4WU9A

Structure of cisptnap-ncp145
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9A00
3W98C 5AVCC 3AZKD 5GT0A 3LELB 3AZJB 2AROA 3VH6A 5B31C 4QLCC 5B2JC 4CAYB 3X1VD 1P3BB 4H9QB 3WKJD 3REKC 5E5AC 3REHB 5FUGA 1P34C 2F8NK 3REIC 4WU8D 4J8XB 4LD9B 3AN2B 3KXBC 5CP6D 4XZQA 4J8UD 3MGPD 3AZLA 2NQBC 3X1UB 4Z5TD 3NQJA 3W96A 1S32D 3KUYC 5B24B 5DNNC 3WTPE 1TAFA 5DNMD 3VH5T 5B40C 3B0BA 4J8WC 5CPKC 2FJ7D 3AV2A 3B0CT 2YFWA 3LZ1A 3UTBA 1P3PA 5AV6A 5B33B 5BNVB 3UT9A 4H9OA 3WAAA 5AY8C 3AFAD 1F66D 3X1SD 3AZMB 4Z66D 3LELC 3REJD 5KDMB 3C1BA 3A6NC 1P3FA 5AVBD 1P3BC 4H9RB 5JRGA 1N1JA 3REHC 5BS7C 4J8XC 4LD9C 5AV9B 3AN2C 4NE3A 4KHAB 4YM6C 3W98D 5AVCD 5BO0A 3X1UC 4QLCD 5B2JD 3WTPC 3X1VB 3REKD 5E5AD 4ZUXA 1P34D 5B1MA 5B24C 3REID 5GT3B 3KXBD 1P3ID 1HQ3C 1BH9B 4KUDA 5B33C 3KUYD 1S32B 5DNND 3AZMC 2BYKB 3NQUB 3MNNB 5AV5A 4WU9B 4J8WD 3AV1D 5CPKD 4H9SC 4WZSB 5GT0B 5C3IB 5B31G 2RVQC 1P3AA 5B0ZA 5AY8D 1F66B 4R8PA 3MGRA 1KX4A 1ID3A 5BNXB 3LELD 4XZQB 5B1LD 5CPJC 3A6ND 1HTAA 5GXQA 3AZLB 1P3BD 3KWQD 4J8XD 4LD9D 3AN2D 5GT3C 2F8ND 3W96B 4YM6D 4AWLB 3W98B 3VH6T 1TAFB 3X1UD 5F99C 5B2IA 3WTPD 3REKB 3LZ1B 2YFWB 3LJAA 5E5AB 3UTBB 3AZFA 1S32C 5B24D 3REIB 1P3PB 3KXBB 3UT9B 4H9OB 2CV5A 1H3OB 3MNNC 1P3IB 1HQ3D 4WU9C 3WAAB 1U35A 5GT0C 5C3IC 3C1CA 5B33D 3B6FD 3UTAA 1P3OD 4EO5B 1KX3D 1F66C 1N1JB 4E44A 1R4VA 4KGCA 5CPKB 3AV1B 4XZQC 2CWEA 4J8VB 3MGQA 3AZEA 5BO0B 4WV4B 3AZLC 3X1TA 2RVQD 3O62A 4DRAA 4CSRB 5AY8B 1M19A 3W96C 5GSUA 3W97D 4AWLC 4M6BA 5B1LB 3AZNA 5CPJD 5JA4A 3A6NB 1BH8B 3LZ1C 3KWQB 3UTBC 1P3PC 1KX5A 3KSYA 5GT3D 3TU4A 3UT9C 2F8NB 3W99A 3WAAC 4YM6B 1P3IC 1WWSA 5F99D 5AV8A 1ZLAA 3WTPB 3R45B 1AOIA 4XUJA 3C1BC 3B6GA 4EO5C 1EQZA 5JRGC 1M18A 1P3AB 2IO5B 5B0ZB 3MNND 4WU9D 1HQ3B 1P3MA 3AZGA 3AV1C 4J8VC 4R8PB 3MGRB 1ID3B 4E45A 5GT0D 3B6FB 5CHLB 4X23A 1P3OB 1KX3B 4ZUXC 5B1MC 1F1EA 4H9NA 1M1AA 4XZQD 5B1LC 3B0DB 3AZLD 1JFIA 1B67A 3AZIA 2HIOB 3KWQC 5B31A 3W96D 3AZFB 3W97B 5B0YA 5B32A 4H9PB 4G91B 3AV2D 5CPJB 1U35B 3LZ1D 3UTBD 1P3PD 2NQBA 3C1CB 5CPIA 3UT9D 5B0ZC 2IO5C 3UTAB 1P3AC 3WAAD 4WNNA 2NZDB 1WWIA 1KU5A 4R8PC 3MGRC 5F99B 1ID3C 1Q9CA 4KGCB 4JJNA 5B40A 3B6FC 3C1BD 3AZEB 1P3FD 1P3OC 3MVDA 5JRGD 1KX3C 1A7WA 5GSUB 4J8VD 1BFMA 3LZ0A 3B0DC 2AROB 2HIOC 5B2IC 1P3KA 3AZNB 1TZYA 3AZJA 3AZFC 4ZUXD 3LJAC 3AYWA 3W97C 5FUGB 5B1MD 4CAYA 4H9QA 3TU4B 2CV5C 3W99B 3REHA 4J8XA 4G91C 3AZHA 3AN2A 1U35C 3VH5W 1AOIB 3C1CC 3NQJB 3UTAC 2YFVA 3B0CW 3B6GB 1EQZB 3MGSA 2NZDC 4KGCC 5AV5D 1P3GA 3AZGB 3AV2B 3MGQC 4UUZA 3AZEC 3X1TC 3WA9A 1P3LA 3RELA 5AV6B 5B0ZD 1P3AD 1M19C 5GSUC 4R8PD 3MGRD 1KX4D 1ID3D 4ZBJB 2PYOA 4H9NB 3AZMA 2AROC 3AZNC 3C1BB 1P3FB 5GXQD 1JFIB 5JRGB 4H9SA 4YS3A 5KDMA 1KX5C 4H9RA 3TU4C 2F8NG 3W99C 5AV9A 2L5AA 2HIOD 4KHAA 5B2ID 1ZLAC 5B32B 3AZKA 1AOIC 2BYMA 3AZFD 3LJAD 4ZUXB 3B6GC 5B1MB 1EQZC 3X1VA 3WKJA 5CPIB 2CV5D 4WU8A 3AZGC 1U35D 3AV2C 5CP6A 4J8UA 3MGPA 4KUDB 3C1CD 4JJNB 5AV6C 3UTAD 4Z5TA 4X23C 4Z2MG 3MVDB 2NZDD 1S32A 4ZBJC 4KGCD 5AV5B 5DNMA 3MGQD 3NQUA 3AZED 3LZ0B 1P3FC 2FJ7A 3X1TD 2HUEB 3AZIC 1P3KB 1TZYB 3O62D 1M19D 5GSUD 4G92B 3AYWB 1KX4B 3AFAA 1F66A 2AROD 3X1SA 3AZND 5B0YC 5B32C 5BNXA 4Z66A 3VH6W 3AZHB 5GXQB 3REJA 1KX5D 5AVBA 3TU4D 5CPIC 2LY8A 3W99D 2YFVB 3MGSB 5AV8D 1ZLAD 5B2IB 3W98A 5AVCA 1P3GB 4KUDC 1AOID 4XUJD 4JJNC 4QLCA 4UUZB 3B6GD 3LJAB 5B2JA 3MVDC 1EQZD 3WA9B 1M18D 1P3LB 3RELB 3REKA 2CV5B 5E5AA 1P34A 3REIA 5AV5C 1P3MD 3AZGD 3KXBA 1H3OA 1P3IA 5G49A 3LZ0C 2PYOB 2HUEC 1P3KC 5AV6D 1TZYC 4X23D 3AZJC 4G92C 3AYWC 4YS3B 1KX4C 3KUYA 1M1AD 5DNNA 4NE6A 2F8NH 3MGQB 3AZHC 5CPKA 5GXQC 4J8WA 3AV1A 3X1TB 3AZID 4J8VA 3O62B 3AZKB 3V9RA 5B31D 2BYMB 1M19B 1B6WA 3MGSC 5AY8A 4CSRA 3WKJB 5B0YD 5B32D 4WU8B 1P3GC 5JA4B 3LELA 5CP6B 5B1LA 4HGAB 3VH5A 4J8UB 3A6NA 3MGPB 2NQBD 1KX5B 1P3BA 3WA9C 1P3LC 3RELC 5CPID 1BH8A 3KWQA 4Z5TB 5BS7A 4Z2MH 4LD9A 2F8NA 4NE5A 5AV8B 4YM6A 1ZLAB 2PYOC 4KUDD 4NFTA 3X1UA 5DNMB 4JJND 5B40D 4XUJB 3WTPA 2FJ7B 3MVDD 3R45A 4DRBA 1M18B 4YS3C 5B24A 1P3MB 5BT1C 3LZ0D 1HQ3A 5AV9C 2JSSA 3AFAB 3X1SB 1P3KD 5B32G 4Z66B 1TZYD 3O62C 3AZKC 4X23B 3AZJD 5B33A 5BNVA 3REJB 3AYWD 3B6FA 1P3OA 5AVBB 3X1VC 3WKJC 1M1AB 1KX3A 3REHD 1ULYA 4WU8C 3AZHD 5CP6C 3AZIB 4HGAC 5AVCB 4J8UC 3MGPC 5B31B 2HIOA 4QLCB 4Z5TC 5B2JB 3MGSD 5AV8C 3W97A 1P34B 5B0YB 1P3GD 5DNMC 4XUJC 5G49B 2FJ7C 4H9PA 5CPJA 3WA9D 2NQBB 1P3LD 3RELD 1M18C 4WNNB 1P3MC 5GT3A 3KUYB 2PYOD 2NZDA 5DNNB 3AFAC 3AZMD 1BH9A 3X1SC 5F99A 5B40B 4Z66C 4J8WB 4YS3D 3REJC 3V9RB 5AVBC 5BT1D 1M1AC 2BYKA 3MNNA 5AV9D 4WU9A
