4WU9A

Structure of cisptnap-ncp145
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu9A00
3AZLB 5B32G 5CPIA 5AV6B 3W97C 4XUJA 1P3FD 4ZBJB 3WAAC 3REIC 4E45A 3A6NA 2BYKA 3AZHD 3UTBC 3AV1D 1KX3A 5BO0B 4YM6D 5B1MC 3AV2A 3AZIB 1B67A 5AY8D 5B2IC 3AZMA 1P3KC 5CPJC 5AVBB 1AOIA 3WA9C 5F99B 5B2JA 3WKJC 5B33A 4XZQC 4H9PB 3W97B 4KHAA 1HTAA 3AZJD 1P3GD 3B0DC 5AVCC 5CPKD 1P3OC 4KUDB 5CPIC 3UTBB 3X1UD 3KXBD 3W96D 5CP6D 3A6NC 1EQZC 5DNMC 5B0YA 3LELD 5G49A 3RELA 1P3KB 5CPJB 3AV2C 3WKJB 1P3BD 1P3ID 2RVQD 2CV5D 2FJ7B 5B24D 3AZMC 1AOIC 5B2JC 5B33C 5B1LB 5CPIB 2PYOA 4XUJB 3A6NB 2BYKB 2BYMA 1KX3B 3X1SD 3REKD 5AV5A 3X1TC 3MGSA 3MGRA 3AV2B 3WTPE 5B0YC 2L5AA 3LJAD 3RELC 3AZMB 5JRGA 3REJA 4J8VD 5AV8D 4X23D 3MNNA 3LZ0A 3WTPA 4Z5TC 3B6FB 3UTAD 3MVDB 4JJNA 5B31D 5B0YB 4Z66D 5G49B 3RELB 5AV5C 3MGSC 3AN2A 3AZED 2NZDA 4HGAC 4ZUXD 5B0ZD 3REJC 4UUZA 4H9NA 3MNNC 4KGCC 2PYOB 1F66A 5GXQC 3KWQD 5BT1D 3TU4A 5GT0D 2BYMB 4LD9A 4J8XB 3MGRB 4JJNC 1M1AA 1TZYA 3KUYA 5JRGB 3REJB 4WU9C 4J8WD 1P3AD 5AV9A 1M19A 3LZ0B 5B32D 4M6BA 2F8NA 3AZGD 3WTPB 3AYWC 1P3MA 4JJNB 3WAAA 4NE5A 3TU4C 3REIA 3UT9D 3VH6T 3W99D 2YFWA 4LD9C 3AN2B 2NZDB 1BH8A 1U35C 1M1AC 5B1MA 5E5AC 3NQUA 1TZYC 4E44A 5BS7A 4J8UD 1ID3D 3NQJA 4UUZB 4H9NB 3AZLD 3WA9A 5AV9C 3V9RA 2AROD 1F66B 4XZQA 3LZ1D 3AV1A 1N1JA 3AFAB 3B0CT 5AVCA 4R8PD 1P3OA 3AZKC 1P3MC 3O62A 3C1CB 3AZID 1M1AB 5B40B 1TZYB 3KUYB 1EQZA 5DNMA 5BNXA 3AZJA 5AV9B 5BS7C 1P3GA 1M19B 1P3FC 2F8NB 4KUDD 3W96A 3X1UA 5CP6A 4QLCD 3AZFB 3W98D 1P3MB 3LELA 2YFVA 3AV1C 2HIOD 3WAAB 1A7WA 1KU5A 4CSRB 3REIB 1KX5D 5AY8C 3X1VD 1P3IA 1P3BA 2NQBD 2CV5A 3O62C 1BH8B 5B1MB 3X1TA 3NQUB 2FJ7D 4WV4B 5C3IC 5B2IB 4WU8D 3WA9B 5B1LD 3AZJC 1P3GC 4YS3D 5CPKC 4XUJD 3VH6W 4XZQB 3C1BD 3AV1B 1N1JB 3A6ND 3REKA 3W96C 3X1UC 3VH5T 5CP6C 3KXBC 3B0DB 5AVCB 1P3OB 1KX3D 3LELC 3O62B 1B6WA 4Z5TA 4J8VA 5GSUD 1P34D 1P3IC 1P3BC 5DNMB 1EQZB 2CV5C 1ZLAD 1BH9A 4EO5C 3B6GD 5BNXB 1S32A 4G92C 3AZJB 1P3GB 3AZND 3B0CW 1AOIB 3W96B 5B2JB 5B33B 1P3PA 2LY8A 5B31A 3B6FD 3LELB 2YFVB 4KGCA 4Z66A 3REKC 3X1SC 3MVDD 4KHAB 5GXQA 3AZEA 1P3IB 1P3BB 4ZUXA 2CV5B 1WWIA 4EO5B 3LJAC 5B0ZA 1ULYA 3X1TB 4G92B 4J8VC 5AV8C 4X23C 1S32C 4WU9A 3MGPD 2PYOD 3REKB 1WWSA 1P3PC 4H9QA 3UTAC 5B31C 4J8XD 4Z66C 4Z5TB 3MGRD 3MGQA 3AYWA 3AZEC 4J8VB 1KX4D 5JRGD 4ZUXC 4J8WA 1P3AA 1BH9B 5B0ZC 2IO5C 3REHA 5AV5B 4CAYA 3MGSB 1S32B 1U35A 4HGAB 3LZ0D 5E5AA 1P3LD 3R45A 5DNND 3WTPD 1P3PB 3MNNB 5BT1C 5B31B 5GT0C 4KGCB 1HQ3D 5GXQB 1M18D 3AZEB 4ZUXB 3AN2D 3B0BA 4G91C 1ID3A 3MGQC 5B0ZB 3AZKA 2IO5B 2NZDD 4J8WC 1P3AC 3AZLA 4WZSB 3REHC 2AROA 5B32C 4WU9B 5GT3D 3LZ1A 1F66D 3AZGC 4R8PA 1Q9CA 3AFAD 4H9QB 1P3FA 3UT9C 4G91B 5AV6D 3C1CD 4Z2MG 3MGQB 3W99C 1BFMA 5B40D 3AZHA 4H9SA 3AYWB 3KUYD 4J8WB 4WNNA 4YM6A 1P3AB 3TU4B 4J8UC 4H9OA 5AY8A 1H3OA 4H9PA 3REHB 1ID3C 4LD9B 4CAYB 1U35B 1M19D 3AZLC 5E5AB 4QLCA 5AVBD 2AROC 3R45B 4ZBJC 5F99D 3LZ1C 3W98A 3AZFD 2HIOA 4R8PC 5CPKA 1KX5A 3W97D 3X1VA 2NQBA 3WAAD 3REID 3AZIC 3KXBA 2FJ7A 5BNVA 3UTBD 1ID3B 3AZKB 3AZHC 4H9SC 5B1MD 4WU8A 5B2ID 4YM6C 5B1LA 4YS3A 1P3KD 2YFWB 5CPJD 2AROB 3WA9D 5B24A 3LZ1B 3C1BA 3WKJD 4KUDC 1TAFA 4QLCC 4XZQD 4R8PB 3NQJB 3W98C 4Z2MH 5AVCD 1P3OD 2HIOC 1P3FB 5CPID 4NE3A 3V9RB 3O62D 1KX5C 5GSUA 3X1VC 1P34A 1ZLAA 5CHLB 2F8NG 3AZHB 2NQBC 3VH6A 3X1SA 1EQZD 4WNNB 5DNMD 4YM6B 2FJ7C 3B6GA 4H9OB 5AY8B 1H3OB 3AZNA 4WU8C 3LJAA 3AV2D 3KSYA 5B1LC 4YS3C 4QLCB 5AV8A 5KDMA 5C3IB 4XUJC 2RVQC 4X23A 3AZMD 1AOID 5B24C 3W98B 3B6FA 5B2JD 5FUGA 3C1BC 5B33D 2HIOB 3MVDA 5CPKB 1KX3C 1KX5B 3X1VB 2NQBB 3X1UB 3KXBB 5CP6B 5BNVB 5GSUC 2CWEA 3UTAA 1P34C 1JFIA 1ZLAC 4WU8B 3X1TD 3B6GC 5B0YD 3AZNC 4YS3B 3RELD 3MGPA 5B24B 3C1BB 1TAFB 3B6FC 4J8XA 2F8NH 3MVDC 3KWQA 4Z5TD 1R4VA 4H9RA 5GSUB 1P34B 1KX4A 1ZLAB 5GT0A 4NFTA 3B6GB 3X1SB 2F8NK 3AZNB 4DRBA 5AV5D 3MGSD 1S32D 1P3LA 3LJAB 5JA4A 5DNNA 5AV8B 5KDMB 3MGPC 2PYOC 4X23B 3REJD 5FUGB 1P3PD 1HQ3A 5B32A 3MNND 1M18A 3VH5W 4KGCD 3AZGA 5GXQD 4J8XC 3VH5A 3MGRC 3KWQC 2JSSA 3UTAB 1KX4C 5JRGC 1JFIB 3UT9A 4Z66B 3W99A 4JJND 5GT3A 3MGPB 3LZ0C 4WU9D 1P3LC 4J8UA 3AFAA 5DNNC 3WTPC 5AV6A 3C1CA 1HQ3C 5B40A 1M18C 3KWQB 4H9RB 4NE6A 3MGQD 1KX4B 3AN2C 5GT0B 3AYWD 2NZDC 5BO0A 2HUEC 3TU4D 5B31G 3AZIA 4AWLC 3REHD 4LD9D 1P3LB 5JA4B 1U35D 5AVBA 1M1AD 5F99A 5E5AD 5GT3C 1TZYD 5DNNB 3AZFA 1F66C 1F1EA 3W97A 3AFAC 1HQ3B 5B32B 1M18B 5AV9D 4CSRA 4KUDA 3AZGB 5AV6C 3C1CC 3UTBA 2F8ND 5B40C 2HUEB 3KUYC 5B2IA 4DRAA 4AWLB 3AZKD 1P3MD 3UT9B 1P3KA 3W99B 5CPJA 5GT3B 3WKJA 1M19C 4J8UB 5AVBC 5F99C 3AZFC
