3V9RA 1P3IC 5B24A 1P3OA 3UTBB 4R8PC 5E5AA 2BYKA 5AV8D 3AFAA 3REKA 1P3OC 4XZQD 2PYOB 3KUYB 4Z66B 4YM6A 3UT9D 5F99D 3REKC 4Z2MH 1P3PD 4H9OA 2F8ND 1HQ3B 3REHC 1A7WA 1BH8B 5B31D 3W98D 1KX3B 3B6FA 3WKJD 3MNNB 2F8NH 5GXQC 5CPJA 5DNMA 3MGQD 5KDMA 5B1MB 4J8WC 2CWEA 3B6GC 4QLCC 4J8UC 1P3LD 1KX4D 2HIOD 3LJAD 5B2JC 3KWQA 4KGCC 3AZGD 4WU9B 1M18B 4H9PB 4X23C 3KWQC 3VH5A 5BT1C 1P3FC 1M18C 2F8NK 4E45A 4KHAB 5AV5A 3AV2A 1M19C 5B2IA 3X1TA 5AV5C 3AV2C 1M1AC 3AZLD 1ID3B 3W96D 4WU8D 3X1TC 1P34A 3C1BA 3C1CA 4J8XC 3X1UC 3O62A 1P3KA 1U35B 1F1EA 3C1CC 3LZ1B 5AY8C 1F66D 5B1LA 5DNND 3MGPB 1P3KC 3O62C 3MGPC 3NQUB 5CPIB 1P3ID 1S32B 3AN2B 5AVCB 5AV6B 2NQBC 3A6NC 4WV4B 4CSRB 1P3OD 5B24D 3AZHC 5E5AD 3NQJB 5JA4A 3AFAD 3REKD 3AV1A 5GT0C 2RVQC 4YM6D 1AOIC 3R45B 5CP6B 3MVDA 3UTAB 4AWLC 4EO5B 3B6FD 5CPJD 5BNVA 5DNMD 4YS3C 2LY8A 3W99B 3WTPE 3LELC 3MGSC 4H9RB 3WTPB 4KUDA 3MGQA 3AZMA 3X1VA 3AZNB 1EQZC 3AZJC 4G91B 5B0YB 3X1VC 3KWQD 3WA9B 5BT1D 4WNNA
chains in the Genus database with same CATH superfamily
1TZYA 3RELA 3WA9C 3MGRC 5GSUA 2Y2MA 4JJNC 1ZLAC 1B67A 2YFVB 5AV5D 3AV2D 2ZY5A 5GSUC 4LD9B 5B2ID 3LZ0A 1P3PB 3X1TD 4ZUXA 3W97A 4XUJC 2F8NB 5B31B 3W98B 2AROA 1P34D 3W97C 3WKJB 3REIC 3C1BD 3C1CD 3KXBB 2AROC 5CPKB 4E44A 3O62D 5B0ZA 1P3KD 5CPKC 3AZKC 5B1LD 5AVBA 3REJC 1P3AB 3B0CT 3B0DB 3AZFA 5BO0A 1P3AC 5AVBC 1KX5C 5B40A 2NZDC 3AZGB 2CV5B 4Z5TA 5B33A 4J8VA 5GT3A 5JRGA 1P3IA 5B33C 4R8PA 3AV1D 3UTBA 3AZEB 4UUZA 3UTBC 3MVDD 3FDDA 3AZLB 3W96B 4WU8B 1W2EA 3LELD 3REHA 3MGSD 2PYOC 5BNXA 3KUYC 4Z66C 5GXQA 4J8WA 1P3GB 4ZBJB 3H0RC 4KUDD 5CHLB 1HQ3C 3VH6W 3B6GA 1P3MB 1P3GC 3AZIB 3AZMD 1KX3C 3X1VD 4QLCA 3MNNC 5G49B 4J8UA 3AYWB 1P3MC 5B1MC 4NE5A 5C3IB 3V9RB 5B2JA 5B24B 4KGCA 1TZYD 3RELD 5E5AB 2Y2GA 2G5IC 5GSUD 2BYKB 3AFAB 4X23A 4WU9A 1P3FA 1M18A 1P3BB 4H9PA 4CAYA 4YM6B 3LZ0D 5BS7C 4HGAB 4ZUXD 1WWIA 4WU9C 1M19A 3W97D 4HGAC 3WAAB 5B32B 3WAAC 1M1AA 3B6FB 5B32C 2AROD 5CPJB 2JCHA 5DNMB 5KDMB 5FUGA 5B0ZD 1ID3C 4J8XA 3X1UA 5AVBD 5AY8A 3AZFD 5B40D 3MGPA 1U35C 4Z5TD 5B33D 3TU4B 3LZ1C 4J8VD 2Y2HA 5GT3D 2NQBA 3A6NA 5JRGD 3AZHA 4R8PD 2RIQA 5CPIC 3UTBD 4NFTA 3VH6A 1S32C 5B2IB 3AN2C 5AVCC 5AV6C 5GT0A 5AV9B 1AOIA 1H3OB 1P34B 3REHD 2FFFB 3C1BB 3X1SB 1BH9A 5GXQD 4J8WD 4YS3A 4WJ3C 5CP6C 4H9QB 3UTAC 1R4VA 3B6GD 3LELA 3MGSA 3W99A 5B1LB 4EO5C 4QLCD 4DRBA 4J8UD 3W99C 1EQZA 3AZJA 3WTPC 4H9SC 5B2JD 2FJ7B 4KGCD 2FJ7C 4WZSB 3AZNC 3WA9A 4G91C 1TAFA 2HUEB 5B0YC 4WU9D 2BYMA 4X23D 3MGRA 3AV1B 4JJNA 1P3FD 1M18D 1ZLAA 1WWSA 2IO5B 2Y2NA 1M19D 3MVDB 5AV8B 4LD9A 4XZQB 4XUJA 1M1AD 3UT9B 5F99B 4LD9C 2Y2PA 1P3PC 3REIA 4KUDB 5B31C 4NE6A 3X1UD 1N1JB 2YFWA 3MGQB 4J8XD 3AZMB 3W98C 3WKJC 5CPKA 2Y2KA 5AY8D 3AZKA 3VH5T 3KXBC 3REJA 1P3LB 1KX4B 3MGPD 2HIOB 1P3AA 4WNNB 4Z2MG 3B0BA 1TZYB 1KX5A 2NZDA 3IP4C 2NQBD 3A6ND 3LJAB 5AVCD 3AZHD 2CV5A 2ZY4A 3B0DC 3LJAC 3A1KA 3AZGC 3LZ0B 2CV5C 1JFIA 4H9NB 4ZUXB 5GT0D 2RVQD 3KSYA 1AOID 3AZEA 3AZEC 2PYOA 3KUYA 4YS3D 4Z66A 5B0ZB 1T3UA 3AZLC 3KFUG 1KU5A 3VH6T 3W96C 3EPLA 4WU8C 3W99D 2J8PA 1HQ3A 1BH8A 1P3GA 3AZFB 1KX3A 1P3MA 3MNNA 3AZIA 1EQZD 3AZJD 5B1MA 1B6WA 3B0CW 4ZBJC 3AYWA 4Z5TB 1F66B 5DNNB 4J8VB 3AZIC 5GT3B 2Y2IA 5JRGB 4G92B 1P3IB 3AYWC 4R8PB 3WA9D 4G92C 3MGRD 4JJND 1P3OB 1ZLAD 5C3IC 3P5JB 5B24C 4UUZB 5E5AC 5BS7A 3REKB 1P3BA 4LD9D 4XUJD 3AFAC 3REHB 5BNXB 1P3BC 2F2AC 3WAAA 4H9OB 4YM6C 5B32A 4KHAA 5GXQB 3REID 4J8WB 3B6GB 3KXBD 3B6FC 4QLCB 4J8UB 2DF4C 1ID3A 5CPJC 5CPKD 5DNMC 3AZKD 3REJD 1P3AD 5B2JB 1KX5D 1PZRA 4KGCB 2NZDD 1U35A 3LZ1A 2CV5D 4X23B 3KWQB 3TU4A 1P3FB 1BFMA 4CAYB 5B32G 3NQUA 5CPIA 3TU4C 1S32A 1M19B 4NE3A 3AN2A 5AVCA 5AV6A 4CSRA 5AV5B 2JSSA 3AZED 3AV2B 1M1AB 3NQJA 2G5HC 5AV9A 3X1TB 2ZY2A 5B2IC 3A1IA 5FUGB 2PYOD 3KUYD 1H3OA 5AV9C 4Z66D 3F6TA 3X1SA 4J8XB 3X1UB 3R45A 5CP6A 3UTAA 1HQ3D 3C1CB 1P34C 1P3GD 5AY8B 4H9QA 3C1BC 3X1SC 1KX3D 1P3KB 3MNND 3O62B 1P3MD 3AZID 5B1MD 3AYWD 2ZM5A 4H9RA 2JE5A 5B1LC 2VQRA 3WTPA 3A6NB 2NQBB 4H9SA 3AZHB 2FJ7A 3AZNA 