chains in the Genus database with same CATH superfamily
3W98C 5AVCC 3AZKD 5GT0A 3LELB 3AZJB 2AROA 3VH6A 5B31C 4QLCC 5B2JC 4CAYB 3X1VD 1P3BB 4H9QB 3WKJD 3REKC 3EPKA 5E5AC 3REHB 5FUGA 1P34C 2F8NK 3REIC 4WU8D 4J8XB 4LD9B 3AN2B 2ZY4A 3KXBC 5CP6D 4XZQA 4J8UD 3MGPD 3AZLA 2NQBC 3X1UB 4Z5TD 3A1KA 3NQJA 3W96A 1S32D 3KUYC 5B24B 5DNNC 3WTPE 1TAFA 5DNMD 3VH5T 5B40C 2ZY3A 3B0BA 4J8WC 5CPKC 2FJ7D 3AV2A 3B0CT 2YFWA 3LZ1A 3UTBA 1P3PA 5AV6A 5B33B 5BNVB 3UT9A 4H9OA 3WAAA 5AY8C 3AFAD 1F66D 3X1SD 3AZMB 4Z66D 3LELC 3REJD 5KDMB 3C1BA 3A6NC 1P3FA 5AVBD 1P3BC 4H9RB 5JRGA 1N1JA 3REHC 5BS7C 4J8XC 4LD9C 5AV9B 3AN2C 4NE3A 4KHAB 4YM6C 3W98D 5AVCD 5BO0A 3A1IA 3X1UC 4QLCD 5B2JD 3WTPC 3FDDA 3X1VB 3REKD 5E5AD 4ZUXA 1P34D 5B1MA 2BG1A 5B24C 3REID 5GT3B 3KXBD 1P3ID 1HQ3C 1BH9B 4KUDA 5B33C 3KUYD 1S32B 5DNND 3AZMC 2BYKB 3NQUB 3MNNB 5AV5A 4WU9B 4J8WD 3AV1D 5CPKD 4H9SC 4WZSB 5GT0B 5C3IB 5B31G 2RVQC 1P3AA 5B0ZA 5AY8D 1F66B 4R8PA 3MGRA 1KX4A 1ID3A 5BNXB 3LELD 4XZQB 5B1LD 5CPJC 3A6ND 1HTAA 5GXQA 3AZLB 1P3BD 3KWQD 4J8XD 4LD9D 3AN2D 5GT3C 2F8ND 3W96B 4YM6D 4AWLB 3W98B 3VH6T 1TAFB 3X1UD 5F99C 5B2IA 3WTPD 3REKB 3LZ1B 2YFWB 3LJAA 5E5AB 3UTBB 3AZFA 1S32C 5B24D 3REIB 2JCHA 1P3PB 3KXBB 3UT9B 4H9OB 2CV5A 1H3OB 3MNNC 1P3IB 1HQ3D 4WU9C 3WAAB 1U35A 2G5HC 5GT0C 5C3IC 3C1CA 5B33D 3B6FD 3UTAA 1P3OD 4EO5B 2Y2QA 1KX3D 1F66C 1N1JB 4E44A 1R4VA 3H0MC 4KGCA 5CPKB 3AV1B 4XZQC 2CWEA 4J8VB 3MGQA 3AZEA 5BO0B 4WV4B 3AZLC 3X1TA 2RVQD 3O62A 4DRAA 4CSRB 5AY8B 1M19A 3W96C 5GSUA 3W97D 4AWLC 4M6BA 5B1LB 3AZNA 2Y2HA 2Y2MA 5CPJD 5JA4A 3A6NB 1BH8B 3LZ1C 3KWQB 2XD5A 3EPLA 3UTBC 1P3PC 1KX5A 3KSYA 5GT3D 3TU4A 3UT9C 2F8NB 3W99A 3WAAC 4YM6B 2Y2OA 1P3IC 1WWSA 5F99D 5AV8A 1ZLAA 2Y2JA 3WTPB 3R45B 1AOIA 4XUJA 3C1BC 3B6GA 4EO5C 1W2EA 5JRGC 1EQZA 1M18A 2VQRA 1P3AB 2IO5B 5B0ZB 3MNND 4WU9D 1HQ3B 1P3MA 3AZGA 3AV1C 4J8VC 4R8PB 3MGRB 1ID3B 4E45A 5GT0D 2FFFB 3B6FB 5CHLB 2ZY5A 4X23A 1P3OB 1KX3B 4ZUXC 5B1MC 1F1EA 2Y2NA 4H9NA 1M1AA 4XZQD 5B1LC 2W8SA 3B0DB 3AZLD 1JFIA 1B67A 3AZIA 2HIOB 3KWQC 3KFUG 5B31A 3W96D 3AZFB 3W97B 5B0YA 5B32A 4H9PB 4G91B 3AV2D 5CPJB 1U35B 1PZRA 2Y2GA 3LZ1D 3UTBD 1P3PD 2NQBA 3C1CB 5CPIA 3UT9D 2IO5C 5B0ZC 3UTAB 1P3AC 3WAAD 2F2AC 4WNNA 2NZDB 1WWIA 1KU5A 4R8PC 3MGRC 5F99B 1ID3C 1Q9CA 4KGCB 2ZM5A 4JJNA 5B40A 3B6FC 3C1BD 3AZEB 1P3FD 1P3OC 3MVDA 5JRGD 1KX3C 2Y2LA 1A7WA 5GSUB 4J8VD 1BFMA 3LZ0A 3B0DC 2AROB 2HIOC 5B2IC 1P3KA 3AZNB 1TZYA 3AZJA 2DQNC 4ZUXD 3LJAC 3AYWA 3AZFC 5FUGB 5B1MD 4CAYA 3W97C 4H9QA 3TU4B 2CV5C 3W99B 3REHA 4J8XA 4G91C 3AZHA 3AN2A 1U35C 3VH5W 1AOIB 3C1CC 3NQJB 3UTAC 2YFVA 3B0CW 3B6GB 1EQZB 3MGSA 2NZDC 4KGCC 5AV5D 2J8PA 1P3GA 3AZGB 3AV2B 3MGQC 4UUZA 3AZEC 3X1TC 2ZY2A 3WA9A 1P3LA 3RELA 5AV6B 5B0ZD 1P3AD 1M19C 5GSUC 4R8PD 3MGRD 1KX4D 1ID3D 4ZBJB 2PYOA 4H9NB 3AZMA 2AROC 3H0LC 3AZNC 3P5JB 3C1BB 5GXQD 1P3FB 1JFIB 5JRGB 3IP4C 4H9SA 4YS3A 5KDMA 1KX5C 4H9RA 3TU4C 2F8NG 3W99C 5AV9A 2L5AA 2HIOD 4KHAA 5B2ID 1ZLAC 5B32B 3AZKA 1AOIC 2BYMA 3AZFD 3LJAD 4ZUXB 3B6GC 5B1MB 1EQZC 3X1VA 3WKJA 5CPIB 2CV5D 4WU8A 3AZGC 1U35D 3AV2C 3EPHA 5CP6A 4J8UA 3MGPA 4KUDB 3C1CD 4JJNB 2UWXA 5AV6C 3UTAD 4Z5TA 4X23C 4Z2MG 3MVDB 2NZDD 1S32A 4ZBJC 4KGCD 5AV5B 5DNMA 3MGQD 3NQUA 3AZED 3LZ0B 1P3FC 2FJ7A 3X1TD 2HUEB 3AZIC 1P3KB 1TZYB 3O62D 1M19D 2JE5A 5GSUD 4G92B 3AYWB 1KX4B 3AFAA 1F66A 2AROD 3X1SA 3AZND 5B0YC 5B32C 5BNXA 4Z66A 3VH6W 3AZHB 5GXQB 3REJA 1KX5D 5AVBA 3TU4D 1T3UA 2LY8A 5CPIC 3W99D 2YFVB 3MGSB 2XD1A 5AV8D 1ZLAD 5B2IB 3W98A 5AVCA 1P3GB 4KUDC 1AOID 4XUJD 4JJNC 4QLCA 4UUZB 3B6GD 3LJAB 5B2JA 3EG5B 3MVDC 1EQZD 3WA9B 1M18D 1P3LB 3RELB 3REKA 2CV5B 5E5AA 1P34A 3REIA 5AV5C 1P3MD 3AZGD 3KXBA 1H3OA 1P3IA 5G49A 3LZ0C 2PYOB 2HUEC 1P3KC 5AV6D 1TZYC 4X23D 3AZJC 4UPKA 4G92C 3AYWC 4YS3B 1KX4C 3KUYA 1M1AD 5DNNA 2Y2IA 4NE6A 2F8NH 3MGQB 3AZHC 5CPKA 5GXQC 4J8WA 3AV1A 4DQYB 3AZID 4J8VA 3X1TB 3O62B 3AZKB 3V9RA 5B31D 2BYMB 1M19B 1B6WA 3MGSC 5AY8A 4CSRA 3WKJB 5B0YD 5B32D 4WU8B 1P3GC 5JA4B 3LELA 5CP6B 5B1LA 4HGAB 3VH5A 4J8UB 3A6NA 3MGPB 2NQBD 1KX5B 1P3BA 3WA9C 1P3LC 3RELC 5CPID 1BH8A 3KWQA 4Z5TB 5BS7A 4Z2MH 4LD9A 2F8NA 4NE5A 5AV8B 4YM6A 1ZLAB 2PYOC 4KUDD 4NFTA 3X1UA 5DNMB 4JJND 5B40D 4XUJB 3WTPA 2FJ7B 3MVDD 3R45A 4DRBA 1M18B 4YS3C 5B24A 1P3MB 5BT1C 3LZ0D 1HQ3A 5AV9C 2JSSA 3AFAB 3X1SB 3AL0C 1P3KD 5B32G 4Z66B 1TZYD 3EPJA 3O62C 3AZKC 4X23B 3AZJD 5B33A 5BNVA 3REJB 3AYWD 3B6FA 1P3OA 5AVBB 3X1VC 3WKJC 1M1AB 1KX3A 3REHD 2Y2KA 1ULYA 4WU8C 3AZHD 2G5IC 5CP6C 2RIQA 3AZIB 4HGAC 5AVCB 3H0RC 4J8UC 3MGPC 5B31B 2HIOA 4QLCB 4Z5TC 5B2JB 3MGSD 1Z2CB 5AV8C 2Y2PA 3W97A 1P34B 5B0YB 1P3GD 5DNMC 4XUJC 5G49B 2FJ7C 4H9PA 5CPJA 3WA9D 2NQBB 1P3LD 3RELD 1M18C 4WNNB 1P3MC 5GT3A 3KUYB 2PYOD 2NZDA 5DNNB 3AFAC 3AZMD 1BH9A 3X1SC 5F99A 3F6TA 5B40B 4Z66C 4J8WB 4WJ3C 4YS3D 3REJC 3V9RB 5AVBC 5BT1D 1M1AC 2BYKA 2DF4C 3MNNA 5AV9D 4WU9A