chains in the Genus database with same CATH superfamily
3AZLB 5B32G 5CPIA 5AV6B 3W97C 4XUJA 1P3FD 4ZBJB 3WAAC 3REIC 4E45A 3A6NA 2BYKA 3AZHD 3UTBC 3AV1D 1KX3A 5BO0B 4YM6D 5B1MC 3AV2A 3AZIB 1B67A 5AY8D 5B2IC 3AZMA 1P3KC 5CPJC 5AVBB 1AOIA 3WA9C 5F99B 1W2EA 5B2JA 3WKJC 5B33A 2G5HC 2Y2MA 4XZQC 4H9PB 3W97B 4KHAA 1HTAA 3AZJD 1P3GD 3B0DC 5AVCC 5CPKD 1P3OC 4KUDB 3F6TA 5CPIC 3UTBB 3X1UD 3KXBD 3W96D 5CP6D 3A6NC 1EQZC 5DNMC 5B0YA 3LELD 5G49A 3RELA 1P3KB 5CPJB 3AV2C 3WKJB 1P3BD 1P3ID 2RVQD 2CV5D 2FJ7B 5B24D 3AZMC 1AOIC 3AL0C 5B2JC 5B33C 5B1LB 5CPIB 2PYOA 4XUJB 4WJ3C 3A6NB 2BYKB 2BYMA 1KX3B 2XD5A 3X1SD 3REKD 5AV5A 3X1TC 3MGSA 3MGRA 3AV2B 3WTPE 5B0YC 2L5AA 3LJAD 3RELC 3AZMB 5JRGA 3REJA 4J8VD 5AV8D 4X23D 3MNNA 3LZ0A 3WTPA 4Z5TC 3B6FB 3UTAD 3MVDB 4JJNA 5B31D 5B0YB 4Z66D 5G49B 3RELB 5AV5C 3MGSC 3AN2A 3AZED 2NZDA 4HGAC 4ZUXD 5B0ZD 2ZY5A 3REJC 4UUZA 4H9NA 3MNNC 4KGCC 2PYOB 1F66A 5GXQC 3KWQD 5BT1D 3TU4A 5GT0D 2BYMB 2ZM5A 4LD9A 4J8XB 3MGRB 4JJNC 1M1AA 2Y2JA 1TZYA 3KUYA 5JRGB 3REJB 4WU9C 4J8WD 1P3AD 3H0MC 5AV9A 1M19A 3LZ0B 5B32D 4M6BA 2F8NA 3AZGD 3WTPB 3AYWC 1P3MA 3H0RC 4JJNB 3WAAA 4NE5A 3TU4C 3REIA 3UT9D 3VH6T 3W99D 2YFWA 4LD9C 3AN2B 2NZDB 1BH8A 1U35C 1M1AC 5B1MA 5E5AC 3NQUA 1TZYC 4E44A 5BS7A 4J8UD 1ID3D 3NQJA 4UUZB 4H9NB 3AZLD 3WA9A 3KFUG 5AV9C 3V9RA 2AROD 1F66B 4XZQA 3LZ1D 2JCHA 3AV1A 1N1JA 3AFAB 3B0CT 5AVCA 4R8PD 1P3OA 3AZKC 1P3MC 3O62A 3C1CB 2VQRA 3AZID 1M1AB 5B40B 1TZYB 3KUYB 1EQZA 5DNMA 5BNXA 3AZJA 5AV9B 5BS7C 1P3GA 1M19B 4UPKA 1P3FC 2F8NB 2Y2QA 4KUDD 3W96A 3X1UA 5CP6A 4QLCD 3AZFB 3W98D 1P3MB 3LELA 2YFVA 3AV1C 2HIOD 3WAAB 1A7WA 1KU5A 4CSRB 3REIB 1KX5D 5AY8C 3X1VD 1P3IA 1P3BA 2NQBD 2CV5A 3O62C 1BH8B 5B1MB 3X1TA 3NQUB 2FJ7D 4WV4B 5C3IC 5B2IB 4WU8D 2FFFB 3WA9B 5B1LD 3AZJC 2Y2LA 1P3GC 4YS3D 5CPKC 4XUJD 3VH6W 4XZQB 3C1BD 3AV1B 1N1JB 3A6ND 3REKA 3W96C 3X1UC 3VH5T 5CP6C 3KXBC 3B0DB 5AVCB 1P3OB 1KX3D 3LELC 3O62B 1B6WA 4Z5TA 4J8VA 2RIQA 5GSUD 1P34D 2Y2NA 5DNMB 1P3IC 2CV5C 1P3BC 1EQZB 1ZLAD 1BH9A 4EO5C 3B6GD 2F2AC 5BNXB 1S32A 4G92C 3AZJB 1P3GB 3AZND 3B0CW 3IP4C 1AOIB 3W96B 5B2JB 5B33B 1P3PA 2W8SA 2LY8A 5B31A 3B6FD 3LELB 2YFVB 4KGCA 4Z66A 3REKC 3X1SC 3MVDD 4KHAB 5GXQA 3AZEA 1P3IB 1P3BB 4ZUXA 2CV5B 1WWIA 4EO5B 3LJAC 5B0ZA 1ULYA 3X1TB 4G92B 4J8VC 5AV8C 2DQNC 4X23C 2Y2GA 1S32C 4WU9A 3MGPD 4DQYB 2PYOD 3EG5B 3REKB 1WWSA 1P3PC 4H9QA 3UTAC 5B31C 4J8XD 4Z66C 4Z5TB 3MGRD 3MGQA 2ZY2A 3EPJA 3AYWA 3AZEC 4J8VB 1KX4D 5JRGD 4ZUXC 4J8WA 1P3AA 1BH9B 5B0ZC 2IO5C 3REHA 5AV5B 4CAYA 3MGSB 1S32B 1U35A 3FDDA 4HGAB 3LZ0D 2Y2KA 5E5AA 1P3LD 3R45A 5DNND 3WTPD 1P3PB 3MNNB 5BT1C 5B31B 5GT0C 4KGCB 1HQ3D 5GXQB 1M18D 3AZEB 4ZUXB 2Y2IA 3AN2D 3B0BA 4G91C 1ID3A 3MGQC 5B0ZB 3AZKA 2IO5B 2NZDD 4J8WC 1P3AC 3AZLA 4WZSB 3REHC 2AROA 5B32C 4WU9B 5GT3D 3LZ1A 1F66D 3AZGC 4R8PA 1Q9CA 3AFAD 4H9QB 1P3FA 3UT9C 4G91B 5AV6D 3C1CD 4Z2MG 3MGQB 3W99C 1BFMA 5B40D 3AZHA 3H0LC 4H9SA 3AYWB 3KUYD 4J8WB 4WNNA 4YM6A 1P3AB 3TU4B 4J8UC 4H9OA 5AY8A 1H3OA 4H9PA 3REHB 1ID3C 2BG1A 4LD9B 4CAYB 1U35B 1M19D 3AZLC 5E5AB 4QLCA 5AVBD 2AROC 3R45B 4ZBJC 5F99D 3LZ1C 3W98A 3AZFD 2HIOA 4R8PC 5CPKA 1T3UA 1KX5A 1PZRA 3W97D 3X1VA 2NQBA 3WAAD 3REID 3AZIC 3KXBA 2FJ7A 5BNVA 3UTBD 1ID3B 3AZKB 3AZHC 4H9SC 5B1MD 4WU8A 2DF4C 5B2ID 4YM6C 5B1LA 4YS3A 1P3KD 2YFWB 5CPJD 2AROB 3WA9D 5B24A 3LZ1B 3C1BA 3WKJD 4KUDC 1TAFA 4QLCC 4XZQD 4R8PB 2J8PA 3NQJB 3W98C 4Z2MH 5AVCD 1P3OD 3A1KA 2HIOC 1P3FB 5CPID 4NE3A 3V9RB 3O62D 1KX5C 5GSUA 3X1VC 1P34A 1ZLAA 5CHLB 2F8NG 3AZHB 2NQBC 3EPLA 3VH6A 3X1SA 1EQZD 4WNNB 5DNMD 4YM6B 2FJ7C 3B6GA 3EPHA 4H9OB 5AY8B 1H3OB 3AZNA 4WU8C 1Z2CB 3LJAA 3AV2D 3KSYA 5B1LC 4YS3C 4QLCB 5AV8A 5KDMA 5C3IB 4XUJC 2RVQC 4X23A 3AZMD 1AOID 5B24C 3W98B 3B6FA 5B2JD 5FUGA 3C1BC 5B33D 2HIOB 3MVDA 5CPKB 1KX3C 1KX5B 3X1VB 2NQBB 3X1UB 3KXBB 5CP6B 5BNVB 5GSUC 2CWEA 3UTAA 1P34C 1JFIA 1ZLAC 4WU8B 3X1TD 3B6GC 5B0YD 3AZNC 4YS3B 3RELD 3MGPA 5B24B 3C1BB 1TAFB 3B6FC 4J8XA 2F8NH 3MVDC 2Y2HA 3KWQA 4Z5TD 1R4VA 4H9RA 5GSUB 1P34B 2Y2OA 1KX4A 1ZLAB 5GT0A 4NFTA 3B6GB 3X1SB 2F8NK 3AZNB 4DRBA 5AV5D 3MGSD 1S32D 1P3LA 3LJAB 5JA4A 5DNNA 5AV8B 5KDMB 3MGPC 2PYOC 4X23B 3REJD 5FUGB 1P3PD 1HQ3A 5B32A 3EPKA 3MNND 1M18A 3VH5W 4KGCD 3AZGA 2UWXA 5GXQD 4J8XC 3VH5A 3MGRC 3KWQC 2JSSA 3UTAB 1KX4C 5JRGC 1JFIB 3UT9A 4Z66B 3W99A 4JJND 5GT3A 3MGPB 3LZ0C 2ZY4A 4WU9D 2JE5A 1P3LC 4J8UA 3AFAA 5DNNC 3WTPC 5AV6A 3C1CA 3A1IA 1HQ3C 5B40A 1M18C 3KWQB 4H9RB 4NE6A 3MGQD 1KX4B 2Y2PA 3AN2C 5GT0B 3AYWD 2NZDC 2ZY3A 3P5JB 5BO0A 2HUEC 3TU4D 5B31G 3AZIA 4AWLC 3REHD 4LD9D 1P3LB 5JA4B 1U35D 5AVBA 1M1AD 5F99A 5E5AD 5GT3C 1TZYD 5DNNB 3AZFA 1F66C 1F1EA 3W97A 3AFAC 1HQ3B 5B32B 1M18B 5AV9D 4CSRA 4KUDA 3AZGB 5AV6C 3C1CC 3UTBA 2F8ND 5B40C 2HUEB 3KUYC 2G5IC 4DRAA 5B2IA 4AWLB 3AZKD 1P3MD 3UT9B 1P3KA 3W99B 5CPJA 5GT3B 2XD1A 3WKJA 1M19C 4J8UB 5AVBC 5F99C 3AZFC
