1H3OB

Crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
74
structure length
74
Chain Sequence
HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Subcomplex of Human Transcription Factor TFIID Formed by TATA Binding Protein-Associated Factors Htaf4 (Htaf(II)135) and Htaf12 (Htaf(II)20).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/tbp-associated factors
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT
total genus 24
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03847 TFIID_20kDa Transcription initiation factor TFIID subunit A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1h3oB00
3V9RB 1EQZB 1H3OA 4H9RB 3X1VB 3LELB 2CV5A 3AZGB 3AZIA 1P3LC 5C3IC 4G92B 1M18B 1P3KC 3C1BD 5AV9B 5B33B 4QLCC 3X1SA 1ZLAB 1P3PD 3MNNB 1P3OC 4H9OA 3AN2A 5B0YB 3RELB 3MGQA 5JA4A 3TU4A 4WU9A 3NQJA 4G91C 2FJ7B 3KWQA 2L5AA 4CAYA 5AV6A 5GT3C 3REJD 3UTAC 3AZEA 5B0YA 5DNNB 5AV6C 3KXBB 5B1MD 3AZMB 3TU4C 3AZIB 4YS3B 3W98C 5B24B 1KU5A 5AV8B 4E45A 5B2JD 5AV9A 1U35A 3X1VC 1P34B 4J8VA 3B6GB 1M18C 3KUYA 5AVBD 3UTBB 4JJNB 1P3OA 1HTAA 4H9PA 5B1LB 1ID3C 4KGCA 3AZJB 4X23C 1P3FA 3WA9C 4J8UC 3REHB 1KX3D 2YFWA 3LZ0A 3VH6T 4H9SC 3R45A 3C1CC 1F66C 1BH8B 3AV2D 4J8XC 2FJ7C 1M19B 3AZLB 3UT9D 3MGSA 5KDMA 1TAFB 3REIA 5GT3B 2YFWB 4J8VC 5C3IB 3LJAB 3A6ND 1P3AC 1U35D 1N1JA 5AV9C 3X1TD 5AY8C 5B33C 5B31C 5CPIB 1A7WA 4JJNA 1P3OB 1KX5A 1P3AD 4KGCB 2RVQD 4KUDB 3X1SD 1M19A 5B24A 5GT0C 3R45B 3MGQC 5B2ID 5GXQA 3AV2A 5B2IC 4WU8A 5AVCB 4CAYB 5DNNC 5AV6B 2BYKA 5F99A 4YS3C 3TU4B 3AZJA 4R8PB 5AV5C 4WNNB 3AV2C 5B2JA 4ZBJC 1P3KA 3REKA 1P3BA 3NQJB 3AN2B 1R4VA 2HUEB 2F8NH 5B40D 3MGPD 3KUYD 3AZHA 5CP6C 3AZNC 1ID3B 3VH5A 3KXBA 4EO5C 3AZMA 2NQBA 4J8UB 4Z66D 5GSUC 1TZYD 3MGRB 3AZKA 1P3FD 4YM6D 3V9RA 1EQZA 2NZDC 3MGSC 4Z5TB 5AVBC 3WKJA 1H3OB 1P3AB 4H9SA 5JRGD 4AWLB 1KX3C 5CP6A 5AY8B 3WAAB 3UTBA 5BNVA 1P3PC 3MGSD 3AZHD 2HIOA 4XUJA 3WTPE 5GT0D 3MGRA 4CSRA 3LJAD 3AZKB 3AV1C 4J8XD 5AV5A 5CPKB 3KUYC 1HQ3A 1P3MB 5GT0B 3AZKD 3AZND 5B2IA 4H9QB 5B31G 3WKJB 5BT1C 3KWQD 3AZHB 4WV4B 5JA4B 4WU9B 1P3LD 5JRGB 3WTPC 4R8PC 3LZ1C 1F66B 1TAFA 4R8PA 4Z5TD 5AVBB 2PYOB 3W96C 3B6GD 4YM6B 2F8NG 5B31A 3AZFD 3B0DB 3VH6W 5E5AC 1KX4B 3W99A 1P3KD 1P3ID 1B67A 4J8UD 3O62A 5B0ZC 1P3GD 1ID3D 3C1CA 1F66A 3KUYB 3AN2D 4E44A 5DNMA 1S32B 3RELD 4DRAA 5B0YD 4R8PD 2IO5C 4Z2MG 5BT1D 1P3PB 3AZLA 5AVCD 4J8WA 4ZUXA 5AV9D 3AZFC 3AZKC 2PYOC 3W99C 3MVDB 4YM6C 5CPIA 3AZGC 3AYWD 1N1JB 1AOID 4KUDD 1P3MC 4KGCD 3C1CD 1F66D 3AZNA 5B32A 4H9PB 1P3OD 3AZHC 3AYWC 4M6BA 4WU9C 1S32D 2LY8A 4CSRB 3REKC 1P3BC 4WU8D 1U35B 5GT3D 3X1UB 4XZQA 3AZLD 4LD9C 4YS3A 3REID 2AROB 1HQ3C 4ZUXD 4LD9A 5DNNA 4WU8C 3REJC 4QLCA 3UTAD 1JFIB 1KX4C 1P3KB 3C1BA 1KX4D 4WNNA 3AZFB 1ZLAC 2CV5C 5AV8C 5B32D 3B0CW 3O62B 1AOIC 2PYOD 2BYKB 5F99B 1P34C 3B6GC 3W96D 3O62D 1P34D 4JJNC 2NZDA 1TZYC 5FUGA 5CPJD 4YM6A 4WU9D 5B33A 1S32C 4H9NB 3B6FA 4G91B 1P3IC 3KWQB 2IO5B 5B1MB 3WKJD 3UTAB 3AZMC 5B0ZD 2NQBC 5CPJC 2AROD 3X1UD 2AROC 2FJ7D 4J8XB 4H9OB 5B40A 3MGPA 5AVCA 4WU8B 5DNMC 3LZ0C 3LJAC 3AV1D 2CV5D 3W97C 4X23A 3WA9A 5AY8D 3AZJC 1ZLAD 3O62C 1AOIB 3AYWB 5F99C 3KSYA 3C1BB 1U35C 3MVDD 1P3FB 3AZGD 1M1AD 1TZYB 4Z66A 2YFVB 5B1LA 3VH6A 1M19C 5GSUD 1EQZD 3UTAA 5B32C 5GT3A 4J8VB 3AZEC 1BH9A 5B32G 1KX5C 4H9NA 5B31B 5CPIC 5CP6D 5G49B 2PYOA 1P3AA 3LZ0B 3AN2C 1HQ3D 4ZUXC 3REIC 1P3GB 4J8XA 3MNNC 1BFMA 1P3IB 3MGQB 2HIOC 4XUJC 2F8NB 1P3LA 5B2IB 5AVCC 3RELC 3MGPC 5B40C 5BO0A 2AROA 1P3FC 3MNNA 5AV5B 5BS7C 2NZDB 4Z5TC 5B0ZA 3AZEB 1P3LB 3W99D 5CPID 3AFAA 1P3IA 5E5AA 3X1TB 2BYMB 4H9RA 3VH5W 3A6NA 3AZNB 1P3GA 1P3MD 3W98A 3UT9B 1M19D 5B0YC 5CPKD 4NE5A 3LZ1A 5CPKC 5DNMD 1ZLAA 5B1LC 5BO0B 3MGSB 3VH5T 4DRBA 3REHC 3WAAD 1WWIA 3LELA 3AZJD 3B0CT 4J8WD 5B1LD 3WTPD 4AWLC 1KX5B 4WZSB 3UTBD 4XZQC 4HGAB 3REHA 5E5AD 3W97A 5GT0A 3MGRD 2CWEA 3AYWA 5AV8D 4Z66B 3UTBC 3REKD 3AZID 1P3BD 5E5AB 3X1TA 3KXBD 3AZMD 1P3PA 1ULYA 1KX5D 3WKJC 4J8WB 2HIOB 4XUJB 3UT9C 4KUDC 5B40B 3MGPB 3A6NC 3AFAC 1S32A 3B6FC 3AZLC 2F8NA 4LD9D 3TU4D 5JRGA 5BS7A 3MNND 4XZQD 5CHLB 5AV6D 3AFAD 3X1TC 5AV8A 5FUGB 4HGAC 1M18D 4J8UA 3X1VD 1KX4A 3W99B 4KGCC 4NE6A 1ID3A 3MVDC 3X1SB 2NZDD 3W98D 5AV5D 1F1EA 1M1AA 4EO5B 1B6WA 3WAAA 5GXQC 4NFTA 2F8ND 2BYMA 2YFVA 3A6NB 1Q9CA 3MGQD 3AFAB 1WWSA 4XZQB 3X1UA 3B6FB 3AV2B 3X1UC 4ZBJB 4LD9B 3WTPA 1HQ3B 2HUEC 5BNXB 4Z66C 4KHAB 5AY8A 3WAAC 5CP6B 3REHD 1KX3B 3W97D 2RVQC 5B31D 3AZFA 2HIOD 4XUJD 3W98B 4UUZB 4J8WC 4JJND 4J8VD 3X1SC 3MVDA 5GSUB 3REKB 1P3BB 3MGRC 5B2JB 3RELA 1M1AB 5B24D 5G49A 4YS3D 1KX3A 1BH8A 5GXQD 5DNND 3REJB 4QLCD 3WTPB 5JRGC 4Z2MH 3LZ1B 2NQBB 1M18A 1EQZC 3X1VA 2CV5B 3AV1B 2F8NK 4KUDA 5DNMB 3B0DC 3W96A 2NQBD 3LZ1D 1P34A 3NQUB 4QLCB 1JFIA 1AOIA 5B33D 5B0ZB 5GXQB 3KWQC 5B1MC 3C1BC 3LELD 5B2JC 5CPJB 3REJA 3AZED 1M1AC 3NQUA 4NE3A 3W96B 5F99D 3LELC 5B32B 3AV1A 4G92C 4H9QA 3W97B 4X23D 3WA9D 3LJAA 5B1MA 3AZIC 5B24C 5CPKA 1P3MA 4ZUXB 5CPJA 3B6FD 5KDMB 3REIB 3B0BA 2JSSA 5AVBA 1P3GC 1BH9B 4KHAA 3LZ0D 3AZGA 5BNVB 5BNXA 4X23B 3WA9B 5GSUA 1TZYA 4Z5TA 3UT9A 4UUZA 2FJ7A 3B6GA 3KXBC 3C1CB