chains in the Genus database with same CATH topology
3W98C 5AVCC 3AZKD 5GT0A 3LELB 3AZJB 2AROA 3VH6A 5B31C 4QLCC 5B2JC 4CAYB 3X1VD 1P3BB 4H9QB 3WKJD 3REKC 3EPKA 5E5AC 3REHB 5FUGA 1P34C 2F8NK 3REIC 4WU8D 4J8XB 4LD9B 3AN2B 2ZY4A 3KXBC 5CP6D 4XZQA 4J8UD 3MGPD 3AZLA 2NQBC 3X1UB 4Z5TD 3A1KA 3NQJA 3W96A 1S32D 3KUYC 5B24B 5DNNC 3WTPE 1TAFA 5DNMD 3VH5T 5B40C 2ZY3A 3B0BA 4J8WC 5CPKC 2FJ7D 3AV2A 3B0CT 2YFWA 3LZ1A 3UTBA 1P3PA 5AV6A 5B33B 5BNVB 3UT9A 4H9OA 3WAAA 5AY8C 3AFAD 1F66D 3X1SD 3AZMB 4Z66D 3LELC 3REJD 5KDMB 3C1BA 3A6NC 1P3FA 5AVBD 1P3BC 4H9RB 5JRGA 1N1JA 3REHC 5BS7C 4J8XC 4LD9C 5AV9B 3AN2C 4NE3A 4KHAB 4YM6C 3W98D 5AVCD 5BO0A 3A1IA 3X1UC 4QLCD 5B2JD 3WTPC 3FDDA 3X1VB 3REKD 5E5AD 4ZUXA 1P34D 5B1MA 2BG1A 5B24C 3REID 5GT3B 3KXBD 1P3ID 1HQ3C 1BH9B 4KUDA 5B33C 3KUYD 1S32B 5DNND 3AZMC 2BYKB 3NQUB 3MNNB 5AV5A 4WU9B 4J8WD 3AV1D 5CPKD 4H9SC 4WZSB 5GT0B 5C3IB 5B31G 2RVQC 1P3AA 5B0ZA 5AY8D 1F66B 4R8PA 3MGRA 1KX4A 1ID3A 5BNXB 3LELD 4XZQB 5B1LD 5CPJC 3A6ND 1HTAA 5GXQA 3AZLB 1P3BD 3KWQD 4J8XD 4LD9D 3AN2D 5GT3C 2F8ND 3W96B 4YM6D 4AWLB 3W98B 3VH6T 1TAFB 3X1UD 5F99C 5B2IA 3WTPD 3REKB 3LZ1B 2YFWB 3LJAA 5E5AB 3UTBB 3AZFA 1S32C 5B24D 3REIB 2JCHA 1P3PB 3KXBB 3UT9B 4H9OB 2CV5A 1H3OB 3MNNC 1P3IB 1HQ3D 4WU9C 3WAAB 1U35A 2G5HC 5GT0C 5C3IC 3C1CA 5B33D 3B6FD 3UTAA 1P3OD 4EO5B 2Y2QA 1KX3D 1F66C 1N1JB 4E44A 1R4VA 3H0MC 4KGCA 5CPKB 3AV1B 4XZQC 2CWEA 4J8VB 3MGQA 3AZEA 5BO0B 4WV4B 3AZLC 3X1TA 2RVQD 3O62A 4DRAA 4CSRB 5AY8B 1M19A 3W96C 5GSUA 3W97D 4AWLC 4M6BA 5B1LB 3AZNA 2Y2HA 2Y2MA 5CPJD 5JA4A 3A6NB 1BH8B 3LZ1C 3KWQB 2XD5A 3EPLA 3UTBC 1P3PC 1KX5A 3KSYA 5GT3D 3TU4A 3UT9C 2F8NB 3W99A 3WAAC 4YM6B 2Y2OA 1P3IC 1WWSA 5F99D 5AV8A 1ZLAA 2Y2JA 3WTPB 3R45B 1AOIA 4XUJA 3C1BC 3B6GA 4EO5C 1W2EA 5JRGC 1EQZA 1M18A 2VQRA 1P3AB 2IO5B 5B0ZB 3MNND 4WU9D 1HQ3B 1P3MA 3AZGA 3AV1C 4J8VC 4R8PB 3MGRB 1ID3B 4E45A 5GT0D 2FFFB 3B6FB 5CHLB 2ZY5A 4X23A 1P3OB 1KX3B 4ZUXC 5B1MC 1F1EA 2Y2NA 4H9NA 1M1AA 4XZQD 5B1LC 2W8SA 3B0DB 3AZLD 1JFIA 1B67A 3AZIA 2HIOB 3KWQC 3KFUG 5B31A 3W96D 3AZFB 3W97B 5B0YA 5B32A 4H9PB 4G91B 3AV2D 5CPJB 1U35B 1PZRA 2Y2GA 3LZ1D 3UTBD 1P3PD 2NQBA 3C1CB 5CPIA 3UT9D 2IO5C 5B0ZC 3UTAB 1P3AC 3WAAD 2F2AC 4WNNA 2NZDB 1WWIA 1KU5A 4R8PC 3MGRC 5F99B 1ID3C 1Q9CA 4KGCB 2ZM5A 4JJNA 5B40A 3B6FC 3C1BD 3AZEB 1P3FD 1P3OC 3MVDA 5JRGD 1KX3C 2Y2LA 1A7WA 5GSUB 4J8VD 1BFMA 3LZ0A 3B0DC 2AROB 2HIOC 5B2IC 1P3KA 3AZNB 1TZYA 3AZJA 2DQNC 4ZUXD 3LJAC 3AYWA 3AZFC 5FUGB 5B1MD 4CAYA 3W97C 4H9QA 3TU4B 2CV5C 3W99B 3REHA 4J8XA 4G91C 3AZHA 3AN2A 1U35C 3VH5W 1AOIB 3C1CC 3NQJB 3UTAC 2YFVA 3B0CW 3B6GB 1EQZB 3MGSA 2NZDC 4KGCC 5AV5D 2J8PA 1P3GA 3AZGB 3AV2B 3MGQC 4UUZA 3AZEC 3X1TC 2ZY2A 3WA9A 1P3LA 3RELA 5AV6B 5B0ZD 1P3AD 1M19C 5GSUC 4R8PD 3MGRD 1KX4D 1ID3D 4ZBJB 2PYOA 4H9NB 3AZMA 2AROC 3H0LC 3AZNC 3P5JB 3C1BB 5GXQD 1P3FB 1JFIB 5JRGB 3IP4C 4H9SA 4YS3A 5KDMA 1KX5C 4H9RA 3TU4C 2F8NG 3W99C 5AV9A 2L5AA 2HIOD 4KHAA 5B2ID 1ZLAC 5B32B 3AZKA 1AOIC 2BYMA 3AZFD 3LJAD 4ZUXB 3B6GC 5B1MB 1EQZC 3X1VA 3WKJA 5CPIB 2CV5D 4WU8A 3AZGC 1U35D 3AV2C 3EPHA 5CP6A 4J8UA 3MGPA 4KUDB 3C1CD 4JJNB 2UWXA 5AV6C 3UTAD 4Z5TA 4X23C 4Z2MG 3MVDB 2NZDD 1S32A 4ZBJC 4KGCD 5AV5B 5DNMA 3MGQD 3NQUA 3AZED 3LZ0B 1P3FC 2FJ7A 3X1TD 2HUEB 3AZIC 1P3KB 1TZYB 3O62D 1M19D 2JE5A 5GSUD 4G92B 3AYWB 1KX4B 3AFAA 1F66A 2AROD 3X1SA 3AZND 5B0YC 5B32C 5BNXA 4Z66A 3VH6W 3AZHB 5GXQB 3REJA 1KX5D 5AVBA 3TU4D 1T3UA 2LY8A 5CPIC 3W99D 2YFVB 3MGSB 2XD1A 5AV8D 1ZLAD 5B2IB 3W98A 5AVCA 1P3GB 4KUDC 1AOID 4XUJD 4JJNC 4QLCA 4UUZB 3B6GD 3LJAB 5B2JA 3EG5B 3MVDC 1EQZD 3WA9B 1M18D 1P3LB 3RELB 3REKA 2CV5B 5E5AA 1P34A 3REIA 5AV5C 1P3MD 3AZGD 3KXBA 1H3OA 1P3IA 5G49A 3LZ0C 2PYOB 2HUEC 1P3KC 5AV6D 1TZYC 4X23D 3AZJC 4UPKA 4G92C 3AYWC 4YS3B 1KX4C 3KUYA 1M1AD 5DNNA 2Y2IA 4NE6A 2F8NH 3MGQB 3AZHC 5CPKA 5GXQC 4J8WA 3AV1A 4DQYB 3AZID 4J8VA 3X1TB 3O62B 3AZKB 3V9RA 5B31D 2BYMB 1M19B 1B6WA 3MGSC 