1H3OB

Crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
74
structure length
74
Chain Sequence
HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT
publication title Crystal Structure of a Subcomplex of Human Transcription Factor TFIID Formed by TATA Binding Protein-Associated Factors Htaf4 (Htaf(II)135) and Htaf12 (Htaf(II)20).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/tbp-associated factors
total genus 24
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03847 TFIID_20kDa Transcription initiation factor TFIID subunit A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1h3oB00
5AV9B 5CPIC 3NQUA 5AV8D 5CP6B 1P3FB 3UTBC 3KXBC 2PYOA 1TZYD 3AZID 2BYKB 3AYWD 4R8PC 5DNNC 4QLCC 4H9SA 2CV5B 1BH9A 4LD9D 3R45B 3VH6W 4UUZB 2AROD 4YM6D 3REJC 4G92C 1P3BD 5AVBA 4HGAC 4ZBJB 4CAYB 3RELD 4ZUXD 3WA9D 5BNVB 4G91B 3MGPA 5GT0C 3UTAC 1P3AA 4Z66B 1ID3B 3X1UB 3AZLD 1B67A 1H3OA 5B1LA 5E5AD 5KDMB 5GXQC 1M18A 1P3KD 3X1SC 3KWQA 4WNNB 1KX3A 2LY8A 2PYOD 3X1VA 5B0ZA 1P3OA 1N1JA 2HIOA 4XUJB 5B40B 4E45A 5AV6C 1F66A 3MNNA 5AVBD 3TU4A 1TZYB 3W99A 1P3LA 3X1TA 3AZIB 3MGQA 3B6FC 2FJ7C 3AYWB 3MGPD 5B1MA 1P3AD 3REHC 3A6NA 5B1LD 5B33C 1M18D 2AROB 5AV5C 3C1CA 1P3BB 3KWQD 1M1AA 1BH8B 3RELB 5B2JA 4ZUXB 1KX3D 3WA9B 3X1VD 3LZ1B 5B0ZD 1P3OD 5E5AB 2HIOD 3AN2C 3O62A 3NQUB 3AZGA 3W98C 5BT1D 3C1BC 4XZQC 1F66D 1TAFA 4Z5TC 2F8ND 2PYOB 5GT3A 5AV9A 3MGRB 3TU4D 1P3LD 3X1TD 3MGQD 1F1EA 1P3FA 1EQZC 5JRGC 5B2IC 5B1MD 1KX4C 1P3GA 4JJNC 1BH9B 3KUYB 3A6ND 3AZJA 1M19A 5CPJA 3C1CD 5AVBB 1M1AD 3R45A 4J8XB 1AOIC 3MGPB 4UUZA 1P3AB 1H3OB 3AV1A 5C3IB 1M18B 3REKA 1S32C 2JSSA 5BNVA 3AZGD 3KWQB 4J8WC 3X1UA 1KX3B 5KDMA 3WAAB 2BYMA 3X1VB 5GT3D 5AV9D 5F99A 1U35C 5CP6C 1P3FD 4KUDA 3AZJD 1M19D 2NZDB 3W96C 1F66B 3MNNB 2CWEA 4WU9C 3REIC 1KX5B 5B40A 3W97A 3W99B 3X1TB 2CV5C 2RVQC 3WTPB 5B24A 3MGQB 3LZ0B 5GSUC 3VH6T 3AV1D 4ZBJC 