chains in the Genus database with same CATH topology
3AZLB 5B32G 5CPIA 5AV6B 3W97C 4XUJA 1P3FD 4ZBJB 3WAAC 3REIC 4E45A 3A6NA 2BYKA 3AZHD 3UTBC 3AV1D 1KX3A 5BO0B 4YM6D 5B1MC 3AV2A 3AZIB 1B67A 5AY8D 5B2IC 3AZMA 1P3KC 5CPJC 5AVBB 1AOIA 3WA9C 5F99B 1W2EA 5B2JA 3WKJC 5B33A 2G5HC 2Y2MA 4XZQC 4H9PB 3W97B 4KHAA 1HTAA 3AZJD 1P3GD 3B0DC 5AVCC 5CPKD 1P3OC 4KUDB 3F6TA 5CPIC 3UTBB 3X1UD 3KXBD 3W96D 5CP6D 3A6NC 1EQZC 5DNMC 5B0YA 3LELD 5G49A 3RELA 1P3KB 5CPJB 3AV2C 3WKJB 1P3BD 1P3ID 2RVQD 2CV5D 2FJ7B 5B24D 3AZMC 1AOIC 3AL0C 5B2JC 5B33C 5B1LB 5CPIB 2PYOA 4XUJB 4WJ3C 3A6NB 2BYKB 2BYMA 1KX3B 2XD5A 3X1SD 3REKD 5AV5A 3X1TC 3MGSA 3MGRA 3AV2B 3WTPE 5B0YC 2L5AA 3LJAD 3RELC 3AZMB 5JRGA 3REJA 4J8VD 5AV8D 4X23D 3MNNA 3LZ0A 3WTPA 4Z5TC 3B6FB 3UTAD 3MVDB 4JJNA 5B31D 5B0YB 4Z66D 5G49B 3RELB 5AV5C 3MGSC 3AN2A 3AZED 2NZDA 4HGAC 4ZUXD 5B0ZD 2ZY5A 3REJC 4UUZA 4H9NA 3MNNC 4KGCC 2PYOB 1F66A 5GXQC 3KWQD 5BT1D 3TU4A 5GT0D 2BYMB 2ZM5A 4LD9A 4J8XB 3MGRB 4JJNC 1M1AA 2Y2JA 1TZYA 3KUYA 5JRGB 3REJB 4WU9C 4J8WD 1P3AD 3H0MC 5AV9A 1M19A 3LZ0B 5B32D 4M6BA 2F8NA 3AZGD 3WTPB 3AYWC 1P3MA 3H0RC 4JJNB 3WAAA 4NE5A 3TU4C 3REIA 3UT9D 3VH6T 3W99D 2YFWA 4LD9C 3AN2B 2NZDB 1BH8A 1U35C 1M1AC 5B1MA 5E5AC 3NQUA 1TZYC 4E44A 5BS7A 4J8UD 1ID3D 3NQJA 4UUZB 4H9NB 3AZLD 3WA9A 3KFUG 5AV9C 3V9RA 2AROD 1F66B 4XZQA 3LZ1D 2JCHA 3AV1A 1N1JA 3AFAB 3B0CT 5AVCA 4R8PD 1P3OA 3AZKC 1P3MC 3O62A 3C1CB 2VQRA 3AZID 1M1AB 5B40B 1TZYB 3KUYB 1EQZA 5DNMA 5BNXA 3AZJA 5AV9B 5BS7C 1P3GA 1M19B 4UPKA 1P3FC 2F8NB 2Y2QA 4KUDD 3W96A 3X1UA 5CP6A 4QLCD 3AZFB 3W98D 1P3MB 3LELA 2YFVA 3AV1C 2HIOD 3WAAB 1A7WA 1KU5A 4CSRB 3REIB 1KX5D 5AY8C 3X1VD 1P3IA 1P3BA 2NQBD 2CV5A 3O62C 1BH8B 5B1MB 3X1TA 3NQUB 2FJ7D 4WV4B 5C3IC 5B2IB 4WU8D 2FFFB 3WA9B 5B1LD 3AZJC 2Y2LA 1P3GC 4YS3D 5CPKC 4XUJD 3VH6W 4XZQB 3C1BD 3AV1B 1N1JB 3A6ND 3REKA 3W96C 3X1UC 3VH5T 5CP6C 3KXBC 3B0DB 5AVCB 1P3OB 1KX3D 3LELC 3O62B 1B6WA 4Z5TA 4J8VA 2RIQA 5GSUD 1P34D 2Y2NA 5DNMB 1P3IC 2CV5C 1P3BC 1EQZB 1ZLAD 1BH9A 4EO5C 3B6GD 2F2AC 5BNXB 1S32A 4G92C 3AZJB 1P3GB 3AZND 3B0CW 3IP4C 1AOIB 3W96B 5B2JB 5B33B 1P3PA 2W8SA 2LY8A 5B31A 3B6FD 3LELB 2YFVB 4KGCA 4Z66A 3REKC 3X1SC 3MVDD 4KHAB 5GXQA 3AZEA 1P3IB 1P3BB 4ZUXA 2CV5B 1WWIA 4EO5B 3LJAC 5B0ZA 1ULYA 3X1TB 4G92B 4J8VC 5AV8C 2DQNC 4X23C 2Y2GA 1S32C 4WU9A 3MGPD 4DQYB 2PYOD 3EG5B 3REKB 1WWSA 1P3PC 4H9QA 3UTAC 5B31C 4J8XD 4Z66C 4Z5TB 3MGRD 3MGQA 2ZY2A 3EPJA 3AYWA 3AZEC 4J8VB 1KX4D 5JRGD 4ZUXC 4J8WA 1P3AA 1BH9B 5B0ZC 2IO5C 3REHA 5AV5B 4CAYA 3MGSB 1S32B 1U35A 3FDDA 4HGAB 3LZ0D 2Y2KA 5E5AA 1P3LD 3R45A 5DNND 3WTPD 1P3PB 3MNNB 5BT1C 5B31B 5GT0C 4KGCB 1HQ3D 5GXQB 1M18D 3AZEB 4ZUXB 2Y2IA 3AN2D 3B0BA 4G91C 1ID3A 3MGQC 5B0ZB 3AZKA 2IO5B 2NZDD 4J8WC 1P3AC 3AZLA 4WZSB 3REHC 2AROA 5B32C 4WU9B 5GT3D 3LZ1A 1F66D 3AZGC 4R8PA 1Q9CA 3AFAD 4H9QB 1P3FA 3UT9C 4G91B 5AV6D 3C1CD 4Z2MG 3MGQB 3W99C 1BFMA 5B40D 3AZHA 3H0LC 4H9SA 3AYWB 3KUYD 4J8WB 4WNNA 4YM6A 1P3AB 3TU4B 4J8UC 4H9OA 5AY8A 1H3OA 4H9PA 3REHB 1ID3C 2BG1A 4LD9B 4CAYB 1U35B 1M19D 3AZLC 5E5AB 4QLCA 5AVBD 2AROC 3R45B 4ZBJC 5F99D 3LZ1C 3W98A 3AZFD 2HIOA 4R8PC 5CPKA 1T3UA 1KX5A 1PZRA 3W97D 3X1VA 2NQBA 3WAAD 3REID 3AZIC 3KXBA 2FJ7A 5BNVA 3UTBD 1ID3B 3AZKB 3AZHC 4H9SC 5B1MD 4WU8A 2DF4C 5B2ID 4YM6C 5B1LA 4YS3A 1P3KD 2YFWB 5CPJD 2AROB 3WA9D 5B24A 3LZ1B 3C1BA 3WKJD 4KUDC 1TAFA 4QLCC 4XZQD 4R8PB 2J8PA 3NQJB 3W98C 4Z2MH 5AVCD 1P3OD 3A1KA 2HIOC 1P3FB 5CPID 4NE3A 3V9RB 3O62D 1KX5C 5GSUA 3X1VC 1P34A 1ZLAA 5CHLB 2F8NG 3AZHB 2NQBC 3EPLA 3VH6A 3X1SA 1EQZD 4WNNB 5DNMD 4YM6B 2FJ7C 3B6GA 3EPHA 4H9OB 5AY8B 1H3OB 3AZNA 4WU8C 1Z2CB 3LJAA 3AV2D 3KSYA 5B1LC 4YS3C 4QLCB 5AV8A 5KDMA 5C3IB 4XUJC 2RVQC 4X23A 3AZMD 1AOID 5B24C 3W98B 3B6FA 5B2JD 5FUGA 3C1BC 5B33D 2HIOB 3MVDA 5CPKB 1KX3C 1KX5B 3X1VB 2NQBB 3X1UB 3KXBB 5CP6B 5BNVB 5GSUC 2CWEA 3UTAA 1P34C 1JFIA 1ZLAC 4WU8B 3X1TD 3B6GC 5B0YD 3AZNC 4YS3B 3RELD 3MGPA 