5AY8A 4CSRA 3WKJB 5B0YD 5B32D 4WU8B 1P3GC 5JA4B 3LELA 5CP6B 5B1LA 4HGAB 3VH5A 4J8UB 3A6NA 3MGPB 2NQBD 1KX5B 1P3BA 3WA9C 1P3LC 3RELC 5CPID 1BH8A 3KWQA 4Z5TB 5BS7A 4Z2MH 4LD9A 2F8NA 4NE5A 5AV8B 4YM6A 1ZLAB 2PYOC 4KUDD 4NFTA 3X1UA 5DNMB 4JJND 5B40D 4XUJB 3WTPA 2FJ7B 3MVDD 3R45A 4DRBA 1M18B 4YS3C 5B24A 1P3MB 5BT1C 3LZ0D 1HQ3A 5AV9C 2JSSA 3AFAB 3X1SB 3AL0C 1P3KD 5B32G 4Z66B 1TZYD 3EPJA 3O62C 3AZKC 4X23B 3AZJD 5B33A 5BNVA 3REJB 3AYWD 3B6FA 1P3OA 5AVBB 3X1VC 3WKJC 1M1AB 1KX3A 3REHD 2Y2KA 1ULYA 4WU8C 3AZHD 2G5IC 5CP6C 2RIQA 3AZIB 4HGAC 5AVCB 3H0RC 4J8UC 3MGPC 5B31B 2HIOA 4QLCB 4Z5TC 5B2JB 3MGSD 1Z2CB 5AV8C 2Y2PA 3W97A 1P34B 5B0YB 1P3GD 5DNMC 4XUJC 5G49B 2FJ7C 4H9PA 5CPJA 3WA9D 2NQBB 1P3LD 3RELD 1M18C 4WNNB 1P3MC 5GT3A 3KUYB 2PYOD 2NZDA 5DNNB 3AFAC 3AZMD 1BH9A 3X1SC 5F99A 3F6TA 5B40B 4Z66C 4J8WB 4WJ3C 4YS3D 3REJC 3V9RB 5AVBC 5BT1D 1M1AC 2BYKA 2DF4C 3MNNA 5AV9D 4WU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 C;  5AVC C;  3AZK D;  5GT0 A;  3LEL B;  3AZJ B;  2ARO A;  3VH6 A;  5B31 C;  4QLC C;  5B2J C;  4CAY B;  3X1V D;  1P3B B;  4H9Q B;  3WKJ D;  3REK C;  5E5A C;  3REH B;  5FUG A;  1P34 C;  2F8N K;  3REI C;  4WU8 D;  4J8X B;  4LD9 B;  3AN2 B;  3KXB C;  5CP6 D;  4XZQ A;  4J8U D;  3MGP D;  3AZL A;  2NQB C;  3X1U B;  4Z5T D;  3NQJ A;  3W96 A;  1S32 D;  3KUY C;  5B24 B;  5DNN C;  3WTP E;  1TAF A;  5DNM D;  3VH5 T;  5B40 C;  3B0B A;  4J8W C;  5CPK C;  2FJ7 D;  3AV2 A;  3B0C T;  2YFW A;  3LZ1 A;  3UTB A;  1P3P A;  5AV6 A;  5B33 B;  5BNV B;  3UT9 A;  4H9O A;  3WAA A;  5AY8 C;  3AFA D;  1F66 D;  3X1S D;  3AZM B;  4Z66 D;  3LEL C;  3REJ D;  5KDM B;  3C1B A;  3A6N C;  1P3F A;  5AVB D;  1P3B C;  4H9R B;  5JRG A;  1N1J A;  3REH C;  5BS7 C;  4J8X C;  4LD9 C;  5AV9 B;  3AN2 C;  4NE3 A;  4KHA B;  4YM6 C;  3W98 D;  5AVC D;  5BO0 A;  3X1U C;  4QLC D;  5B2J D;  3WTP C;  3X1V B;  3REK D;  5E5A D;  4ZUX A;  1P34 D;  5B1M A;  5B24 C;  3REI D;  5GT3 B;  3KXB D;  1P3I D;  1HQ3 C;  1BH9 B;  4KUD A;  5B33 C;  3KUY D;  1S32 B;  5DNN D;  3AZM C;  2BYK B;  3NQU B;  3MNN B;  5AV5 A;  4WU9 B;  4J8W D;  3AV1 D;  5CPK D;  4H9S C;  4WZS B;  5GT0 B;  5C3I B;  5B31 G;  2RVQ C;  1P3A A;  5B0Z A;  5AY8 D;  1F66 B;  4R8P A;  3MGR A;  1KX4 A;  1ID3 A;  5BNX B;  3LEL D;  4XZQ B;  5B1L D;  5CPJ C;  3A6N D;  1HTA A;  5GXQ A;  3AZL B;  1P3B D;  3KWQ D;  4J8X D;  4LD9 D;  3AN2 D;  5GT3 C;  2F8N D;  3W96 B;  4YM6 D;  4AWL B;  3W98 B;  3VH6 T;  1TAF B;  3X1U D;  5F99 C;  5B2I A;  3WTP D;  3REK B;  3LZ1 B;  2YFW B;  3LJA A;  5E5A B;  3UTB B;  3AZF A;  1S32 C;  5B24 D;  3REI B;  1P3P B;  3KXB B;  3UT9 B;  4H9O B;  2CV5 A;  1H3O B;  3MNN C;  1P3I B;  1HQ3 D;  4WU9 C;  3WAA B;  1U35 A;  5GT0 C;  5C3I C;  3C1C A;  5B33 D;  3B6F D;  3UTA A;  1P3O D;  4EO5 B;  1KX3 D;  1F66 C;  1N1J B;  4E44 A;  1R4V A;  4KGC A;  5CPK B;  3AV1 B;  4XZQ C;  2CWE A;  4J8V B;  3MGQ A;  3AZE A;  5BO0 B;  4WV4 B;  3AZL C;  3X1T A;  2RVQ D;  3O62 A;  4DRA A;  4CSR B;  5AY8 B;  1M19 A;  3W96 C;  5GSU A;  3W97 D;  4AWL C;  4M6B A;  5B1L B;  3AZN A;  5CPJ D;  5JA4 A;  3A6N B;  1BH8 B;  3LZ1 C;  3KWQ B;  3UTB C;  1P3P C;  1KX5 A;  3KSY A;  5GT3 D;  3TU4 A;  3UT9 C;  2F8N B;  3W99 A;  3WAA C;  4YM6 B;  1P3I C;  1WWS A;  5F99 D;  5AV8 A;  1ZLA A;  3WTP B;  3R45 B;  1AOI A;  4XUJ A;  3C1B C;  3B6G A;  4EO5 C;  1EQZ A;  5JRG C;  1M18 A;  1P3A B;  2IO5 B;  5B0Z B;  3MNN D;  4WU9 D;  1HQ3 B;  1P3M A;  3AZG A;  3AV1 C;  4J8V C;  4R8P B;  3MGR B;  1ID3 B;  4E45 A;  5GT0 D;  3B6F B;  5CHL B;  4X23 A;  1P3O B;  1KX3 B;  4ZUX C;  5B1M C;  1F1E A;  4H9N A;  1M1A A;  4XZQ D;  5B1L C;  3B0D B;  3AZL D;  1JFI A;  1B67 A;  3AZI A;  2HIO B;  3KWQ C;  5B31 A;  3W96 D;  3AZF B;  3W97 B;  5B0Y A;  5B32 A;  4H9P B;  4G91 B;  3AV2 D;  5CPJ B;  1U35 B;  3LZ1 D;  3UTB D;  1P3P D;  2NQB A;  3C1C B;  5CPI A;  3UT9 D;  5B0Z C;  2IO5 C;  3UTA B;  1P3A C;  3WAA D;  4WNN A;  2NZD B;  1WWI A;  1KU5 A;  4R8P C;  3MGR C;  5F99 B;  1ID3 C;  1Q9C A;  4KGC B;  4JJN A;  5B40 A;  3B6F C;  3C1B D;  3AZE B;  1P3F D;  1P3O C;  3MVD A;  5JRG D;  1KX3 C;  1A7W A;  5GSU B;  4J8V D;  1BFM A;  3LZ0 A;  3B0D C;  2ARO B;  2HIO C;  5B2I C;  1P3K A;  3AZN B;  1TZY A;  3AZJ A;  3AZF C;  4ZUX D;  3LJA C;  3AYW A;  3W97 C;  5FUG B;  5B1M D;  4CAY A;  4H9Q A;  3TU4 B;  2CV5 C;  3W99 B;  3REH A;  4J8X A;  4G91 C;  3AZH A;  