3REKD 3C1CB 4Z66C 3X1UD 5B2JB 5AY8C 4KGCA 1ZLAC 3AZNA 5F99D 3AV2A 3O62B 4J8UC 2F8NH 5CPIA 3B0DC 3LZ1A 1TAFB 5GT3B 5B40D 3UTBA 3W97D 4EO5C 3KXBA 2IO5C 5AV8C 4X23C 1P3GB 4R8PA 2HUEB 3MGRA 3AZJB 1M19B 1TZYC 5CPJB 3MGSC 3AYWC 3V9RA 3KUYA 4LD9C 4KGCD 5BS7C 4YM6C 3AZND 5GT0A 3UTAA 3AV2D 3AV1B 3LJAB 4CSRA 3REKB 4J8VB 4ZUXC 5GXQA 4J8XA 5CPID 3LZ1D 3X1SA 3AZLC 2BYMB 4NE6A 3UTBD 3KXBD 3MVDA 3VH6A 5F99B 1P3KC 4KHAB 3WAAA 1P34C 4KUDB 4R8PD 2PYOC 3MGRD 3AZFC 3W97B 4H9SC 3KUYD 5B24B 3UT9B 2NZDA 4H9RA 3LELC 1KX5A 3UTAD 1P3IA 1HTAA 1P3PA 3WTPA 5B33A 5B32C 5GXQD 4J8XD 3LZ0A 3MGPC 1P3AC 3X1SD 3AZMA 5B1LC 5C3IC 4KGCB 3MVDD 3AZNB 2L5AA 4Z2MG 3AV2B 3VH5W 1KX3C 3AN2A 3WAAD 3AZEC 5CPIB 3W98A 5B0ZC 1P3MC 1P3OC 5AVCC 2HIOC 3UTBB 3AFAA 3KXBB 3B6GC 5BT1C 3AZKC 2NZDD 1F66C 3MNND 1EQZA 5JRGA 4R8PB 1KX5D 4QLCB 3W99D 5B0YA 3TU4C 1P3ID 1P3LC 3X1TC 3WTPD 5B33D 1P3PD 3V9RB 3LZ0D 5B1MC 3REJB 4G92B 3AZMD 4HGAB 3A6NC 4H9OB 4NE5A 1HQ3C 5GT0B 3C1CC 3UTAB 2NQBA 1M1AC 4CSRB 3AZHA 5B2JD 3AN2D 5GXQB 5CPKA 3W98D 3X1SB 1ULYA 4J8WA 3LJAA 4J8VA 3O62D 3AFAD 3MVDB 3AZGC 3WKJA 4H9NA 5BNXA 1U35A 1EQZD 5JRGD 4AWLB 5AV9C 2YFVA 5B0YD 5BO0A 4H9QA 4KHAA 1P3FC 5B31A 1P3GD 4WU9A 2HUEC 3AZJC 1M19C 4H9RB 5CPJD 3B6FB 2FJ7B 2NQBD 1P3IB 3REHB 5CHLB 1P3PB 3AZHD 5B33B 3UT9A 5DNMA 5CPKD 4YS3A 5AV5B 3AZMB 4J8WD 4Z2MH 3LJAD 4J8VD 3REKC 2YFWA 5AY8A 4DRAA 4G91C 3WKJD 1ID3C 3X1UC 3AN2B 5FUGA 5B31G 3W98B 1BFMA 4WU8A 3NQJA 5B31D 3AFAB 4KUDD 1JFIB 3B0CW 1EQZB 5JRGB 4XUJC 4X23A 5B40C 5JA4A 4JJNB 5B0YB 3W97C 5B24D 3UT9D 5DNMD 4YS3D 3MGSA 5DNNA 4QLCA 3AZIC 1AOIB 1A7WA 5AY8D 2NQBB 3WTPE 3REJA 3AZHB 1KU5A 1R4VA 5CPKB 4H9OA 2AROC 4WU8D 4J8WB 1P3BC 3AV2C 1B6WA 3RELC 3WA9C 3KSYA 3VH5T 3WKJB 4H9NB 5BNXB 1P3KA 3LZ1C 1U35B 5E5AC 4X23D 2YFVB 1P34A 5BO0B 4H9QB 4E44A 3W96B 5B31B 3MGSD 3REIB 4WU9B 3AZFA 5DNND 4QLCD 3MGRC 5AV6A 4H9PA 4NFTA 5GSUB 3REJD 3LELA 