5B0YA 5GT0B 5JA4B 1P3BD 1AOIB 2HUEC 2Y2JA 4AWLB 3AV1C 5AV8A 3WAAD 1BH9B 2YFVA 5B32D 2IO5C 4XZQA 4YS3B 3MVDC 5F99A 5AV8C 3UT9A 1P3PA 3LELB 3H0MC 3MGSB 4XZQC 5BNVB 2F8NA 2L5AA 3UT9C 1ULYA 5F99C 1ID3D 5B31A 3W98A 2Y2LA 3WKJA 1N1JA 1EQZB 2BG1A 3AZJB 2DQNC 4KUDC 3KXBA 1HTAA 3X1VB 3MGQC 3AZMC 1U35D 1P3LA 3LZ1D 1KX4A 2HIOA 1TAFB 3MGRB 3TU4D 2BYMB 4M6BA 4JJNB 1ZLAB 1P3LC 1KX4C 5CPID 2HIOC 3RELB 3LJAA 5GSUB 1S32D 1TZYC 3RELC 3AZGA 3AN2D 5AV6D 4XUJB 2F8NG 4H9NA 5B31G 5AV9D 4DQYB 4DRAA 2Y2OA 3LZ0C 3W97B 3REIB 4ZUXC 2AROB 3X1SD 2YFWB 5CP6D 3UTAD 3AZLA 3W96A 4WU8A 3AZKB 3REJB 5B0ZC 1Q9CA 3VH5W 5AVBB 1KX5B 2NZDB 3WTPD 5BO0B 1F66A 3AZFC 5B40B 5DNNA 2FJ7D 5G49A 5B33B 3AZND 5B40C 2XD5A 5B0YD 1F66C 1JFIB 4Z5TC 5DNNC 4J8VC 5GT3C 5JRGC 3V9RA 1P3IC 5B24A 1P3OA 3UTBB 4R8PC 5E5AA 2BYKA 5AV8D 3AFAA 3REKA 1P3OC 4XZQD 2PYOB 3KUYB 3EPKA 4Z66B 4YM6A 3UT9D 5F99D 3REKC 4Z2MH 1P3PD 4H9OA 2F8ND 1HQ3B 3REHC 1A7WA 1BH8B 5B31D 3W98D 1KX3B 3B6FA 3WKJD 3MNNB 2F8NH 5GXQC 5CPJA 5DNMA 3MGQD 5KDMA 5B1MB 4J8WC 2CWEA 3B6GC 4QLCC 4J8UC 1P3LD 1KX4D 2HIOD 3AL0C 3LJAD 5B2JC 3KWQA 4KGCC 3AZGD 4WU9B 1M18B 4H9PB 4X23C 3KWQC 3VH5A 5BT1C 1P3FC 1M18C 2F8NK 4E45A 4KHAB 5AV5A 3AV2A 1M19C 5B2IA 3X1TA 5AV5C 3AV2C 1M1AC 3AZLD 1ID3B 3W96D 4WU8D 3X1TC 3EPHA 1P34A 3C1BA 3C1CA 4J8XC 3X1UC 3O62A 1P3KA 1U35B 1F1EA 3C1CC 3LZ1B 5AY8C 1F66D 5B1LA 5DNND 3MGPB 1P3KC 3O62C 3MGPC 3NQUB 5CPIB 1P3ID 1S32B 3AN2B 5AVCB 5AV6B 2NQBC 3A6NC 4WV4B 2ZY3A 2Y2QA 4CSRB 5B24D 1P3OD 3AZHC 5E5AD 3NQJB 5JA4A 3AFAD 3REKD 3AV1A 5GT0C 2RVQC 4YM6D 1Z2CB 1AOIC 3R45B 5CP6B 3MVDA 3UTAB 4AWLC 4EO5B 3B6FD 5CPJD 5BNVA 5DNMD 4UPKA 4YS3C 2LY8A 3W99B 3WTPE 3LELC 3EG5B 3MGSC 4H9RB 3WTPB 4KUDA 2UWXA 3H0LC 3MGQA 3AZMA 3X1VA 3AZNB 1EQZC 3AZJC 4G91B 2XD1A 5B0YB 3EPJA 3X1VC 3KWQD 3WA9B 5BT1D 4WNNA 2W8SA
chains in the Genus database with same CATH topology
1TZYA 3RELA 3WA9C 3MGRC 5GSUA 2Y2MA 4JJNC 1ZLAC 1B67A 2YFVB 5AV5D 3AV2D 2ZY5A 5GSUC 4LD9B 5B2ID 3LZ0A 1P3PB 3X1TD 4ZUXA 3W97A 4XUJC 2F8NB 5B31B 3W98B 2AROA 1P34D 3W97C 3WKJB 3REIC 3C1BD 3C1CD 3KXBB 2AROC 5CPKB 4E44A 3O62D 5B0ZA 1P3KD 5CPKC 3AZKC 5B1LD 5AVBA 3REJC 1P3AB 3B0CT 3B0DB 3AZFA 5BO0A 1P3AC 5AVBC 1KX5C 5B40A 2NZDC 3AZGB 2CV5B 4Z5TA 5B33A 4J8VA 5GT3A 5JRGA 1P3IA 5B33C 4R8PA 3AV1D 3UTBA 3AZEB 4UUZA 3UTBC 3MVDD 3FDDA 3AZLB 3W96B 4WU8B 1W2EA 3LELD 3REHA 3MGSD 2PYOC 5BNXA 3KUYC 4Z66C 5GXQA 4J8WA 1P3GB 4ZBJB 3H0RC 4KUDD 5CHLB 1HQ3C 3VH6W 3B6GA 1P3MB 1P3GC 3AZIB 3AZMD 1KX3C 3X1VD 4QLCA 3MNNC 5G49B 4J8UA 3AYWB 1P3MC 5B1MC 4NE5A 5C3IB 3V9RB 5B2JA 5B24B 4KGCA 1TZYD 3RELD 5E5AB 2Y2GA 2G5IC 5GSUD 2BYKB 3AFAB 4X23A 4WU9A 1P3FA 1M18A 1P3BB 4H9PA 4CAYA 4YM6B 3LZ0D 5BS7C 4HGAB 4ZUXD 1WWIA 4WU9C 1M19A 3W97D 4HGAC 3WAAB 5B32B 3WAAC 1M1AA 3B6FB 5B32C 2AROD 5CPJB 2JCHA 5DNMB 5KDMB 5FUGA 5B0ZD 1ID3C 4J8XA 3X1UA 5AVBD 5AY8A 3AZFD 5B40D 3MGPA 1U35C 4Z5TD 5B33D 3TU4B 3LZ1C 4J8VD 2Y2HA 5GT3D 2NQBA 3A6NA 5JRGD 3AZHA 4R8PD 2RIQA 5CPIC 3UTBD 4NFTA 3VH6A 1S32C 5B2IB 3AN2C 5AVCC 5AV6C 5GT0A 5AV9B 1AOIA 1H3OB 1P34B 3REHD 2FFFB 3C1BB 3X1SB 1BH9A 5GXQD 4J8WD 4YS3A 4WJ3C 5CP6C 4H9QB 3UTAC 1R4VA 3B6GD 3LELA 3MGSA 3W99A 5B1LB 4EO5C 4QLCD 4DRBA 4J8UD 3W99C 1EQZA 3AZJA 3WTPC 4H9SC 5B2JD 2FJ7B 4KGCD 2FJ7C 4WZSB 3AZNC 3WA9A 4G91C 1TAFA 2HUEB 5B0YC 4WU9D 2BYMA 4X23D 3MGRA 3AV1B 4JJNA 1P3FD 1M18D 1ZLAA 1WWSA 2IO5B 2Y2NA 1M19D 3MVDB 5AV8B 4LD9A 4XZQB 4XUJA 1M1AD 3UT9B 5F99B 4LD9C 2Y2PA 1P3PC 3REIA 4KUDB 5B31C 4NE6A 3X1UD 1N1JB 2YFWA 3MGQB 4J8XD 3AZMB 3W98C 3WKJC 5CPKA 2Y2KA 5AY8D 3AZKA 3VH5T 3KXBC 3REJA 1P3LB 1KX4B 3MGPD 2HIOB 1P3AA 4WNNB 4Z2MG 3B0BA 1TZYB 1KX5A 2NZDA 3IP4C 2NQBD 3A6ND 3LJAB 5AVCD 3AZHD 2CV5A 2ZY4A 3B0DC 3LJAC 3A1KA 3AZGC 3LZ0B 2CV5C 1JFIA 4H9NB 4ZUXB 5GT0D 2RVQD 3KSYA 1AOID 3AZEA 3AZEC 2PYOA 3KUYA 4YS3D 4Z66A 5B0ZB 1T3UA 3AZLC 3KFUG 1KU5A 3VH6T 3W96C 3EPLA 4WU8C 3W99D 2J8PA 1HQ3A 1BH8A 1P3GA 3AZFB 1KX3A 1P3MA 3MNNA 3AZIA 1EQZD 3AZJD 5B1MA 1B6WA 3B0CW 