chains in the Genus database with same CATH superfamily
3V9RB 1EQZB 1H3OA 4H9RB 2ZM5A 3X1VB 3LELB 2CV5A 3AZGB 2Y2HA 3AZIA 1P3LC 5C3IC 4G92B 1M18B 1P3KC 3C1BD 5AV9B 5B33B 4QLCC 3X1SA 1ZLAB 1P3PD 3MNNB 1P3OC 4H9OA 3AN2A 5B0YB 3RELB 3MGQA 5JA4A 3TU4A 4WU9A 3NQJA 4G91C 2FJ7B 3KWQA 2L5AA 4CAYA 5AV6A 3EG5B 5GT3C 3REJD 3UTAC 3AZEA 5B0YA 5DNNB 5AV6C 3KXBB 5B1MD 3AZMB 3TU4C 3AZIB 4YS3B 3W98C 5B24B 1KU5A 5AV8B 4E45A 5B2JD 5AV9A 1U35A 3X1VC 1P34B 4J8VA 3B6GB 1M18C 3KUYA 5AVBD 3UTBB 4JJNB 1P3OA 1HTAA 4H9PA 5B1LB 1ID3C 4KGCA 3AZJB 4X23C 1P3FA 3WA9C 4J8UC 3REHB 1KX3D 2YFWA 3LZ0A 3VH6T 4H9SC 3R45A 3C1CC 1F66C 1BH8B 3AV2D 4J8XC 2FJ7C 1M19B 3AZLB 3UT9D 3MGSA 5KDMA 1TAFB 3REIA 5GT3B 2YFWB 4J8VC 5C3IB 1W2EA 3LJAB 3A6ND 1P3AC 1U35D 1N1JA 5AV9C 3X1TD 5AY8C 5B33C 5B31C 5CPIB 3EPHA 1A7WA 4JJNA 1P3OB 1KX5A 1P3AD 4KGCB 2RVQD 4KUDB 3X1SD 2UWXA 2G5HC 1M19A 5B24A 5GT0C 3R45B 3MGQC 5B2ID 5GXQA 3AV2A 5B2IC 4WU8A 5AVCB 5AV6B 3A1IA 4CAYB 2BYKA 5F99A 5DNNC 4YS3C 3TU4B 3AZJA 4R8PB 5AV5C 4WNNB 3AV2C 5B2JA 4ZBJC 1P3KA 3REKA 1P3BA 3NQJB 3AN2B 1R4VA 2HUEB 2F8NH 5B40D 3MGPD 3KUYD 3AZHA 5CP6C 3AZNC 1ID3B 3VH5A 3KXBA 4EO5C 3AZMA 2NQBA 4J8UB 4Z66D 5GSUC 1TZYD 3MGRB 3AZKA 1P3FD 4YM6D 3V9RA 1EQZA 2NZDC 3MGSC 4Z5TB 5AVBC 3WKJA 1H3OB 1P3AB 4H9SA 5JRGD 4AWLB 1KX3C 5CP6A 5AY8B 3WAAB 3UTBA 5BNVA 1P3PC 3MGSD 3AZHD 2HIOA 4XUJA 3WTPE 5GT0D 3MGRA 4CSRA 3LJAD 3AZKB 3AV1C 4J8XD 5AV5A 5CPKB 3KUYC 1HQ3A 1P3MB 3EPKA 5GT0B 3AZKD 3AZND 5B2IA 4H9QB 5B31G 3WKJB 5BT1C 3KWQD 3AZHB 4WV4B 5JA4B 4WU9B 1P3LD 5JRGB 3WTPC 4R8PC 3LZ1C 1F66B 1TAFA 4R8PA 4Z5TD 5AVBB 2PYOB 3W96C 3B6GD 4YM6B 2F8NG 5B31A 3AZFD 3B0DB 3VH6W 5E5AC 1KX4B 3W99A 1P3KD 1P3ID 1B67A 4J8UD 3O62A 5B0ZC 1P3GD 1ID3D 3C1CA 1F66A 3KUYB 3AN2D 4E44A 5DNMA 1S32B 3RELD 4DRAA 5B0YD 4R8PD 2IO5C 4Z2MG 2Y2NA 5BT1D 1P3PB 3AZLA 5AVCD 4J8WA 4ZUXA 2BG1A 5AV9D 3AZFC 3AZKC 2PYOC 3W99C 3MVDB 2ZY4A 4YM6C 5CPIA 3AZGC 3AYWD 1N1JB 1AOID 4KUDD 1P3MC 4KGCD 3C1CD 1F66D 3AZNA 5B32A 4H9PB 1P3OD 3AZHC 2G5IC 3AYWC 4M6BA 4WU9C 1S32D 2LY8A 4CSRB 3REKC 1P3BC 4WU8D 1U35B 4DQYB 5GT3D 3X1UB 4XZQA 3AZLD 4LD9C 4YS3A 3REID 2AROB 1HQ3C 4ZUXD 3P5JB 4LD9A 5DNNA 4WU8C 3REJC 4QLCA 3UTAD 1JFIB 1KX4C 2W8SA 1P3KB 3C1BA 1KX4D 4WNNA 3AZFB 1ZLAC 2CV5C 5AV8C 1T3UA 5B32D 3B0CW 3O62B 1AOIC 2PYOD 2BYKB 5F99B 1P34C 3B6GC 3W96D 3O62D 1P34D 4JJNC 2NZDA 3F6TA 1TZYC 5FUGA 5CPJD 4YM6A 4WU9D 5B33A 2Y2QA 4H9NB 1S32C 3B6FA 4G91B 1P3IC 3KWQB 2IO5B 5B1MB 3WKJD 3UTAB 3AZMC 5B0ZD 2NQBC 5CPJC 2AROD 3X1UD 2AROC 2FJ7D 4J8XB 4H9OB 5B40A 3MGPA 5AVCA 4WU8B 5DNMC 3LZ0C 3LJAC 3AV1D 2JE5A 2CV5D 3W97C 4X23A 3WA9A 5AY8D 2J8PA 2Y2JA 3AZJC 1ZLAD 3O62C 1AOIB 3AYWB 5F99C 3KSYA 3C1BB 1U35C 3MVDD 1P3FB 3AZGD 1M1AD 1TZYB 4Z66A 2YFVB 5B1LA 3AL0C 3VH6A 1M19C 5GSUD 1EQZD 3UTAA 5B32C 5GT3A 4J8VB 3AZEC 1BH9A 5B32G 1KX5C 4H9NA 5B31B 5CPIC 2DF4C 2JCHA 1PZRA 5CP6D 5G49B 2PYOA 1P3AA 3LZ0B 1Z2CB 3AN2C 1HQ3D 2Y2LA 4ZUXC 3REIC 1P3GB 4J8XA 3MNNC 1BFMA 1P3IB 3MGQB 2HIOC 4XUJC 2F8NB 1P3LA 5B2IB 5AVCC 3RELC 3MGPC 5B40C 5BO0A 2AROA 1P3FC 3MNNA 5AV5B 5BS7C 2NZDB 4Z5TC 5B0ZA 3AZEB 1P3LB 3W99D 5CPID 3AFAA 1P3IA 5E5AA 2FFFB 3X1TB 2BYMB 4H9RA 3VH5W 3A6NA 3AZNB 1P3GA 1P3MD 3W98A 3UT9B 1M19D 5B0YC 5CPKD 2Y2MA 4NE5A 2VQRA 3LZ1A 5CPKC 5DNMD 1ZLAA 5B1LC 3FDDA 5BO0B 3MGSB 3VH5T 4DRBA 3REHC 3WAAD 1WWIA 3LELA 3AZJD 3B0CT 4J8WD 5B1LD 3WTPD 4AWLC 1KX5B 4WZSB 3UTBD 4XZQC 4HGAB 4UPKA 5E5AD 3REHA 3W97A 5GT0A 3MGRD 2CWEA 2ZY2A 5AV8D 3AYWA 2XD1A 4Z66B 2Y2IA 3UTBC 3REKD 3AZID 1P3BD 5E5AB 3X1TA 3KXBD 3AZMD 1P3PA 1ULYA 1KX5D 3WKJC 4J8WB 2HIOB 4XUJB 3UT9C 2F2AC 4KUDC 3EPLA 5B40B 3MGPB 3A6NC 3AFAC 1S32A 3B6FC 3AZLC 2F8NA 4LD9D 3TU4D 5JRGA 5BS7A 3MNND 4XZQD 5CHLB 5AV6D 3AFAD 3X1TC 5AV8A 3KFUG 5FUGB 3EPJA 4HGAC 1M18D 4J8UA 3X1VD 1KX4A 3W99B 4KGCC 4NE6A 1ID3A 3MVDC 3X1SB 2NZDD 3W98D 5AV5D 1F1EA 1M1AA 4EO5B 1B6WA 3WAAA 5GXQC 4NFTA 2F8ND 