3KUYC 5DNMB 4YS3B 2F8NK 3B6FA 5B32A 2FJ7A 5GT0D 5AVBC 3REHA 2YFWB 5AY8B 4J8XC 1ZLAB 5AV5A 1M18C 4J8UB 5FUGB 1P34D 3MVDC 3AZEA 4WU8B 3KWQC 3B0DB 3NQJB 1P3MA 5AVCA 3WAAC 3AZFD 3X1VC 4EO5B 4AWLC 2IO5B 5AV6D 5AV8B 3B6GA 3C1BA 4XZQA 3AZKA 4X23B 5JA4B 4Z5TA 3LELD 2F8NA 5B32G 1JFIA 2NZDC 3B6FD 5B32D 2FJ7D 3MNNC 3MGSB 3VH5A 5DNNB 5B2IA 1KX4A 1KX5C 4JJNA 3REHD 3W99C 1P3IC 1P3PC 4LD9B 3WTPC 3MGQC 4NE3A 3LZ0C 1HQ3A 5AV5D 4YM6B 3AZMC 1AOIA 3AZED 3AZLB 1P3MD 5B2JC 5AVCD 1S32A 1P3KB 3B6GD 3C1BD 4XZQD 3AZKD 2F8NG 3O62C 4Z5TD 3AFAC 1P34B 5G49A 5CP6A 4M6BA 4WV4B 3AZFB 5B2ID 1KX4D 5GT3C 4JJND 3B0CT 5B0YC 5AV6B 4H9PB 3W96A 1HQ3D 2BYKA 1P3GC 3REIA 3LELB 2CV5A 5B32B 5CPJC 1AOID 5GSUA 1WWSA 2NQBC 3AZHC 5B1LB 1S32D 4WZSB 5CPKC 4CAYA 4DRBA 4Z66A 3AV1C 3LJAC 1ID3A 4J8VC 1WWIA 3AZEB 1ZLAA 3WKJC 5B0ZB 1P3MB 1N1JB 5AVCB 5CP6D 1U35D 2HIOB 1P3OB 4WNNA 4J8UA 3B6GB 5F99C 4XZQB 3C1BB 3AZKB 3W96D 5B31C 4Z5TB 4WU9D 3REID 4XUJA 2F8NB 4KUDC 3TU4B 2CV5D 1P3LB 2RVQD 5AV8A 1Q9CA 5B2IB 1KX4B 5B1MB 5GSUD 3A6NB 5B24C 1TZYA 3UT9C 5DNMC 3AZIA 1HQ3B 4YS3C 3AYWA 1M1AB 4Z66D 1ID3D 4LD9A 3B0BA 1ZLAD 5BS7A 2AROA 4YM6A 1P3BA 1S32B 1BH8A 3RELA 4J8UD 4ZUXA 4KGCC 3WA9A 3AZNC 3AZGB 4WU8C 3AZLA 5E5AA 4XUJD 5G49B
chains in the Genus database with same CATH superfamily
5AV9B 5CPIC 3NQUA 5AV8D 5CP6B 1P3FB 3UTBC 3KXBC 2PYOA 1TZYD 3AZID 2BYKB 2DF4C 3AYWD 4R8PC 5DNNC 3P5JB 4H9SA 4QLCC 2CV5B 1BH9A 4LD9D 3R45B 3VH6W 4UUZB 2AROD 4YM6D 3REJC 4G92C 1P3BD 5AVBA 4HGAC 4ZBJB 4CAYB 3RELD 4ZUXD 3WA9D 5BNVB 4G91B 3MGPA 5GT0C 3UTAC 1P3AA 4Z66B 1ID3B 3X1UB 3AZLD 1B67A 1H3OA 5B1LA 5E5AD 5KDMB 5GXQC 1M18A 1P3KD 3X1SC 3KWQA 4WNNB 1KX3A 2LY8A 2PYOD 3X1VA 2J8PA 5B0ZA 1P3OA 1N1JA 2HIOA 4XUJB 2BG1A 5B40B 4E45A 5AV6C 1F66A 3MNNA 1T3UA 3KFUG 5AVBD 2Y2NA 3TU4A 1TZYB 3W99A 1P3LA 3X1TA 3AZIB 3MGQA 3B6FC 2FJ7C 2Y2IA 3AYWB 3MGPD 5B1MA 1P3AD 3REHC 3A6NA 5B1LD 5B33C 