4ZBJC 3AYWA 4Z5TB 1F66B 5DNNB 4J8VB 3AZIC 5GT3B 2Y2IA 5JRGB 4G92B 1P3IB 3AYWC 4R8PB 3WA9D 4G92C 3MGRD 4JJND 1P3OB 1ZLAD 5C3IC 3P5JB 5B24C 4UUZB 5E5AC 5BS7A 3REKB 1P3BA 4LD9D 4XUJD 3AFAC 3REHB 5BNXB 1P3BC 2F2AC 3WAAA 4H9OB 4YM6C 5B32A 4KHAA 5GXQB 3REID 4J8WB 3B6GB 3KXBD 3B6FC 4QLCB 4J8UB 2DF4C 1ID3A 5CPJC 5CPKD 5DNMC 3AZKD 3REJD 1P3AD 5B2JB 1KX5D 1PZRA 4KGCB 2NZDD 1U35A 3LZ1A 2CV5D 4X23B 3KWQB 3TU4A 1P3FB 1BFMA 4CAYB 5B32G 3NQUA 5CPIA 3TU4C 1S32A 1M19B 4NE3A 3AN2A 5AVCA 5AV6A 4CSRA 5AV5B 2JSSA 3AZED 3AV2B 1M1AB 3NQJA 2G5HC 5AV9A 3X1TB 2ZY2A 5B2IC 3A1IA 5FUGB 2PYOD 3KUYD 1H3OA 5AV9C 4Z66D 3F6TA 3X1SA 4J8XB 3X1UB 3R45A 5CP6A 3UTAA 1HQ3D 3C1CB 1P34C 1P3GD 5AY8B 4H9QA 3C1BC 3X1SC 1KX3D 1P3KB 3MNND 3O62B 1P3MD 3AZID 5B1MD 3AYWD 2ZM5A 4H9RA 2JE5A 5B1LC 2VQRA 3WTPA 3A6NB 2NQBB 4H9SA 3AZHB 2FJ7A 3AZNA 5B0YA 5GT0B 5JA4B 1P3BD 1AOIB 2HUEC 2Y2JA 4AWLB 3AV1C 5AV8A 3WAAD 1BH9B 2YFVA 5B32D 2IO5C 4XZQA 4YS3B 3MVDC 5F99A 5AV8C 3UT9A 1P3PA 3LELB 3H0MC 3MGSB 4XZQC 5BNVB 2F8NA 2L5AA 3UT9C 1ULYA 5F99C 1ID3D 5B31A 3W98A 2Y2LA 3WKJA 1N1JA 1EQZB 2BG1A 3AZJB 2DQNC 4KUDC 3KXBA 1HTAA 3X1VB 3MGQC 3AZMC 1U35D 1P3LA 3LZ1D 1KX4A 2HIOA 1TAFB 3MGRB 3TU4D 2BYMB 4M6BA 4JJNB 1ZLAB 1P3LC 1KX4C 5CPID 2HIOC 3RELB 3LJAA 5GSUB 1S32D 1TZYC 3RELC 3AZGA 3AN2D 5AV6D 4XUJB 2F8NG 4H9NA 5B31G 5AV9D 4DQYB 4DRAA 2Y2OA 3LZ0C 3W97B 3REIB 4ZUXC 2AROB 3X1SD 2YFWB 5CP6D 3UTAD 3AZLA 3W96A 4WU8A 3AZKB 3REJB 5B0ZC 1Q9CA 3VH5W 5AVBB 1KX5B 2NZDB 3WTPD 5BO0B 1F66A 3AZFC 5B40B 5DNNA 2FJ7D 5G49A 5B33B 3AZND 5B40C 2XD5A 5B0YD 1F66C 1JFIB 4Z5TC 5DNNC 4J8VC 5GT3C 5JRGC 3V9RA 1P3IC 5B24A 1P3OA 3UTBB 4R8PC 5E5AA 2BYKA 5AV8D 3AFAA 3REKA 1P3OC 4XZQD 2PYOB 3KUYB 3EPKA 4Z66B 4YM6A 3UT9D 5F99D 3REKC 4Z2MH 1P3PD 4H9OA 2F8ND 1HQ3B 3REHC 1A7WA 1BH8B 5B31D 3W98D 1KX3B 3B6FA 3WKJD 3MNNB 2F8NH 5GXQC 5CPJA 5DNMA 3MGQD 5KDMA 5B1MB 4J8WC 2CWEA 3B6GC 4QLCC 4J8UC 1P3LD 1KX4D 2HIOD 3AL0C 3LJAD 5B2JC 3KWQA 4KGCC 3AZGD 4WU9B 1M18B 4H9PB 4X23C 3KWQC 3VH5A 5BT1C 1P3FC 1M18C 2F8NK 4E45A 4KHAB 5AV5A 3AV2A 1M19C 5B2IA 3X1TA 5AV5C 3AV2C 1M1AC 3AZLD 1ID3B 3W96D 4WU8D 3X1TC 3EPHA 1P34A 3C1BA 3C1CA 4J8XC 3X1UC 3O62A 1P3KA 1U35B 1F1EA 3C1CC 3LZ1B 5AY8C 1F66D 5B1LA 5DNND 3MGPB 1P3KC 3O62C 3MGPC 3NQUB 5CPIB 1P3ID 1S32B 3AN2B 5AVCB 5AV6B 2NQBC 3A6NC 4WV4B 2ZY3A 2Y2QA 4CSRB 5B24D 1P3OD 3AZHC 5E5AD 3NQJB 5JA4A 3AFAD 3REKD 3AV1A 5GT0C 2RVQC 4YM6D 1Z2CB 1AOIC 3R45B 5CP6B 3MVDA 3UTAB 4AWLC 4EO5B 3B6FD 5CPJD 5BNVA 5DNMD 4UPKA 4YS3C 2LY8A 3W99B 3WTPE 3LELC 3EG5B 3MGSC 4H9RB 3WTPB 4KUDA 2UWXA 3H0LC 3MGQA 3AZMA 3X1VA 3AZNB 1EQZC 3AZJC 4G91B 2XD1A 5B0YB 3EPJA 3X1VC 3KWQD 3WA9B 5BT1D 4WNNA 2W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY A;  3REL A;  3WA9 C;  3MGR C;  5GSU A;  4JJN C;  1ZLA C;  1B67 A;  2YFV B;  5AV5 D;  3AV2 D;  5GSU C;  4LD9 B;  5B2I D;  3LZ0 A;  1P3P B;  3X1T D;  4ZUX A;  3W97 A;  4XUJ C;  2F8N B;  5B31 B;  3W98 B;  2ARO A;  1P34 D;  3W97 C;  3WKJ B;  3REI C;  3C1B D;  3C1C D;  3KXB B;  2ARO C;  5CPK B;  4E44 A;  3O62 D;  5B0Z A;  1P3K D;  5CPK C;  3AZK C;  5B1L D;  5AVB A;  3REJ C;  1P3A B;  3B0C T;  3B0D B;  3AZF A;  5BO0 A;  1P3A C;  5AVB C;  1KX5 C;  5B40 A;  2NZD C;  3AZG B;  2CV5 B;  4Z5T A;  5B33 A;  4J8V A;  5GT3 A;  5JRG A;  1P3I A;  5B33 C;  4R8P A;  3AV1 D;  3UTB A;  3AZE B;  4UUZ A;  3UTB C;  3MVD D;  3AZL B;  3W96 B;  4WU8 B;  3LEL D;  3REH A;  3MGS D;  2PYO C;  5BNX A;  3KUY C;  4Z66 C;  5GXQ A;  4J8W A;  1P3G B;  4ZBJ B;  4KUD D;  5CHL B;  1HQ3 C;  3VH6 W;  3B6G A;  1P3M B;  1P3G C;  3AZI B;  3AZM D;  1KX3 C;  3X1V D;  4QLC A;  3MNN C;  5G49 B;  4J8U A;  3AYW B;  1P3M C;  5B1M C;  4NE5 A;  5C3I B;  3V9R B;  5B2J A;  5B24 B;  4KGC A;  1TZY D;  3REL D;  5E5A B;  5GSU D;  2BYK B;  3AFA B;  4X23 A;  4WU9 A;  1P3F A;  1M18 A;  1P3B B;  4H9P A;  4CAY A;  4YM6 B;  3LZ0 D;  5BS7 C;  4HGA B;  4ZUX D;  1WWI A;  4WU9 C;  1M19 A;  3W97 D;  4HGA C;  3WAA B;  