2BYMA 2YFVA 3A6NB 1Q9CA 3MGQD 3AFAB 1WWSA 4XZQB 3X1UA 3B6FB 3AV2B 3X1UC 4ZBJB 4LD9B 3WTPA 1HQ3B 2Y2PA 2HUEC 5BNXB 4Z66C 4KHAB 5CP6B 3WAAC 5AY8A 3REHD 1KX3B 3W97D 2RVQC 5B31D 3AZFA 2HIOD 4XUJD 3W98B 4UUZB 4J8WC 4JJND 4J8VD 3X1SC 3MVDA 5GSUB 3REKB 1P3BB 3MGRC 5B2JB 2Y2OA 3RELA 1M1AB 5B24D 3H0LC 4WJ3C 5G49A 4YS3D 1KX3A 1BH8A 5GXQD 5DNND 3REJB 4QLCD 3WTPB 5JRGC 4Z2MH 3IP4C 3LZ1B 2NQBB 1M18A 2Y2GA 1EQZC 3X1VA 2CV5B 2Y2KA 3AV1B 2F8NK 4KUDA 5DNMB 3B0DC 3A1KA 3W96A 2NQBD 3LZ1D 1P34A 3NQUB 4QLCB 1JFIA 1AOIA 5B33D 5B0ZB 5GXQB 3KWQC 5B1MC 3C1BC 3LELD 5B2JC 2DQNC 5CPJB 3REJA 3AZED 1M1AC 3NQUA 4NE3A 3W96B 5F99D 3LELC 5B32B 3AV1A 4G92C 3H0RC 4H9QA 3W97B 4X23D 3WA9D 3LJAA 5B1MA 3AZIC 3H0MC 5B24C 2ZY5A 5CPKA 2RIQA 1P3MA 4ZUXB 5CPJA 3B6FD 5KDMB 3REIB 3B0BA 2JSSA 5AVBA 1P3GC 1BH9B 4KHAA 3LZ0D 3AZGA 5BNVB 5BNXA 4X23B 3WA9B 5GSUA 1TZYA 2ZY3A 4Z5TA 3UT9A 4UUZA 2XD5A 2FJ7A 3B6GA 3KXBC 3C1CB
chains in the Genus database with same CATH topology
3V9RB 1EQZB 1H3OA 4H9RB 2ZM5A 3X1VB 3LELB 2CV5A 3AZGB 2Y2HA 3AZIA 1P3LC 5C3IC 4G92B 1M18B 1P3KC 3C1BD 5AV9B 5B33B 4QLCC 3X1SA 1ZLAB 1P3PD 3MNNB 1P3OC 4H9OA 3AN2A 5B0YB 3RELB 3MGQA 5JA4A 3TU4A 4WU9A 3NQJA 4G91C 2FJ7B 3KWQA 2L5AA 4CAYA 5AV6A 3EG5B 5GT3C 3REJD 3UTAC 3AZEA 5B0YA 5DNNB 5AV6C 3KXBB 5B1MD 3AZMB 3TU4C 3AZIB 4YS3B 3W98C 5B24B 1KU5A 5AV8B 4E45A 5B2JD 5AV9A 1U35A 3X1VC 1P34B 4J8VA 3B6GB 1M18C 3KUYA 5AVBD 3UTBB 4JJNB 1P3OA 1HTAA 4H9PA 5B1LB 1ID3C 4KGCA 3AZJB 4X23C 1P3FA 3WA9C 4J8UC 3REHB 1KX3D 2YFWA 3LZ0A 3VH6T 4H9SC 3R45A 3C1CC 1F66C 1BH8B 3AV2D 4J8XC 2FJ7C 1M19B 3AZLB 3UT9D 3MGSA 5KDMA 1TAFB 3REIA 5GT3B 2YFWB 4J8VC 5C3IB 1W2EA 3LJAB 3A6ND 1P3AC 1U35D 1N1JA 5AV9C 3X1TD 5AY8C 5B33C 5B31C 5CPIB 3EPHA 1A7WA 4JJNA 1P3OB 1KX5A 1P3AD 4KGCB 2RVQD 4KUDB 3X1SD 2UWXA 2G5HC 1M19A 5B24A 5GT0C 3R45B 3MGQC 5B2ID 5GXQA 3AV2A 5B2IC 4WU8A 5AVCB 5AV6B 3A1IA 4CAYB 2BYKA 5F99A 5DNNC 4YS3C 3TU4B 3AZJA 4R8PB 5AV5C 4WNNB 3AV2C 5B2JA 4ZBJC 1P3KA 3REKA 1P3BA 3NQJB 3AN2B 1R4VA 2HUEB 2F8NH 5B40D 3MGPD 3KUYD 3AZHA 5CP6C 3AZNC 1ID3B 3VH5A 3KXBA 4EO5C 3AZMA 2NQBA 4J8UB 4Z66D 5GSUC 1TZYD 3MGRB 3AZKA 1P3FD 4YM6D 3V9RA 1EQZA 2NZDC 3MGSC 4Z5TB 5AVBC 3WKJA 1H3OB 1P3AB 4H9SA 5JRGD 4AWLB 1KX3C 5CP6A 5AY8B 3WAAB 3UTBA 5BNVA 1P3PC 3MGSD 3AZHD 2HIOA 4XUJA 3WTPE 5GT0D 3MGRA 4CSRA 3LJAD 3AZKB 3AV1C 4J8XD 5AV5A 5CPKB 3KUYC 1HQ3A 1P3MB 3EPKA 5GT0B 3AZKD 3AZND 5B2IA 4H9QB 5B31G 3WKJB 5BT1C 3KWQD 3AZHB 4WV4B 5JA4B 4WU9B 1P3LD 5JRGB 3WTPC 4R8PC 3LZ1C 1F66B 1TAFA 4R8PA 4Z5TD 5AVBB 2PYOB 3W96C 3B6GD 4YM6B 2F8NG 5B31A 3AZFD 3B0DB 3VH6W 5E5AC 1KX4B 3W99A 1P3KD 1P3ID 1B67A 4J8UD 3O62A 5B0ZC 1P3GD 1ID3D 3C1CA 1F66A 3KUYB 3AN2D 4E44A 5DNMA 1S32B 3RELD 4DRAA 5B0YD 4R8PD 2IO5C 4Z2MG 2Y2NA 5BT1D 1P3PB 3AZLA 5AVCD 4J8WA 4ZUXA 2BG1A 5AV9D 3AZFC 3AZKC 2PYOC 3W99C 3MVDB 2ZY4A 4YM6C 5CPIA 3AZGC 3AYWD 1N1JB 1AOID 4KUDD 1P3MC 4KGCD 3C1CD 1F66D 3AZNA 5B32A 4H9PB 1P3OD 3AZHC 2G5IC 3AYWC 4M6BA 4WU9C 1S32D 2LY8A 4CSRB 3REKC 1P3BC 4WU8D 1U35B 4DQYB 5GT3D 3X1UB 4XZQA 3AZLD 4LD9C 4YS3A 3REID 2AROB 1HQ3C 4ZUXD 3P5JB 4LD9A 5DNNA 4WU8C 3REJC 4QLCA 3UTAD 1JFIB 1KX4C 2W8SA 1P3KB 3C1BA 1KX4D 4WNNA 3AZFB 1ZLAC 2CV5C 5AV8C 1T3UA 5B32D 3B0CW 3O62B 1AOIC 2PYOD 2BYKB 5F99B 1P34C 3B6GC 3W96D 3O62D 1P34D 4JJNC 2NZDA 3F6TA 1TZYC 5FUGA 5CPJD 4YM6A 4WU9D 5B33A 2Y2QA 4H9NB 1S32C 3B6FA 4G91B 1P3IC 3KWQB 2IO5B 5B1MB 3WKJD 3UTAB 3AZMC 5B0ZD 2NQBC 5CPJC 2AROD 3X1UD 2AROC 2FJ7D 4J8XB 4H9OB 5B40A 3MGPA 5AVCA 4WU8B 5DNMC 3LZ0C 3LJAC 3AV1D 2JE5A 2CV5D 3W97C 4X23A 3WA9A 5AY8D 2J8PA 2Y2JA 3AZJC 1ZLAD 3O62C 1AOIB 3AYWB 5F99C 3KSYA 3C1BB 1U35C 3MVDD 1P3FB 3AZGD 1M1AD 1TZYB 4Z66A 2YFVB 5B1LA 3AL0C 3VH6A 1M19C 5GSUD 1EQZD 3UTAA 5B32C 5GT3A 4J8VB 3AZEC 1BH9A 5B32G 1KX5C 4H9NA 5B31B 5CPIC 2DF4C 2JCHA 1PZRA 5CP6D 5G49B 2PYOA 1P3AA 3LZ0B 1Z2CB 3AN2C 1HQ3D 2Y2LA 4ZUXC 3REIC 1P3GB 4J8XA 3MNNC 1BFMA 1P3IB 3MGQB 2HIOC 4XUJC 2F8NB 1P3LA 5B2IB 5AVCC 3RELC 3MGPC 5B40C 5BO0A 2AROA 1P3FC 3MNNA 5AV5B 5BS7C 2NZDB 4Z5TC 5B0ZA 3AZEB 1P3LB 3W99D 5CPID 3AFAA 1P3IA 5E5AA 2FFFB 3X1TB 2BYMB 4H9RA 3VH5W 3A6NA 3AZNB 1P3GA 1P3MD 3W98A 3UT9B 1M19D 5B0YC 5CPKD 2Y2MA 4NE5A 2VQRA 3LZ1A 5CPKC 5DNMD 1ZLAA 5B1LC 3FDDA 5BO0B 3MGSB 3VH5T 4DRBA 3REHC 3WAAD 1WWIA 3LELA 3AZJD 3B0CT 4J8WD 5B1LD 3WTPD 4AWLC 1KX5B 4WZSB 3UTBD 4XZQC 4HGAB 4UPKA 5E5AD 3REHA 3W97A 5GT0A 3MGRD 2CWEA 2ZY2A 5AV8D 3AYWA 2XD1A 4Z66B 2Y2IA 3UTBC 3REKD 3AZID 1P3BD 5E5AB 3X1TA 3KXBD 3AZMD 1P3PA 1ULYA 