3AN2 A;  1U35 C;  3VH5 W;  1AOI B;  3C1C C;  3NQJ B;  3UTA C;  2YFV A;  3B0C W;  3B6G B;  1EQZ B;  3MGS A;  2NZD C;  4KGC C;  5AV5 D;  1P3G A;  3AZG B;  3AV2 B;  3MGQ C;  4UUZ A;  3AZE C;  3X1T C;  3WA9 A;  1P3L A;  3REL A;  5AV6 B;  5B0Z D;  1P3A D;  1M19 C;  5GSU C;  4R8P D;  3MGR D;  1KX4 D;  1ID3 D;  4ZBJ B;  2PYO A;  4H9N B;  3AZM A;  2ARO C;  3AZN C;  3C1B B;  1P3F B;  5GXQ D;  1JFI B;  5JRG B;  4H9S A;  4YS3 A;  5KDM A;  1KX5 C;  4H9R A;  3TU4 C;  2F8N G;  3W99 C;  5AV9 A;  2L5A A;  2HIO D;  4KHA A;  5B2I D;  1ZLA C;  5B32 B;  3AZK A;  1AOI C;  2BYM A;  3AZF D;  3LJA D;  4ZUX B;  3B6G C;  5B1M B;  1EQZ C;  3X1V A;  3WKJ A;  5CPI B;  2CV5 D;  4WU8 A;  3AZG C;  1U35 D;  3AV2 C;  5CP6 A;  4J8U A;  3MGP A;  4KUD B;  3C1C D;  4JJN B;  5AV6 C;  3UTA D;  4Z5T A;  4X23 C;  4Z2M G;  3MVD B;  2NZD D;  1S32 A;  4ZBJ C;  4KGC D;  5AV5 B;  5DNM A;  3MGQ D;  3NQU A;  3AZE D;  3LZ0 B;  1P3F C;  2FJ7 A;  3X1T D;  2HUE B;  3AZI C;  1P3K B;  1TZY B;  3O62 D;  1M19 D;  5GSU D;  4G92 B;  3AYW B;  1KX4 B;  3AFA A;  1F66 A;  2ARO D;  3X1S A;  3AZN D;  5B0Y C;  5B32 C;  5BNX A;  4Z66 A;  3VH6 W;  3AZH B;  5GXQ B;  3REJ A;  1KX5 D;  5AVB A;  3TU4 D;  5CPI C;  2LY8 A;  3W99 D;  2YFV B;  3MGS B;  5AV8 D;  1ZLA D;  5B2I B;  3W98 A;  5AVC A;  1P3G B;  4KUD C;  1AOI D;  4XUJ D;  4JJN C;  4QLC A;  4UUZ B;  3B6G D;  3LJA B;  5B2J A;  3MVD C;  1EQZ D;  3WA9 B;  1M18 D;  1P3L B;  3REL B;  3REK A;  2CV5 B;  5E5A A;  1P34 A;  3REI A;  5AV5 C;  1P3M D;  3AZG D;  3KXB A;  1H3O A;  1P3I A;  5G49 A;  3LZ0 C;  2PYO B;  2HUE C;  1P3K C;  5AV6 D;  1TZY C;  4X23 D;  3AZJ C;  4G92 C;  3AYW C;  4YS3 B;  1KX4 C;  3KUY A;  1M1A D;  5DNN A;  4NE6 A;  2F8N H;  3MGQ B;  3AZH C;  5CPK A;  5GXQ C;  4J8W A;  3AV1 A;  3X1T B;  3AZI D;  4J8V A;  3O62 B;  3AZK B;  3V9R A;  5B31 D;  2BYM B;  1M19 B;  1B6W A;  3MGS C;  5AY8 A;  4CSR A;  3WKJ B;  5B0Y D;  5B32 D;  4WU8 B;  1P3G C;  5JA4 B;  3LEL A;  5CP6 B;  5B1L A;  4HGA B;  3VH5 A;  4J8U B;  3A6N A;  3MGP B;  2NQB D;  1KX5 B;  1P3B A;  3WA9 C;  1P3L C;  3REL C;  5CPI D;  1BH8 A;  3KWQ A;  4Z5T B;  5BS7 A;  4Z2M H;  4LD9 A;  2F8N A;  4NE5 A;  5AV8 B;  4YM6 A;  1ZLA B;  2PYO C;  4KUD D;  4NFT A;  3X1U A;  5DNM B;  4JJN D;  5B40 D;  4XUJ B;  3WTP A;  2FJ7 B;  3MVD D;  3R45 A;  4DRB A;  1M18 B;  4YS3 C;  5B24 A;  1P3M B;  5BT1 C;  3LZ0 D;  1HQ3 A;  5AV9 C;  2JSS A;  3AFA B;  3X1S B;  1P3K D;  5B32 G;  4Z66 B;  1TZY D;  3O62 C;  3AZK C;  4X23 B;  3AZJ D;  5B33 A;  5BNV A;  3REJ B;  3AYW D;  3B6F A;  1P3O A;  5AVB B;  3X1V C;  3WKJ C;  1M1A B;  1KX3 A;  3REH D;  1ULY A;  4WU8 C;  3AZH D;  5CP6 C;  3AZI B;  4HGA C;  5AVC B;  4J8U C;  3MGP C;  5B31 B;  2HIO A;  4QLC B;  4Z5T C;  5B2J B;  3MGS D;  5AV8 C;  3W97 A;  1P34 B;  5B0Y B;  1P3G D;  5DNM C;  4XUJ C;  5G49 B;  2FJ7 C;  4H9P A;  5CPJ A;  3WA9 D;  2NQB B;  1P3L D;  3REL D;  1M18 C;  4WNN B;  1P3M C;  5GT3 A;  3KUY B;  2PYO D;  2NZD A;  5DNN B;  3AFA C;  3AZM D;  1BH9 A;  3X1S C;  5F99 A;  5B40 B;  4Z66 C;  4J8W B;  4YS3 D;  3REJ C;  3V9R B;  5AVB C;  5BT1 D;  1M1A C;  2BYK A;  3MNN A;  5AV9 D;  4WU9 A; 
#chains in the Genus database with same CATH topology
 3W98 C;  5AVC C;  3AZK D;  5GT0 A;  3LEL B;  3AZJ B;  2ARO A;  3VH6 A;  5B31 C;  4QLC C;  5B2J C;  4CAY B;  3X1V D;  1P3B B;  4H9Q B;  3WKJ D;  3REK C;  3EPK A;  5E5A C;  3REH B;  5FUG A;  1P34 C;  2F8N K;  3REI C;  4WU8 D;  4J8X B;  4LD9 B;  3AN2 B;  2ZY4 A;  3KXB C;  5CP6 D;  4XZQ A;  4J8U D;  3MGP D;  3AZL A;  2NQB C;  3X1U B;  4Z5T D;  3A1K A;  3NQJ A;  3W96 A;  1S32 D;  3KUY C;  5B24 B;  5DNN C;  3WTP E;  1TAF A;  5DNM D;  3VH5 T;  5B40 C;  2ZY3 A;  3B0B A;  4J8W C;  5CPK C;  2FJ7 D;  3AV2 A;  3B0C T;  2YFW A;  3LZ1 A;  3UTB A;  1P3P A;  5AV6 A;  5B33 B;  5BNV B;  3UT9 A;  4H9O A;  3WAA A;  5AY8 C;  3AFA D;  1F66 D;  3X1S D;  3AZM B;  4Z66 D;  3LEL C;  3REJ D;  5KDM B;  3C1B A;  3A6N C;  1P3F A;  5AVB D;  1P3B C;  4H9R B;  5JRG A;  1N1J A;  3REH C;  5BS7 C;  4J8X C;  4LD9 C;  5AV9 B;  3AN2 C;  4NE3 A;  4KHA B;  4YM6 C;  3W98 D;  5AVC D;  5BO0 A;  3A1I A;  3X1U C;  4QLC D;  5B2J D;  3WTP C;  3FDD A;  3X1V B;  3REK D;  5E5A D;  4ZUX A;  1P34 D;  5B1M A;  2BG1 A;  5B24 C;  3REI D;  5GT3 B;  3KXB D;  1P3I D;  1HQ3 C;  1BH9 B;  4KUD A;  5B33 C;  3KUY D;  1S32 B;  5DNN D;  3AZM C;  2BYK