3REHC

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehC00
1ULYA 4X23A 4Z66C 3LZ0C 3MGRB 2HIOB 5B0ZD 2FJ7B 3REHC 3AZID 3W98A 3B6FD 5BO0A 3LJAA 5F99A 5B40D 1P3FD 3TU4D 3MGPC 1WWIA 3KXBA 4NE5A 3RELA 1P3KA 1KU5A 5AV5C 1P3IA 4R8PD 1KX3D 4YM6D 1P3BA 1M18C 3AZIB 3AZND 3AYWD 3B6FB 5DNMD 3UTAD 3AN2C 2NZDA 1S32C 3NQUA 5AV9B 5B40B 3TU4B 3O62D 3AZGA 3AZLC 4R8PB 5G49B 1KX3B 1BFMA 3VH6A 3W99B 4YM6B 3LZ1A 4J8VA 3AZNB 3AYWB 1P3MC 3VH5W 5DNMB 3UTAB 5JA4B 5AV9C 3WKJC 5B0ZA 4ZUXD 1F66C 4LD9D 4AWLB 3O62B 5GT3D 3WAAD 1P3FA 3AFAB 2YFWB 4H9PB 2CV5D 4KGCA 4YS3A 3REJD 5B1MA 3MGQB 3X1SD 1P34D 4ZUXB 1P3GC 4LD9B 4AWLC 3UTAA 1H3OA 2YFVA 3AZFB 3AV2D 4H9RA 3AFAC 3REIC 1JFIB 5BNVB 3X1UD 3X1TC 5GXQD 5B1LD 2PYOC 3W97B 2CV5B 3AZHD 3REJB 4JJNB 2F8ND 4WNNA 2AROC 4KHAA 3B0DB 3AV1A 3W96C 4G92C 4Z5TA 1P3PD 1HTAA 3MGSD 3REKA 3AV2B 5AV8C 3WA9A 4CAYB 5CPKA 4QLCC 2F8NG 3WTPC 5GXQB 5B1LB 5GT3A 1M1AD 4H9SC 3W97C 3WAAA 2IO5B 5B31D 3AZED 3A6ND 5AVCB 1TZYA 3MNNB 3C1CC 1AOIA 5GT0C 5B2IB 4XUJC 4J8WB 4J8XC 1HQ3C 5JRGC 5CP6C 1P3PB 5CPIC 5AV6D 3X1SA 4Z66D 3R45B 1P34A 4XZQC 3REHD 3KUYD 4CSRB 3AZEB 3A6NB 1KX5B 4HGAB 4Z2MH 1P3LC 3X1UA 3MGPD 4NFTA 4WU8D 3AZHA 5B32C 5B24C 5E5AC 3C1BC 1P3OA 2F8NA 5AV5D 3AZJA 5AV6B 3UTBA 4Z66B 3LZ0B 2HIOD 3KWQC 5DNNC 5B0YC 2FJ7D 5B33C 3B6GA 5CPJC 3LELB 3MGSA 5B2JA 3AN2D 4WV4B 2BYMB 1S32D 4KUDA 4H9NB 3MGPB 1M1AA 1M19C 5B31A 5AY8A 4G91C 1R4VA 1KX4C 3AZLD 5AV5B 3UT9C 4WZSB 2BYKA 3AZKC 1N1JA 1P3AA 3VH5T 1M18B 5BT1C 3LELC 1P3MD 2CWEA 3AN2B 5AV9D 1S32B 3WKJD 3REHA 3X1VA 3KUYA 1F66D 4WU9C 1BH8B 1U35A 4X23C 1EQZA 3AZLB 1ID3A 4WU8A 3W99D 3W98C 4H9OB 5BS7A 1P3MB 5F99C 3MGRA 2HIOA 4ZBJC 3WKJB 2FJ7A 3KXBC 1P3GD 5CHLB 1F66B 1P3KC 3AFAD 3REID 3X1TD 1TAFB 1P3BC 3KSYA 4EO5C 1Q9CA 2NZDC 3MGQD 2AROD 3W96D 3AZIA 1P3GB 3VH5A 3B6FA 3AZFD 3AZGC 5AV9A 3WKJA 5AV8D 5B40A 3REIB 3TU4A 4J8UB 2RVQC 3WTPD 3X1TB 2PYOB 3W97D 3B0BA 4E44A 3LZ1C 4J8VC 4H9QB 3C1CD 4JJND 4R8PA 5G49A 1KX3A 3W99A 4YM6A 1HQ3D 2AROB 5B0ZC 3W96B 4G92B 4E45A 5CP6D 3AZNA 3AYWA 4M6BA 5DNMA 5JA4A 5AV8B 4J8UC 3AZMC 4QLCB 4XZQD 3O62A 4KGCC 3WTPB 5FUGB 4YS3C 5AVCD 4UUZB 3MNND 3AFAA 5B1MC 3C1CB 1P3LD 5B2ID 5GT0B 2YFWA 4H9PA 4J8WD 4XUJB 4J8XB 1HQ3B 5B32D 3V9RB 4DRBA 5E5AD 2HUEC 5C3IC 5B24D 5JRGB 3C1BD 5CP6B 5CPIB 3MGQA 4ZUXA 3KWQD 5DNND 4LD9A 4XZQB 5B33D 3AZFA 5AVBB 5B32G 1KX5D 1JFIA 5BNVA 1P3LB 3W97A 3B0CW 2CV5A 1M19D 3AV1C 5B32B 4Z5TC 5B24B 5E5AB 3C1BB 3REJA 4JJNA 3REKC 3MVDC 3UT9D 3LZ0D 1ZLAB 2F8NH 5CPKC 3AZKD 3WA9C 3KWQB 5DNNB 5B0YB 5GT3C 5B33B 3WAAC 3LELD 5CPJB 1TZYC 5AVBC 3AV2A 4CAYA 1AOIC 1A7WA 5GXQA 5B1LA 4WU9D 1M19B 5AVCA 3MNNA 4G91B 1KX4B 5KDMB 5B2IA 4J8WA 1P34C 3UT9B 1ZLAC 3C1BA 3AZKB 1BH9B 1P3PA 1M18D 3W98D 4NE6A 3R45A 2NQBB 5BNXB 3X1UC 3KXBD 3AZHC 4CSRA 4WU9B 3AZEA 5GSUB 3A6NA 1P3KD 1P3OC 1KX5A 3AZJC 3NQJB 4X23B 3WTPE 3UTBC 1WWSA 1P3BD 3B6GC 3W98B 5AV6A 3MGSC 5B2JC 2JSSA 5BO0B 4Z66A 3LZ0A 3LJAB 2NQBC 2NZDD 4DRAA 4KUDC 5F99B 4ZBJB 3KXBB 5B31C 5AY8C 3LELA 4NE3A 3RELB 5GSUC 1P3KB 2BYMA 2F8NK 1B6WA 4H9NA 1P3IB 3MGPA 3LZ1D 1P3BB 4J8VD 1P3AC 5AV5A 4EO5B 2NZDB 3LJAC 2LY8A 3NQUB 3X1VC 1F1EA 3KUYC 1M18A 3RELC 3AZGB 3AN2A 1U35C 1S32A 1EQZC 1ID3C 1P3IC 4J8UD 3AZMD 4WU8C 2PYOD 4KGCD 3LZ1B 1BH8A 4YS3D 4J8VB 3AZLA 5B1MD 5BS7C 3MGRC 2HIOC 2FJ7C 5B0ZB 4H9OA 1P3MA 1P3FB 1F66A 4QLCD 3AZMB 4KGCB 3VH6W 4YS3B 3B0CT 5B1MB 5GT0D 1TAFA 4XUJD 4J8XD 3AV1D 4Z5TD 3AZIC 2HUEB 5C3IB 5JRGD 3B6FC 1H3OB 2YFVB 5CPID 3REKD 3MVDD 3WA9D 5B40C 4H9RB 5CPKD 3TU4C 1P3FC 1P3GA 1TZYD 5AVBD 3REIA 1AOID 4J8UA 4R8PC 4WNNB 3AZMA 1KX3C 3X1TA 2PYOA 3W99C 4YM6C 4KHAB 3AV1B 4Z5TB 3AZNC 4H9QA 3AYWC 5DNMC 3UTAC 3REKB 2AROA 3MVDB 1ZLAD 3WA9B 5CPKB 3W96A 5B0YD 3O62C 5GT3B 3WAAB 5CPJD 1TZYB 5AV8A 4QLCA 1AOIB 3WTPA 4H9SA 5FUGA 4UUZA 1P3OD 1KX4D 3C1CA 3AZJD 5GT0A 3MGQC 3UTBD 4XUJA 3X1SB 4J8XA 1HQ3A 1P34B 3V9RA 4ZUXC 5JRGA 4LD9C 5CP6A 3AZFC 3B6GD 5CPIA 5BT1D 5B2JD 3MVDA 2NQBD 4KUDD 3X1UB 4XZQA 2CV5C 5AY8D 3AZHB 5GSUD 5AVBA 3REJC 1P3OB 4JJNC 2F8NB 1P3LA 3AZJB 4X23D 3UTBB 3X1SC 4Z2MG 3B0DC 5B32A 5B24A 5E5AA 1P3AD 3B6GB 3MGSB 5B31G 5B2JB 3AV2C 3LJAD 1ZLAA 5F99D 4KUDB 3KWQA 5GXQC 5B1LC 5DNNA 5B33A 5B0YA 3X1VD 1M1AB 2IO5C 3RELD 5B31B 5AY8B 5AVCC 5CPJA 3MNNC 1U35D 5B2IC 1EQZD 1ID3D 4J8WC 1P3ID 2BYKB 1M19A 1N1JB 1P3PC 1KX4A 1P3AB 5KDMA 3UT9A 3MGRD 3AZKA 1BH9A 3REHB 3X1VB 3KUYB 1M1AC 3AZEC 3A6NC 3AZGD 1KX5C 2NQBA 4HGAC 1U35B 5BNXA 1EQZB 1ID3B 1B67A 2L5AA 2RVQD 3VH6T 4WU8B 4WU9A 5GSUA 3NQJA 5AV6C