5B24B 3C1BB 1TAFB 3B6FC 4J8XA 2F8NH 3MVDC 2Y2HA 3KWQA 4Z5TD 1R4VA 4H9RA 5GSUB 1P34B 2Y2OA 1KX4A 1ZLAB 5GT0A 4NFTA 3B6GB 3X1SB 2F8NK 3AZNB 4DRBA 5AV5D 3MGSD 1S32D 1P3LA 3LJAB 5JA4A 5DNNA 5AV8B 5KDMB 3MGPC 2PYOC 4X23B 3REJD 5FUGB 1P3PD 1HQ3A 5B32A 3EPKA 3MNND 1M18A 3VH5W 4KGCD 3AZGA 2UWXA 5GXQD 4J8XC 3VH5A 3MGRC 3KWQC 2JSSA 3UTAB 1KX4C 5JRGC 1JFIB 3UT9A 4Z66B 3W99A 4JJND 5GT3A 3MGPB 3LZ0C 2ZY4A 4WU9D 2JE5A 1P3LC 4J8UA 3AFAA 5DNNC 3WTPC 5AV6A 3C1CA 3A1IA 1HQ3C 5B40A 1M18C 3KWQB 4H9RB 4NE6A 3MGQD 1KX4B 2Y2PA 3AN2C 5GT0B 3AYWD 2NZDC 2ZY3A 3P5JB 5BO0A 2HUEC 3TU4D 5B31G 3AZIA 4AWLC 3REHD 4LD9D 1P3LB 5JA4B 1U35D 5AVBA 1M1AD 5F99A 5E5AD 5GT3C 1TZYD 5DNNB 3AZFA 1F66C 1F1EA 3W97A 3AFAC 1HQ3B 5B32B 1M18B 5AV9D 4CSRA 4KUDA 3AZGB 5AV6C 3C1CC 3UTBA 2F8ND 5B40C 2HUEB 3KUYC 2G5IC 4DRAA 5B2IA 4AWLB 3AZKD 1P3MD 3UT9B 1P3KA 3W99B 5CPJA 5GT3B 2XD1A 3WKJA 1M19C 4J8UB 5AVBC 5F99C 3AZFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  5B32 G;  5CPI A;  5AV6 B;  3W97 C;  4XUJ A;  1P3F D;  4ZBJ B;  3WAA C;  3REI C;  4E45 A;  3A6N A;  2BYK A;  3AZH D;  3UTB C;  3AV1 D;  1KX3 A;  5BO0 B;  4YM6 D;  5B1M C;  3AV2 A;  3AZI B;  1B67 A;  5AY8 D;  5B2I C;  3AZM A;  1P3K C;  5CPJ C;  5AVB B;  1AOI A;  3WA9 C;  5F99 B;  5B2J A;  3WKJ C;  5B33 A;  4XZQ C;  4H9P B;  3W97 B;  4KHA A;  1HTA A;  3AZJ D;  1P3G D;  3B0D C;  5AVC C;  5CPK D;  1P3O C;  4KUD B;  5CPI C;  3UTB B;  3X1U D;  3KXB D;  3W96 D;  5CP6 D;  3A6N C;  1EQZ C;  5DNM C;  5B0Y A;  3LEL D;  5G49 A;  3REL A;  1P3K B;  5CPJ B;  3AV2 C;  3WKJ B;  1P3B D;  1P3I D;  2RVQ D;  2CV5 D;  2FJ7 B;  5B24 D;  3AZM C;  1AOI C;  5B2J C;  5B33 C;  5B1L B;  5CPI B;  2PYO A;  4XUJ B;  3A6N B;  2BYK B;  2BYM A;  1KX3 B;  3X1S D;  3REK D;  5AV5 A;  3X1T C;  3MGS A;  3MGR A;  3AV2 B;  3WTP E;  5B0Y C;  2L5A A;  3LJA D;  3REL C;  3AZM B;  5JRG A;  3REJ A;  4J8V D;  5AV8 D;  4X23 D;  3MNN A;  3LZ0 A;  3WTP A;  4Z5T C;  3B6F B;  3UTA D;  3MVD B;  4JJN A;  5B31 D;  5B0Y B;  4Z66 D;  5G49 B;  3REL B;  5AV5 C;  3MGS C;  3AN2 A;  3AZE D;  2NZD A;  4HGA C;  4ZUX D;  5B0Z D;  3REJ C;  4UUZ A;  4H9N A;  3MNN C;  4KGC C;  2PYO B;  1F66 A;  5GXQ C;  3KWQ D;  5BT1 D;  3TU4 A;  5GT0 D;  2BYM B;  4LD9 A;  4J8X B;  3MGR B;  4JJN C;  1M1A A;  1TZY A;  3KUY A;  5JRG B;  3REJ B;  4WU9 C;  4J8W D;  1P3A D;  5AV9 A;  1M19 A;  3LZ0 B;  5B32 D;  4M6B A;  2F8N A;  3AZG D;  3WTP B;  3AYW C;  1P3M A;  4JJN B;  3WAA A;  4NE5 A;  3TU4 C;  3REI A;  3UT9 D;  3VH6 T;  3W99 D;  2YFW A;  4LD9 C;  3AN2 B;  2NZD B;  1BH8 A;  1U35 C;  1M1A C;  5B1M A;  5E5A C;  3NQU A;  1TZY C;  4E44 A;  5BS7 A;  4J8U D;  1ID3 D;  3NQJ A;  4UUZ B;  4H9N B;  3AZL D;  3WA9 A;  5AV9 C;  3V9R A;  2ARO D;  1F66 B;  4XZQ A;  3LZ1 D;  3AV1 A;  1N1J A;  3AFA B;  3B0C T;  5AVC A;  4R8P D;  1P3O A;  3AZK C;  1P3M C;  3O62 A;  3C1C B;  3AZI D;  1M1A B;  5B40 B;  1TZY B;  3KUY B;  1EQZ A;  5DNM A;  5BNX A;  3AZJ A;  5AV9 B;  5BS7 C;  1P3G A;  1M19 B;  1P3F C;  2F8N B;  4KUD D;  3W96 A;  3X1U A;  5CP6 A;  4QLC D;  3AZF B;  3W98 D;  1P3M B;  3LEL A;  2YFV A;  3AV1 C;  2HIO D;  3WAA B;  1A7W A;  1KU5 A;  4CSR B;  3REI B;  1KX5 D;  5AY8 C;  3X1V D;  1P3I A;  1P3B A;  2NQB D;  2CV5 A;  3O62 C;  1BH8 B;  5B1M B;  3X1T A;  3NQU B;  2FJ7 D;  4WV4 B;  5C3I C;  5B2I B;  4WU8 D;  3WA9 B;  5B1L D;  3AZJ C;  1P3G C;  4YS3 D;  5CPK C;  4XUJ D;  3VH6 W;  4XZQ B;  3C1B D;  3AV1 B;  1N1J B;  3A6N D;  3REK A;  3W96 C;  3X1U C;  3VH5 T;  5CP6 C;  3KXB C;  3B0D B;  5AVC B;  1P3O B;  1KX3 D;  3LEL C;  3O62 B;  1B6W A;  4Z5T A;  4J8V A;  5GSU D;  1P34 D;  1P3I C;  1P3B C;  5DNM B;  1EQZ B;  2CV5 C;  1ZLA D;  1BH9 A;  4EO5 C;  3B6G D;  5BNX B;  1S32 A;  4G92 C;  3AZJ B;  1P3G B;  3AZN D;  3B0C W;  1AOI B;  3W96 B;  5B2J B;  5B33 B;  1P3P A;  2LY8 A;  5B31 A;  3B6F D;  3LEL B;  2YFV B;  4KGC A;  4Z66 A;  3REK C;  3X1S C;  3MVD D;  4KHA B;  5GXQ A;  3AZE A;  1P3I B;  1P3B B;  4ZUX A;  2CV5 B;  1WWI A;  4EO5 B;  3LJA C;  5B0Z A;  1ULY A;  3X1T B;  4G92 B;  4J8V C;  5AV8 C;  4X23 C;  1S32 C;  4WU9 A;  3MGP D;  2PYO D;  3REK B;  1WWS A;  1P3P C;  4H9Q A;  3UTA C;  5B31 C;  4J8X D;  4Z66 C;  4Z5T B;  3MGR D;  3MGQ A;  3AYW A;  3AZE C;  4J8V B;  1KX4 D;  5JRG D;  4ZUX C;  4J8W A;  1P3A A;  1BH9 B;  5B0Z C;  2IO5 C;  3REH A;  5AV5 B;  4CAY A;  3MGS B;  1S32 B;  1U35 A;  4HGA B;  