1KX5D 3WKJC 4J8WB 2HIOB 4XUJB 3UT9C 2F2AC 4KUDC 3EPLA 5B40B 3MGPB 3A6NC 3AFAC 1S32A 3B6FC 3AZLC 2F8NA 4LD9D 3TU4D 5JRGA 5BS7A 3MNND 4XZQD 5CHLB 5AV6D 3AFAD 3X1TC 5AV8A 3KFUG 5FUGB 3EPJA 4HGAC 1M18D 4J8UA 3X1VD 1KX4A 3W99B 4KGCC 4NE6A 1ID3A 3MVDC 3X1SB 2NZDD 3W98D 5AV5D 1F1EA 1M1AA 4EO5B 1B6WA 3WAAA 5GXQC 4NFTA 2F8ND 2BYMA 2YFVA 3A6NB 1Q9CA 3MGQD 3AFAB 1WWSA 4XZQB 3X1UA 3B6FB 3AV2B 3X1UC 4ZBJB 4LD9B 3WTPA 1HQ3B 2Y2PA 2HUEC 5BNXB 4Z66C 4KHAB 5CP6B 3WAAC 5AY8A 3REHD 1KX3B 3W97D 2RVQC 5B31D 3AZFA 2HIOD 4XUJD 3W98B 4UUZB 4J8WC 4JJND 4J8VD 3X1SC 3MVDA 5GSUB 3REKB 1P3BB 3MGRC 5B2JB 2Y2OA 3RELA 1M1AB 5B24D 3H0LC 4WJ3C 5G49A 4YS3D 1KX3A 1BH8A 5GXQD 5DNND 3REJB 4QLCD 3WTPB 5JRGC 4Z2MH 3IP4C 3LZ1B 2NQBB 1M18A 2Y2GA 1EQZC 3X1VA 2CV5B 2Y2KA 3AV1B 2F8NK 4KUDA 5DNMB 3B0DC 3A1KA 3W96A 2NQBD 3LZ1D 1P34A 3NQUB 4QLCB 1JFIA 1AOIA 5B33D 5B0ZB 5GXQB 3KWQC 5B1MC 3C1BC 3LELD 5B2JC 2DQNC 5CPJB 3REJA 3AZED 1M1AC 3NQUA 4NE3A 3W96B 5F99D 3LELC 5B32B 3AV1A 4G92C 3H0RC 4H9QA 3W97B 4X23D 3WA9D 3LJAA 5B1MA 3AZIC 3H0MC 5B24C 2ZY5A 5CPKA 2RIQA 1P3MA 4ZUXB 5CPJA 3B6FD 5KDMB 3REIB 3B0BA 2JSSA 5AVBA 1P3GC 1BH9B 4KHAA 3LZ0D 3AZGA 5BNVB 5BNXA 4X23B 3WA9B 5GSUA 1TZYA 2ZY3A 4Z5TA 3UT9A 4UUZA 2XD5A 2FJ7A 3B6GA 3KXBC 3C1CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9R B;  1EQZ B;  1H3O A;  4H9R B;  3X1V B;  3LEL B;  2CV5 A;  3AZG B;  3AZI A;  1P3L C;  5C3I C;  4G92 B;  1M18 B;  1P3K C;  3C1B D;  5AV9 B;  5B33 B;  4QLC C;  3X1S A;  1ZLA B;  1P3P D;  3MNN B;  1P3O C;  4H9O A;  3AN2 A;  5B0Y B;  3REL B;  3MGQ A;  5JA4 A;  3TU4 A;  4WU9 A;  3NQJ A;  4G91 C;  2FJ7 B;  3KWQ A;  2L5A A;  4CAY A;  5AV6 A;  5GT3 C;  3REJ D;  3UTA C;  3AZE A;  5B0Y A;  5DNN B;  5AV6 C;  3KXB B;  5B1M D;  3AZM B;  3TU4 C;  3AZI B;  4YS3 B;  3W98 C;  5B24 B;  1KU5 A;  5AV8 B;  4E45 A;  5B2J D;  5AV9 A;  1U35 A;  3X1V C;  1P34 B;  4J8V A;  3B6G B;  1M18 C;  3KUY A;  5AVB D;  3UTB B;  4JJN B;  1P3O A;  1HTA A;  4H9P A;  5B1L B;  1ID3 C;  4KGC A;  3AZJ B;  4X23 C;  1P3F A;  3WA9 C;  4J8U C;  3REH B;  1KX3 D;  2YFW A;  3LZ0 A;  3VH6 T;  4H9S C;  3R45 A;  3C1C C;  1F66 C;  1BH8 B;  3AV2 D;  4J8X C;  2FJ7 C;  1M19 B;  3AZL B;  3UT9 D;  3MGS A;  5KDM A;  1TAF B;  3REI A;  5GT3 B;  2YFW B;  4J8V C;  5C3I B;  3LJA B;  3A6N D;  1P3A C;  1U35 D;  1N1J A;  5AV9 C;  3X1T D;  5AY8 C;  5B33 C;  5B31 C;  5CPI B;  1A7W A;  4JJN A;  1P3O B;  1KX5 A;  1P3A D;  4KGC B;  2RVQ D;  4KUD B;  3X1S D;  1M19 A;  5B24 A;  5GT0 C;  3R45 B;  3MGQ C;  5B2I D;  5GXQ A;  3AV2 A;  5B2I C;  4WU8 A;  5AVC B;  4CAY B;  5DNN C;  5AV6 B;  2BYK A;  5F99 A;  4YS3 C;  3TU4 B;  3AZJ A;  4R8P B;  5AV5 C;  4WNN B;  3AV2 C;  5B2J A;  4ZBJ C;  1P3K A;  3REK A;  1P3B A;  3NQJ B;  3AN2 B;  1R4V A;  2HUE B;  2F8N H;  5B40 D;  3MGP D;  3KUY D;  3AZH A;  5CP6 C;  3AZN C;  1ID3 B;  3VH5 A;  3KXB A;  4EO5 C;  3AZM A;  2NQB A;  4J8U B;  4Z66 D;  5GSU C;  1TZY D;  3MGR B;  3AZK A;  1P3F D;  4YM6 D;  3V9R A;  1EQZ A;  2NZD C;  3MGS C;  4Z5T B;  5AVB C;  3WKJ A;  1H3O B;  1P3A B;  4H9S A;  5JRG D;  4AWL B;  1KX3 C;  5CP6 A;  5AY8 B;  3WAA B;  3UTB A;  5BNV A;  1P3P C;  3MGS D;  3AZH D;  2HIO A;  4XUJ A;  3WTP E;  5GT0 D;  3MGR A;  4CSR A;  3LJA D;  3AZK B;  3AV1 C;  4J8X D;  5AV5 A;  5CPK B;  3KUY C;  1HQ3 A;  1P3M B;  5GT0 B;  3AZK D;  3AZN D;  5B2I A;  4H9Q B;  5B31 G;  3WKJ B;  5BT1 C;  3KWQ D;  3AZH B;  4WV4 B;  5JA4 B;  4WU9 B;  1P3L D;  5JRG B;  3WTP C;  4R8P C;  3LZ1 C;  1F66 B;  1TAF A;  4R8P A;  4Z5T D;  5AVB B;  2PYO B;  3W96 C;  3B6G D;  4YM6 B;  2F8N G;  5B31 A;  3AZF D;  3B0D B;  3VH6 W;  5E5A C;  1KX4 B;  3W99 A;  1P3K D;  1P3I D;  1B67 A;  4J8U D;  3O62 A;  5B0Z C;  1P3G D;  1ID3 D;  3C1C A;  1F66 A;  3KUY B;  3AN2 D;  4E44 A;  5DNM A;  1S32 B;  3REL D;  4DRA A;  5B0Y D;  4R8P D;  2IO5 C;  4Z2M G;  5BT1 D;  1P3P B;  3AZL A;  5AVC D;  4J8W A;  4ZUX A;  5AV9 D;  3AZF C;  3AZK C;  2PYO C;  3W99 C;  3MVD B;  4YM6 C;  5CPI A;  3AZG C;  3AYW D;  1N1J B;  1AOI D;  4KUD D;  1P3M C;  4KGC D;  3C1C D;  1F66 D;  3AZN A;  5B32 A;  4H9P B;  1P3O D;  3AZH C;  3AYW C;  4M6B A;  4WU9 C;  1S32 D;  2LY8 A;  4CSR B;  3REK C;  1P3B C;  4WU8 D;  1U35 B;  5GT3 D;  3X1U B;  4XZQ A;  3AZL D;  4LD9 C;  4YS3 A;  3REI D;  2ARO B;  1HQ3 C;  4ZUX D;  4LD9 A;  5DNN A;  4WU8 C;  3REJ C;  4QLC A;  3UTA D;  1JFI B;  1KX4 C;  1P3K B;  3C1B A;  1KX4 D;  4WNN A;  3AZF B;  1ZLA C;  2CV5 C;  5AV8 