B;  3NQU B;  3MNN B;  5AV5 A;  4WU9 B;  4J8W D;  3AV1 D;  5CPK D;  4H9S C;  4WZS B;  5GT0 B;  5C3I B;  5B31 G;  2RVQ C;  1P3A A;  5B0Z A;  5AY8 D;  1F66 B;  4R8P A;  3MGR A;  1KX4 A;  1ID3 A;  5BNX B;  3LEL D;  4XZQ B;  5B1L D;  5CPJ C;  3A6N D;  1HTA A;  5GXQ A;  3AZL B;  1P3B D;  3KWQ D;  4J8X D;  4LD9 D;  3AN2 D;  5GT3 C;  2F8N D;  3W96 B;  4YM6 D;  4AWL B;  3W98 B;  3VH6 T;  1TAF B;  3X1U D;  5F99 C;  5B2I A;  3WTP D;  3REK B;  3LZ1 B;  2YFW B;  3LJA A;  5E5A B;  3UTB B;  3AZF A;  1S32 C;  5B24 D;  3REI B;  2JCH A;  1P3P B;  3KXB B;  3UT9 B;  4H9O B;  2CV5 A;  1H3O B;  3MNN C;  1P3I B;  1HQ3 D;  4WU9 C;  3WAA B;  1U35 A;  2G5H C;  5GT0 C;  5C3I C;  3C1C A;  5B33 D;  3B6F D;  3UTA A;  1P3O D;  4EO5 B;  2Y2Q A;  1KX3 D;  1F66 C;  1N1J B;  4E44 A;  1R4V A;  3H0M C;  4KGC A;  5CPK B;  3AV1 B;  4XZQ C;  2CWE A;  4J8V B;  3MGQ A;  3AZE A;  5BO0 B;  4WV4 B;  3AZL C;  3X1T A;  2RVQ D;  3O62 A;  4DRA A;  4CSR B;  5AY8 B;  1M19 A;  3W96 C;  5GSU A;  3W97 D;  4AWL C;  4M6B A;  5B1L B;  3AZN A;  2Y2H A;  2Y2M A;  5CPJ D;  5JA4 A;  3A6N B;  1BH8 B;  3LZ1 C;  3KWQ B;  2XD5 A;  3EPL A;  3UTB C;  1P3P C;  1KX5 A;  3KSY A;  5GT3 D;  3TU4 A;  3UT9 C;  2F8N B;  3W99 A;  3WAA C;  4YM6 B;  2Y2O A;  1P3I C;  1WWS A;  5F99 D;  5AV8 A;  1ZLA A;  2Y2J A;  3WTP B;  3R45 B;  1AOI A;  4XUJ A;  3C1B C;  3B6G A;  4EO5 C;  1W2E A;  5JRG C;  1EQZ A;  1M18 A;  2VQR A;  1P3A B;  2IO5 B;  5B0Z B;  3MNN D;  4WU9 D;  1HQ3 B;  1P3M A;  3AZG A;  3AV1 C;  4J8V C;  4R8P B;  3MGR B;  1ID3 B;  4E45 A;  5GT0 D;  2FFF B;  3B6F B;  5CHL B;  2ZY5 A;  4X23 A;  1P3O B;  1KX3 B;  4ZUX C;  5B1M C;  1F1E A;  2Y2N A;  4H9N A;  1M1A A;  4XZQ D;  5B1L C;  2W8S A;  3B0D B;  3AZL D;  1JFI A;  1B67 A;  3AZI A;  2HIO B;  3KWQ C;  3KFU G;  5B31 A;  3W96 D;  3AZF B;  3W97 B;  5B0Y A;  5B32 A;  4H9P B;  4G91 B;  3AV2 D;  5CPJ B;  1U35 B;  1PZR A;  2Y2G A;  3LZ1 D;  3UTB D;  1P3P D;  2NQB A;  3C1C B;  5CPI A;  3UT9 D;  2IO5 C;  5B0Z C;  3UTA B;  1P3A C;  3WAA D;  2F2A C;  4WNN A;  2NZD B;  1WWI A;  1KU5 A;  4R8P C;  3MGR C;  5F99 B;  1ID3 C;  1Q9C A;  4KGC B;  2ZM5 A;  4JJN A;  5B40 A;  3B6F C;  3C1B D;  3AZE B;  1P3F D;  1P3O C;  3MVD A;  5JRG D;  1KX3 C;  2Y2L A;  1A7W A;  5GSU B;  4J8V D;  1BFM A;  3LZ0 A;  3B0D C;  2ARO B;  2HIO C;  5B2I C;  1P3K A;  3AZN B;  1TZY A;  3AZJ A;  2DQN C;  4ZUX D;  3LJA C;  3AYW A;  3AZF C;  5FUG B;  5B1M D;  4CAY A;  3W97 C;  4H9Q A;  3TU4 B;  2CV5 C;  3W99 B;  3REH A;  4J8X A;  4G91 C;  3AZH A;  3AN2 A;  1U35 C;  3VH5 W;  1AOI B;  3C1C C;  3NQJ B;  3UTA C;  2YFV A;  3B0C W;  3B6G B;  1EQZ B;  3MGS A;  2NZD C;  4KGC C;  5AV5 D;  2J8P A;  1P3G A;  3AZG B;  3AV2 B;  3MGQ C;  4UUZ A;  3AZE C;  3X1T C;  2ZY2 A;  3WA9 A;  1P3L A;  3REL A;  5AV6 B;  5B0Z D;  1P3A D;  1M19 C;  5GSU C;  4R8P D;  3MGR D;  1KX4 D;  1ID3 D;  4ZBJ B;  2PYO A;  4H9N B;  3AZM A;  2ARO C;  3H0L C;  3AZN C;  3P5J B;  3C1B B;  5GXQ D;  1P3F B;  1JFI B;  5JRG B;  3IP4 C;  4H9S A;  4YS3 A;  5KDM A;  1KX5 C;  4H9R A;  3TU4 C;  2F8N G;  3W99 C;  5AV9 A;  2L5A A;  2HIO D;  4KHA A;  5B2I D;  1ZLA C;  5B32 B;  3AZK A;  1AOI C;  2BYM A;  3AZF D;  3LJA D;  4ZUX B;  3B6G C;  5B1M B;  1EQZ C;  3X1V A;  3WKJ A;  5CPI B;  2CV5 D;  4WU8 A;  3AZG C;  1U35 D;  3AV2 C;  3EPH A;  5CP6 A;  4J8U A;  3MGP A;  4KUD B;  3C1C D;  4JJN B;  2UWX A;  5AV6 C;  3UTA D;  4Z5T A;  4X23 C;  4Z2M G;  3MVD B;  2NZD D;  1S32 A;  4ZBJ C;  4KGC D;  5AV5 B;  5DNM A;  3MGQ D;  3NQU A;  3AZE D;  3LZ0 B;  1P3F C;  2FJ7 A;  3X1T D;  2HUE B;  3AZI C;  1P3K B;  1TZY B;  3O62 D;  1M19 D;  2JE5 A;  5GSU D;  4G92 B;  3AYW B;  1KX4 B;  3AFA A;  1F66 A;  2ARO D;  3X1S A;  3AZN D;  5B0Y C;  5B32 C;  5BNX A;  4Z66 A;  3VH6 W;  3AZH B;  5GXQ B;  3REJ A;  1KX5 D;  5AVB A;  3TU4 D;  1T3U A;  2LY8 A;  5CPI C;  3W99 D;  2YFV B;  3MGS B;  2XD1 A;  5AV8 D;  1ZLA D;  5B2I B;  3W98 A;  5AVC A;  1P3G B;  4KUD C;  1AOI D;  4XUJ D;  4JJN C;  4QLC A;  4UUZ B;  3B6G D;  3LJA B;  5B2J A;  3EG5 B;  3MVD C;  1EQZ D;  3WA9 B;  1M18 D;  1P3L B;  3REL B;  3REK A;  2CV5 B;  5E5A A;  1P34 A;  3REI A;  5AV5 C;  1P3M D;  3AZG D;  3KXB A;  1H3O A;  1P3I A;  5G49 A;  3LZ0 C;  2PYO B;  2HUE C;  1P3K C;  5AV6 D;  1TZY C;  4X23 D;  3AZJ C;  4UPK A;  4G92 C;  3AYW C;  4YS3 B;  1KX4 C;  3KUY A;  1M1A D;  5DNN A;  2Y2I A;  4NE6 