3LZ0 D;  5E5A A;  1P3L D;  3R45 A;  5DNN D;  3WTP D;  1P3P B;  3MNN B;  5BT1 C;  5B31 B;  5GT0 C;  4KGC B;  1HQ3 D;  5GXQ B;  1M18 D;  3AZE B;  4ZUX B;  3AN2 D;  3B0B A;  4G91 C;  1ID3 A;  3MGQ C;  5B0Z B;  3AZK A;  2IO5 B;  2NZD D;  4J8W C;  1P3A C;  3AZL A;  4WZS B;  3REH C;  2ARO A;  5B32 C;  4WU9 B;  5GT3 D;  3LZ1 A;  1F66 D;  3AZG C;  4R8P A;  1Q9C A;  3AFA D;  4H9Q B;  1P3F A;  3UT9 C;  4G91 B;  5AV6 D;  3C1C D;  4Z2M G;  3MGQ B;  3W99 C;  1BFM A;  5B40 D;  3AZH A;  4H9S A;  3AYW B;  3KUY D;  4J8W B;  4WNN A;  4YM6 A;  1P3A B;  3TU4 B;  4J8U C;  4H9O A;  5AY8 A;  1H3O A;  4H9P A;  3REH B;  1ID3 C;  4LD9 B;  4CAY B;  1U35 B;  1M19 D;  3AZL C;  5E5A B;  4QLC A;  5AVB D;  2ARO C;  3R45 B;  4ZBJ C;  5F99 D;  3LZ1 C;  3W98 A;  3AZF D;  2HIO A;  4R8P C;  5CPK A;  1KX5 A;  3W97 D;  3X1V A;  2NQB A;  3WAA D;  3REI D;  3AZI C;  3KXB A;  2FJ7 A;  5BNV A;  3UTB D;  1ID3 B;  3AZK B;  3AZH C;  4H9S C;  5B1M D;  4WU8 A;  5B2I D;  4YM6 C;  5B1L A;  4YS3 A;  1P3K D;  2YFW B;  5CPJ D;  2ARO B;  3WA9 D;  5B24 A;  3LZ1 B;  3C1B A;  3WKJ D;  4KUD C;  1TAF A;  4QLC C;  4XZQ D;  4R8P B;  3NQJ B;  3W98 C;  4Z2M H;  5AVC D;  1P3O D;  2HIO C;  1P3F B;  5CPI D;  4NE3 A;  3V9R B;  3O62 D;  1KX5 C;  5GSU A;  3X1V C;  1P34 A;  1ZLA A;  5CHL B;  2F8N G;  3AZH B;  2NQB C;  3VH6 A;  3X1S A;  1EQZ D;  4WNN B;  5DNM D;  4YM6 B;  2FJ7 C;  3B6G A;  4H9O B;  5AY8 B;  1H3O B;  3AZN A;  4WU8 C;  3LJA A;  3AV2 D;  3KSY A;  5B1L C;  4YS3 C;  4QLC B;  5AV8 A;  5KDM A;  5C3I B;  4XUJ C;  2RVQ C;  4X23 A;  3AZM D;  1AOI D;  5B24 C;  3W98 B;  3B6F A;  5B2J D;  5FUG A;  3C1B C;  5B33 D;  2HIO B;  3MVD A;  5CPK B;  1KX3 C;  1KX5 B;  3X1V B;  2NQB B;  3X1U B;  3KXB B;  5CP6 B;  5BNV B;  5GSU C;  2CWE A;  3UTA A;  1P34 C;  1JFI A;  1ZLA C;  4WU8 B;  3X1T D;  3B6G C;  5B0Y D;  3AZN C;  4YS3 B;  3REL D;  3MGP A;  5B24 B;  3C1B B;  1TAF B;  3B6F C;  4J8X A;  2F8N H;  3MVD C;  3KWQ A;  4Z5T D;  1R4V A;  4H9R A;  5GSU B;  1P34 B;  1KX4 A;  1ZLA B;  5GT0 A;  4NFT A;  3B6G B;  3X1S B;  2F8N K;  3AZN B;  4DRB A;  5AV5 D;  3MGS D;  1S32 D;  1P3L A;  3LJA B;  5JA4 A;  5DNN A;  5AV8 B;  5KDM B;  3MGP C;  2PYO C;  4X23 B;  3REJ D;  5FUG B;  1P3P D;  1HQ3 A;  5B32 A;  3MNN D;  1M18 A;  3VH5 W;  4KGC D;  3AZG A;  5GXQ D;  4J8X C;  3VH5 A;  3MGR C;  3KWQ C;  2JSS A;  3UTA B;  1KX4 C;  5JRG C;  1JFI B;  3UT9 A;  4Z66 B;  3W99 A;  4JJN D;  5GT3 A;  3MGP B;  3LZ0 C;  4WU9 D;  1P3L C;  4J8U A;  3AFA A;  5DNN C;  3WTP C;  5AV6 A;  3C1C A;  1HQ3 C;  5B40 A;  1M18 C;  3KWQ B;  4H9R B;  4NE6 A;  3MGQ D;  1KX4 B;  3AN2 C;  5GT0 B;  3AYW D;  2NZD C;  5BO0 A;  2HUE C;  3TU4 D;  5B31 G;  3AZI A;  4AWL C;  3REH D;  4LD9 D;  1P3L B;  5JA4 B;  1U35 D;  5AVB A;  1M1A D;  5F99 A;  5E5A D;  5GT3 C;  1TZY D;  5DNN B;  3AZF A;  1F66 C;  1F1E A;  3W97 A;  3AFA C;  1HQ3 B;  5B32 B;  1M18 B;  5AV9 D;  4CSR A;  4KUD A;  3AZG B;  5AV6 C;  3C1C C;  3UTB A;  2F8N D;  5B40 C;  2HUE B;  3KUY C;  5B2I A;  4DRA A;  4AWL B;  3AZK D;  1P3M D;  3UT9 B;  1P3K A;  3W99 B;  5CPJ A;  5GT3 B;  3WKJ A;  1M19 C;  4J8U B;  5AVB C;  5F99 C;  3AZF C; 
#chains in the Genus database with same CATH topology
 3AZL B;  5B32 G;  5CPI A;  5AV6 B;  3W97 C;  4XUJ A;  1P3F D;  4ZBJ B;  3WAA C;  3REI C;  4E45 A;  3A6N A;  2BYK A;  3AZH D;  3UTB C;  3AV1 D;  1KX3 A;  5BO0 B;  4YM6 D;  5B1M C;  3AV2 A;  3AZI B;  1B67 A;  5AY8 D;  5B2I C;  3AZM A;  1P3K C;  5CPJ C;  5AVB B;  1AOI A;  3WA9 C;  5F99 B;  1W2E A;  5B2J A;  3WKJ C;  5B33 A;  2G5H C;  2Y2M A;  4XZQ C;  4H9P B;  3W97 B;  4KHA A;  1HTA A;  3AZJ D;  1P3G D;  3B0D C;  5AVC C;  5CPK D;  1P3O C;  4KUD B;  3F6T A;  5CPI C;  3UTB B;  3X1U D;  3KXB D;  3W96 D;  5CP6 D;  3A6N C;  1EQZ C;  5DNM C;  5B0Y A;  3LEL D;  5G49 A;  3REL A;  1P3K B;  5CPJ B;  3AV2 C;  3WKJ B;  1P3B D;  1P3I D;  2RVQ D;  2CV5 D;  2FJ7 B;  5B24 D;  3AZM C;  1AOI C;  3AL0 C;  5B2J C;  5B33 C;  5B1L B;  5CPI B;  2PYO A;  4XUJ B;  4WJ3 C;  3A6N B;  2BYK B;  2BYM A;  1KX3 B;  2XD5 A;  3X1S D;  3REK D;  5AV5 A;  3X1T C;  3MGS A;  3MGR A;  3AV2 B;  3WTP E;  5B0Y C;  2L5A A;  3LJA D;  3REL C;  3AZM B;  5JRG A;  3REJ A;  4J8V D;  5AV8 D;  4X23 D;  3MNN A;  3LZ0 A;  3WTP A;  4Z5T C;  3B6F B;  3UTA D;  3MVD B;  4JJN A;  5B31 D;  5B0Y B;  4Z66 D;  5G49 B;  3REL B;  5AV5 C;  3MGS C;  3AN2 A;  