C;  5B32 D;  3B0C W;  3O62 B;  1AOI C;  2PYO D;  2BYK B;  5F99 B;  1P34 C;  3B6G C;  3W96 D;  3O62 D;  1P34 D;  4JJN C;  2NZD A;  1TZY C;  5FUG A;  5CPJ D;  4YM6 A;  4WU9 D;  5B33 A;  1S32 C;  4H9N B;  3B6F A;  4G91 B;  1P3I C;  3KWQ B;  2IO5 B;  5B1M B;  3WKJ D;  3UTA B;  3AZM C;  5B0Z D;  2NQB C;  5CPJ C;  2ARO D;  3X1U D;  2ARO C;  2FJ7 D;  4J8X B;  4H9O B;  5B40 A;  3MGP A;  5AVC A;  4WU8 B;  5DNM C;  3LZ0 C;  3LJA C;  3AV1 D;  2CV5 D;  3W97 C;  4X23 A;  3WA9 A;  5AY8 D;  3AZJ C;  1ZLA D;  3O62 C;  1AOI B;  3AYW B;  5F99 C;  3KSY A;  3C1B B;  1U35 C;  3MVD D;  1P3F B;  3AZG D;  1M1A D;  1TZY B;  4Z66 A;  2YFV B;  5B1L A;  3VH6 A;  1M19 C;  5GSU D;  1EQZ D;  3UTA A;  5B32 C;  5GT3 A;  4J8V B;  3AZE C;  1BH9 A;  5B32 G;  1KX5 C;  4H9N A;  5B31 B;  5CPI C;  5CP6 D;  5G49 B;  2PYO A;  1P3A A;  3LZ0 B;  3AN2 C;  1HQ3 D;  4ZUX C;  3REI C;  1P3G B;  4J8X A;  3MNN C;  1BFM A;  1P3I B;  3MGQ B;  2HIO C;  4XUJ C;  2F8N B;  1P3L A;  5B2I B;  5AVC C;  3REL C;  3MGP C;  5B40 C;  5BO0 A;  2ARO A;  1P3F C;  3MNN A;  5AV5 B;  5BS7 C;  2NZD B;  4Z5T C;  5B0Z A;  3AZE B;  1P3L B;  3W99 D;  5CPI D;  3AFA A;  1P3I A;  5E5A A;  3X1T B;  2BYM B;  4H9R A;  3VH5 W;  3A6N A;  3AZN B;  1P3G A;  1P3M D;  3W98 A;  3UT9 B;  1M19 D;  5B0Y C;  5CPK D;  4NE5 A;  3LZ1 A;  5CPK C;  5DNM D;  1ZLA A;  5B1L C;  5BO0 B;  3MGS B;  3VH5 T;  4DRB A;  3REH C;  3WAA D;  1WWI A;  3LEL A;  3AZJ D;  3B0C T;  4J8W D;  5B1L D;  3WTP D;  4AWL C;  1KX5 B;  4WZS B;  3UTB D;  4XZQ C;  4HGA B;  3REH A;  5E5A D;  3W97 A;  5GT0 A;  3MGR D;  2CWE A;  3AYW A;  5AV8 D;  4Z66 B;  3UTB C;  3REK D;  3AZI D;  1P3B D;  5E5A B;  3X1T A;  3KXB D;  3AZM D;  1P3P A;  1ULY A;  1KX5 D;  3WKJ C;  4J8W B;  2HIO B;  4XUJ B;  3UT9 C;  4KUD C;  5B40 B;  3MGP B;  3A6N C;  3AFA C;  1S32 A;  3B6F C;  3AZL C;  2F8N A;  4LD9 D;  3TU4 D;  5JRG A;  5BS7 A;  3MNN D;  4XZQ D;  5CHL B;  5AV6 D;  3AFA D;  3X1T C;  5AV8 A;  5FUG B;  4HGA C;  1M18 D;  4J8U A;  3X1V D;  1KX4 A;  3W99 B;  4KGC C;  4NE6 A;  1ID3 A;  3MVD C;  3X1S B;  2NZD D;  3W98 D;  5AV5 D;  1F1E A;  1M1A A;  4EO5 B;  1B6W A;  3WAA A;  5GXQ C;  4NFT A;  2F8N D;  2BYM A;  2YFV A;  3A6N B;  1Q9C A;  3MGQ D;  3AFA B;  1WWS A;  4XZQ B;  3X1U A;  3B6F B;  3AV2 B;  3X1U C;  4ZBJ B;  4LD9 B;  3WTP A;  1HQ3 B;  2HUE C;  5BNX B;  4Z66 C;  4KHA B;  5AY8 A;  3WAA C;  5CP6 B;  3REH D;  1KX3 B;  3W97 D;  2RVQ C;  5B31 D;  3AZF A;  2HIO D;  4XUJ D;  3W98 B;  4UUZ B;  4J8W C;  4JJN D;  4J8V D;  3X1S C;  3MVD A;  5GSU B;  3REK B;  1P3B B;  3MGR C;  5B2J B;  3REL A;  1M1A B;  5B24 D;  5G49 A;  4YS3 D;  1KX3 A;  1BH8 A;  5GXQ D;  5DNN D;  3REJ B;  4QLC D;  3WTP B;  5JRG C;  4Z2M H;  3LZ1 B;  2NQB B;  1M18 A;  1EQZ C;  3X1V A;  2CV5 B;  3AV1 B;  2F8N K;  4KUD A;  5DNM B;  3B0D C;  3W96 A;  2NQB D;  3LZ1 D;  1P34 A;  3NQU B;  4QLC B;  1JFI A;  1AOI A;  5B33 D;  5B0Z B;  5GXQ B;  3KWQ C;  5B1M C;  3C1B C;  3LEL D;  5B2J C;  5CPJ B;  3REJ A;  3AZE D;  1M1A C;  3NQU A;  4NE3 A;  3W96 B;  5F99 D;  3LEL C;  5B32 B;  3AV1 A;  4G92 C;  4H9Q A;  3W97 B;  4X23 D;  3WA9 D;  3LJA A;  5B1M A;  3AZI C;  5B24 C;  5CPK A;  1P3M A;  4ZUX B;  5CPJ A;  3B6F D;  5KDM B;  3REI B;  3B0B A;  2JSS A;  5AVB A;  1P3G C;  1BH9 B;  4KHA A;  3LZ0 D;  3AZG A;  5BNV B;  5BNX A;  4X23 B;  3WA9 B;  5GSU A;  1TZY A;  4Z5T A;  3UT9 A;  4UUZ A;  2FJ7 A;  3B6G A;  3KXB C;  3C1C B; 
#chains in the Genus database with same CATH topology
 3V9R B;  1EQZ B;  1H3O A;  4H9R B;  2ZM5 A;  3X1V B;  3LEL B;  2CV5 A;  3AZG B;  2Y2H A;  3AZI A;  1P3L C;  5C3I C;  4G92 B;  1M18 B;  1P3K C;  3C1B D;  5AV9 B;  5B33 B;  4QLC C;  3X1S A;  1ZLA B;  1P3P D;  3MNN B;  1P3O C;  4H9O A;  3AN2 A;  5B0Y B;  3REL B;  3MGQ A;  5JA4 A;  3TU4 A;  4WU9 A;  3NQJ A;  4G91 C;  2FJ7 B;  3KWQ A;  2L5A A;  4CAY A;  5AV6 A;  3EG5 B;  5GT3 C;  3REJ D;  3UTA C;  3AZE A;  5B0Y A;  5DNN B;  5AV6 C;  3KXB B;  5B1M D;  3AZM B;  3TU4 C;  3AZI B;  4YS3 B;  3W98 C;  5B24 B;  1KU5 A;  5AV8 B;  4E45 A;  5B2J D;  5AV9 A;  1U35 A;  3X1V C;  1P34 B;  4J8V A;  3B6G B;  1M18 C;  3KUY A;  5AVB D;  3UTB B;  4JJN B;  1P3O A;  1HTA A;  4H9P A;  5B1L B;  1ID3 C;  4KGC A;  3AZJ B;  4X23 C;  1P3F A;  3WA9 C;  4J8U C;  3REH B;  1KX3 D;  2YFW A;  3LZ0 A;  3VH6 T;  4H9S C;  3R45 A;  3C1C C;  1F66 C;  1BH8 B;  3AV2 D;  4J8X C;  2FJ7 C;  1M19 B;  3AZL B;  3UT9 D;  3MGS A;  5KDM A;  1TAF