1M18D 2AROB 5AV5C 3C1CA 1P3BB 3KWQD 1M1AA 1BH8B 3RELB 5B2JA 4ZUXB 1KX3D 3WA9B 3X1VD 3LZ1B 5B0ZD 1P3OD 5E5AB 2HIOD 3AN2C 3O62A 4DQYB 3NQUB 2ZY5A 3AZGA 3W98C 5BT1D 3C1BC 4XZQC 3H0LC 1F66D 1TAFA 4Z5TC 2F8ND 2PYOB 5GT3A 5AV9A 3MGRB 3TU4D 1P3LD 3X1TD 3MGQD 1F1EA 1P3FA 1EQZC 5JRGC 5B2IC 5B1MD 1KX4C 1P3GA 4JJNC 1BH9B 3KUYB 3A6ND 3AZJA 1M19A 5CPJA 3C1CD 5AVBB 1M1AD 3R45A 4J8XB 1AOIC 3MGPB 4UUZA 1P3AB 1H3OB 3AV1A 5C3IB 1M18B 3REKA 1S32C 2JSSA 5BNVA 3AZGD 3KWQB 4J8WC 3X1UA 1KX3B 5KDMA 3WAAB 2BYMA 3X1VB 5GT3D 5AV9D 5F99A 1U35C 5CP6C 1P3FD 4KUDA 3AZJD 1M19D 3H0RC 2NZDB 3W96C 1F66B 3MNNB 2CWEA 4WU9C 3REIC 1KX5B 5B40A 3W97A 3W99B 3X1TB 2CV5C 2RVQC 3WTPB 5B24A 3MGQB 3LZ0B 2ZY4A 5GSUC 3VH6T 2JE5A 3AV1D 4ZBJC 3REKD 2Y2JA 3C1CB 4Z66C 3X1UD 5B2JB 5AY8C 4KGCA 1ZLAC 3AZNA 5F99D 3AV2A 3O62B 4J8UC 2F8NH 5CPIA 2ZY3A 3B0DC 3LZ1A 1TAFB 5GT3B 5B40D 3EG5B 3UTBA 4EO5C 3KXBA 3W97D 2IO5C 5AV8C 4X23C 1P3GB 4R8PA 2HUEB 3MGRA 3AZJB 1M19B 1TZYC 2Y2KA 5CPJB 3MGSC 2F2AC 3V9RA 3AYWC 3KUYA 4LD9C 4KGCD 5BS7C 4YM6C 3AZND 5GT0A 3UTAA 3AV2D 3AV1B 3LJAB 4CSRA 3REKB 4J8VB 2JCHA 4UPKA 4ZUXC 5GXQA 4J8XA 5CPID 3LZ1D 3X1SA 3AZLC 2BYMB 4NE6A 3UTBD 3KXBD 3MVDA 3VH6A 5F99B 1P3KC 4KHAB 3H0MC 3WAAA 1P34C 4KUDB 4R8PD 2PYOC 3MGRD 3AZFC 3W97B 4H9SC 3KUYD 5B24B 3UT9B 2NZDA 4H9RA 1Z2CB 3LELC 1KX5A 3UTAD 1P3IA 1HTAA 1P3PA 3WTPA 5B33A 5B32C 5GXQD 4J8XD 3LZ0A 3MGPC 1P3AC 3X1SD 3AZMA 5B1LC 5C3IC 4KGCB 3MVDD 3AZNB 2L5AA 4Z2MG 3AV2B 3VH5W 1KX3C 3AN2A 3WAAD 3AZEC 5CPIB 3AL0C 3W98A 5B0ZC 1P3MC 1P3OC 5AVCC 2HIOC 3UTBB 3AFAA 3KXBB 3B6GC 5BT1C 3AZKC 2NZDD 1F66C 3MNND 1EQZA 5JRGA 4R8PB 1KX5D 4QLCB 3W99D 5B0YA 3TU4C 3A1KA 1P3ID 3X1TC 3WTPD 5B33D 1P3LC 1P3PD 1W2EA 3V9RB 3LZ0D 5B1MC 3REJB 4G92B 3AZMD 4HGAB 3A6NC 3FDDA 4H9OB 4NE5A 1HQ3C 2Y2LA 5GT0B 3C1CC 3UTAB 2NQBA 4WJ3C 1M1AC 4CSRB 3AZHA 5B2JD 3AN2D 5GXQB 5CPKA 3EPJA 3W98D 3X1SB 1ULYA 4J8WA 