5B32 B;  3WAA C;  1M1A A;  3B6F B;  5B32 C;  2ARO D;  5CPJ B;  5DNM B;  5KDM B;  5FUG A;  5B0Z D;  1ID3 C;  4J8X A;  3X1U A;  5AVB D;  5AY8 A;  3AZF D;  5B40 D;  3MGP A;  1U35 C;  4Z5T D;  5B33 D;  3TU4 B;  3LZ1 C;  4J8V D;  5GT3 D;  2NQB A;  3A6N A;  5JRG D;  3AZH A;  4R8P D;  5CPI C;  3UTB D;  4NFT A;  3VH6 A;  1S32 C;  5B2I B;  3AN2 C;  5AVC C;  5AV6 C;  5GT0 A;  5AV9 B;  1AOI A;  1H3O B;  1P34 B;  3REH D;  3C1B B;  3X1S B;  1BH9 A;  5GXQ D;  4J8W D;  4YS3 A;  5CP6 C;  4H9Q B;  3UTA C;  1R4V A;  3B6G D;  3LEL A;  3MGS A;  3W99 A;  5B1L B;  4EO5 C;  4QLC D;  4DRB A;  4J8U D;  3W99 C;  1EQZ A;  3AZJ A;  3WTP C;  4H9S C;  5B2J D;  2FJ7 B;  4KGC D;  2FJ7 C;  4WZS B;  3AZN C;  3WA9 A;  4G91 C;  1TAF A;  2HUE B;  5B0Y C;  4WU9 D;  2BYM A;  4X23 D;  3MGR A;  3AV1 B;  4JJN A;  1P3F D;  1M18 D;  1ZLA A;  1WWS A;  2IO5 B;  1M19 D;  3MVD B;  5AV8 B;  4LD9 A;  4XZQ B;  4XUJ A;  1M1A D;  3UT9 B;  5F99 B;  4LD9 C;  1P3P C;  3REI A;  4KUD B;  5B31 C;  4NE6 A;  3X1U D;  1N1J B;  2YFW A;  3MGQ B;  4J8X D;  3AZM B;  3W98 C;  3WKJ C;  5CPK A;  5AY8 D;  3AZK A;  3VH5 T;  3KXB C;  3REJ A;  1P3L B;  1KX4 B;  3MGP D;  2HIO B;  1P3A A;  4WNN B;  4Z2M G;  3B0B A;  1TZY B;  1KX5 A;  2NZD A;  2NQB D;  3A6N D;  3LJA B;  5AVC D;  3AZH D;  2CV5 A;  3B0D C;  3LJA C;  3AZG C;  3LZ0 B;  2CV5 C;  1JFI A;  4H9N B;  4ZUX B;  5GT0 D;  2RVQ D;  3KSY A;  1AOI D;  3AZE A;  3AZE C;  2PYO A;  3KUY A;  4YS3 D;  4Z66 A;  5B0Z B;  3AZL C;  1KU5 A;  3VH6 T;  3W96 C;  4WU8 C;  3W99 D;  1HQ3 A;  1BH8 A;  1P3G A;  3AZF B;  1KX3 A;  1P3M A;  3MNN A;  3AZI A;  1EQZ D;  3AZJ D;  5B1M A;  1B6W A;  3B0C W;  4ZBJ C;  3AYW A;  4Z5T B;  1F66 B;  5DNN B;  4J8V B;  3AZI C;  5GT3 B;  5JRG B;  4G92 B;  1P3I B;  3AYW C;  4R8P B;  3WA9 D;  4G92 C;  3MGR D;  4JJN D;  1P3O B;  1ZLA D;  5C3I C;  5B24 C;  4UUZ B;  5E5A C;  5BS7 A;  3REK B;  1P3B A;  4LD9 D;  4XUJ D;  3AFA C;  3REH B;  5BNX B;  1P3B C;  3WAA A;  4H9O B;  4YM6 C;  5B32 A;  4KHA A;  5GXQ B;  3REI D;  4J8W B;  3B6G B;  3KXB D;  3B6F C;  4QLC B;  4J8U B;  1ID3 A;  5CPJ C;  5CPK D;  5DNM C;  3AZK D;  3REJ D;  1P3A D;  5B2J B;  1KX5 D;  4KGC B;  2NZD D;  1U35 A;  3LZ1 A;  2CV5 D;  4X23 B;  3KWQ B;  3TU4 A;  1P3F B;  1BFM A;  4CAY B;  5B32 G;  3NQU A;  5CPI A;  3TU4 C;  1S32 A;  1M19 B;  4NE3 A;  3AN2 A;  5AVC A;  5AV6 A;  4CSR A;  5AV5 B;  2JSS A;  3AZE D;  3AV2 B;  1M1A B;  3NQJ A;  5AV9 A;  3X1T B;  5B2I C;  5FUG B;  2PYO D;  3KUY D;  1H3O A;  5AV9 C;  4Z66 D;  3X1S A;  4J8X B;  3X1U B;  3R45 A;  5CP6 A;  3UTA A;  1HQ3 D;  3C1C B;  1P34 C;  1P3G D;  5AY8 B;  4H9Q A;  3C1B C;  3X1S C;  1KX3 D;  1P3K B;  3MNN D;  3O62 B;  1P3M D;  3AZI D;  5B1M D;  3AYW D;  4H9R A;  3WTP A;  5B1L C;  2NQB B;  3A6N B;  4H9S A;  3AZH B;  2FJ7 A;  3AZN A;  5B0Y A;  5GT0 B;  5JA4 B;  1P3B D;  1AOI B;  2HUE C;  3AV1 C;  4AWL B;  5AV8 A;  3WAA D;  1BH9 B;  2YFV A;  5B32 D;  2IO5 C;  4XZQ A;  4YS3 B;  3MVD C;  5F99 A;  5AV8 C;  3UT9 A;  1P3P A;  3LEL B;  3MGS B;  4XZQ C;  5BNV B;  2F8N A;  2L5A A;  3UT9 C;  1ULY A;  5F99 C;  1ID3 D;  5B31 A;  3W98 A;  3WKJ A;  1N1J A;  1EQZ B;  3AZJ B;  4KUD C;  3KXB A;  1HTA A;  3X1V B;  3MGQ C;  3AZM C;  1U35 D;  1P3L A;  3LZ1 D;  1KX4 A;  2HIO A;  1TAF B;  3MGR B;  3TU4 D;  2BYM B;  4M6B A;  4JJN B;  1ZLA B;  1P3L C;  1KX4 C;  5CPI D;  2HIO C;  3REL B;  3LJA A;  5GSU B;  1S32 D;  1TZY C;  3REL C;  3AZG A;  3AN2 D;  5AV6 D;  4XUJ B;  2F8N G;  4H9N A;  5B31 G;  5AV9 D;  4DRA A;  3LZ0 C;  3W97 B;  3REI B;  4ZUX C;  2ARO B;  3X1S D;  2YFW B;  5CP6 D;  3UTA D;  3AZL A;  3W96 A;  4WU8 A;  3AZK B;  3REJ B;  5B0Z C;  1Q9C A;  3VH5 W;  5AVB B;  1KX5 B;  2NZD B;  3WTP D;  5BO0 B;  1F66 A;  3AZF C;  5B40 B;  5DNN A;  2FJ7 D;  5G49 A;  5B33 B;  3AZN D;  5B40 C;  5B0Y D;  1F66 C;  1JFI B;  4Z5T C;  5DNN C;  4J8V C;  5GT3 C;  5JRG C;  3V9R A;  1P3I C;  5B24 A;  1P3O A;  3UTB B;  4R8P