chains in the Genus database with same CATH superfamily
1ULYA 4X23A 4Z66C 3LZ0C 3MGRB 2HIOB 5B0ZD 2FJ7B 3REHC 3AZID 3W98A 3B6FD 5BO0A 3LJAA 5F99A 5B40D 1P3FD 3TU4D 3MGPC 1WWIA 3KXBA 4NE5A 2BG1A 3RELA 1P3KA 1KU5A 5AV5C 1P3IA 4R8PD 1KX3D 4YM6D 1P3BA 2F2AC 1M18C 3AZIB 3AZND 3AYWD 3B6FB 5DNMD 3UTAD 3AN2C 2NZDA 1S32C 3NQUA 5AV9B 5B40B 3TU4B 3O62D 3AZGA 2Y2HA 3H0RC 3AZLC 4R8PB 5G49B 1KX3B 1BFMA 3VH6A 3W99B 4YM6B 3LZ1A 4J8VA 3AZNB 3AYWB 1P3MC 3VH5W 5DNMB 3UTAB 2Y2PA 5JA4B 5AV9C 3WKJC 5B0ZA 4ZUXD 1F66C 4LD9D 4AWLB 3O62B 5GT3D 3WAAD 1T3UA 1P3FA 3F6TA 3AFAB 2YFWB 4H9PB 2CV5D 4KGCA 4YS3A 3REJD 5B1MA 3MGQB 3X1SD 1P34D 2VQRA 4ZUXB 1P3GC 4LD9B 4AWLC 3H0MC 1H3OA 2YFVA 3UTAA 3AZFB 3AV2D 4H9RA 3AFAC 2J8PA 3REIC 1JFIB 5BNVB 3X1UD 3X1TC 5GXQD 5B1LD 2PYOC 3H0LC 2DF4C 2CV5B 3W97B 2JE5A 3AZHD 3REJB 4JJNB 2F8ND 4WNNA 2AROC 4KHAA 3B0DB 3AV1A 3W96C 4G92C 4Z5TA 1P3PD 1HTAA 3MGSD 3REKA 4WJ3C 3AV2B 5AV8C 3WA9A 4CAYB 5CPKA 4QLCC 2F8NG 3A1IA 5GXQB 5B1LB 5GT3A 3WTPC 4H9SC 1M1AD 3W97C 3WAAA 2IO5B 5B31D 3AZED 3A6ND 5AVCB 1TZYA 3MNNB 3C1CC 1AOIA 5GT0C 5B2IB 4XUJC 4J8WB 4J8XC 1HQ3C 5JRGC 5CP6C 1P3PB 5CPIC 5AV6D 3X1SA 4Z66D 3R45B 1P34A 4XZQC 3REHD 3KUYD 4CSRB 2RIQA 3A6NB 3AZEB 1KX5B 4HGAB 4Z2MH 1P3LC 3X1UA 3MGPD 4NFTA 4WU8D 3AZHA 5B32C 5B24C 5E5AC 3C1BC 1P3OA 2F8NA 5AV5D 3AZJA 5AV6B 3UTBA 4Z66B 3EPJA 3LZ0B 2HIOD 3KWQC 5DNNC 5B0YC 2FJ7D 5B33C 3B6GA 5CPJC 3LELB 3MGSA 5B2JA 3P5JB 3AN2D 4WV4B 2BYMB 1S32D 4KUDA 4H9NB 3MGPB 1M1AA 1M19C 5B31A 5AY8A 4G91C 1R4VA 1KX4C 3AZLD 5AV5B 3UT9C 4WZSB 2BYKA 3AZKC 1N1JA 1P3AA 3VH5T 2Y2MA 1M18B 5BT1C 3LELC 1P3MD 2CWEA 3AN2B 5AV9D 1S32B 3WKJD 3REHA 3X1VA 3KUYA 1F66D 4WU9C 2Y2GA 1BH8B 1U35A 4X23C 1EQZA 3AZLB 1ID3A 4WU8A 3W99D 3W98C 2Y2QA 4H9OB 5BS7A 1P3MB 5F99C 3MGRA 2HIOA 4ZBJC 3WKJB 2FJ7A 3KXBC 1P3GD 5CHLB 1F66B 1P3KC 2FFFB 3AFAD 3REID 3EPHA 3X1TD 1TAFB 1P3BC 2W8SA 3KSYA 2G5HC 4EO5C 1Q9CA 2ZY4A 2NZDC 3MGQD 2AROD 3W96D 3AZIA 1P3GB 3VH5A 3B6FA 3AZFD 3AZGC 2Y2OA 5AV9A 3WKJA 5AV8D 5B40A 3REIB 3TU4A 4J8UB 2RVQC 3WTPD 3X1TB 2PYOB 3W97D 3B0BA 4E44A 3LZ1C 4J8VC 2ZM5A 4H9QB 3C1CD 4JJND 4R8PA 5G49A 1KX3A 3W99A 4YM6A 1HQ3D 2AROB 2Y2LA 5B0ZC 3W96B 4G92B 4E45A 5CP6D 3AZNA 3AYWA 4M6BA 5DNMA 5JA4A 3EPLA 5AV8B 4J8UC 3AZMC 4QLCB 4XZQD 3O62A 4KGCC 3WTPB 5FUGB 4YS3C 5AVCD 4UUZB 3MNND 3AFAA 5B1MC 3C1CB 1P3LD 5B2ID 5GT0B 2YFWA 4H9PA 4J8WD 4XUJB 4J8XB 1HQ3B 5B32D 3V9RB 4DRBA 5E5AD 2HUEC 5C3IC 5B24D 5JRGB 3C1BD 5CP6B 5CPIB 3MGQA 4ZUXA 3KWQD 5DNND 4LD9A 4XZQB 5B33D 2Y2KA 3AZFA 5AVBB 5B32G 1KX5D 1JFIA 5BNVA 1P3LB 3W97A 3B0CW 2CV5A 1M19D 3AV1C 5B32B 4Z5TC 5B24B 5E5AB 3C1BB 3REJA 4JJNA 3REKC 3MVDC 3UT9D 3LZ0D 1ZLAB 2F8NH 5CPKC 3AZKD 3WA9C 3EPKA 3KWQB 5DNNB 5B0YB 5GT3C 5B33B 3WAAC 3LELD 5CPJB 1TZYC 5AVBC 3AV2A 1Z2CB 4CAYA 1AOIC 1A7WA 5GXQA 5B1LA 4WU9D 1M19B 5AVCA 3MNNA 4G91B 1KX4B 5KDMB 5B2IA 4J8WA 1P34C 3UT9B 1ZLAC 3C1BA 3AZKB 1BH9B 1P3PA 1M18D 3W98D 4NE6A 3R45A 2UWXA 2NQBB 5BNXB 3X1UC 3KXBD 4DQYB 3AZHC 4CSRA 4WU9B 3AZEA 5GSUB 3A6NA 1P3KD 1P3OC 1KX5A 2JCHA 3AZJC 1PZRA 3NQJB 4X23B 3WTPE 3UTBC 2G5IC 1WWSA 1P3BD 3B6GC 3W98B 5AV6A 3MGSC 5B2JC 2JSSA 5BO0B 4Z66A 3LZ0A 3LJAB 2NQBC 2NZDD 4DRAA 4KUDC 5F99B 4ZBJB 3KXBB 5B31C 5AY8C 3LELA 4NE3A 3RELB 5GSUC 1P3KB 2BYMA 2F8NK 1B6WA 4H9NA 1P3IB 3MGPA 3LZ1D 1P3BB 4J8VD 1P3AC 5AV5A 4EO5B 2NZDB 3LJAC 2ZY5A 2LY8A 3NQUB 3KFUG 3X1VC 1F1EA 3KUYC 1M18A 3RELC 3AZGB 3AN2A 1U35C 1S32A 1EQZC 1ID3C 1P3IC 4J8UD 3AZMD 4WU8C 2PYOD 4KGCD 2Y2IA 3LZ1B 1BH8A 4YS3D 4J8VB 3AZLA 5B1MD 5BS7C 1W2EA 3MGRC 2HIOC 2FJ7C 5B0ZB 4H9OA 1P3MA 3IP4C 1P3FB 1F66A 4QLCD 3AZMB 2ZY2A 4KGCB 3VH6W 4YS3B 4UPKA 3B0CT 5B1MB 5GT0D 1TAFA 4XUJD 4J8XD 3AV1D 4Z5TD 3AZIC 2HUEB 5C3IB 5JRGD 3B6FC 2XD5A 1H3OB 2YFVB 5CPID 3REKD 3MVDD 3WA9D 5B40C 4H9RB 5CPKD 3TU4C 1P3FC 1P3GA 1TZYD 5AVBD 3REIA 1AOID 4J8UA 4R8PC 4WNNB 3AZMA 2XD1A 3X1TA 1KX3C 2PYOA 3W99C 4YM6C 4KHAB 3AV1B 4Z5TB 3AZNC 4H9QA 3AYWC 5DNMC 3UTAC 3REKB 2AROA 2ZY3A 3MVDB 1ZLAD 3WA9B 5CPKB 3W96A 5B0YD 3O62C 5GT3B 3WAAB 5CPJD 1TZYB 5AV8A 4QLCA 1AOIB 3WTPA 4H9SA 5FUGA 4UUZA 1P3OD 1KX4D 3C1CA 3AZJD 5GT0A 3MGQC 3UTBD 4XUJA 3X1SB 4J8XA 1HQ3A 1P34B 3A1KA 3V9RA 4ZUXC 5JRGA 4LD9C 5CP6A 3AZFC 3B6GD 2Y2JA 5CPIA 5BT1D 5B2JD 3MVDA 2NQBD 4KUDD 3EG5B 3X1UB 4XZQA 2CV5C 5AY8D 3FDDA 3AZHB 2DQNC 5GSUD 5AVBA 3REJC 1P3OB 4JJNC 2F8NB 1P3LA 3AZJB 4X23D 3UTBB 3X1SC 4Z2MG 3B0DC 5B32A 5B24A 5E5AA 1P3AD 3B6GB 3MGSB 5B31G 5B2JB 3AV2C 3LJAD 1ZLAA 5F99D 4KUDB 3KWQA 5GXQC 5B1LC 5DNNA 5B33A 5B0YA 3X1VD 1M1AB 2IO5C 3RELD 5B31B 5AY8B 5AVCC 5CPJA 3MNNC 1U35D 5B2IC 1EQZD 1ID3D 4J8WC 1P3ID 3AL0C 2BYKB 1M19A 1N1JB 1P3PC 1KX4A 1P3AB 5KDMA 2Y2NA 3UT9A 3MGRD 3AZKA 1BH9A 3REHB 3X1VB 3KUYB 1M1AC 3AZEC 3A6NC 3AZGD 1KX5C 2NQBA 4HGAC 1U35B 5BNXA 1EQZB 1ID3B 1B67A 2L5AA 2RVQD 3VH6T 4WU8B 4WU9A 5GSUA 3NQJA 5AV6C