A;  2F8N H;  3MGQ B;  3AZH C;  5CPK A;  5GXQ C;  4J8W A;  3AV1 A;  4DQY B;  3AZI D;  4J8V A;  3X1T B;  3O62 B;  3AZK B;  3V9R A;  5B31 D;  2BYM B;  1M19 B;  1B6W A;  3MGS C;  5AY8 A;  4CSR A;  3WKJ B;  5B0Y D;  5B32 D;  4WU8 B;  1P3G C;  5JA4 B;  3LEL A;  5CP6 B;  5B1L A;  4HGA B;  3VH5 A;  4J8U B;  3A6N A;  3MGP B;  2NQB D;  1KX5 B;  1P3B A;  3WA9 C;  1P3L C;  3REL C;  5CPI D;  1BH8 A;  3KWQ A;  4Z5T B;  5BS7 A;  4Z2M H;  4LD9 A;  2F8N A;  4NE5 A;  5AV8 B;  4YM6 A;  1ZLA B;  2PYO C;  4KUD D;  4NFT A;  3X1U A;  5DNM B;  4JJN D;  5B40 D;  4XUJ B;  3WTP A;  2FJ7 B;  3MVD D;  3R45 A;  4DRB A;  1M18 B;  4YS3 C;  5B24 A;  1P3M B;  5BT1 C;  3LZ0 D;  1HQ3 A;  5AV9 C;  2JSS A;  3AFA B;  3X1S B;  3AL0 C;  1P3K D;  5B32 G;  4Z66 B;  1TZY D;  3EPJ A;  3O62 C;  3AZK C;  4X23 B;  3AZJ D;  5B33 A;  5BNV A;  3REJ B;  3AYW D;  3B6F A;  1P3O A;  5AVB B;  3X1V C;  3WKJ C;  1M1A B;  1KX3 A;  3REH D;  2Y2K A;  1ULY A;  4WU8 C;  3AZH D;  2G5I C;  5CP6 C;  2RIQ A;  3AZI B;  4HGA C;  5AVC B;  3H0R C;  4J8U C;  3MGP C;  5B31 B;  2HIO A;  4QLC B;  4Z5T C;  5B2J B;  3MGS D;  1Z2C B;  5AV8 C;  2Y2P A;  3W97 A;  1P34 B;  5B0Y B;  1P3G D;  5DNM C;  4XUJ C;  5G49 B;  2FJ7 C;  4H9P A;  5CPJ A;  3WA9 D;  2NQB B;  1P3L D;  3REL D;  1M18 C;  4WNN B;  1P3M C;  5GT3 A;  3KUY B;  2PYO D;  2NZD A;  5DNN B;  3AFA C;  3AZM D;  1BH9 A;  3X1S C;  5F99 A;  3F6T A;  5B40 B;  4Z66 C;  4J8W B;  4WJ3 C;  4YS3 D;  3REJ C;  3V9R B;  5AVB C;  5BT1 D;  1M1A C;  2BYK A;  2DF4 C;  3MNN A;  5AV9 D;  4WU9 A; 
#chains in the Genus database with same CATH homology
 3W98 C;  5AVC C;  3AZK D;  5GT0 A;  3LEL B;  3AZJ B;  2ARO A;  3VH6 A;  5B31 C;  4QLC C;  5B2J C;  4CAY B;  3X1V D;  1P3B B;  4H9Q B;  3WKJ D;  3REK C;  3EPK A;  5E5A C;  3REH B;  5FUG A;  1P34 C;  2F8N K;  3REI C;  4WU8 D;  4J8X B;  4LD9 B;  3AN2 B;  2ZY4 A;  3KXB C;  5CP6 D;  4XZQ A;  4J8U D;  3MGP D;  3AZL A;  2NQB C;  3X1U B;  4Z5T D;  3A1K A;  3NQJ A;  3W96 A;  1S32 D;  3KUY C;  5B24 B;  5DNN C;  3WTP E;  1TAF A;  5DNM D;  3VH5 T;  5B40 C;  2ZY3 A;  3B0B A;  4J8W C;  5CPK C;  2FJ7 D;  3AV2 A;  3B0C T;  2YFW A;  3LZ1 A;  3UTB A;  1P3P A;  5AV6 A;  5B33 B;  5BNV B;  3UT9 A;  4H9O A;  3WAA A;  5AY8 C;  3AFA D;  1F66 D;  3X1S D;  3AZM B;  4Z66 D;  3LEL C;  3REJ D;  5KDM B;  3C1B A;  3A6N C;  1P3F A;  5AVB D;  1P3B C;  4H9R B;  5JRG A;  1N1J A;  3REH C;  5BS7 C;  4J8X C;  4LD9 C;  5AV9 B;  3AN2 C;  4NE3 A;  4KHA B;  4YM6 C;  3W98 D;  5AVC D;  5BO0 A;  3A1I A;  3X1U C;  4QLC D;  5B2J D;  3WTP C;  3FDD A;  3X1V B;  3REK D;  5E5A D;  4ZUX A;  1P34 D;  5B1M A;  2BG1 A;  5B24 C;  3REI D;  5GT3 B;  3KXB D;  1P3I D;  1HQ3 C;  1BH9 B;  4KUD A;  5B33 C;  3KUY D;  1S32 B;  5DNN D;  3AZM C;  2BYK B;  3NQU B;  3MNN B;  5AV5 A;  4WU9 B;  4J8W D;  3AV1 D;  5CPK D;  4H9S C;  4WZS B;  5GT0 B;  5C3I B;  5B31 G;  2RVQ C;  1P3A A;  5B0Z A;  5AY8 D;  1F66 B;  4R8P A;  3MGR A;  1KX4 A;  1ID3 A;  5BNX B;  3LEL D;  4XZQ B;  5B1L D;  5CPJ C;  3A6N D;  1HTA A;  5GXQ A;  3AZL B;  1P3B D;  3KWQ D;  4J8X D;  4LD9 D;  3AN2 D;  5GT3 C;  2F8N D;  3W96 B;  4YM6 D;  4AWL B;  3W98 B;  3VH6 T;  1TAF B;  3X1U D;  5F99 C;  5B2I A;  3WTP D;  3REK B;  3LZ1 B;  2YFW B;  3LJA A;  5E5A B;  3UTB B;  3AZF A;  1S32 C;  5B24 D;  3REI B;  2JCH A;  1P3P B;  3KXB B;  3UT9 B;  4H9O B;  2CV5 A;  1H3O B;  3MNN C;  1P3I B;  1HQ3 D;  4WU9 C;  3WAA B;  1U35 A;  2G5H C;  5GT0 C;  5C3I C;  3C1C A;  5B33 D;  3B6F D;  3UTA A;  1P3O D;  4EO5 B;  2Y2Q A;  1KX3 D;  1F66 C;  1N1J B;  4E44 A;  1R4V A;  3H0M C;  4KGC A;  5CPK B;  3AV1 B;  4XZQ C;  2CWE A;  4J8V B;  3MGQ A;  3AZE A;  5BO0 B;  4WV4 B;  3AZL C;  3X1T A;  2RVQ D;  3O62 A;  4DRA A;  4CSR B;  5AY8 B;  1M19 A;  3W96 C;  5GSU A;  3W97 D;  4AWL C;  4M6B A;  5B1L B;  3AZN A;  2Y2H A;  2Y2M A;  5CPJ D;  5JA4 A;  3A6N B;  1BH8 B;  3LZ1 C;  3KWQ B;  2XD5 A;  3EPL A;  3UTB C;  1P3P C;  1KX5 A;  3KSY A;  5GT3 D;  3TU4 A;  3UT9 C;  2F8N B;  3W99 A;  3WAA C;  4YM6 B;  2Y2O A;  1P3I C;  1WWS A;  5F99 D;  5AV8 A;  1ZLA A;  2Y2J A;  3WTP B;  3R45 B;  1AOI A;  4XUJ A;  3C1B C;  3B6G A;  4EO5 C;  1W2E A;  5JRG C;  1EQZ A;  1M18 A;  2VQR A;  1P3A B;  2IO5 B;  5B0Z B;  3MNN D;  4WU9 D;  1HQ3 B;  1P3M A;  3AZG A;  3AV1 C;  4J8V C;  4R8P B;  3MGR B;  1ID3 B;  4E45 A;  5GT0 D;  2FFF B;  3B6F B;  5CHL B;  2ZY5 