B;  3REI A;  5GT3 B;  2YFW B;  4J8V C;  5C3I B;  1W2E A;  3LJA B;  3A6N D;  1P3A C;  1U35 D;  1N1J A;  5AV9 C;  3X1T D;  5AY8 C;  5B33 C;  5B31 C;  5CPI B;  3EPH A;  1A7W A;  4JJN A;  1P3O B;  1KX5 A;  1P3A D;  4KGC B;  2RVQ D;  4KUD B;  3X1S D;  2UWX A;  2G5H C;  1M19 A;  5B24 A;  5GT0 C;  3R45 B;  3MGQ C;  5B2I D;  5GXQ A;  3AV2 A;  5B2I C;  4WU8 A;  5AVC B;  5AV6 B;  3A1I A;  4CAY B;  2BYK A;  5F99 A;  5DNN C;  4YS3 C;  3TU4 B;  3AZJ A;  4R8P B;  5AV5 C;  4WNN B;  3AV2 C;  5B2J A;  4ZBJ C;  1P3K A;  3REK A;  1P3B A;  3NQJ B;  3AN2 B;  1R4V A;  2HUE B;  2F8N H;  5B40 D;  3MGP D;  3KUY D;  3AZH A;  5CP6 C;  3AZN C;  1ID3 B;  3VH5 A;  3KXB A;  4EO5 C;  3AZM A;  2NQB A;  4J8U B;  4Z66 D;  5GSU C;  1TZY D;  3MGR B;  3AZK A;  1P3F D;  4YM6 D;  3V9R A;  1EQZ A;  2NZD C;  3MGS C;  4Z5T B;  5AVB C;  3WKJ A;  1H3O B;  1P3A B;  4H9S A;  5JRG D;  4AWL B;  1KX3 C;  5CP6 A;  5AY8 B;  3WAA B;  3UTB A;  5BNV A;  1P3P C;  3MGS D;  3AZH D;  2HIO A;  4XUJ A;  3WTP E;  5GT0 D;  3MGR A;  4CSR A;  3LJA D;  3AZK B;  3AV1 C;  4J8X D;  5AV5 A;  5CPK B;  3KUY C;  1HQ3 A;  1P3M B;  3EPK A;  5GT0 B;  3AZK D;  3AZN D;  5B2I A;  4H9Q B;  5B31 G;  3WKJ B;  5BT1 C;  3KWQ D;  3AZH B;  4WV4 B;  5JA4 B;  4WU9 B;  1P3L D;  5JRG B;  3WTP C;  4R8P C;  3LZ1 C;  1F66 B;  1TAF A;  4R8P A;  4Z5T D;  5AVB B;  2PYO B;  3W96 C;  3B6G D;  4YM6 B;  2F8N G;  5B31 A;  3AZF D;  3B0D B;  3VH6 W;  5E5A C;  1KX4 B;  3W99 A;  1P3K D;  1P3I D;  1B67 A;  4J8U D;  3O62 A;  5B0Z C;  1P3G D;  1ID3 D;  3C1C A;  1F66 A;  3KUY B;  3AN2 D;  4E44 A;  5DNM A;  1S32 B;  3REL D;  4DRA A;  5B0Y D;  4R8P D;  2IO5 C;  4Z2M G;  2Y2N A;  5BT1 D;  1P3P B;  3AZL A;  5AVC D;  4J8W A;  4ZUX A;  2BG1 A;  5AV9 D;  3AZF C;  3AZK C;  2PYO C;  3W99 C;  3MVD B;  2ZY4 A;  4YM6 C;  5CPI A;  3AZG C;  3AYW D;  1N1J B;  1AOI D;  4KUD D;  1P3M C;  4KGC D;  3C1C D;  1F66 D;  3AZN A;  5B32 A;  4H9P B;  1P3O D;  3AZH C;  2G5I C;  3AYW C;  4M6B A;  4WU9 C;  1S32 D;  2LY8 A;  4CSR B;  3REK C;  1P3B C;  4WU8 D;  1U35 B;  4DQY B;  5GT3 D;  3X1U B;  4XZQ A;  3AZL D;  4LD9 C;  4YS3 A;  3REI D;  2ARO B;  1HQ3 C;  4ZUX D;  3P5J B;  4LD9 A;  5DNN A;  4WU8 C;  3REJ C;  4QLC A;  3UTA D;  1JFI B;  1KX4 C;  2W8S A;  1P3K B;  3C1B A;  1KX4 D;  4WNN A;  3AZF B;  1ZLA C;  2CV5 C;  5AV8 C;  1T3U A;  5B32 D;  3B0C W;  3O62 B;  1AOI C;  2PYO D;  2BYK B;  5F99 B;  1P34 C;  3B6G C;  3W96 D;  3O62 D;  1P34 D;  4JJN C;  2NZD A;  3F6T A;  1TZY C;  5FUG A;  5CPJ D;  4YM6 A;  4WU9 D;  5B33 A;  2Y2Q A;  4H9N B;  1S32 C;  3B6F A;  4G91 B;  1P3I C;  3KWQ B;  2IO5 B;  5B1M B;  3WKJ D;  3UTA B;  3AZM C;  5B0Z D;  2NQB C;  5CPJ C;  2ARO D;  3X1U D;  2ARO C;  2FJ7 D;  4J8X B;  4H9O B;  5B40 A;  3MGP A;  5AVC A;  4WU8 B;  5DNM C;  3LZ0 C;  3LJA C;  3AV1 D;  2JE5 A;  2CV5 D;  3W97 C;  4X23 A;  3WA9 A;  5AY8 D;  2J8P A;  2Y2J A;  3AZJ C;  1ZLA D;  3O62 C;  1AOI B;  3AYW B;  5F99 C;  3KSY A;  3C1B B;  1U35 C;  3MVD D;  1P3F B;  3AZG D;  1M1A D;  1TZY B;  4Z66 A;  2YFV B;  5B1L A;  3AL0 C;  3VH6 A;  1M19 C;  5GSU D;  1EQZ D;  3UTA A;  5B32 C;  5GT3 A;  4J8V B;  3AZE C;  1BH9 A;  5B32 G;  1KX5 C;  4H9N A;  5B31 B;  5CPI C;  2DF4 C;  2JCH A;  1PZR A;  5CP6 D;  5G49 B;  2PYO A;  1P3A A;  3LZ0 B;  1Z2C B;  3AN2 C;  1HQ3 D;  2Y2L A;  4ZUX C;  3REI C;  1P3G B;  4J8X A;  3MNN C;  1BFM A;  1P3I B;  3MGQ B;  2HIO C;  4XUJ C;  2F8N B;  1P3L A;  5B2I B;  5AVC C;  3REL C;  3MGP C;  5B40 C;  5BO0 A;  2ARO A;  1P3F C;  3MNN A;  5AV5 B;  5BS7 C;  2NZD B;  4Z5T C;  5B0Z A;  3AZE B;  1P3L B;  3W99 D;  5CPI D;  3AFA A;  1P3I A;  5E5A A;  2FFF B;  3X1T B;  2BYM B;  4H9R A;  3VH5 W;  3A6N A;  3AZN B;  1P3G A;  1P3M D;  3W98 A;  3UT9 B;  1M19 D;  5B0Y C;  5CPK D;  2Y2M A;  4NE5 A;  2VQR A;  3LZ1 A;  5CPK C;  5DNM D;  1ZLA A;  5B1L C;  3FDD A;  5BO0 B;  3MGS B;  3VH5 T;  4DRB A;  3REH C;  3WAA D;  1WWI A;  3LEL A;  3AZJ D;  3B0C T;  4J8W D;  5B1L D;  3WTP D;  4AWL C;  1KX5 B;  4WZS B;  3UTB D;  4XZQ C;  4HGA B;  4UPK A;  5E5A D;  3REH A;  3W97 A;  5GT0 A;  3MGR D;  2CWE A;  2ZY2 A;  5AV8 D;  3AYW A;  2XD1 A;  4Z66 B;  2Y2I A;  3UTB C;  3REK D;  3AZI D;  1P3B D;  5E5A B;  3X1T A;  3KXB D;  3AZM D;  1P3P A;  1ULY A;  1KX5 D;  3WKJ C;  4J8W B;  2HIO B;  4XUJ B;  3UT9 C;  2F2A C;  4KUD C;  3EPL A;  5B40 B;  3MGP B;  3A6N C;  3AFA C;  1S32 A;  3B6F C;  3AZL C;  2F8N A;  4LD9 D;  3TU4 D;  5JRG A;  5BS7 A;  