chains in the Genus database with same CATH topology
1ULYA 4X23A 4Z66C 3LZ0C 3MGRB 2HIOB 5B0ZD 2FJ7B 3REHC 3AZID 3W98A 3B6FD 5BO0A 3LJAA 5F99A 5B40D 1P3FD 3TU4D 3MGPC 1WWIA 3KXBA 4NE5A 2BG1A 3RELA 1P3KA 1KU5A 5AV5C 1P3IA 4R8PD 1KX3D 4YM6D 1P3BA 2F2AC 1M18C 3AZIB 3AZND 3AYWD 3B6FB 5DNMD 3UTAD 3AN2C 2NZDA 1S32C 3NQUA 5AV9B 5B40B 3TU4B 3O62D 3AZGA 2Y2HA 3H0RC 3AZLC 4R8PB 5G49B 1KX3B 1BFMA 3VH6A 3W99B 4YM6B 3LZ1A 4J8VA 3AZNB 3AYWB 1P3MC 3VH5W 5DNMB 3UTAB 2Y2PA 5JA4B 5AV9C 3WKJC 5B0ZA 4ZUXD 1F66C 4LD9D 4AWLB 3O62B 5GT3D 3WAAD 1T3UA 1P3FA 3F6TA 3AFAB 2YFWB 4H9PB 2CV5D 4KGCA 4YS3A 3REJD 5B1MA 3MGQB 3X1SD 1P34D 2VQRA 4ZUXB 1P3GC 4LD9B 4AWLC 3H0MC 1H3OA 2YFVA 3UTAA 3AZFB 3AV2D 4H9RA 3AFAC 2J8PA 3REIC 1JFIB 5BNVB 3X1UD 3X1TC 5GXQD 5B1LD 2PYOC 3H0LC 2DF4C 2CV5B 3W97B 2JE5A 3AZHD 3REJB 4JJNB 2F8ND 4WNNA 2AROC 4KHAA 3B0DB 3AV1A 3W96C 4G92C 4Z5TA 1P3PD 1HTAA 3MGSD 3REKA 4WJ3C 3AV2B 5AV8C 3WA9A 4CAYB 5CPKA 4QLCC 2F8NG 3A1IA 5GXQB 5B1LB 5GT3A 3WTPC 4H9SC 1M1AD 3W97C 3WAAA 2IO5B 5B31D 3AZED 3A6ND 5AVCB 1TZYA 3MNNB 3C1CC 1AOIA 5GT0C 5B2IB 4XUJC 4J8WB 4J8XC 1HQ3C 5JRGC 5CP6C 1P3PB 5CPIC 5AV6D 3X1SA 4Z66D 3R45B 1P34A 4XZQC 3REHD 3KUYD 4CSRB 2RIQA 3A6NB 3AZEB 1KX5B 4HGAB 4Z2MH 1P3LC 3X1UA 3MGPD 4NFTA 4WU8D 3AZHA 5B32C 5B24C 5E5AC 3C1BC 1P3OA 2F8NA 5AV5D 3AZJA 5AV6B 3UTBA 4Z66B 3EPJA 3LZ0B 2HIOD 3KWQC 5DNNC 5B0YC 2FJ7D 5B33C 3B6GA 5CPJC 3LELB 3MGSA 5B2JA 3P5JB 3AN2D 4WV4B 2BYMB 1S32D 4KUDA 4H9NB 3MGPB 1M1AA 1M19C 5B31A 5AY8A 4G91C 1R4VA 1KX4C 3AZLD 5AV5B 3UT9C 4WZSB 2BYKA 3AZKC 1N1JA 1P3AA 3VH5T 2Y2MA 1M18B 5BT1C 3LELC 1P3MD 2CWEA 3AN2B 5AV9D 1S32B 3WKJD 3REHA 3X1VA 3KUYA 1F66D 4WU9C 2Y2GA 1BH8B 1U35A 4X23C 1EQZA 3AZLB 1ID3A 4WU8A 3W99D 3W98C 2Y2QA 4H9OB 5BS7A 1P3MB 5F99C 3MGRA 2HIOA 4ZBJC 3WKJB 2FJ7A 3KXBC 1P3GD 5CHLB 1F66B 1P3KC 2FFFB 3AFAD 3REID 3EPHA 3X1TD 1TAFB 1P3BC 2W8SA 3KSYA 2G5HC 4EO5C 1Q9CA 2ZY4A 2NZDC 3MGQD 2AROD 3W96D 3AZIA 1P3GB 3VH5A 3B6FA 3AZFD 3AZGC 2Y2OA 5AV9A 3WKJA 5AV8D 5B40A 3REIB 3TU4A 4J8UB 2RVQC 3WTPD 3X1TB 2PYOB 3W97D 3B0BA 4E44A 3LZ1C 4J8VC 2ZM5A 4H9QB 3C1CD 4JJND 4R8PA 5G49A 1KX3A 3W99A 4YM6A 1HQ3D 2AROB 2Y2LA 5B0ZC 3W96B 4G92B 4E45A 5CP6D 3AZNA 3AYWA 4M6BA 5DNMA 5JA4A 3EPLA 5AV8B 4J8UC 3AZMC 4QLCB 4XZQD 3O62A 4KGCC 3WTPB 5FUGB 4YS3C 5AVCD 4UUZB 3MNND 3AFAA 5B1MC 3C1CB 1P3LD 5B2ID 5GT0B 2YFWA 4H9PA 4J8WD 4XUJB 4J8XB 1HQ3B 5B32D 3V9RB 4DRBA 5E5AD 2HUEC 5C3IC 5B24D 5JRGB 3C1BD 5CP6B 5CPIB 3MGQA 4ZUXA 3KWQD 5DNND 4LD9A 4XZQB 5B33D 2Y2KA 3AZFA 5AVBB 5B32G 1KX5D 1JFIA 5BNVA 1P3LB 3W97A 3B0CW 2CV5A 1M19D 3AV1C 5B32B 4Z5TC 5B24B 5E5AB 3C1BB 3REJA 4JJNA 3REKC 3MVDC 3UT9D 3LZ0D 1ZLAB 2F8NH 5CPKC 3AZKD 3WA9C 3EPKA 3KWQB 5DNNB 5B0YB 5GT3C 5B33B 3WAAC 3LELD 5CPJB 1TZYC 5AVBC 3AV2A 1Z2CB 4CAYA 1AOIC 1A7WA 5GXQA 5B1LA 4WU9D 1M19B 5AVCA 3MNNA 4G91B 1KX4B 5KDMB 5B2IA 4J8WA 1P34C 3UT9B 1ZLAC 3C1BA 3AZKB 1BH9B 1P3PA 1M18D 3W98D 4NE6A 3R45A 2UWXA 2NQBB 5BNXB 3X1UC 3KXBD 4DQYB 3AZHC 4CSRA 4WU9B 3AZEA 5GSUB 3A6NA 1P3KD 1P3OC 1KX5A 2JCHA 3AZJC 1PZRA 3NQJB 4X23B 3WTPE 3UTBC 2G5IC 1WWSA 1P3BD 3B6GC 3W98B 5AV6A 3MGSC 5B2JC 2JSSA 5BO0B 4Z66A 3LZ0A 3LJAB 2NQBC 2NZDD 4DRAA 4KUDC 5F99B 4ZBJB 3KXBB 5B31C 5AY8C 3LELA 4NE3A 3RELB 5GSUC 1P3KB 2BYMA 2F8NK 1B6WA 4H9NA 1P3IB 3MGPA 3LZ1D 1P3BB 4J8VD 1P3AC 5AV5A 4EO5B 2NZDB 3LJAC 2ZY5A 2LY8A 3NQUB 3KFUG 3X1VC 1F1EA 3KUYC 1M18A 3RELC 3AZGB 3AN2A 1U35C 1S32A 1EQZC 1ID3C 1P3IC 4J8UD 3AZMD 4WU8C 2PYOD 4KGCD 2Y2IA 3LZ1B 1BH8A 4YS3D 4J8VB 3AZLA 5B1MD 5BS7C 1W2EA 3MGRC 2HIOC 2FJ7C 5B0ZB 4H9OA 1P3MA 3IP4C 1P3FB 1F66A 4QLCD 3AZMB 2ZY2A 4KGCB 3VH6W 4YS3B 4UPKA 3B0CT 5B1MB 5GT0D 1TAFA 4XUJD 4J8XD 3AV1D 4Z5TD 3AZIC 2HUEB 5C3IB 5JRGD 3B6FC 2XD5A 1H3OB 2YFVB 5CPID 3REKD 3MVDD 3WA9D 5B40C 4H9RB 5CPKD 3TU4C 1P3FC 1P3GA 1TZYD 5AVBD 3REIA 1AOID 4J8UA 4R8PC 4WNNB 3AZMA 2XD1A 3X1TA 1KX3C 2PYOA 3W99C 4YM6C 4KHAB 3AV1B 4Z5TB 3AZNC 