3LJAA 4J8VA 3O62D 3AFAD 3MVDB 2Y2QA 3AZGC 3WKJA 3EPLA 4H9NA 5BNXA 1U35A 1EQZD 3A1IA 3EPHA 5JRGD 4AWLB 5AV9C 2YFVA 5B0YD 5BO0A 4H9QA 4KHAA 1P3FC 5B31A 1P3GD 4WU9A 2HUEC 3AZJC 1M19C 4H9RB 5CPJD 3B6FB 2FJ7B 2NQBD 2FFFB 1P3IB 3REHB 5CHLB 1P3PB 2UWXA 3AZHD 5B33B 3UT9A 5DNMA 5CPKD 4YS3A 5AV5B 3AZMB 4J8WD 2Y2HA 4Z2MH 3LJAD 4J8VD 3REKC 2YFWA 5AY8A 4DRAA 4G91C 3WKJD 2DQNC 1ID3C 3EPKA 3X1UC 3AN2B 5FUGA 5B31G 3W98B 2G5HC 1BFMA 4WU8A 3NQJA 5B31D 3AFAB 4KUDD 1JFIB 3F6TA 3B0CW 1EQZB 5JRGB 4XUJC 4X23A 5B40C 5JA4A 4JJNB 5B0YB 3W97C 5B24D 3UT9D 5DNMD 4YS3D 3MGSA 5DNNA 4QLCA 3AZIC 1AOIB 1A7WA 5AY8D 2NQBB 3WTPE 3REJA 3AZHB 1KU5A 1R4VA 5CPKB 4H9OA 2AROC 4WU8D 4J8WB 1P3BC 3AV2C 1B6WA 3RELC 3WA9C 3KSYA 3VH5T 3WKJB 4H9NB 5BNXB 1P3KA 3LZ1C 1U35B 5E5AC 4X23D 2YFVB 1P34A 5BO0B 4H9QB 2Y2PA 4E44A 2XD1A 3W96B 5B31B 3MGSD 3REIB 4WU9B 3AZFA 5DNND 4QLCD 3MGRC 5AV6A 4H9PA 4NFTA 5GSUB 3REJD 3LELA 1PZRA 3KUYC 5DNMB 4YS3B 2F8NK 3B6FA 5B32A 2FJ7A 5GT0D 5AVBC 2ZM5A 3REHA 2YFWB 5AY8B 4J8XC 1ZLAB 5AV5A 1M18C 4J8UB 5FUGB 1P34D 3MVDC 3AZEA 4WU8B 3KWQC 3B0DB 3NQJB 1P3MA 5AVCA 3WAAC 3AZFD 3X1VC 4EO5B 4AWLC 2IO5B 5AV6D 5AV8B 3B6GA 3C1BA 4XZQA 2RIQA 3AZKA 4X23B 5JA4B 4Z5TA 3LELD 2F8NA 5B32G 1JFIA 2NZDC 3B6FD 5B32D 2FJ7D 3MNNC 3MGSB 3VH5A 5DNNB 5B2IA 1KX4A 1KX5C 4JJNA 3REHD 3W99C 1P3IC 2ZY2A 1P3PC 4LD9B 3WTPC 3MGQC 4NE3A 2G5IC 3LZ0C 1HQ3A 5AV5D 4YM6B 3AZMC 1AOIA 3AZED 3AZLB 1P3MD 5B2JC 5AVCD 1S32A 1P3KB 3B6GD 3C1BD 4XZQD 3AZKD 2F8NG 3O62C 4Z5TD 3AFAC 1P34B 5G49A 5CP6A 4M6BA 4WV4B 3AZFB 5B2ID 1KX4D 5GT3C 2XD5A 4JJND 3B0CT 5B0YC 5AV6B 4H9PB 3W96A 1HQ3D 2BYKA 1P3GC 3REIA 3LELB 2CV5A 5B32B 5CPJC 1AOID 5GSUA 1WWSA 2NQBC 3AZHC 5B1LB 1S32D 4WZSB 5CPKC 4CAYA 4DRBA 4Z66A 3AV1C 3LJAC 1ID3A 4J8VC 1WWIA 3AZEB 1ZLAA 3WKJC 5B0ZB 1P3MB 1N1JB 5AVCB 5CP6D 1U35D 2HIOB 1P3OB 4WNNA 4J8UA 2Y2MA 3B6GB 5F99C 4XZQB 3C1BB 3AZKB 3W96D 5B31C 4Z5TB 