C;  5E5A A;  2BYK A;  5AV8 D;  3AFA A;  3REK A;  1P3O C;  4XZQ D;  2PYO B;  3KUY B;  4Z66 B;  4YM6 A;  3UT9 D;  5F99 D;  3REK C;  4Z2M H;  1P3P D;  4H9O A;  2F8N D;  1HQ3 B;  3REH C;  1A7W A;  1BH8 B;  5B31 D;  3W98 D;  1KX3 B;  3B6F A;  3WKJ D;  3MNN B;  2F8N H;  5GXQ C;  5CPJ A;  5DNM A;  3MGQ D;  5KDM A;  5B1M B;  4J8W C;  2CWE A;  3B6G C;  4QLC C;  4J8U C;  1P3L D;  1KX4 D;  2HIO D;  3LJA D;  5B2J C;  3KWQ A;  4KGC C;  3AZG D;  4WU9 B;  1M18 B;  4H9P B;  4X23 C;  3KWQ C;  3VH5 A;  5BT1 C;  1P3F C;  1M18 C;  2F8N K;  4E45 A;  4KHA B;  5AV5 A;  3AV2 A;  1M19 C;  5B2I A;  3X1T A;  5AV5 C;  3AV2 C;  1M1A C;  3AZL D;  1ID3 B;  3W96 D;  4WU8 D;  3X1T C;  1P34 A;  3C1B A;  3C1C A;  4J8X C;  3X1U C;  3O62 A;  1P3K A;  1U35 B;  1F1E A;  3C1C C;  3LZ1 B;  5AY8 C;  1F66 D;  5B1L A;  5DNN D;  3MGP B;  1P3K C;  3O62 C;  3MGP C;  3NQU B;  5CPI B;  1P3I D;  1S32 B;  3AN2 B;  5AVC B;  5AV6 B;  2NQB C;  3A6N C;  4WV4 B;  4CSR B;  1P3O D;  5B24 D;  3AZH C;  5E5A D;  3NQJ B;  5JA4 A;  3AFA D;  3REK D;  3AV1 A;  5GT0 C;  2RVQ C;  4YM6 D;  1AOI C;  3R45 B;  5CP6 B;  3MVD A;  3UTA B;  4AWL C;  4EO5 B;  3B6F D;  5CPJ D;  5BNV A;  5DNM D;  4YS3 C;  2LY8 A;  3W99 B;  3WTP E;  3LEL C;  3MGS C;  4H9R B;  3WTP B;  4KUD A;  3MGQ A;  3AZM A;  3X1V A;  3AZN B;  1EQZ C;  3AZJ C;  4G91 B;  5B0Y B;  3X1V C;  3KWQ D;  3WA9 B;  5BT1 D;  4WNN A; 
#chains in the Genus database with same CATH topology
 1TZY A;  3REL A;  3WA9 C;  3MGR C;  5GSU A;  2Y2M A;  4JJN C;  1ZLA C;  1B67 A;  2YFV B;  5AV5 D;  3AV2 D;  2ZY5 A;  5GSU C;  4LD9 B;  5B2I D;  3LZ0 A;  1P3P B;  3X1T D;  4ZUX A;  3W97 A;  4XUJ C;  2F8N B;  5B31 B;  3W98 B;  2ARO A;  1P34 D;  3W97 C;  3WKJ B;  3REI C;  3C1B D;  3C1C D;  3KXB B;  2ARO C;  5CPK B;  4E44 A;  3O62 D;  5B0Z A;  1P3K D;  5CPK C;  3AZK C;  5B1L D;  5AVB A;  3REJ C;  1P3A B;  3B0C T;  3B0D B;  3AZF A;  5BO0 A;  1P3A C;  5AVB C;  1KX5 C;  5B40 A;  2NZD C;  3AZG B;  2CV5 B;  4Z5T A;  5B33 A;  4J8V A;  5GT3 A;  5JRG A;  1P3I A;  5B33 C;  4R8P A;  3AV1 D;  3UTB A;  3AZE B;  4UUZ A;  3UTB C;  3MVD D;  3FDD A;  3AZL B;  3W96 B;  4WU8 B;  1W2E A;  3LEL D;  3REH A;  3MGS D;  2PYO C;  5BNX A;  3KUY C;  4Z66 C;  5GXQ A;  4J8W A;  1P3G B;  4ZBJ B;  3H0R C;  4KUD D;  5CHL B;  1HQ3 C;  3VH6 W;  3B6G A;  1P3M B;  1P3G C;  3AZI B;  3AZM D;  1KX3 C;  3X1V D;  4QLC A;  3MNN C;  5G49 B;  4J8U A;  3AYW B;  1P3M C;  5B1M C;  4NE5 A;  5C3I B;  3V9R B;  5B2J A;  5B24 B;  4KGC A;  1TZY D;  3REL D;  5E5A B;  2Y2G A;  2G5I C;  5GSU D;  2BYK B;  3AFA B;  4X23 A;  4WU9 A;  1P3F A;  1M18 A;  1P3B B;  4H9P A;  4CAY A;  4YM6 B;  3LZ0 D;  5BS7 C;  4HGA B;  4ZUX D;  1WWI A;  4WU9 C;  1M19 A;  3W97 D;  4HGA C;  3WAA B;  5B32 B;  3WAA C;  1M1A A;  3B6F B;  5B32 C;  2ARO D;  5CPJ B;  2JCH A;  5DNM B;  5KDM B;  5FUG A;  5B0Z D;  1ID3 C;  4J8X A;  3X1U A;  5AVB D;  5AY8 A;  3AZF D;  5B40 D;  3MGP A;  1U35 C;  4Z5T D;  5B33 D;  3TU4 B;  3LZ1 C;  4J8V D;  2Y2H A;  5GT3 D;  2NQB A;  3A6N A;  5JRG D;  3AZH A;  4R8P D;  2RIQ A;  5CPI C;  3UTB D;  4NFT A;  3VH6 A;  1S32 C;  5B2I B;  3AN2 C;  5AVC C;  5AV6 C;  5GT0 A;  5AV9 B;  1AOI A;  1H3O B;  1P34 B;  3REH D;  2FFF B;  3C1B B;  3X1S B;  1BH9 A;  5GXQ D;  4J8W D;  4YS3 A;  4WJ3 C;  5CP6 C;  4H9Q B;  3UTA C;  1R4V A;  3B6G D;  3LEL A;  3MGS A;  3W99 A;  5B1L B;  4EO5 C;  4QLC D;  4DRB A;  4J8U D;  3W99 C;  1EQZ A;  3AZJ A;  3WTP C;  4H9S C;  5B2J D;  2FJ7 B;  4KGC D;  2FJ7 C;  4WZS B;  3AZN C;  3WA9 A;  4G91 C;  1TAF A;  2HUE B;  5B0Y C;  4WU9 D;  2BYM A;  4X23 D;  3MGR A;  3AV1 B;  4JJN A;  1P3F D;  1M18 D;  1ZLA A;  1WWS A;  2IO5 B;  2Y2N A;  1M19 D;  3MVD B;  5AV8 B;  4LD9 A;  4XZQ B;  4XUJ A;  1M1A D;  3UT9 B;  5F99 B;  4LD9 C;  2Y2P A;  1P3P C;  3REI A;  4KUD B;  5B31 C;  4NE6 A;  3X1U D;  1N1J B;  2YFW A;  3MGQ B;  4J8X D;  3AZM B;  3W98 C;  3WKJ C;  5CPK A;  2Y2K A;  5AY8 D;  