4H9QA 3AYWC 5DNMC 3UTAC 3REKB 2AROA 2ZY3A 3MVDB 1ZLAD 3WA9B 5CPKB 3W96A 5B0YD 3O62C 5GT3B 3WAAB 5CPJD 1TZYB 5AV8A 4QLCA 1AOIB 3WTPA 4H9SA 5FUGA 4UUZA 1P3OD 1KX4D 3C1CA 3AZJD 5GT0A 3MGQC 3UTBD 4XUJA 3X1SB 4J8XA 1HQ3A 1P34B 3A1KA 3V9RA 4ZUXC 5JRGA 4LD9C 5CP6A 3AZFC 3B6GD 2Y2JA 5CPIA 5BT1D 5B2JD 3MVDA 2NQBD 4KUDD 3EG5B 3X1UB 4XZQA 2CV5C 5AY8D 3FDDA 3AZHB 2DQNC 5GSUD 5AVBA 3REJC 1P3OB 4JJNC 2F8NB 1P3LA 3AZJB 4X23D 3UTBB 3X1SC 4Z2MG 3B0DC 5B32A 5B24A 5E5AA 1P3AD 3B6GB 3MGSB 5B31G 5B2JB 3AV2C 3LJAD 1ZLAA 5F99D 4KUDB 3KWQA 5GXQC 5B1LC 5DNNA 5B33A 5B0YA 3X1VD 1M1AB 2IO5C 3RELD 5B31B 5AY8B 5AVCC 5CPJA 3MNNC 1U35D 5B2IC 1EQZD 1ID3D 4J8WC 1P3ID 3AL0C 2BYKB 1M19A 1N1JB 1P3PC 1KX4A 1P3AB 5KDMA 2Y2NA 3UT9A 3MGRD 3AZKA 1BH9A 3REHB 3X1VB 3KUYB 1M1AC 3AZEC 3A6NC 3AZGD 1KX5C 2NQBA 4HGAC 1U35B 5BNXA 1EQZB 1ID3B 1B67A 2L5AA 2RVQD 3VH6T 4WU8B 4WU9A 5GSUA 3NQJA 5AV6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  4X23 A;  4Z66 C;  3LZ0 C;  3MGR B;  2HIO B;  5B0Z D;  2FJ7 B;  3REH C;  3AZI D;  3W98 A;  3B6F D;  5BO0 A;  3LJA A;  5F99 A;  5B40 D;  1P3F D;  3TU4 D;  3MGP C;  1WWI A;  3KXB A;  4NE5 A;  3REL A;  1P3K A;  1KU5 A;  5AV5 C;  1P3I A;  4R8P D;  1KX3 D;  4YM6 D;  1P3B A;  1M18 C;  3AZI B;  3AZN D;  3AYW D;  3B6F B;  5DNM D;  3UTA D;  3AN2 C;  2NZD A;  1S32 C;  3NQU A;  5AV9 B;  5B40 B;  3TU4 B;  3O62 D;  3AZG A;  3AZL C;  4R8P B;  5G49 B;  1KX3 B;  1BFM A;  3VH6 A;  3W99 B;  4YM6 B;  3LZ1 A;  4J8V A;  3AZN B;  3AYW B;  1P3M C;  3VH5 W;  5DNM B;  3UTA B;  5JA4 B;  5AV9 C;  3WKJ C;  5B0Z A;  4ZUX D;  1F66 C;  4LD9 D;  4AWL B;  3O62 B;  5GT3 D;  3WAA D;  1P3F A;  3AFA B;  2YFW B;  4H9P B;  2CV5 D;  4KGC A;  4YS3 A;  3REJ D;  5B1M A;  3MGQ B;  3X1S D;  1P34 D;  4ZUX B;  1P3G C;  4LD9 B;  4AWL C;  3UTA A;  1H3O A;  2YFV A;  3AZF B;  3AV2 D;  4H9R A;  3AFA C;  3REI C;  1JFI B;  5BNV B;  3X1U D;  3X1T C;  5GXQ D;  5B1L D;  2PYO C;  3W97 B;  2CV5 B;  3AZH D;  3REJ B;  4JJN B;  2F8N D;  4WNN A;  2ARO C;  4KHA A;  3B0D B;  3AV1 A;  3W96 C;  4G92 C;  4Z5T A;  1P3P D;  1HTA A;  3MGS D;  3REK A;  3AV2 B;  5AV8 C;  3WA9 A;  4CAY B;  5CPK A;  4QLC C;  2F8N G;  3WTP C;  5GXQ B;  5B1L B;  5GT3 A;  1M1A D;  4H9S C;  3W97 C;  3WAA A;  2IO5 B;  5B31 D;  3AZE D;  3A6N D;  5AVC B;  1TZY A;  3MNN B;  3C1C C;  1AOI A;  5GT0 C;  5B2I B;  4XUJ C;  4J8W B;  4J8X C;  1HQ3 C;  5JRG C;  5CP6 C;  1P3P B;  5CPI C;  5AV6 D;  3X1S A;  4Z66 D;  3R45 B;  1P34 A;  4XZQ C;  3REH D;  3KUY D;  4CSR B;  3AZE B;  3A6N B;  1KX5 B;  4HGA B;  4Z2M H;  1P3L C;  3X1U A;  3MGP D;  4NFT A;  4WU8 D;  3AZH A;  5B32 C;  5B24 C;  5E5A C;  3C1B C;  1P3O A;  2F8N A;  5AV5 D;  3AZJ A;  5AV6 B;  3UTB A;  4Z66 B;  3LZ0 B;  2HIO D;  3KWQ C;  5DNN C;  5B0Y C;  2FJ7 D;  5B33 C;  3B6G A;  5CPJ C;  3LEL B;  3MGS A;  5B2J A;  3AN2 D;  4WV4 B;  2BYM B;  1S32 D;  4KUD A;  4H9N B;  3MGP B;  1M1A A;  1M19 C;  5B31 A;  5AY8 A;  4G91 C;  1R4V A;  1KX4 C;  3AZL D;  5AV5 B;  3UT9 C;  4WZS B;  2BYK A;  3AZK C;  1N1J A;  1P3A A;  3VH5 T;  1M18 B;  5BT1 C;  3LEL C;  1P3M D;  2CWE A;  3AN2 B;  5AV9 D;  1S32 B;  3WKJ D;  3REH A;  3X1V A;  3KUY A;  1F66 D;  4WU9 C;  1BH8 B;  1U35 A;  4X23 C;  1EQZ A;  3AZL B;  1ID3 A;  4WU8 A;  3W99 D;  3W98 C;  4H9O B;  5BS7 A;  1P3M B;  5F99 C;  3MGR A;  2HIO A;  4ZBJ C;  3WKJ B;  2FJ7 A;  3KXB C;  1P3G D;  5CHL B;  1F66 B;  1P3K C;  3AFA D;  3REI D;  3X1T D;  1TAF B;  1P3B C;  3KSY A;  4EO5 C;  1Q9C A;  2NZD C;  3MGQ D;  2ARO D;  3W96 D;  3AZI A;  1P3G B;  3VH5 A;  3B6F A;  3AZF D;  3AZG C;  5AV9 A;  3WKJ A;  5AV8 D;  5B40 A;  3REI B;  3TU4 A;  4J8U B;  2RVQ C;  3WTP D;  3X1T B;  2PYO B;  3W97 D;  3B0B A;  4E44 A;  3LZ1 C;  4J8V C;  4H9Q B;  3C1C D;  4JJN D;  4R8P A;  5G49 A;  1KX3 A;  3W99 A;  4YM6 A;  1HQ3 D;  2ARO B;  5B0Z C;  3W96 B;  4G92 B;  4E45 A;  5CP6 D;  3AZN A;  3AYW A;  4M6B A;  5DNM A;  5JA4 A;  5AV8 B;  4J8U C;  3AZM C;  4QLC B;  4XZQ D;  3O62 A;  4KGC C;  3WTP B;  5FUG B;  4YS3 C;  5AVC D;  4UUZ B;  3MNN D;  3AFA A;  5B1M C;  3C1C B;  1P3L D;  5B2I D;  5GT0 B;  2YFW A;  4H9P A;  4J8W D;  4XUJ B;  4J8X B;  1HQ3 B;  5B32 D;  3V9R B;  4DRB A;  5E5A D;  2HUE C;  5C3I C;  5B24 D;  5JRG B;  3C1B D;  5CP6 B;  5CPI B;  3MGQ A;  4ZUX A;  3KWQ D;  5DNN D;  4LD9 A;  4XZQ B;  5B33 D;  3AZF A;  5AVB B;  5B32 G;  1KX5 D;  1JFI A;  5BNV