A;  4X23 A;  1P3O B;  1KX3 B;  4ZUX C;  5B1M C;  1F1E A;  2Y2N A;  4H9N A;  1M1A A;  4XZQ D;  5B1L C;  2W8S A;  3B0D B;  3AZL D;  1JFI A;  1B67 A;  3AZI A;  2HIO B;  3KWQ C;  3KFU G;  5B31 A;  3W96 D;  3AZF B;  3W97 B;  5B0Y A;  5B32 A;  4H9P B;  4G91 B;  3AV2 D;  5CPJ B;  1U35 B;  1PZR A;  2Y2G A;  3LZ1 D;  3UTB D;  1P3P D;  2NQB A;  3C1C B;  5CPI A;  3UT9 D;  2IO5 C;  5B0Z C;  3UTA B;  1P3A C;  3WAA D;  2F2A C;  4WNN A;  2NZD B;  1WWI A;  1KU5 A;  4R8P C;  3MGR C;  5F99 B;  1ID3 C;  1Q9C A;  4KGC B;  2ZM5 A;  4JJN A;  5B40 A;  3B6F C;  3C1B D;  3AZE B;  1P3F D;  1P3O C;  3MVD A;  5JRG D;  1KX3 C;  2Y2L A;  1A7W A;  5GSU B;  4J8V D;  1BFM A;  3LZ0 A;  3B0D C;  2ARO B;  2HIO C;  5B2I C;  1P3K A;  3AZN B;  1TZY A;  3AZJ A;  2DQN C;  4ZUX D;  3LJA C;  3AYW A;  3AZF C;  5FUG B;  5B1M D;  4CAY A;  3W97 C;  4H9Q A;  3TU4 B;  2CV5 C;  3W99 B;  3REH A;  4J8X A;  4G91 C;  3AZH A;  3AN2 A;  1U35 C;  3VH5 W;  1AOI B;  3C1C C;  3NQJ B;  3UTA C;  2YFV A;  3B0C W;  3B6G B;  1EQZ B;  3MGS A;  2NZD C;  4KGC C;  5AV5 D;  2J8P A;  1P3G A;  3AZG B;  3AV2 B;  3MGQ C;  4UUZ A;  3AZE C;  3X1T C;  2ZY2 A;  3WA9 A;  1P3L A;  3REL A;  5AV6 B;  5B0Z D;  1P3A D;  1M19 C;  5GSU C;  4R8P D;  3MGR D;  1KX4 D;  1ID3 D;  4ZBJ B;  2PYO A;  4H9N B;  3AZM A;  2ARO C;  3H0L C;  3AZN C;  3P5J B;  3C1B B;  5GXQ D;  1P3F B;  1JFI B;  5JRG B;  3IP4 C;  4H9S A;  4YS3 A;  5KDM A;  1KX5 C;  4H9R A;  3TU4 C;  2F8N G;  3W99 C;  5AV9 A;  2L5A A;  2HIO D;  4KHA A;  5B2I D;  1ZLA C;  5B32 B;  3AZK A;  1AOI C;  2BYM A;  3AZF D;  3LJA D;  4ZUX B;  3B6G C;  5B1M B;  1EQZ C;  3X1V A;  3WKJ A;  5CPI B;  2CV5 D;  4WU8 A;  3AZG C;  1U35 D;  3AV2 C;  3EPH A;  5CP6 A;  4J8U A;  3MGP A;  4KUD B;  3C1C D;  4JJN B;  2UWX A;  5AV6 C;  3UTA D;  4Z5T A;  4X23 C;  4Z2M G;  3MVD B;  2NZD D;  1S32 A;  4ZBJ C;  4KGC D;  5AV5 B;  5DNM A;  3MGQ D;  3NQU A;  3AZE D;  3LZ0 B;  1P3F C;  2FJ7 A;  3X1T D;  2HUE B;  3AZI C;  1P3K B;  1TZY B;  3O62 D;  1M19 D;  2JE5 A;  5GSU D;  4G92 B;  3AYW B;  1KX4 B;  3AFA A;  1F66 A;  2ARO D;  3X1S A;  3AZN D;  5B0Y C;  5B32 C;  5BNX A;  4Z66 A;  3VH6 W;  3AZH B;  5GXQ B;  3REJ A;  1KX5 D;  5AVB A;  3TU4 D;  1T3U A;  2LY8 A;  5CPI C;  3W99 D;  2YFV B;  3MGS B;  2XD1 A;  5AV8 D;  1ZLA D;  5B2I B;  3W98 A;  5AVC A;  1P3G B;  4KUD C;  1AOI D;  4XUJ D;  4JJN C;  4QLC A;  4UUZ B;  3B6G D;  3LJA B;  5B2J A;  3EG5 B;  3MVD C;  1EQZ D;  3WA9 B;  1M18 D;  1P3L B;  3REL B;  3REK A;  2CV5 B;  5E5A A;  1P34 A;  3REI A;  5AV5 C;  1P3M D;  3AZG D;  3KXB A;  1H3O A;  1P3I A;  5G49 A;  3LZ0 C;  2PYO B;  2HUE C;  1P3K C;  5AV6 D;  1TZY C;  4X23 D;  3AZJ C;  4UPK A;  4G92 C;  3AYW C;  4YS3 B;  1KX4 C;  3KUY A;  1M1A D;  5DNN A;  2Y2I A;  4NE6 A;  2F8N H;  3MGQ B;  3AZH C;  5CPK A;  5GXQ C;  4J8W A;  3AV1 A;  4DQY B;  3AZI D;  4J8V A;  3X1T B;  3O62 B;  3AZK B;  3V9R A;  5B31 D;  2BYM B;  1M19 B;  1B6W A;  3MGS C;  5AY8 A;  4CSR A;  3WKJ B;  5B0Y D;  5B32 D;  4WU8 B;  1P3G C;  5JA4 B;  3LEL A;  5CP6 B;  5B1L A;  4HGA B;  3VH5 A;  4J8U B;  3A6N A;  3MGP B;  2NQB D;  1KX5 B;  1P3B A;  3WA9 C;  1P3L C;  3REL C;  5CPI D;  1BH8 A;  3KWQ A;  4Z5T B;  5BS7 A;  4Z2M H;  4LD9 A;  2F8N A;  4NE5 A;  5AV8 B;  4YM6 A;  1ZLA B;  2PYO C;  4KUD D;  4NFT A;  3X1U A;  5DNM B;  4JJN D;  5B40 D;  4XUJ B;  3WTP A;  2FJ7 B;  3MVD D;  3R45 A;  4DRB A;  1M18 B;  4YS3 C;  5B24 A;  1P3M B;  5BT1 C;  3LZ0 D;  1HQ3 A;  5AV9 C;  2JSS A;  3AFA B;  3X1S B;  3AL0 C;  1P3K D;  5B32 G;  4Z66 B;  1TZY D;  3EPJ A;  3O62 C;  3AZK C;  4X23 B;  3AZJ D;  5B33 A;  5BNV A;  3REJ B;  3AYW D;  3B6F A;  1P3O A;  5AVB B;  3X1V C;  3WKJ C;  1M1A B;  1KX3 A;  3REH D;  2Y2K A;  1ULY A;  4WU8 C;  3AZH D;  2G5I C;  5CP6 C;  2RIQ A;  3AZI B;  4HGA C;  5AVC B;  3H0R C;  4J8U C;  3MGP C;  5B31 B;  2HIO A;  4QLC B;  4Z5T C;  5B2J B;  3MGS D;  1Z2C B;  5AV8 C;  2Y2P A;  3W97 A;  1P34 B;  5B0Y B;  1P3G D;  5DNM C;  4XUJ C;  5G49 B;  2FJ7 C;  4H9P A;  5CPJ A;  3WA9 D;  2NQB B;  1P3L D;  3REL D;  1M18 C;  4WNN B;  1P3M C;  5GT3 A;  3KUY B;  2PYO D;  2NZD A;  5DNN B;  3AFA C;  3AZM D;  1BH9 A;  3X1S C;  5F99 A;  3F6T A;  5B40 B;  4Z66 C;  4J8W B;  4WJ3 C;  4YS3 D;  3REJ C;  3V9R B;  5AVB C;  5BT1 D;  1M1A C;  2BYK A;  2DF4 C;  3MNN A;  5AV9 D;  4WU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...