4WU9D 3REID 4XUJA 2F8NB 4KUDC 3TU4B 2CV5D 1P3LB 2RVQD 5AV8A 1Q9CA 5B2IB 1KX4B 5B1MB 5GSUD 2Y2GA 3A6NB 5B24C 1TZYA 3UT9C 5DNMC 3AZIA 1HQ3B 4YS3C 3AYWA 1M1AB 4Z66D 1ID3D 4LD9A 3B0BA 2W8SA 1ZLAD 5BS7A 2AROA 4YM6A 2VQRA 1P3BA 1S32B 1BH8A 3RELA 4J8UD 4ZUXA 4KGCC 3IP4C 3AZNC 3AZGB 3WA9A 4WU8C 2Y2OA 3AZLA 5E5AA 4XUJD 5G49B
chains in the Genus database with same CATH topology
5AV9B 5CPIC 3NQUA 5AV8D 5CP6B 1P3FB 3UTBC 3KXBC 2PYOA 1TZYD 3AZID 2BYKB 2DF4C 3AYWD 4R8PC 5DNNC 3P5JB 4H9SA 4QLCC 2CV5B 1BH9A 4LD9D 3R45B 3VH6W 4UUZB 2AROD 4YM6D 3REJC 4G92C 1P3BD 5AVBA 4HGAC 4ZBJB 4CAYB 3RELD 4ZUXD 3WA9D 5BNVB 4G91B 3MGPA 5GT0C 3UTAC 1P3AA 4Z66B 1ID3B 3X1UB 3AZLD 1B67A 1H3OA 5B1LA 5E5AD 5KDMB 5GXQC 1M18A 1P3KD 3X1SC 3KWQA 4WNNB 1KX3A 2LY8A 2PYOD 3X1VA 2J8PA 5B0ZA 1P3OA 1N1JA 2HIOA 4XUJB 2BG1A 5B40B 4E45A 5AV6C 1F66A 3MNNA 1T3UA 3KFUG 5AVBD 2Y2NA 3TU4A 1TZYB 3W99A 1P3LA 3X1TA 3AZIB 3MGQA 3B6FC 2FJ7C 2Y2IA 3AYWB 3MGPD 5B1MA 1P3AD 3REHC 3A6NA 5B1LD 5B33C 1M18D 2AROB 5AV5C 3C1CA 1P3BB 3KWQD 1M1AA 1BH8B 3RELB 5B2JA 4ZUXB 1KX3D 3WA9B 3X1VD 3LZ1B 5B0ZD 1P3OD 5E5AB 2HIOD 3AN2C 3O62A 4DQYB 3NQUB 2ZY5A 3AZGA 3W98C 5BT1D 3C1BC 4XZQC 3H0LC 1F66D 1TAFA 4Z5TC 2F8ND 2PYOB 5GT3A 5AV9A 3MGRB 3TU4D 1P3LD 3X1TD 3MGQD 1F1EA 1P3FA 1EQZC 5JRGC 5B2IC 5B1MD 1KX4C 1P3GA 4JJNC 1BH9B 3KUYB 3A6ND 3AZJA 1M19A 5CPJA 3C1CD 5AVBB 1M1AD 3R45A 4J8XB 1AOIC 3MGPB 4UUZA 1P3AB 1H3OB 3AV1A 5C3IB 1M18B 3REKA 1S32C 2JSSA 5BNVA 3AZGD 3KWQB 4J8WC 3X1UA 1KX3B 5KDMA 3WAAB 2BYMA 3X1VB 5GT3D 5AV9D 5F99A 1U35C 5CP6C 1P3FD 4KUDA 3AZJD 1M19D 3H0RC 2NZDB 3W96C 1F66B 3MNNB 2CWEA 4WU9C 3REIC 1KX5B 5B40A 3W97A 3W99B 3X1TB 2CV5C 2RVQC 3WTPB 5B24A 3MGQB 3LZ0B 2ZY4A 5GSUC 3VH6T 2JE5A 3AV1D 4ZBJC 3REKD 2Y2JA 3C1CB 4Z66C 3X1UD 5B2JB 5AY8C 4KGCA 1ZLAC 3AZNA 5F99D 3AV2A 3O62B 4J8UC 2F8NH 5CPIA 2ZY3A 3B0DC 3LZ1A 1TAFB 5GT3B 5B40D 3EG5B 3UTBA 4EO5C 3KXBA 