A;  1P3L B;  3W97 A;  3B0C W;  2CV5 A;  1M19 D;  3AV1 C;  5B32 B;  4Z5T C;  5B24 B;  5E5A B;  3C1B B;  3REJ A;  4JJN A;  3REK C;  3MVD C;  3UT9 D;  3LZ0 D;  1ZLA B;  2F8N H;  5CPK C;  3AZK D;  3WA9 C;  3KWQ B;  5DNN B;  5B0Y B;  5GT3 C;  5B33 B;  3WAA C;  3LEL D;  5CPJ B;  1TZY C;  5AVB C;  3AV2 A;  4CAY A;  1AOI C;  1A7W A;  5GXQ A;  5B1L A;  4WU9 D;  1M19 B;  5AVC A;  3MNN A;  4G91 B;  1KX4 B;  5KDM B;  5B2I A;  4J8W A;  1P34 C;  3UT9 B;  1ZLA C;  3C1B A;  3AZK B;  1BH9 B;  1P3P A;  1M18 D;  3W98 D;  4NE6 A;  3R45 A;  2NQB B;  5BNX B;  3X1U C;  3KXB D;  3AZH C;  4CSR A;  4WU9 B;  3AZE A;  5GSU B;  3A6N A;  1P3K D;  1P3O C;  1KX5 A;  3AZJ C;  3NQJ B;  4X23 B;  3WTP E;  3UTB C;  1WWS A;  1P3B D;  3B6G C;  3W98 B;  5AV6 A;  3MGS C;  5B2J C;  2JSS A;  5BO0 B;  4Z66 A;  3LZ0 A;  3LJA B;  2NQB C;  2NZD D;  4DRA A;  4KUD C;  5F99 B;  4ZBJ B;  3KXB B;  5B31 C;  5AY8 C;  3LEL A;  4NE3 A;  3REL B;  5GSU C;  1P3K B;  2BYM A;  2F8N K;  1B6W A;  4H9N A;  1P3I B;  3MGP A;  3LZ1 D;  1P3B B;  4J8V D;  1P3A C;  5AV5 A;  4EO5 B;  2NZD B;  3LJA C;  2LY8 A;  3NQU B;  3X1V C;  1F1E A;  3KUY C;  1M18 A;  3REL C;  3AZG B;  3AN2 A;  1U35 C;  1S32 A;  1EQZ C;  1ID3 C;  1P3I C;  4J8U D;  3AZM D;  4WU8 C;  2PYO D;  4KGC D;  3LZ1 B;  1BH8 A;  4YS3 D;  4J8V B;  3AZL A;  5B1M D;  5BS7 C;  3MGR C;  2HIO C;  2FJ7 C;  5B0Z B;  4H9O A;  1P3M A;  1P3F B;  1F66 A;  4QLC D;  3AZM B;  4KGC B;  3VH6 W;  4YS3 B;  3B0C T;  5B1M B;  5GT0 D;  1TAF A;  4XUJ D;  4J8X D;  3AV1 D;  4Z5T D;  3AZI C;  2HUE B;  5C3I B;  5JRG D;  3B6F C;  1H3O B;  2YFV B;  5CPI D;  3REK D;  3MVD D;  3WA9 D;  5B40 C;  4H9R B;  5CPK D;  3TU4 C;  1P3F C;  1P3G A;  1TZY D;  5AVB D;  3REI A;  1AOI D;  4J8U A;  4R8P C;  4WNN B;  3AZM A;  1KX3 C;  3X1T A;  2PYO A;  3W99 C;  4YM6 C;  4KHA B;  3AV1 B;  4Z5T B;  3AZN C;  4H9Q A;  3AYW C;  5DNM C;  3UTA C;  3REK B;  2ARO A;  3MVD B;  1ZLA D;  3WA9 B;  5CPK B;  3W96 A;  5B0Y D;  3O62 C;  5GT3 B;  3WAA B;  5CPJ D;  1TZY B;  5AV8 A;  4QLC A;  1AOI B;  3WTP A;  4H9S A;  5FUG A;  4UUZ A;  1P3O D;  1KX4 D;  3C1C A;  3AZJ D;  5GT0 A;  3MGQ C;  3UTB D;  4XUJ A;  3X1S B;  4J8X A;  1HQ3 A;  1P34 B;  3V9R A;  4ZUX C;  5JRG A;  4LD9 C;  5CP6 A;  3AZF C;  3B6G D;  5CPI A;  5BT1 D;  5B2J D;  3MVD A;  2NQB D;  4KUD D;  3X1U B;  4XZQ A;  2CV5 C;  5AY8 D;  3AZH B;  5GSU D;  5AVB A;  3REJ C;  1P3O B;  4JJN C;  2F8N B;  1P3L A;  3AZJ B;  4X23 D;  3UTB B;  3X1S C;  4Z2M G;  3B0D C;  5B32 A;  5B24 A;  5E5A A;  1P3A D;  3B6G B;  3MGS B;  5B31 G;  5B2J B;  3AV2 C;  3LJA D;  1ZLA A;  5F99 D;  4KUD B;  3KWQ A;  5GXQ C;  5B1L C;  5DNN A;  5B33 A;  5B0Y A;  3X1V D;  1M1A B;  2IO5 C;  3REL D;  5B31 B;  5AY8 B;  5AVC C;  5CPJ A;  3MNN C;  1U35 D;  5B2I C;  1EQZ D;  1ID3 D;  4J8W C;  1P3I D;  2BYK B;  1M19 A;  1N1J B;  1P3P C;  1KX4 A;  1P3A B;  5KDM A;  3UT9 A;  3MGR D;  3AZK A;  1BH9 A;  3REH B;  3X1V B;  3KUY B;  1M1A C;  3AZE C;  3A6N C;  3AZG D;  1KX5 C;  2NQB A;  4HGA C;  1U35 B;  5BNX A;  1EQZ B;  1ID3 B;  1B67 A;  2L5A A;  2RVQ D;  3VH6 T;  4WU8 B;  4WU9 A;  5GSU A;  3NQJ A;  5AV6 C; 
#chains in the Genus database with same CATH topology
 1ULY A;  4X23 A;  4Z66 C;  3LZ0 C;  3MGR B;  2HIO B;  5B0Z D;  2FJ7 B;  3REH C;  3AZI D;  3W98 A;  3B6F D;  5BO0 A;  3LJA A;  5F99 A;  5B40 D;  1P3F D;  3TU4 D;  3MGP C;  1WWI A;  3KXB A;  4NE5 A;  2BG1 A;  3REL A;  1P3K A;  1KU5 A;  5AV5 C;  1P3I A;  4R8P D;  1KX3 D;  4YM6 D;  1P3B A;  2F2A C;  1M18 C;  3AZI B;  3AZN D;  3AYW D;  3B6F B;  5DNM D;  3UTA D;  3AN2 C;  2NZD A;  1S32 C;  3NQU A;  5AV9 B;  5B40 B;  3TU4 B;  3O62 D;  3AZG A;  2Y2H A;  3H0R C;  3AZL C;  4R8P B;  5G49 B;  1KX3 B;  1BFM A;  3VH6 A;  3W99 B;  4YM6 B;  3LZ1 A;  4J8V A;  3AZN B;  3AYW B;  1P3M C;  3VH5 W;  5DNM B;  3UTA B;  2Y2P A;  5JA4 B;  5AV9 C;  3WKJ C;  5B0Z A;  4ZUX D;  1F66 C;  4LD9 D;  4AWL B;  3O62 B;  5GT3 D;  3WAA D;  1T3U A;  1P3F A;  3F6T A;  3AFA B;  2YFW B;  4H9P B;  2CV5 D;  4KGC A;  4YS3 A;  3REJ D;  5B1M A;  3MGQ B;  3X1S D;  1P34 D;  2VQR A;  4ZUX B;  1P3G C;  4LD9 B;  4AWL C;  3H0M C;  1H3O A;  2YFV A;  3UTA A;  3AZF B;  3AV2 D;  4H9R A;  3AFA C;  2J8P A;  3REI C;  1JFI B;  5BNV B;  3X1U D;  3X1T C;  5GXQ D;  5B1L D;  2PYO C;  3H0L C;  2DF4 C;  2CV5 B;  3W97 B;  2JE5 A;  3AZH D;  3REJ B;  4JJN B;  2F8N D;  