3AZE D;  2NZD A;  4HGA C;  4ZUX D;  5B0Z D;  2ZY5 A;  3REJ C;  4UUZ A;  4H9N A;  3MNN C;  4KGC C;  2PYO B;  1F66 A;  5GXQ C;  3KWQ D;  5BT1 D;  3TU4 A;  5GT0 D;  2BYM B;  2ZM5 A;  4LD9 A;  4J8X B;  3MGR B;  4JJN C;  1M1A A;  2Y2J A;  1TZY A;  3KUY A;  5JRG B;  3REJ B;  4WU9 C;  4J8W D;  1P3A D;  3H0M C;  5AV9 A;  1M19 A;  3LZ0 B;  5B32 D;  4M6B A;  2F8N A;  3AZG D;  3WTP B;  3AYW C;  1P3M A;  3H0R C;  4JJN B;  3WAA A;  4NE5 A;  3TU4 C;  3REI A;  3UT9 D;  3VH6 T;  3W99 D;  2YFW A;  4LD9 C;  3AN2 B;  2NZD B;  1BH8 A;  1U35 C;  1M1A C;  5B1M A;  5E5A C;  3NQU A;  1TZY C;  4E44 A;  5BS7 A;  4J8U D;  1ID3 D;  3NQJ A;  4UUZ B;  4H9N B;  3AZL D;  3WA9 A;  3KFU G;  5AV9 C;  3V9R A;  2ARO D;  1F66 B;  4XZQ A;  3LZ1 D;  2JCH A;  3AV1 A;  1N1J A;  3AFA B;  3B0C T;  5AVC A;  4R8P D;  1P3O A;  3AZK C;  1P3M C;  3O62 A;  3C1C B;  2VQR A;  3AZI D;  1M1A B;  5B40 B;  1TZY B;  3KUY B;  1EQZ A;  5DNM A;  5BNX A;  3AZJ A;  5AV9 B;  5BS7 C;  1P3G A;  1M19 B;  4UPK A;  1P3F C;  2F8N B;  2Y2Q A;  4KUD D;  3W96 A;  3X1U A;  5CP6 A;  4QLC D;  3AZF B;  3W98 D;  1P3M B;  3LEL A;  2YFV A;  3AV1 C;  2HIO D;  3WAA B;  1A7W A;  1KU5 A;  4CSR B;  3REI B;  1KX5 D;  5AY8 C;  3X1V D;  1P3I A;  1P3B A;  2NQB D;  2CV5 A;  3O62 C;  1BH8 B;  5B1M B;  3X1T A;  3NQU B;  2FJ7 D;  4WV4 B;  5C3I C;  5B2I B;  4WU8 D;  2FFF B;  3WA9 B;  5B1L D;  3AZJ C;  2Y2L A;  1P3G C;  4YS3 D;  5CPK C;  4XUJ D;  3VH6 W;  4XZQ B;  3C1B D;  3AV1 B;  1N1J B;  3A6N D;  3REK A;  3W96 C;  3X1U C;  3VH5 T;  5CP6 C;  3KXB C;  3B0D B;  5AVC B;  1P3O B;  1KX3 D;  3LEL C;  3O62 B;  1B6W A;  4Z5T A;  4J8V A;  2RIQ A;  5GSU D;  1P34 D;  2Y2N A;  5DNM B;  1P3I C;  2CV5 C;  1P3B C;  1EQZ B;  1ZLA D;  1BH9 A;  4EO5 C;  3B6G D;  2F2A C;  5BNX B;  1S32 A;  4G92 C;  3AZJ B;  1P3G B;  3AZN D;  3B0C W;  3IP4 C;  1AOI B;  3W96 B;  5B2J B;  5B33 B;  1P3P A;  2W8S A;  2LY8 A;  5B31 A;  3B6F D;  3LEL B;  2YFV B;  4KGC A;  4Z66 A;  3REK C;  3X1S C;  3MVD D;  4KHA B;  5GXQ A;  3AZE A;  1P3I B;  1P3B B;  4ZUX A;  2CV5 B;  1WWI A;  4EO5 B;  3LJA C;  5B0Z A;  1ULY A;  3X1T B;  4G92 B;  4J8V C;  5AV8 C;  2DQN C;  4X23 C;  2Y2G A;  1S32 C;  4WU9 A;  3MGP D;  4DQY B;  2PYO D;  3EG5 B;  3REK B;  1WWS A;  1P3P C;  4H9Q A;  3UTA C;  5B31 C;  4J8X D;  4Z66 C;  4Z5T B;  3MGR D;  3MGQ A;  2ZY2 A;  3EPJ A;  3AYW A;  3AZE C;  4J8V B;  1KX4 D;  5JRG D;  4ZUX C;  4J8W A;  1P3A A;  1BH9 B;  5B0Z C;  2IO5 C;  3REH A;  5AV5 B;  4CAY A;  3MGS B;  1S32 B;  1U35 A;  3FDD A;  4HGA B;  3LZ0 D;  2Y2K A;  5E5A A;  1P3L D;  3R45 A;  5DNN D;  3WTP D;  1P3P B;  3MNN B;  5BT1 C;  5B31 B;  5GT0 C;  4KGC B;  1HQ3 D;  5GXQ B;  1M18 D;  3AZE B;  4ZUX B;  2Y2I A;  3AN2 D;  3B0B A;  4G91 C;  1ID3 A;  3MGQ C;  5B0Z B;  3AZK A;  2IO5 B;  2NZD D;  4J8W C;  1P3A C;  3AZL A;  4WZS B;  3REH C;  2ARO A;  5B32 C;  4WU9 B;  5GT3 D;  3LZ1 A;  1F66 D;  3AZG C;  4R8P A;  1Q9C A;  3AFA D;  4H9Q B;  1P3F A;  3UT9 C;  4G91 B;  5AV6 D;  3C1C D;  4Z2M G;  3MGQ B;  3W99 C;  1BFM A;  5B40 D;  3AZH A;  3H0L C;  4H9S A;  3AYW B;  3KUY D;  4J8W B;  4WNN A;  4YM6 A;  1P3A B;  3TU4 B;  4J8U C;  4H9O A;  5AY8 A;  1H3O A;  4H9P A;  3REH B;  1ID3 C;  2BG1 A;  4LD9 B;  4CAY B;  1U35 B;  1M19 D;  3AZL C;  5E5A B;  4QLC A;  5AVB D;  2ARO C;  3R45 B;  4ZBJ C;  5F99 D;  3LZ1 C;  3W98 A;  3AZF D;  2HIO A;  4R8P C;  5CPK A;  1T3U A;  1KX5 A;  1PZR A;  3W97 D;  3X1V A;  2NQB A;  3WAA D;  3REI D;  3AZI C;  3KXB A;  2FJ7 A;  5BNV A;  3UTB D;  1ID3 B;  3AZK B;  3AZH C;  4H9S C;  5B1M D;  4WU8 A;  2DF4 C;  5B2I D;  4YM6 C;  5B1L A;  4YS3 A;  1P3K D;  2YFW B;  5CPJ D;  2ARO B;  3WA9 D;  5B24 A;  3LZ1 B;  3C1B A;  3WKJ D;  4KUD C;  1TAF A;  4QLC C;  4XZQ D;  4R8P B;  2J8P A;  3NQJ B;  3W98 C;  4Z2M H;  5AVC D;  1P3O D;  3A1K A;  2HIO C;  1P3F B;  5CPI D;  4NE3 A;  3V9R B;  3O62 D;  1KX5 C;  5GSU A;  3X1V C;  1P34 A;  1ZLA A;  5CHL B;  2F8N G;  3AZH B;  2NQB C;  3EPL A;  3VH6 A;  3X1S A;  1EQZ D;  4WNN B;  5DNM D;  4YM6 B;  2FJ7 C;  3B6G A;  3EPH A;  4H9O B;  5AY8 B;  1H3O B;  3AZN A;  4WU8 C;  1Z2C B;  3LJA A;  3AV2 D;  3KSY A;  5B1L C;  4YS3 C;  4QLC B;  5AV8 A;  5KDM A;  5C3I B;  4XUJ C;  2RVQ C;  4X23 A;  3AZM D;  1AOI D;  5B24 C;  3W98 B;  3B6F A;  5B2J D;  5FUG A;  3C1B C;  5B33 D;  2HIO B;  3MVD A;  5CPK B;  1KX3 C;  1KX5 B;  3X1V B;  2NQB B;  