3AZK A;  3VH5 T;  3KXB C;  3REJ A;  1P3L B;  1KX4 B;  3MGP D;  2HIO B;  1P3A A;  4WNN B;  4Z2M G;  3B0B A;  1TZY B;  1KX5 A;  2NZD A;  3IP4 C;  2NQB D;  3A6N D;  3LJA B;  5AVC D;  3AZH D;  2CV5 A;  2ZY4 A;  3B0D C;  3LJA C;  3A1K A;  3AZG C;  3LZ0 B;  2CV5 C;  1JFI A;  4H9N B;  4ZUX B;  5GT0 D;  2RVQ D;  3KSY A;  1AOI D;  3AZE A;  3AZE C;  2PYO A;  3KUY A;  4YS3 D;  4Z66 A;  5B0Z B;  1T3U A;  3AZL C;  3KFU G;  1KU5 A;  3VH6 T;  3W96 C;  3EPL A;  4WU8 C;  3W99 D;  2J8P A;  1HQ3 A;  1BH8 A;  1P3G A;  3AZF B;  1KX3 A;  1P3M A;  3MNN A;  3AZI A;  1EQZ D;  3AZJ D;  5B1M A;  1B6W A;  3B0C W;  4ZBJ C;  3AYW A;  4Z5T B;  1F66 B;  5DNN B;  4J8V B;  3AZI C;  5GT3 B;  2Y2I A;  5JRG B;  4G92 B;  1P3I B;  3AYW C;  4R8P B;  3WA9 D;  4G92 C;  3MGR D;  4JJN D;  1P3O B;  1ZLA D;  5C3I C;  3P5J B;  5B24 C;  4UUZ B;  5E5A C;  5BS7 A;  3REK B;  1P3B A;  4LD9 D;  4XUJ D;  3AFA C;  3REH B;  5BNX B;  1P3B C;  2F2A C;  3WAA A;  4H9O B;  4YM6 C;  5B32 A;  4KHA A;  5GXQ B;  3REI D;  4J8W B;  3B6G B;  3KXB D;  3B6F C;  4QLC B;  4J8U B;  2DF4 C;  1ID3 A;  5CPJ C;  5CPK D;  5DNM C;  3AZK D;  3REJ D;  1P3A D;  5B2J B;  1KX5 D;  1PZR A;  4KGC B;  2NZD D;  1U35 A;  3LZ1 A;  2CV5 D;  4X23 B;  3KWQ B;  3TU4 A;  1P3F B;  1BFM A;  4CAY B;  5B32 G;  3NQU A;  5CPI A;  3TU4 C;  1S32 A;  1M19 B;  4NE3 A;  3AN2 A;  5AVC A;  5AV6 A;  4CSR A;  5AV5 B;  2JSS A;  3AZE D;  3AV2 B;  1M1A B;  3NQJ A;  2G5H C;  5AV9 A;  3X1T B;  2ZY2 A;  5B2I C;  3A1I A;  5FUG B;  2PYO D;  3KUY D;  1H3O A;  5AV9 C;  4Z66 D;  3F6T A;  3X1S A;  4J8X B;  3X1U B;  3R45 A;  5CP6 A;  3UTA A;  1HQ3 D;  3C1C B;  1P34 C;  1P3G D;  5AY8 B;  4H9Q A;  3C1B C;  3X1S C;  1KX3 D;  1P3K B;  3MNN D;  3O62 B;  1P3M D;  3AZI D;  5B1M D;  3AYW D;  2ZM5 A;  4H9R A;  2JE5 A;  5B1L C;  2VQR A;  3WTP A;  3A6N B;  2NQB B;  4H9S A;  3AZH B;  2FJ7 A;  3AZN A;  5B0Y A;  5GT0 B;  5JA4 B;  1P3B D;  1AOI B;  2HUE C;  2Y2J A;  4AWL B;  3AV1 C;  5AV8 A;  3WAA D;  1BH9 B;  2YFV A;  5B32 D;  2IO5 C;  4XZQ A;  4YS3 B;  3MVD C;  5F99 A;  5AV8 C;  3UT9 A;  1P3P A;  3LEL B;  3H0M C;  3MGS B;  4XZQ C;  5BNV B;  2F8N A;  2L5A A;  3UT9 C;  1ULY A;  5F99 C;  1ID3 D;  5B31 A;  3W98 A;  2Y2L A;  3WKJ A;  1N1J A;  1EQZ B;  2BG1 A;  3AZJ B;  2DQN C;  4KUD C;  3KXB A;  1HTA A;  3X1V B;  3MGQ C;  3AZM C;  1U35 D;  1P3L A;  3LZ1 D;  1KX4 A;  2HIO A;  1TAF B;  3MGR B;  3TU4 D;  2BYM B;  4M6B A;  4JJN B;  1ZLA B;  1P3L C;  1KX4 C;  5CPI D;  2HIO C;  3REL B;  3LJA A;  5GSU B;  1S32 D;  1TZY C;  3REL C;  3AZG A;  3AN2 D;  5AV6 D;  4XUJ B;  2F8N G;  4H9N A;  5B31 G;  5AV9 D;  4DQY B;  4DRA A;  2Y2O A;  3LZ0 C;  3W97 B;  3REI B;  4ZUX C;  2ARO B;  3X1S D;  2YFW B;  5CP6 D;  3UTA D;  3AZL A;  3W96 A;  4WU8 A;  3AZK B;  3REJ B;  5B0Z C;  1Q9C A;  3VH5 W;  5AVB B;  1KX5 B;  2NZD B;  3WTP D;  5BO0 B;  1F66 A;  3AZF C;  5B40 B;  5DNN A;  2FJ7 D;  5G49 A;  5B33 B;  3AZN D;  5B40 C;  2XD5 A;  5B0Y D;  1F66 C;  1JFI B;  4Z5T C;  5DNN C;  4J8V C;  5GT3 C;  5JRG C;  3V9R A;  1P3I C;  5B24 A;  1P3O A;  3UTB B;  4R8P C;  5E5A A;  2BYK A;  5AV8 D;  3AFA A;  3REK A;  1P3O C;  4XZQ D;  2PYO B;  3KUY B;  3EPK A;  4Z66 B;  4YM6 A;  3UT9 D;  5F99 D;  3REK C;  4Z2M H;  1P3P D;  4H9O A;  2F8N D;  1HQ3 B;  3REH C;  1A7W A;  1BH8 B;  5B31 D;  3W98 D;  1KX3 B;  3B6F A;  3WKJ D;  3MNN B;  2F8N H;  5GXQ C;  5CPJ A;  5DNM A;  3MGQ D;  5KDM A;  5B1M B;  4J8W C;  2CWE A;  3B6G C;  4QLC C;  4J8U C;  1P3L D;  1KX4 D;  2HIO D;  3AL0 C;  3LJA D;  5B2J C;  3KWQ A;  4KGC C;  3AZG D;  4WU9 B;  1M18 B;  4H9P B;  4X23 C;  3KWQ C;  3VH5 A;  5BT1 C;  1P3F C;  1M18 C;  2F8N K;  4E45 A;  4KHA B;  5AV5 A;  3AV2 A;  1M19 C;  5B2I A;  3X1T A;  5AV5 C;  3AV2 C;  1M1A C;  3AZL D;  1ID3 B;  3W96 D;  4WU8 D;  3X1T C;  3EPH A;  1P34 A;  3C1B A;  3C1C A;  4J8X C;  3X1U C;  3O62 A;  1P3K A;  1U35 B;  1F1E A;  3C1C C;  3LZ1 B;  5AY8 C;  1F66 D;  5B1L