4WNN A;  2ARO C;  4KHA A;  3B0D B;  3AV1 A;  3W96 C;  4G92 C;  4Z5T A;  1P3P D;  1HTA A;  3MGS D;  3REK A;  4WJ3 C;  3AV2 B;  5AV8 C;  3WA9 A;  4CAY B;  5CPK A;  4QLC C;  2F8N G;  3A1I A;  5GXQ B;  5B1L B;  5GT3 A;  3WTP C;  4H9S C;  1M1A D;  3W97 C;  3WAA A;  2IO5 B;  5B31 D;  3AZE D;  3A6N D;  5AVC B;  1TZY A;  3MNN B;  3C1C C;  1AOI A;  5GT0 C;  5B2I B;  4XUJ C;  4J8W B;  4J8X C;  1HQ3 C;  5JRG C;  5CP6 C;  1P3P B;  5CPI C;  5AV6 D;  3X1S A;  4Z66 D;  3R45 B;  1P34 A;  4XZQ C;  3REH D;  3KUY D;  4CSR B;  2RIQ A;  3A6N B;  3AZE B;  1KX5 B;  4HGA B;  4Z2M H;  1P3L C;  3X1U A;  3MGP D;  4NFT A;  4WU8 D;  3AZH A;  5B32 C;  5B24 C;  5E5A C;  3C1B C;  1P3O A;  2F8N A;  5AV5 D;  3AZJ A;  5AV6 B;  3UTB A;  4Z66 B;  3EPJ A;  3LZ0 B;  2HIO D;  3KWQ C;  5DNN C;  5B0Y C;  2FJ7 D;  5B33 C;  3B6G A;  5CPJ C;  3LEL B;  3MGS A;  5B2J A;  3P5J B;  3AN2 D;  4WV4 B;  2BYM B;  1S32 D;  4KUD A;  4H9N B;  3MGP B;  1M1A A;  1M19 C;  5B31 A;  5AY8 A;  4G91 C;  1R4V A;  1KX4 C;  3AZL D;  5AV5 B;  3UT9 C;  4WZS B;  2BYK A;  3AZK C;  1N1J A;  1P3A A;  3VH5 T;  2Y2M A;  1M18 B;  5BT1 C;  3LEL C;  1P3M D;  2CWE A;  3AN2 B;  5AV9 D;  1S32 B;  3WKJ D;  3REH A;  3X1V A;  3KUY A;  1F66 D;  4WU9 C;  2Y2G A;  1BH8 B;  1U35 A;  4X23 C;  1EQZ A;  3AZL B;  1ID3 A;  4WU8 A;  3W99 D;  3W98 C;  2Y2Q A;  4H9O B;  5BS7 A;  1P3M B;  5F99 C;  3MGR A;  2HIO A;  4ZBJ C;  3WKJ B;  2FJ7 A;  3KXB C;  1P3G D;  5CHL B;  1F66 B;  1P3K C;  2FFF B;  3AFA D;  3REI D;  3EPH A;  3X1T D;  1TAF B;  1P3B C;  2W8S A;  3KSY A;  2G5H C;  4EO5 C;  1Q9C A;  2ZY4 A;  2NZD C;  3MGQ D;  2ARO D;  3W96 D;  3AZI A;  1P3G B;  3VH5 A;  3B6F A;  3AZF D;  3AZG C;  2Y2O A;  5AV9 A;  3WKJ A;  5AV8 D;  5B40 A;  3REI B;  3TU4 A;  4J8U B;  2RVQ C;  3WTP D;  3X1T B;  2PYO B;  3W97 D;  3B0B A;  4E44 A;  3LZ1 C;  4J8V C;  2ZM5 A;  4H9Q B;  3C1C D;  4JJN D;  4R8P A;  5G49 A;  1KX3 A;  3W99 A;  4YM6 A;  1HQ3 D;  2ARO B;  2Y2L A;  5B0Z C;  3W96 B;  4G92 B;  4E45 A;  5CP6 D;  3AZN A;  3AYW A;  4M6B A;  5DNM A;  5JA4 A;  3EPL A;  5AV8 B;  4J8U C;  3AZM C;  4QLC B;  4XZQ D;  3O62 A;  4KGC C;  3WTP B;  5FUG B;  4YS3 C;  5AVC D;  4UUZ B;  3MNN D;  3AFA A;  5B1M C;  3C1C B;  1P3L D;  5B2I D;  5GT0 B;  2YFW A;  4H9P A;  4J8W D;  4XUJ B;  4J8X B;  1HQ3 B;  5B32 D;  3V9R B;  4DRB A;  5E5A D;  2HUE C;  5C3I C;  5B24 D;  5JRG B;  3C1B D;  5CP6 B;  5CPI B;  3MGQ A;  4ZUX A;  3KWQ D;  5DNN D;  4LD9 A;  4XZQ B;  5B33 D;  2Y2K A;  3AZF A;  5AVB B;  5B32 G;  1KX5 D;  1JFI A;  5BNV A;  1P3L B;  3W97 A;  3B0C W;  2CV5 A;  1M19 D;  3AV1 C;  5B32 B;  4Z5T C;  5B24 B;  5E5A B;  3C1B B;  3REJ A;  4JJN A;  3REK C;  3MVD C;  3UT9 D;  3LZ0 D;  1ZLA B;  2F8N H;  5CPK C;  3AZK D;  3WA9 C;  3EPK A;  3KWQ B;  5DNN B;  5B0Y B;  5GT3 C;  5B33 B;  3WAA C;  3LEL D;  5CPJ B;  1TZY C;  5AVB C;  3AV2 A;  1Z2C B;  4CAY A;  1AOI C;  1A7W A;  5GXQ A;  5B1L A;  4WU9 D;  1M19 B;  5AVC A;  3MNN A;  4G91 B;  1KX4 B;  5KDM B;  5B2I A;  4J8W A;  1P34 C;  3UT9 B;  1ZLA C;  3C1B A;  3AZK B;  1BH9 B;  1P3P A;  1M18 D;  3W98 D;  4NE6 A;  3R45 A;  2UWX A;  2NQB B;  5BNX B;  3X1U C;  3KXB D;  4DQY B;  3AZH C;  4CSR A;  4WU9 B;  3AZE A;  5GSU B;  3A6N A;  1P3K D;  1P3O C;  1KX5 A;  2JCH A;  3AZJ C;  1PZR A;  3NQJ B;  4X23 B;  3WTP E;  3UTB C;  2G5I C;  1WWS A;  1P3B D;  3B6G C;  3W98 B;  5AV6 A;  3MGS C;  5B2J C;  2JSS A;  5BO0 B;  4Z66 A;  3LZ0 A;  3LJA B;  2NQB C;  2NZD D;  4DRA A;  4KUD C;  5F99 B;  4ZBJ B;  3KXB B;  5B31 C;  5AY8 C;  3LEL A;  4NE3 A;  3REL B;  5GSU C;  1P3K B;  2BYM A;  2F8N K;  1B6W A;  4H9N A;  1P3I B;  3MGP A;  3LZ1 D;  1P3B B;  4J8V D;  1P3A C;  5AV5 A;  4EO5 B;  2NZD B;  3LJA C;  2ZY5 A;  2LY8 A;  3NQU B;  3KFU G;  3X1V C;  1F1E A;  3KUY C;  1M18 A;  3REL C;  3AZG B;  3AN2 A;  1U35 C;  1S32 A;  1EQZ C;  1ID3 C;  1P3I C;  4J8U D;  3AZM D;  4WU8 C;  2PYO D;  4KGC D;  2Y2I A;  3LZ1 B;  1BH8 A;  4YS3 D;  4J8V B;  3AZL A;  5B1M D;  5BS7 C;  1W2E A;  3MGR C;  2HIO C;  2FJ7 C;  5B0Z B;  4H9O A;  1P3M A;  3IP4 C;  1P3F B;  1F66 A;  4QLC D;  3AZM B;  2ZY2 A;  4KGC B;  3VH6 W;  4YS3 B;  4UPK A;  3B0C T;  5B1M B;  5GT0 D;  1TAF A;  4XUJ D;  4J8X D;  3AV1 D;  4Z5T D;  3AZI C;  2HUE B;  5C3I B;  5JRG D;  3B6F C;  2XD5 A;  1H3O B;  2YFV B;  5CPI D;  3REK D;  3MVD D;  3WA9 D;  5B40 C;  4H9R B;  5CPK D;  3TU4 