3MNN D;  4XZQ D;  5CHL B;  5AV6 D;  3AFA D;  3X1T C;  5AV8 A;  3KFU G;  5FUG B;  3EPJ A;  4HGA C;  1M18 D;  4J8U A;  3X1V D;  1KX4 A;  3W99 B;  4KGC C;  4NE6 A;  1ID3 A;  3MVD C;  3X1S B;  2NZD D;  3W98 D;  5AV5 D;  1F1E A;  1M1A A;  4EO5 B;  1B6W A;  3WAA A;  5GXQ C;  4NFT A;  2F8N D;  2BYM A;  2YFV A;  3A6N B;  1Q9C A;  3MGQ D;  3AFA B;  1WWS A;  4XZQ B;  3X1U A;  3B6F B;  3AV2 B;  3X1U C;  4ZBJ B;  4LD9 B;  3WTP A;  1HQ3 B;  2Y2P A;  2HUE C;  5BNX B;  4Z66 C;  4KHA B;  5CP6 B;  3WAA C;  5AY8 A;  3REH D;  1KX3 B;  3W97 D;  2RVQ C;  5B31 D;  3AZF A;  2HIO D;  4XUJ D;  3W98 B;  4UUZ B;  4J8W C;  4JJN D;  4J8V D;  3X1S C;  3MVD A;  5GSU B;  3REK B;  1P3B B;  3MGR C;  5B2J B;  2Y2O A;  3REL A;  1M1A B;  5B24 D;  3H0L C;  4WJ3 C;  5G49 A;  4YS3 D;  1KX3 A;  1BH8 A;  5GXQ D;  5DNN D;  3REJ B;  4QLC D;  3WTP B;  5JRG C;  4Z2M H;  3IP4 C;  3LZ1 B;  2NQB B;  1M18 A;  2Y2G A;  1EQZ C;  3X1V A;  2CV5 B;  2Y2K A;  3AV1 B;  2F8N K;  4KUD A;  5DNM B;  3B0D C;  3A1K A;  3W96 A;  2NQB D;  3LZ1 D;  1P34 A;  3NQU B;  4QLC B;  1JFI A;  1AOI A;  5B33 D;  5B0Z B;  5GXQ B;  3KWQ C;  5B1M C;  3C1B C;  3LEL D;  5B2J C;  2DQN C;  5CPJ B;  3REJ A;  3AZE D;  1M1A C;  3NQU A;  4NE3 A;  3W96 B;  5F99 D;  3LEL C;  5B32 B;  3AV1 A;  4G92 C;  3H0R C;  4H9Q A;  3W97 B;  4X23 D;  3WA9 D;  3LJA A;  5B1M A;  3AZI C;  3H0M C;  5B24 C;  2ZY5 A;  5CPK A;  2RIQ A;  1P3M A;  4ZUX B;  5CPJ A;  3B6F D;  5KDM B;  3REI B;  3B0B A;  2JSS A;  5AVB A;  1P3G C;  1BH9 B;  4KHA A;  3LZ0 D;  3AZG A;  5BNV B;  5BNX A;  4X23 B;  3WA9 B;  5GSU A;  1TZY A;  2ZY3 A;  4Z5T A;  3UT9 A;  4UUZ A;  2XD5 A;  2FJ7 A;  3B6G A;  3KXB C;  3C1C B; 
#chains in the Genus database with same CATH homology
 3V9R B;  1EQZ B;  1H3O A;  4H9R B;  2ZM5 A;  3X1V B;  3LEL B;  2CV5 A;  3AZG B;  2Y2H A;  3AZI A;  1P3L C;  5C3I C;  4G92 B;  1M18 B;  1P3K C;  3C1B D;  5AV9 B;  5B33 B;  4QLC C;  3X1S A;  1ZLA B;  1P3P D;  3MNN B;  1P3O C;  4H9O A;  3AN2 A;  5B0Y B;  3REL B;  3MGQ A;  5JA4 A;  3TU4 A;  4WU9 A;  3NQJ A;  4G91 C;  2FJ7 B;  3KWQ A;  2L5A A;  4CAY A;  5AV6 A;  3EG5 B;  5GT3 C;  3REJ D;  3UTA C;  3AZE A;  5B0Y A;  5DNN B;  5AV6 C;  3KXB B;  5B1M D;  3AZM B;  3TU4 C;  3AZI B;  4YS3 B;  3W98 C;  5B24 B;  1KU5 A;  5AV8 B;  4E45 A;  5B2J D;  5AV9 A;  1U35 A;  3X1V C;  1P34 B;  4J8V A;  3B6G B;  1M18 C;  3KUY A;  5AVB D;  3UTB B;  4JJN B;  1P3O A;  1HTA A;  4H9P A;  5B1L B;  1ID3 C;  4KGC A;  3AZJ B;  4X23 C;  1P3F A;  3WA9 C;  4J8U C;  3REH B;  1KX3 D;  2YFW A;  3LZ0 A;  3VH6 T;  4H9S C;  3R45 A;  3C1C C;  1F66 C;  1BH8 B;  3AV2 D;  4J8X C;  2FJ7 C;  1M19 B;  3AZL B;  3UT9 D;  3MGS A;  5KDM A;  1TAF B;  3REI A;  5GT3 B;  2YFW B;  4J8V C;  5C3I B;  1W2E A;  3LJA B;  3A6N D;  1P3A C;  1U35 D;  1N1J A;  5AV9 C;  3X1T D;  5AY8 C;  5B33 C;  5B31 C;  5CPI B;  3EPH A;  1A7W A;  4JJN A;  1P3O B;  1KX5 A;  1P3A D;  4KGC B;  2RVQ D;  4KUD B;  3X1S D;  2UWX A;  2G5H C;  1M19 A;  5B24 A;  5GT0 C;  3R45 B;  3MGQ C;  5B2I D;  5GXQ A;  3AV2 A;  5B2I C;  4WU8 A;  5AVC B;  5AV6 B;  3A1I A;  4CAY B;  2BYK A;  5F99 A;  5DNN C;  4YS3 C;  3TU4 B;  3AZJ A;  4R8P B;  5AV5 C;  4WNN B;  3AV2 C;  5B2J A;  4ZBJ C;  1P3K A;  3REK A;  1P3B A;  3NQJ B;  3AN2 B;  1R4V A;  2HUE B;  2F8N H;  5B40 D;  3MGP D;  3KUY D;  3AZH A;  5CP6 C;  3AZN C;  1ID3 B;  3VH5 A;  3KXB A;  4EO5 C;  3AZM A;  2NQB A;  4J8U B;  4Z66 D;  5GSU C;  1TZY D;  3MGR B;  3AZK A;  1P3F D;  4YM6 D;  3V9R A;  1EQZ A;  2NZD C;  3MGS C;  4Z5T B;  5AVB C;  3WKJ A;  1H3O B;  1P3A B;  4H9S A;  5JRG D;  4AWL B;  1KX3 C;  5CP6 A;  5AY8 B;  3WAA B;  3UTB A;  5BNV A;  1P3P C;  3MGS D;  3AZH D;  2HIO A;  4XUJ A;  3WTP E;  5GT0 D;  3MGR A;  4CSR A;  3LJA D;  3AZK B;  3AV1 C;  4J8X D;  5AV5 A;  5CPK B;  3KUY C;  1HQ3 A;  1P3M B;  3EPK A;  5GT0 B;  3AZK D;  3AZN D;  5B2I A;  4H9Q B;  5B31 G;  3WKJ B;  5BT1 C;  3KWQ D;  3AZH B;  4WV4 B;  5JA4 B;  4WU9 B;  1P3L D;  5JRG B;  3WTP C;  4R8P C;  3LZ1 C;  1F66 B;  1TAF A;  4R8P A;  4Z5T D;  5AVB B;  2PYO B;  3W96 C;  3B6G D;  4YM6 B;  2F8N G;  5B31 A;  3AZF D;  3B0D B;  3VH6 W;  5E5A C;  1KX4 B;  3W99 A;  1P3K D;  1P3I D;  1B67 A;  4J8U D;  3O62 A;  5B0Z C;  1P3G D;  1ID3 D;  3C1C A;  1F66 A;  3KUY B;  3AN2 D;  4E44 A;  5DNM A;  1S32 B;  3REL D;  4DRA A;  5B0Y D;  4R8P D;  2IO5 C;  4Z2M G;  2Y2N A;  5BT1 D;  1P3P B;  3AZL A;  5AVC D;  4J8W A;  4ZUX A;  2BG1 A;  5AV9 