3X1U B;  3KXB B;  5CP6 B;  5BNV B;  5GSU C;  2CWE A;  3UTA A;  1P34 C;  1JFI A;  1ZLA C;  4WU8 B;  3X1T D;  3B6G C;  5B0Y D;  3AZN C;  4YS3 B;  3REL D;  3MGP A;  5B24 B;  3C1B B;  1TAF B;  3B6F C;  4J8X A;  2F8N H;  3MVD C;  2Y2H A;  3KWQ A;  4Z5T D;  1R4V A;  4H9R A;  5GSU B;  1P34 B;  2Y2O A;  1KX4 A;  1ZLA B;  5GT0 A;  4NFT A;  3B6G B;  3X1S B;  2F8N K;  3AZN B;  4DRB A;  5AV5 D;  3MGS D;  1S32 D;  1P3L A;  3LJA B;  5JA4 A;  5DNN A;  5AV8 B;  5KDM B;  3MGP C;  2PYO C;  4X23 B;  3REJ D;  5FUG B;  1P3P D;  1HQ3 A;  5B32 A;  3EPK A;  3MNN D;  1M18 A;  3VH5 W;  4KGC D;  3AZG A;  2UWX A;  5GXQ D;  4J8X C;  3VH5 A;  3MGR C;  3KWQ C;  2JSS A;  3UTA B;  1KX4 C;  5JRG C;  1JFI B;  3UT9 A;  4Z66 B;  3W99 A;  4JJN D;  5GT3 A;  3MGP B;  3LZ0 C;  2ZY4 A;  4WU9 D;  2JE5 A;  1P3L C;  4J8U A;  3AFA A;  5DNN C;  3WTP C;  5AV6 A;  3C1C A;  3A1I A;  1HQ3 C;  5B40 A;  1M18 C;  3KWQ B;  4H9R B;  4NE6 A;  3MGQ D;  1KX4 B;  2Y2P A;  3AN2 C;  5GT0 B;  3AYW D;  2NZD C;  2ZY3 A;  3P5J B;  5BO0 A;  2HUE C;  3TU4 D;  5B31 G;  3AZI A;  4AWL C;  3REH D;  4LD9 D;  1P3L B;  5JA4 B;  1U35 D;  5AVB A;  1M1A D;  5F99 A;  5E5A D;  5GT3 C;  1TZY D;  5DNN B;  3AZF A;  1F66 C;  1F1E A;  3W97 A;  3AFA C;  1HQ3 B;  5B32 B;  1M18 B;  5AV9 D;  4CSR A;  4KUD A;  3AZG B;  5AV6 C;  3C1C C;  3UTB A;  2F8N D;  5B40 C;  2HUE B;  3KUY C;  2G5I C;  4DRA A;  5B2I A;  4AWL B;  3AZK D;  1P3M D;  3UT9 B;  1P3K A;  3W99 B;  5CPJ A;  5GT3 B;  2XD1 A;  3WKJ A;  1M19 C;  4J8U B;  5AVB C;  5F99 C;  3AZF C; 
#chains in the Genus database with same CATH homology
 3AZL B;  5B32 G;  5CPI A;  5AV6 B;  3W97 C;  4XUJ A;  1P3F D;  4ZBJ B;  3WAA C;  3REI C;  4E45 A;  3A6N A;  2BYK A;  3AZH D;  3UTB C;  3AV1 D;  1KX3 A;  5BO0 B;  4YM6 D;  5B1M C;  3AV2 A;  3AZI B;  1B67 A;  5AY8 D;  5B2I C;  3AZM A;  1P3K C;  5CPJ C;  5AVB B;  1AOI A;  3WA9 C;  5F99 B;  1W2E A;  5B2J A;  3WKJ C;  5B33 A;  2G5H C;  2Y2M A;  4XZQ C;  4H9P B;  3W97 B;  4KHA A;  1HTA A;  3AZJ D;  1P3G D;  3B0D C;  5AVC C;  5CPK D;  1P3O C;  4KUD B;  3F6T A;  5CPI C;  3UTB B;  3X1U D;  3KXB D;  3W96 D;  5CP6 D;  3A6N C;  1EQZ C;  5DNM C;  5B0Y A;  3LEL D;  5G49 A;  3REL A;  1P3K B;  5CPJ B;  3AV2 C;  3WKJ B;  1P3B D;  1P3I D;  2RVQ D;  2CV5 D;  2FJ7 B;  5B24 D;  3AZM C;  1AOI C;  3AL0 C;  5B2J C;  5B33 C;  5B1L B;  5CPI B;  2PYO A;  4XUJ B;  4WJ3 C;  3A6N B;  2BYK B;  2BYM A;  1KX3 B;  2XD5 A;  3X1S D;  3REK D;  5AV5 A;  3X1T C;  3MGS A;  3MGR A;  3AV2 B;  3WTP E;  5B0Y C;  2L5A A;  3LJA D;  3REL C;  3AZM B;  5JRG A;  3REJ A;  4J8V D;  5AV8 D;  4X23 D;  3MNN A;  3LZ0 A;  3WTP A;  4Z5T C;  3B6F B;  3UTA D;  3MVD B;  4JJN A;  5B31 D;  5B0Y B;  4Z66 D;  5G49 B;  3REL B;  5AV5 C;  3MGS C;  3AN2 A;  3AZE D;  2NZD A;  4HGA C;  4ZUX D;  5B0Z D;  2ZY5 A;  3REJ C;  4UUZ A;  4H9N A;  3MNN C;  4KGC C;  2PYO B;  1F66 A;  5GXQ C;  3KWQ D;  5BT1 D;  3TU4 A;  5GT0 D;  2BYM B;  2ZM5 A;  4LD9 A;  4J8X B;  3MGR B;  4JJN C;  1M1A A;  2Y2J A;  1TZY A;  3KUY A;  5JRG B;  3REJ B;  4WU9 C;  4J8W D;  1P3A D;  3H0M C;  5AV9 A;  1M19 A;  3LZ0 B;  5B32 D;  4M6B A;  2F8N A;  3AZG D;  3WTP B;  3AYW C;  1P3M A;  3H0R C;  4JJN B;  3WAA A;  4NE5 A;  3TU4 C;  3REI A;  3UT9 D;  3VH6 T;  3W99 D;  2YFW A;  4LD9 C;  3AN2 B;  2NZD B;  1BH8 A;  1U35 C;  1M1A C;  5B1M A;  5E5A C;  3NQU A;  1TZY C;  4E44 A;  5BS7 A;  4J8U D;  1ID3 D;  3NQJ A;  4UUZ B;  4H9N B;  3AZL D;  3WA9 A;  3KFU G;  5AV9 C;  3V9R A;  2ARO D;  1F66 B;  4XZQ A;  3LZ1 D;  2JCH A;  3AV1 A;  1N1J A;  3AFA B;  3B0C T;  5AVC A;  4R8P D;  1P3O A;  3AZK C;  1P3M C;  3O62 A;  3C1C B;  2VQR A;  3AZI D;  1M1A B;  5B40 B;  1TZY B;  3KUY B;  1EQZ A;  5DNM A;  5BNX A;  3AZJ A;  5AV9 B;  5BS7 C;  1P3G A;  1M19 B;  4UPK A;  1P3F C;  2F8N B;  2Y2Q A;  4KUD D;  3W96 A;  3X1U A;  5CP6 A;  4QLC D;  3AZF B;  3W98 D;  1P3M B;  3LEL A;  2YFV A;  3AV1 C;  2HIO D;  3WAA B;  1A7W A;  1KU5 A;  4CSR B;  3REI B;  1KX5 D;  5AY8 C;  3X1V D;  1P3I A;  1P3B A;  2NQB D;  2CV5 A;  3O62 C;  1BH8 B;  5B1M B;  3X1T A;  3NQU B;  2FJ7 D;  4WV4 B;  5C3I C;  5B2I B;  4WU8 D;  2FFF B;  3WA9 B;  5B1L D;  3AZJ C;  2Y2L A;  1P3G C;  4YS3 D;  5CPK C;  4XUJ D;  3VH6 W;  4XZQ B;  3C1B D;  3AV1 B;  1N1J B;  3A6N D;  3REK A;  3W96 C;  3X1U C;  3VH5 T;  5CP6 C;  3KXB C;  3B0D B;  5AVC B;  1P3O B;  1KX3 D;  3LEL