C;  1P3F C;  1P3G A;  1TZY D;  5AVB D;  3REI A;  1AOI D;  4J8U A;  4R8P C;  4WNN B;  3AZM A;  2XD1 A;  3X1T A;  1KX3 C;  2PYO A;  3W99 C;  4YM6 C;  4KHA B;  3AV1 B;  4Z5T B;  3AZN C;  4H9Q A;  3AYW C;  5DNM C;  3UTA C;  3REK B;  2ARO A;  2ZY3 A;  3MVD B;  1ZLA D;  3WA9 B;  5CPK B;  3W96 A;  5B0Y D;  3O62 C;  5GT3 B;  3WAA B;  5CPJ D;  1TZY B;  5AV8 A;  4QLC A;  1AOI B;  3WTP A;  4H9S A;  5FUG A;  4UUZ A;  1P3O D;  1KX4 D;  3C1C A;  3AZJ D;  5GT0 A;  3MGQ C;  3UTB D;  4XUJ A;  3X1S B;  4J8X A;  1HQ3 A;  1P34 B;  3A1K A;  3V9R A;  4ZUX C;  5JRG A;  4LD9 C;  5CP6 A;  3AZF C;  3B6G D;  2Y2J A;  5CPI A;  5BT1 D;  5B2J D;  3MVD A;  2NQB D;  4KUD D;  3EG5 B;  3X1U B;  4XZQ A;  2CV5 C;  5AY8 D;  3FDD A;  3AZH B;  2DQN C;  5GSU D;  5AVB A;  3REJ C;  1P3O B;  4JJN C;  2F8N B;  1P3L A;  3AZJ B;  4X23 D;  3UTB B;  3X1S C;  4Z2M G;  3B0D C;  5B32 A;  5B24 A;  5E5A A;  1P3A D;  3B6G B;  3MGS B;  5B31 G;  5B2J B;  3AV2 C;  3LJA D;  1ZLA A;  5F99 D;  4KUD B;  3KWQ A;  5GXQ C;  5B1L C;  5DNN A;  5B33 A;  5B0Y A;  3X1V D;  1M1A B;  2IO5 C;  3REL D;  5B31 B;  5AY8 B;  5AVC C;  5CPJ A;  3MNN C;  1U35 D;  5B2I C;  1EQZ D;  1ID3 D;  4J8W C;  1P3I D;  3AL0 C;  2BYK B;  1M19 A;  1N1J B;  1P3P C;  1KX4 A;  1P3A B;  5KDM A;  2Y2N A;  3UT9 A;  3MGR D;  3AZK A;  1BH9 A;  3REH B;  3X1V B;  3KUY B;  1M1A C;  3AZE C;  3A6N C;  3AZG D;  1KX5 C;  2NQB A;  4HGA C;  1U35 B;  5BNX A;  1EQZ B;  1ID3 B;  1B67 A;  2L5A A;  2RVQ D;  3VH6 T;  4WU8 B;  4WU9 A;  5GSU A;  3NQJ A;  5AV6 C; 
#chains in the Genus database with same CATH homology
 1ULY A;  4X23 A;  4Z66 C;  3LZ0 C;  3MGR B;  2HIO B;  5B0Z D;  2FJ7 B;  3REH C;  3AZI D;  3W98 A;  3B6F D;  5BO0 A;  3LJA A;  5F99 A;  5B40 D;  1P3F D;  3TU4 D;  3MGP C;  1WWI A;  3KXB A;  4NE5 A;  2BG1 A;  3REL A;  1P3K A;  1KU5 A;  5AV5 C;  1P3I A;  4R8P D;  1KX3 D;  4YM6 D;  1P3B A;  2F2A C;  1M18 C;  3AZI B;  3AZN D;  3AYW D;  3B6F B;  5DNM D;  3UTA D;  3AN2 C;  2NZD A;  1S32 C;  3NQU A;  5AV9 B;  5B40 B;  3TU4 B;  3O62 D;  3AZG A;  2Y2H A;  3H0R C;  3AZL C;  4R8P B;  5G49 B;  1KX3 B;  1BFM A;  3VH6 A;  3W99 B;  4YM6 B;  3LZ1 A;  4J8V A;  3AZN B;  3AYW B;  1P3M C;  3VH5 W;  5DNM B;  3UTA B;  2Y2P A;  5JA4 B;  5AV9 C;  3WKJ C;  5B0Z A;  4ZUX D;  1F66 C;  4LD9 D;  4AWL B;  3O62 B;  5GT3 D;  3WAA D;  1T3U A;  1P3F A;  3F6T A;  3AFA B;  2YFW B;  4H9P B;  2CV5 D;  4KGC A;  4YS3 A;  3REJ D;  5B1M A;  3MGQ B;  3X1S D;  1P34 D;  2VQR A;  4ZUX B;  1P3G C;  4LD9 B;  4AWL C;  3H0M C;  1H3O A;  2YFV A;  3UTA A;  3AZF B;  3AV2 D;  4H9R A;  3AFA C;  2J8P A;  3REI C;  1JFI B;  5BNV B;  3X1U D;  3X1T C;  5GXQ D;  5B1L D;  2PYO C;  3H0L C;  2DF4 C;  2CV5 B;  3W97 B;  2JE5 A;  3AZH D;  3REJ B;  4JJN B;  2F8N D;  4WNN A;  2ARO C;  4KHA A;  3B0D B;  3AV1 A;  3W96 C;  4G92 C;  4Z5T A;  1P3P D;  1HTA A;  3MGS D;  3REK A;  4WJ3 C;  3AV2 B;  5AV8 C;  3WA9 A;  4CAY B;  5CPK A;  4QLC C;  2F8N G;  3A1I A;  5GXQ B;  5B1L B;  5GT3 A;  3WTP C;  4H9S C;  1M1A D;  3W97 C;  3WAA A;  2IO5 B;  5B31 D;  3AZE D;  3A6N D;  5AVC B;  1TZY A;  3MNN B;  3C1C C;  1AOI A;  5GT0 C;  5B2I B;  4XUJ C;  4J8W B;  4J8X C;  1HQ3 C;  5JRG C;  5CP6 C;  1P3P B;  5CPI C;  5AV6 D;  3X1S A;  4Z66 D;  3R45 B;  1P34 A;  4XZQ C;  3REH D;  3KUY D;  4CSR B;  2RIQ A;  3A6N B;  3AZE B;  1KX5 B;  4HGA B;  4Z2M H;  1P3L C;  3X1U A;  3MGP D;  4NFT A;  4WU8 D;  3AZH A;  5B32 C;  5B24 C;  5E5A C;  3C1B C;  1P3O A;  2F8N A;  5AV5 D;  3AZJ A;  5AV6 B;  3UTB A;  4Z66 B;  3EPJ A;  3LZ0 B;  2HIO D;  3KWQ C;  5DNN C;  5B0Y C;  2FJ7 D;  5B33 C;  3B6G A;  5CPJ C;  3LEL B;  3MGS A;  5B2J A;  3P5J B;  3AN2 D;  4WV4 B;  2BYM B;  1S32 D;  4KUD A;  4H9N B;  3MGP B;  1M1A A;  1M19 C;  5B31 A;  5AY8 A;  4G91 C;  1R4V A;  1KX4 C;  3AZL D;  5AV5 B;  3UT9 C;  4WZS B;  2BYK A;  3AZK C;  1N1J A;  1P3A A;  3VH5 T;  2Y2M A;  1M18 B;  5BT1 C;  3LEL C;  1P3M D;  2CWE A;  3AN2 B;  5AV9 D;  1S32 B;  3WKJ D;  3REH A;  3X1V A;  3KUY A;  1F66 D;  4WU9 C;  2Y2G A;  1BH8 B;  1U35 A;  4X23 C;  1EQZ A;  3AZL B;  1ID3 A;  4WU8 A;  3W99 D;  3W98 C;  2Y2Q A;  4H9O B;  5BS7 A;  1P3M B;  5F99 C;  3MGR A;  2HIO A;  4ZBJ C;  3WKJ B;  2FJ7 A;  3KXB C;  1P3G D;  5CHL B;  1F66 B;  1P3K C;  2FFF B;  3AFA D;  3REI D;  3EPH A;  3X1T D;  1TAF B;  1P3B C;  2W8S A;  3KSY A;  2G5H C;  4EO5 C;  1Q9C A;  