D;  3AZF C;  3AZK C;  2PYO C;  3W99 C;  3MVD B;  2ZY4 A;  4YM6 C;  5CPI A;  3AZG C;  3AYW D;  1N1J B;  1AOI D;  4KUD D;  1P3M C;  4KGC D;  3C1C D;  1F66 D;  3AZN A;  5B32 A;  4H9P B;  1P3O D;  3AZH C;  2G5I C;  3AYW C;  4M6B A;  4WU9 C;  1S32 D;  2LY8 A;  4CSR B;  3REK C;  1P3B C;  4WU8 D;  1U35 B;  4DQY B;  5GT3 D;  3X1U B;  4XZQ A;  3AZL D;  4LD9 C;  4YS3 A;  3REI D;  2ARO B;  1HQ3 C;  4ZUX D;  3P5J B;  4LD9 A;  5DNN A;  4WU8 C;  3REJ C;  4QLC A;  3UTA D;  1JFI B;  1KX4 C;  2W8S A;  1P3K B;  3C1B A;  1KX4 D;  4WNN A;  3AZF B;  1ZLA C;  2CV5 C;  5AV8 C;  1T3U A;  5B32 D;  3B0C W;  3O62 B;  1AOI C;  2PYO D;  2BYK B;  5F99 B;  1P34 C;  3B6G C;  3W96 D;  3O62 D;  1P34 D;  4JJN C;  2NZD A;  3F6T A;  1TZY C;  5FUG A;  5CPJ D;  4YM6 A;  4WU9 D;  5B33 A;  2Y2Q A;  4H9N B;  1S32 C;  3B6F A;  4G91 B;  1P3I C;  3KWQ B;  2IO5 B;  5B1M B;  3WKJ D;  3UTA B;  3AZM C;  5B0Z D;  2NQB C;  5CPJ C;  2ARO D;  3X1U D;  2ARO C;  2FJ7 D;  4J8X B;  4H9O B;  5B40 A;  3MGP A;  5AVC A;  4WU8 B;  5DNM C;  3LZ0 C;  3LJA C;  3AV1 D;  2JE5 A;  2CV5 D;  3W97 C;  4X23 A;  3WA9 A;  5AY8 D;  2J8P A;  2Y2J A;  3AZJ C;  1ZLA D;  3O62 C;  1AOI B;  3AYW B;  5F99 C;  3KSY A;  3C1B B;  1U35 C;  3MVD D;  1P3F B;  3AZG D;  1M1A D;  1TZY B;  4Z66 A;  2YFV B;  5B1L A;  3AL0 C;  3VH6 A;  1M19 C;  5GSU D;  1EQZ D;  3UTA A;  5B32 C;  5GT3 A;  4J8V B;  3AZE C;  1BH9 A;  5B32 G;  1KX5 C;  4H9N A;  5B31 B;  5CPI C;  2DF4 C;  2JCH A;  1PZR A;  5CP6 D;  5G49 B;  2PYO A;  1P3A A;  3LZ0 B;  1Z2C B;  3AN2 C;  1HQ3 D;  2Y2L A;  4ZUX C;  3REI C;  1P3G B;  4J8X A;  3MNN C;  1BFM A;  1P3I B;  3MGQ B;  2HIO C;  4XUJ C;  2F8N B;  1P3L A;  5B2I B;  5AVC C;  3REL C;  3MGP C;  5B40 C;  5BO0 A;  2ARO A;  1P3F C;  3MNN A;  5AV5 B;  5BS7 C;  2NZD B;  4Z5T C;  5B0Z A;  3AZE B;  1P3L B;  3W99 D;  5CPI D;  3AFA A;  1P3I A;  5E5A A;  2FFF B;  3X1T B;  2BYM B;  4H9R A;  3VH5 W;  3A6N A;  3AZN B;  1P3G A;  1P3M D;  3W98 A;  3UT9 B;  1M19 D;  5B0Y C;  5CPK D;  2Y2M A;  4NE5 A;  2VQR A;  3LZ1 A;  5CPK C;  5DNM D;  1ZLA A;  5B1L C;  3FDD A;  5BO0 B;  3MGS B;  3VH5 T;  4DRB A;  3REH C;  3WAA D;  1WWI A;  3LEL A;  3AZJ D;  3B0C T;  4J8W D;  5B1L D;  3WTP D;  4AWL C;  1KX5 B;  4WZS B;  3UTB D;  4XZQ C;  4HGA B;  4UPK A;  5E5A D;  3REH A;  3W97 A;  5GT0 A;  3MGR D;  2CWE A;  2ZY2 A;  5AV8 D;  3AYW A;  2XD1 A;  4Z66 B;  2Y2I A;  3UTB C;  3REK D;  3AZI D;  1P3B D;  5E5A B;  3X1T A;  3KXB D;  3AZM D;  1P3P A;  1ULY A;  1KX5 D;  3WKJ C;  4J8W B;  2HIO B;  4XUJ B;  3UT9 C;  2F2A C;  4KUD C;  3EPL A;  5B40 B;  3MGP B;  3A6N C;  3AFA C;  1S32 A;  3B6F C;  3AZL C;  2F8N A;  4LD9 D;  3TU4 D;  5JRG A;  5BS7 A;  3MNN D;  4XZQ D;  5CHL B;  5AV6 D;  3AFA D;  3X1T C;  5AV8 A;  3KFU G;  5FUG B;  3EPJ A;  4HGA C;  1M18 D;  4J8U A;  3X1V D;  1KX4 A;  3W99 B;  4KGC C;  4NE6 A;  1ID3 A;  3MVD C;  3X1S B;  2NZD D;  3W98 D;  5AV5 D;  1F1E A;  1M1A A;  4EO5 B;  1B6W A;  3WAA A;  5GXQ C;  4NFT A;  2F8N D;  2BYM A;  2YFV A;  3A6N B;  1Q9C A;  3MGQ D;  3AFA B;  1WWS A;  4XZQ B;  3X1U A;  3B6F B;  3AV2 B;  3X1U C;  4ZBJ B;  4LD9 B;  3WTP A;  1HQ3 B;  2Y2P A;  2HUE C;  5BNX B;  4Z66 C;  4KHA B;  5CP6 B;  3WAA C;  5AY8 A;  3REH D;  1KX3 B;  3W97 D;  2RVQ C;  5B31 D;  3AZF A;  2HIO D;  4XUJ D;  3W98 B;  4UUZ B;  4J8W C;  4JJN D;  4J8V D;  3X1S C;  3MVD A;  5GSU B;  3REK B;  1P3B B;  3MGR C;  5B2J B;  2Y2O A;  3REL A;  1M1A B;  5B24 D;  3H0L C;  4WJ3 C;  5G49 A;  4YS3 D;  1KX3 A;  1BH8 A;  5GXQ D;  5DNN D;  3REJ B;  4QLC D;  3WTP B;  5JRG C;  4Z2M H;  3IP4 C;  3LZ1 B;  2NQB B;  1M18 A;  2Y2G A;  1EQZ C;  3X1V A;  2CV5 B;  2Y2K A;  3AV1 B;  2F8N K;  4KUD A;  5DNM B;  3B0D C;  3A1K A;  3W96 A;  2NQB D;  3LZ1 D;  1P34 A;  3NQU B;  4QLC B;  1JFI A;  1AOI A;  5B33 D;  5B0Z B;  5GXQ B;  3KWQ C;  5B1M C;  3C1B C;  3LEL D;  5B2J C;  2DQN C;  5CPJ B;  3REJ A;  3AZE D;  1M1A C;  3NQU A;  4NE3 A;  3W96 B;  5F99 D;  3LEL C;  5B32 B;  3AV1 A;  4G92 C;  3H0R C;  4H9Q A;  3W97 B;  4X23 D;  3WA9 D;  3LJA A;  5B1M A;  3AZI C;  3H0M C;  5B24 C;  2ZY5 A;  5CPK A;  2RIQ A;  1P3M A;  4ZUX B;  5CPJ A;  3B6F D;  5KDM B;  3REI B;  3B0B A;  2JSS A;  5AVB A;  1P3G C;  1BH9 B;  4KHA A;  3LZ0 D;  3AZG A;  5BNV B;  5BNX A;  4X23 B;  3WA9 B;  5GSU A;  1TZY A;  2ZY3 A;  4Z5T A;  3UT9 A;  4UUZ A;  2XD5 A;  2FJ7 A;  3B6G A;  3KXB C;  3C1C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...