A;  5DNN D;  3MGP B;  1P3K C;  3O62 C;  3MGP C;  3NQU B;  5CPI B;  1P3I D;  1S32 B;  3AN2 B;  5AVC B;  5AV6 B;  2NQB C;  3A6N C;  4WV4 B;  2ZY3 A;  2Y2Q A;  4CSR B;  5B24 D;  1P3O D;  3AZH C;  5E5A D;  3NQJ B;  5JA4 A;  3AFA D;  3REK D;  3AV1 A;  5GT0 C;  2RVQ C;  4YM6 D;  1Z2C B;  1AOI C;  3R45 B;  5CP6 B;  3MVD A;  3UTA B;  4AWL C;  4EO5 B;  3B6F D;  5CPJ D;  5BNV A;  5DNM D;  4UPK A;  4YS3 C;  2LY8 A;  3W99 B;  3WTP E;  3LEL C;  3EG5 B;  3MGS C;  4H9R B;  3WTP B;  4KUD A;  2UWX A;  3H0L C;  3MGQ A;  3AZM A;  3X1V A;  3AZN B;  1EQZ C;  3AZJ C;  4G91 B;  2XD1 A;  5B0Y B;  3EPJ A;  3X1V C;  3KWQ D;  3WA9 B;  5BT1 D;  4WNN A;  2W8S A; 
#chains in the Genus database with same CATH homology
 1TZY A;  3REL A;  3WA9 C;  3MGR C;  5GSU A;  2Y2M A;  4JJN C;  1ZLA C;  1B67 A;  2YFV B;  5AV5 D;  3AV2 D;  2ZY5 A;  5GSU C;  4LD9 B;  5B2I D;  3LZ0 A;  1P3P B;  3X1T D;  4ZUX A;  3W97 A;  4XUJ C;  2F8N B;  5B31 B;  3W98 B;  2ARO A;  1P34 D;  3W97 C;  3WKJ B;  3REI C;  3C1B D;  3C1C D;  3KXB B;  2ARO C;  5CPK B;  4E44 A;  3O62 D;  5B0Z A;  1P3K D;  5CPK C;  3AZK C;  5B1L D;  5AVB A;  3REJ C;  1P3A B;  3B0C T;  3B0D B;  3AZF A;  5BO0 A;  1P3A C;  5AVB C;  1KX5 C;  5B40 A;  2NZD C;  3AZG B;  2CV5 B;  4Z5T A;  5B33 A;  4J8V A;  5GT3 A;  5JRG A;  1P3I A;  5B33 C;  4R8P A;  3AV1 D;  3UTB A;  3AZE B;  4UUZ A;  3UTB C;  3MVD D;  3FDD A;  3AZL B;  3W96 B;  4WU8 B;  1W2E A;  3LEL D;  3REH A;  3MGS D;  2PYO C;  5BNX A;  3KUY C;  4Z66 C;  5GXQ A;  4J8W A;  1P3G B;  4ZBJ B;  3H0R C;  4KUD D;  5CHL B;  1HQ3 C;  3VH6 W;  3B6G A;  1P3M B;  1P3G C;  3AZI B;  3AZM D;  1KX3 C;  3X1V D;  4QLC A;  3MNN C;  5G49 B;  4J8U A;  3AYW B;  1P3M C;  5B1M C;  4NE5 A;  5C3I B;  3V9R B;  5B2J A;  5B24 B;  4KGC A;  1TZY D;  3REL D;  5E5A B;  2Y2G A;  2G5I C;  5GSU D;  2BYK B;  3AFA B;  4X23 A;  4WU9 A;  1P3F A;  1M18 A;  1P3B B;  4H9P A;  4CAY A;  4YM6 B;  3LZ0 D;  5BS7 C;  4HGA B;  4ZUX D;  1WWI A;  4WU9 C;  1M19 A;  3W97 D;  4HGA C;  3WAA B;  5B32 B;  3WAA C;  1M1A A;  3B6F B;  5B32 C;  2ARO D;  5CPJ B;  2JCH A;  5DNM B;  5KDM B;  5FUG A;  5B0Z D;  1ID3 C;  4J8X A;  3X1U A;  5AVB D;  5AY8 A;  3AZF D;  5B40 D;  3MGP A;  1U35 C;  4Z5T D;  5B33 D;  3TU4 B;  3LZ1 C;  4J8V D;  2Y2H A;  5GT3 D;  2NQB A;  3A6N A;  5JRG D;  3AZH A;  4R8P D;  2RIQ A;  5CPI C;  3UTB D;  4NFT A;  3VH6 A;  1S32 C;  5B2I B;  3AN2 C;  5AVC C;  5AV6 C;  5GT0 A;  5AV9 B;  1AOI A;  1H3O B;  1P34 B;  3REH D;  2FFF B;  3C1B B;  3X1S B;  1BH9 A;  5GXQ D;  4J8W D;  4YS3 A;  4WJ3 C;  5CP6 C;  4H9Q B;  3UTA C;  1R4V A;  3B6G D;  3LEL A;  3MGS A;  3W99 A;  5B1L B;  4EO5 C;  4QLC D;  4DRB A;  4J8U D;  3W99 C;  1EQZ A;  3AZJ A;  3WTP C;  4H9S C;  5B2J D;  2FJ7 B;  4KGC D;  2FJ7 C;  4WZS B;  3AZN C;  3WA9 A;  4G91 C;  1TAF A;  2HUE B;  5B0Y C;  4WU9 D;  2BYM A;  4X23 D;  3MGR A;  3AV1 B;  4JJN A;  1P3F D;  1M18 D;  1ZLA A;  1WWS A;  2IO5 B;  2Y2N A;  1M19 D;  3MVD B;  5AV8 B;  4LD9 A;  4XZQ B;  4XUJ A;  1M1A D;  3UT9 B;  5F99 B;  4LD9 C;  2Y2P A;  1P3P C;  3REI A;  4KUD B;  5B31 C;  4NE6 A;  3X1U D;  1N1J B;  2YFW A;  3MGQ B;  4J8X D;  3AZM B;  3W98 C;  3WKJ C;  5CPK A;  2Y2K A;  5AY8 D;  3AZK A;  3VH5 T;  3KXB C;  3REJ A;  1P3L B;  1KX4 B;  3MGP D;  2HIO B;  1P3A A;  4WNN B;  4Z2M G;  3B0B A;  1TZY B;  1KX5 A;  2NZD A;  3IP4 C;  2NQB D;  3A6N D;  3LJA B;  5AVC D;  3AZH D;  2CV5 A;  2ZY4 A;  3B0D C;  3LJA C;  3A1K A;  3AZG C;  3LZ0 B;  2CV5 C;  1JFI A;  4H9N B;  4ZUX B;  5GT0 D;  2RVQ D;  3KSY A;  1AOI D;  3AZE A;  3AZE C;  2PYO A;  3KUY A;  4YS3 D;  4Z66 A;  5B0Z B;  1T3U A;  3AZL C;  3KFU G;  1KU5 A;  3VH6 T;  3W96 C;  3EPL A;  4WU8 C;  3W99 D;  2J8P A;  1HQ3 A;  1BH8 A;  1P3G A;  3AZF B;  1KX3 A;  1P3M A;  3MNN A;  3AZI A;  1EQZ D;  3AZJ D;  5B1M A;  1B6W A;  3B0C W;  4ZBJ C;  3AYW A;  4Z5T B;  1F66 B;  5DNN B;  4J8V B;  3AZI C;  5GT3 B;  2Y2I A;  5JRG B;  4G92 B;  