2ZY4 A;  2NZD C;  3MGQ D;  2ARO D;  3W96 D;  3AZI A;  1P3G B;  3VH5 A;  3B6F A;  3AZF D;  3AZG C;  2Y2O A;  5AV9 A;  3WKJ A;  5AV8 D;  5B40 A;  3REI B;  3TU4 A;  4J8U B;  2RVQ C;  3WTP D;  3X1T B;  2PYO B;  3W97 D;  3B0B A;  4E44 A;  3LZ1 C;  4J8V C;  2ZM5 A;  4H9Q B;  3C1C D;  4JJN D;  4R8P A;  5G49 A;  1KX3 A;  3W99 A;  4YM6 A;  1HQ3 D;  2ARO B;  2Y2L A;  5B0Z C;  3W96 B;  4G92 B;  4E45 A;  5CP6 D;  3AZN A;  3AYW A;  4M6B A;  5DNM A;  5JA4 A;  3EPL A;  5AV8 B;  4J8U C;  3AZM C;  4QLC B;  4XZQ D;  3O62 A;  4KGC C;  3WTP B;  5FUG B;  4YS3 C;  5AVC D;  4UUZ B;  3MNN D;  3AFA A;  5B1M C;  3C1C B;  1P3L D;  5B2I D;  5GT0 B;  2YFW A;  4H9P A;  4J8W D;  4XUJ B;  4J8X B;  1HQ3 B;  5B32 D;  3V9R B;  4DRB A;  5E5A D;  2HUE C;  5C3I C;  5B24 D;  5JRG B;  3C1B D;  5CP6 B;  5CPI B;  3MGQ A;  4ZUX A;  3KWQ D;  5DNN D;  4LD9 A;  4XZQ B;  5B33 D;  2Y2K A;  3AZF A;  5AVB B;  5B32 G;  1KX5 D;  1JFI A;  5BNV A;  1P3L B;  3W97 A;  3B0C W;  2CV5 A;  1M19 D;  3AV1 C;  5B32 B;  4Z5T C;  5B24 B;  5E5A B;  3C1B B;  3REJ A;  4JJN A;  3REK C;  3MVD C;  3UT9 D;  3LZ0 D;  1ZLA B;  2F8N H;  5CPK C;  3AZK D;  3WA9 C;  3EPK A;  3KWQ B;  5DNN B;  5B0Y B;  5GT3 C;  5B33 B;  3WAA C;  3LEL D;  5CPJ B;  1TZY C;  5AVB C;  3AV2 A;  1Z2C B;  4CAY A;  1AOI C;  1A7W A;  5GXQ A;  5B1L A;  4WU9 D;  1M19 B;  5AVC A;  3MNN A;  4G91 B;  1KX4 B;  5KDM B;  5B2I A;  4J8W A;  1P34 C;  3UT9 B;  1ZLA C;  3C1B A;  3AZK B;  1BH9 B;  1P3P A;  1M18 D;  3W98 D;  4NE6 A;  3R45 A;  2UWX A;  2NQB B;  5BNX B;  3X1U C;  3KXB D;  4DQY B;  3AZH C;  4CSR A;  4WU9 B;  3AZE A;  5GSU B;  3A6N A;  1P3K D;  1P3O C;  1KX5 A;  2JCH A;  3AZJ C;  1PZR A;  3NQJ B;  4X23 B;  3WTP E;  3UTB C;  2G5I C;  1WWS A;  1P3B D;  3B6G C;  3W98 B;  5AV6 A;  3MGS C;  5B2J C;  2JSS A;  5BO0 B;  4Z66 A;  3LZ0 A;  3LJA B;  2NQB C;  2NZD D;  4DRA A;  4KUD C;  5F99 B;  4ZBJ B;  3KXB B;  5B31 C;  5AY8 C;  3LEL A;  4NE3 A;  3REL B;  5GSU C;  1P3K B;  2BYM A;  2F8N K;  1B6W A;  4H9N A;  1P3I B;  3MGP A;  3LZ1 D;  1P3B B;  4J8V D;  1P3A C;  5AV5 A;  4EO5 B;  2NZD B;  3LJA C;  2ZY5 A;  2LY8 A;  3NQU B;  3KFU G;  3X1V C;  1F1E A;  3KUY C;  1M18 A;  3REL C;  3AZG B;  3AN2 A;  1U35 C;  1S32 A;  1EQZ C;  1ID3 C;  1P3I C;  4J8U D;  3AZM D;  4WU8 C;  2PYO D;  4KGC D;  2Y2I A;  3LZ1 B;  1BH8 A;  4YS3 D;  4J8V B;  3AZL A;  5B1M D;  5BS7 C;  1W2E A;  3MGR C;  2HIO C;  2FJ7 C;  5B0Z B;  4H9O A;  1P3M A;  3IP4 C;  1P3F B;  1F66 A;  4QLC D;  3AZM B;  2ZY2 A;  4KGC B;  3VH6 W;  4YS3 B;  4UPK A;  3B0C T;  5B1M B;  5GT0 D;  1TAF A;  4XUJ D;  4J8X D;  3AV1 D;  4Z5T D;  3AZI C;  2HUE B;  5C3I B;  5JRG D;  3B6F C;  2XD5 A;  1H3O B;  2YFV B;  5CPI D;  3REK D;  3MVD D;  3WA9 D;  5B40 C;  4H9R B;  5CPK D;  3TU4 C;  1P3F C;  1P3G A;  1TZY D;  5AVB D;  3REI A;  1AOI D;  4J8U A;  4R8P C;  4WNN B;  3AZM A;  2XD1 A;  3X1T A;  1KX3 C;  2PYO A;  3W99 C;  4YM6 C;  4KHA B;  3AV1 B;  4Z5T B;  3AZN C;  4H9Q A;  3AYW C;  5DNM C;  3UTA C;  3REK B;  2ARO A;  2ZY3 A;  3MVD B;  1ZLA D;  3WA9 B;  5CPK B;  3W96 A;  5B0Y D;  3O62 C;  5GT3 B;  3WAA B;  5CPJ D;  1TZY B;  5AV8 A;  4QLC A;  1AOI B;  3WTP A;  4H9S A;  5FUG A;  4UUZ A;  1P3O D;  1KX4 D;  3C1C A;  3AZJ D;  5GT0 A;  3MGQ C;  3UTB D;  4XUJ A;  3X1S B;  4J8X A;  1HQ3 A;  1P34 B;  3A1K A;  3V9R A;  4ZUX C;  5JRG A;  4LD9 C;  5CP6 A;  3AZF C;  3B6G D;  2Y2J A;  5CPI A;  5BT1 D;  5B2J D;  3MVD A;  2NQB D;  4KUD D;  3EG5 B;  3X1U B;  4XZQ A;  2CV5 C;  5AY8 D;  3FDD A;  3AZH B;  2DQN C;  5GSU D;  5AVB A;  3REJ C;  1P3O B;  4JJN C;  2F8N B;  1P3L A;  3AZJ B;  4X23 D;  3UTB B;  3X1S C;  4Z2M G;  3B0D C;  5B32 A;  5B24 A;  5E5A A;  1P3A D;  3B6G B;  3MGS B;  5B31 G;  5B2J B;  3AV2 C;  3LJA D;  1ZLA A;  5F99 D;  4KUD B;  3KWQ A;  5GXQ C;  5B1L C;  5DNN A;  5B33 A;  5B0Y A;  3X1V D;  1M1A B;  2IO5 C;  3REL D;  5B31 B;  5AY8 B;  5AVC C;  5CPJ A;  3MNN C;  1U35 D;  5B2I C;  1EQZ D;  1ID3 D;  4J8W C;  1P3I D;  3AL0 C;  2BYK B;  1M19 A;  1N1J B;  1P3P C;  1KX4 A;  1P3A B;  5KDM A;  2Y2N A;  3UT9 A;  3MGR D;  3AZK A;  1BH9 A;  3REH B;  3X1V B;  3KUY B;  1M1A C;  3AZE C;  3A6N C;  3AZG D;  1KX5 C;  2NQB A;  4HGA C;  1U35 B;  5BNX A;  1EQZ B;  1ID3 B;  1B67 A;  2L5A A;  2RVQ D;  3VH6 T;  4WU8 B;  4WU9 A;  5GSU A;  3NQJ A;  5AV6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...