C;  3O62 B;  1B6W A;  4Z5T A;  4J8V A;  2RIQ A;  5GSU D;  1P34 D;  2Y2N A;  5DNM B;  1P3I C;  2CV5 C;  1P3B C;  1EQZ B;  1ZLA D;  1BH9 A;  4EO5 C;  3B6G D;  2F2A C;  5BNX B;  1S32 A;  4G92 C;  3AZJ B;  1P3G B;  3AZN D;  3B0C W;  3IP4 C;  1AOI B;  3W96 B;  5B2J B;  5B33 B;  1P3P A;  2W8S A;  2LY8 A;  5B31 A;  3B6F D;  3LEL B;  2YFV B;  4KGC A;  4Z66 A;  3REK C;  3X1S C;  3MVD D;  4KHA B;  5GXQ A;  3AZE A;  1P3I B;  1P3B B;  4ZUX A;  2CV5 B;  1WWI A;  4EO5 B;  3LJA C;  5B0Z A;  1ULY A;  3X1T B;  4G92 B;  4J8V C;  5AV8 C;  2DQN C;  4X23 C;  2Y2G A;  1S32 C;  4WU9 A;  3MGP D;  4DQY B;  2PYO D;  3EG5 B;  3REK B;  1WWS A;  1P3P C;  4H9Q A;  3UTA C;  5B31 C;  4J8X D;  4Z66 C;  4Z5T B;  3MGR D;  3MGQ A;  2ZY2 A;  3EPJ A;  3AYW A;  3AZE C;  4J8V B;  1KX4 D;  5JRG D;  4ZUX C;  4J8W A;  1P3A A;  1BH9 B;  5B0Z C;  2IO5 C;  3REH A;  5AV5 B;  4CAY A;  3MGS B;  1S32 B;  1U35 A;  3FDD A;  4HGA B;  3LZ0 D;  2Y2K A;  5E5A A;  1P3L D;  3R45 A;  5DNN D;  3WTP D;  1P3P B;  3MNN B;  5BT1 C;  5B31 B;  5GT0 C;  4KGC B;  1HQ3 D;  5GXQ B;  1M18 D;  3AZE B;  4ZUX B;  2Y2I A;  3AN2 D;  3B0B A;  4G91 C;  1ID3 A;  3MGQ C;  5B0Z B;  3AZK A;  2IO5 B;  2NZD D;  4J8W C;  1P3A C;  3AZL A;  4WZS B;  3REH C;  2ARO A;  5B32 C;  4WU9 B;  5GT3 D;  3LZ1 A;  1F66 D;  3AZG C;  4R8P A;  1Q9C A;  3AFA D;  4H9Q B;  1P3F A;  3UT9 C;  4G91 B;  5AV6 D;  3C1C D;  4Z2M G;  3MGQ B;  3W99 C;  1BFM A;  5B40 D;  3AZH A;  3H0L C;  4H9S A;  3AYW B;  3KUY D;  4J8W B;  4WNN A;  4YM6 A;  1P3A B;  3TU4 B;  4J8U C;  4H9O A;  5AY8 A;  1H3O A;  4H9P A;  3REH B;  1ID3 C;  2BG1 A;  4LD9 B;  4CAY B;  1U35 B;  1M19 D;  3AZL C;  5E5A B;  4QLC A;  5AVB D;  2ARO C;  3R45 B;  4ZBJ C;  5F99 D;  3LZ1 C;  3W98 A;  3AZF D;  2HIO A;  4R8P C;  5CPK A;  1T3U A;  1KX5 A;  1PZR A;  3W97 D;  3X1V A;  2NQB A;  3WAA D;  3REI D;  3AZI C;  3KXB A;  2FJ7 A;  5BNV A;  3UTB D;  1ID3 B;  3AZK B;  3AZH C;  4H9S C;  5B1M D;  4WU8 A;  2DF4 C;  5B2I D;  4YM6 C;  5B1L A;  4YS3 A;  1P3K D;  2YFW B;  5CPJ D;  2ARO B;  3WA9 D;  5B24 A;  3LZ1 B;  3C1B A;  3WKJ D;  4KUD C;  1TAF A;  4QLC C;  4XZQ D;  4R8P B;  2J8P A;  3NQJ B;  3W98 C;  4Z2M H;  5AVC D;  1P3O D;  3A1K A;  2HIO C;  1P3F B;  5CPI D;  4NE3 A;  3V9R B;  3O62 D;  1KX5 C;  5GSU A;  3X1V C;  1P34 A;  1ZLA A;  5CHL B;  2F8N G;  3AZH B;  2NQB C;  3EPL A;  3VH6 A;  3X1S A;  1EQZ D;  4WNN B;  5DNM D;  4YM6 B;  2FJ7 C;  3B6G A;  3EPH A;  4H9O B;  5AY8 B;  1H3O B;  3AZN A;  4WU8 C;  1Z2C B;  3LJA A;  3AV2 D;  3KSY A;  5B1L C;  4YS3 C;  4QLC B;  5AV8 A;  5KDM A;  5C3I B;  4XUJ C;  2RVQ C;  4X23 A;  3AZM D;  1AOI D;  5B24 C;  3W98 B;  3B6F A;  5B2J D;  5FUG A;  3C1B C;  5B33 D;  2HIO B;  3MVD A;  5CPK B;  1KX3 C;  1KX5 B;  3X1V B;  2NQB B;  3X1U B;  3KXB B;  5CP6 B;  5BNV B;  5GSU C;  2CWE A;  3UTA A;  1P34 C;  1JFI A;  1ZLA C;  4WU8 B;  3X1T D;  3B6G C;  5B0Y D;  3AZN C;  4YS3 B;  3REL D;  3MGP A;  5B24 B;  3C1B B;  1TAF B;  3B6F C;  4J8X A;  2F8N H;  3MVD C;  2Y2H A;  3KWQ A;  4Z5T D;  1R4V A;  4H9R A;  5GSU B;  1P34 B;  2Y2O A;  1KX4 A;  1ZLA B;  5GT0 A;  4NFT A;  3B6G B;  3X1S B;  2F8N K;  3AZN B;  4DRB A;  5AV5 D;  3MGS D;  1S32 D;  1P3L A;  3LJA B;  5JA4 A;  5DNN A;  5AV8 B;  5KDM B;  3MGP C;  2PYO C;  4X23 B;  3REJ D;  5FUG B;  1P3P D;  1HQ3 A;  5B32 A;  3EPK A;  3MNN D;  1M18 A;  3VH5 W;  4KGC D;  3AZG A;  2UWX A;  5GXQ D;  4J8X C;  3VH5 A;  3MGR C;  3KWQ C;  2JSS A;  3UTA B;  1KX4 C;  5JRG C;  1JFI B;  3UT9 A;  4Z66 B;  3W99 A;  4JJN D;  5GT3 A;  3MGP B;  3LZ0 C;  2ZY4 A;  4WU9 D;  2JE5 A;  1P3L C;  4J8U A;  3AFA A;  5DNN C;  3WTP C;  5AV6 A;  3C1C A;  3A1I A;  1HQ3 C;  5B40 A;  1M18 C;  3KWQ B;  4H9R B;  4NE6 A;  3MGQ D;  1KX4 B;  2Y2P A;  3AN2 C;  5GT0 B;  3AYW D;  2NZD C;  2ZY3 A;  3P5J B;  5BO0 A;  2HUE C;  3TU4 D;  5B31 G;  3AZI A;  4AWL C;  3REH D;  4LD9 D;  1P3L B;  5JA4 B;  1U35 D;  5AVB A;  1M1A D;  5F99 A;  5E5A D;  5GT3 C;  1TZY D;  5DNN B;  3AZF A;  1F66 C;  1F1E A;  3W97 A;  3AFA C;  1HQ3 B;  5B32 B;  1M18 B;  5AV9 D;  4CSR A;  4KUD A;  3AZG B;  5AV6 C;  3C1C C;  3UTB A;  2F8N D;  5B40 C;  2HUE B;  3KUY C;  2G5I C;  4DRA A;  5B2I A;  4AWL B;  3AZK D;  1P3M D;  3UT9 B;  1P3K A;  3W99 B;  5CPJ A;  5GT3 B;  2XD1 A;  3WKJ A;  1M19 C;  4J8U B;  5AVB C;  5F99 C;  3AZF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...