1P3I B;  3AYW C;  4R8P B;  3WA9 D;  4G92 C;  3MGR D;  4JJN D;  1P3O B;  1ZLA D;  5C3I C;  3P5J B;  5B24 C;  4UUZ B;  5E5A C;  5BS7 A;  3REK B;  1P3B A;  4LD9 D;  4XUJ D;  3AFA C;  3REH B;  5BNX B;  1P3B C;  2F2A C;  3WAA A;  4H9O B;  4YM6 C;  5B32 A;  4KHA A;  5GXQ B;  3REI D;  4J8W B;  3B6G B;  3KXB D;  3B6F C;  4QLC B;  4J8U B;  2DF4 C;  1ID3 A;  5CPJ C;  5CPK D;  5DNM C;  3AZK D;  3REJ D;  1P3A D;  5B2J B;  1KX5 D;  1PZR A;  4KGC B;  2NZD D;  1U35 A;  3LZ1 A;  2CV5 D;  4X23 B;  3KWQ B;  3TU4 A;  1P3F B;  1BFM A;  4CAY B;  5B32 G;  3NQU A;  5CPI A;  3TU4 C;  1S32 A;  1M19 B;  4NE3 A;  3AN2 A;  5AVC A;  5AV6 A;  4CSR A;  5AV5 B;  2JSS A;  3AZE D;  3AV2 B;  1M1A B;  3NQJ A;  2G5H C;  5AV9 A;  3X1T B;  2ZY2 A;  5B2I C;  3A1I A;  5FUG B;  2PYO D;  3KUY D;  1H3O A;  5AV9 C;  4Z66 D;  3F6T A;  3X1S A;  4J8X B;  3X1U B;  3R45 A;  5CP6 A;  3UTA A;  1HQ3 D;  3C1C B;  1P34 C;  1P3G D;  5AY8 B;  4H9Q A;  3C1B C;  3X1S C;  1KX3 D;  1P3K B;  3MNN D;  3O62 B;  1P3M D;  3AZI D;  5B1M D;  3AYW D;  2ZM5 A;  4H9R A;  2JE5 A;  5B1L C;  2VQR A;  3WTP A;  3A6N B;  2NQB B;  4H9S A;  3AZH B;  2FJ7 A;  3AZN A;  5B0Y A;  5GT0 B;  5JA4 B;  1P3B D;  1AOI B;  2HUE C;  2Y2J A;  4AWL B;  3AV1 C;  5AV8 A;  3WAA D;  1BH9 B;  2YFV A;  5B32 D;  2IO5 C;  4XZQ A;  4YS3 B;  3MVD C;  5F99 A;  5AV8 C;  3UT9 A;  1P3P A;  3LEL B;  3H0M C;  3MGS B;  4XZQ C;  5BNV B;  2F8N A;  2L5A A;  3UT9 C;  1ULY A;  5F99 C;  1ID3 D;  5B31 A;  3W98 A;  2Y2L A;  3WKJ A;  1N1J A;  1EQZ B;  2BG1 A;  3AZJ B;  2DQN C;  4KUD C;  3KXB A;  1HTA A;  3X1V B;  3MGQ C;  3AZM C;  1U35 D;  1P3L A;  3LZ1 D;  1KX4 A;  2HIO A;  1TAF B;  3MGR B;  3TU4 D;  2BYM B;  4M6B A;  4JJN B;  1ZLA B;  1P3L C;  1KX4 C;  5CPI D;  2HIO C;  3REL B;  3LJA A;  5GSU B;  1S32 D;  1TZY C;  3REL C;  3AZG A;  3AN2 D;  5AV6 D;  4XUJ B;  2F8N G;  4H9N A;  5B31 G;  5AV9 D;  4DQY B;  4DRA A;  2Y2O A;  3LZ0 C;  3W97 B;  3REI B;  4ZUX C;  2ARO B;  3X1S D;  2YFW B;  5CP6 D;  3UTA D;  3AZL A;  3W96 A;  4WU8 A;  3AZK B;  3REJ B;  5B0Z C;  1Q9C A;  3VH5 W;  5AVB B;  1KX5 B;  2NZD B;  3WTP D;  5BO0 B;  1F66 A;  3AZF C;  5B40 B;  5DNN A;  2FJ7 D;  5G49 A;  5B33 B;  3AZN D;  5B40 C;  2XD5 A;  5B0Y D;  1F66 C;  1JFI B;  4Z5T C;  5DNN C;  4J8V C;  5GT3 C;  5JRG C;  3V9R A;  1P3I C;  5B24 A;  1P3O A;  3UTB B;  4R8P C;  5E5A A;  2BYK A;  5AV8 D;  3AFA A;  3REK A;  1P3O C;  4XZQ D;  2PYO B;  3KUY B;  3EPK A;  4Z66 B;  4YM6 A;  3UT9 D;  5F99 D;  3REK C;  4Z2M H;  1P3P D;  4H9O A;  2F8N D;  1HQ3 B;  3REH C;  1A7W A;  1BH8 B;  5B31 D;  3W98 D;  1KX3 B;  3B6F A;  3WKJ D;  3MNN B;  2F8N H;  5GXQ C;  5CPJ A;  5DNM A;  3MGQ D;  5KDM A;  5B1M B;  4J8W C;  2CWE A;  3B6G C;  4QLC C;  4J8U C;  1P3L D;  1KX4 D;  2HIO D;  3AL0 C;  3LJA D;  5B2J C;  3KWQ A;  4KGC C;  3AZG D;  4WU9 B;  1M18 B;  4H9P B;  4X23 C;  3KWQ C;  3VH5 A;  5BT1 C;  1P3F C;  1M18 C;  2F8N K;  4E45 A;  4KHA B;  5AV5 A;  3AV2 A;  1M19 C;  5B2I A;  3X1T A;  5AV5 C;  3AV2 C;  1M1A C;  3AZL D;  1ID3 B;  3W96 D;  4WU8 D;  3X1T C;  3EPH A;  1P34 A;  3C1B A;  3C1C A;  4J8X C;  3X1U C;  3O62 A;  1P3K A;  1U35 B;  1F1E A;  3C1C C;  3LZ1 B;  5AY8 C;  1F66 D;  5B1L A;  5DNN D;  3MGP B;  1P3K C;  3O62 C;  3MGP C;  3NQU B;  5CPI B;  1P3I D;  1S32 B;  3AN2 B;  5AVC B;  5AV6 B;  2NQB C;  3A6N C;  4WV4 B;  2ZY3 A;  2Y2Q A;  4CSR B;  5B24 D;  1P3O D;  3AZH C;  5E5A D;  3NQJ B;  5JA4 A;  3AFA D;  3REK D;  3AV1 A;  5GT0 C;  2RVQ C;  4YM6 D;  1Z2C B;  1AOI C;  3R45 B;  5CP6 B;  3MVD A;  3UTA B;  4AWL C;  4EO5 B;  3B6F D;  5CPJ D;  5BNV A;  5DNM D;  4UPK A;  4YS3 C;  2LY8 A;  3W99 B;  3WTP E;  3LEL C;  3EG5 B;  3MGS C;  4H9R B;  3WTP B;  4KUD A;  2UWX A;  3H0L C;  3MGQ A;  3AZM A;  3X1V A;  3AZN B;  1EQZ C;  3AZJ C;  4G91 B;  2XD1 A;  5B0Y B;  3EPJ A;  3X1V C;  3KWQ D;  3WA9 B;  5BT1 D;  4WNN A;  2W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...