3W97D 2IO5C 5AV8C 4X23C 1P3GB 4R8PA 2HUEB 3MGRA 3AZJB 1M19B 1TZYC 2Y2KA 5CPJB 3MGSC 2F2AC 3V9RA 3AYWC 3KUYA 4LD9C 4KGCD 5BS7C 4YM6C 3AZND 5GT0A 3UTAA 3AV2D 3AV1B 3LJAB 4CSRA 3REKB 4J8VB 2JCHA 4UPKA 4ZUXC 5GXQA 4J8XA 5CPID 3LZ1D 3X1SA 3AZLC 2BYMB 4NE6A 3UTBD 3KXBD 3MVDA 3VH6A 5F99B 1P3KC 4KHAB 3H0MC 3WAAA 1P34C 4KUDB 4R8PD 2PYOC 3MGRD 3AZFC 3W97B 4H9SC 3KUYD 5B24B 3UT9B 2NZDA 4H9RA 1Z2CB 3LELC 1KX5A 3UTAD 1P3IA 1HTAA 1P3PA 3WTPA 5B33A 5B32C 5GXQD 4J8XD 3LZ0A 3MGPC 1P3AC 3X1SD 3AZMA 5B1LC 5C3IC 4KGCB 3MVDD 3AZNB 2L5AA 4Z2MG 3AV2B 3VH5W 1KX3C 3AN2A 3WAAD 3AZEC 5CPIB 3AL0C 3W98A 5B0ZC 1P3MC 1P3OC 5AVCC 2HIOC 3UTBB 3AFAA 3KXBB 3B6GC 5BT1C 3AZKC 2NZDD 1F66C 3MNND 1EQZA 5JRGA 4R8PB 1KX5D 4QLCB 3W99D 5B0YA 3TU4C 3A1KA 1P3ID 3X1TC 3WTPD 5B33D 1P3LC 1P3PD 1W2EA 3V9RB 3LZ0D 5B1MC 3REJB 4G92B 3AZMD 4HGAB 3A6NC 3FDDA 4H9OB 4NE5A 1HQ3C 2Y2LA 5GT0B 3C1CC 3UTAB 2NQBA 4WJ3C 1M1AC 4CSRB 3AZHA 5B2JD 3AN2D 5GXQB 5CPKA 3EPJA 3W98D 3X1SB 1ULYA 4J8WA 3LJAA 4J8VA 3O62D 3AFAD 3MVDB 2Y2QA 3AZGC 3WKJA 3EPLA 4H9NA 5BNXA 1U35A 1EQZD 3A1IA 3EPHA 5JRGD 4AWLB 5AV9C 2YFVA 5B0YD 5BO0A 4H9QA 4KHAA 1P3FC 5B31A 1P3GD 4WU9A 2HUEC 3AZJC 1M19C 4H9RB 5CPJD 3B6FB 2FJ7B 2NQBD 2FFFB 1P3IB 3REHB 5CHLB 1P3PB 2UWXA 3AZHD 5B33B 3UT9A 5DNMA 5CPKD 4YS3A 5AV5B 3AZMB 4J8WD 2Y2HA 4Z2MH 3LJAD 4J8VD 3REKC 2YFWA 5AY8A 4DRAA 4G91C 3WKJD 2DQNC 1ID3C 3EPKA 3X1UC 3AN2B 5FUGA 5B31G 3W98B 2G5HC 1BFMA 4WU8A 3NQJA 5B31D 3AFAB 4KUDD 1JFIB 3F6TA 3B0CW 1EQZB 5JRGB 4XUJC 4X23A 5B40C 5JA4A 4JJNB 5B0YB 3W97C 5B24D 3UT9D 5DNMD 4YS3D 3MGSA 5DNNA 4QLCA 3AZIC 1AOIB 1A7WA 5AY8D 2NQBB 3WTPE 3REJA 3AZHB 1KU5A 1R4VA 5CPKB 4H9OA 2AROC 4WU8D 4J8WB 1P3BC 3AV2C 1B6WA 3RELC 3WA9C 3KSYA 3VH5T 3WKJB 4H9NB 5BNXB 1P3KA 3LZ1C 1U35B 5E5AC 4X23D 2YFVB 1P34A 5BO0B 4H9QB 2Y2PA 4E44A 2XD1A 3W96B 5B31B 3MGSD 3REIB 4WU9B 3AZFA 5DNND 4QLCD 3MGRC 5AV6A 4H9PA 4NFTA 5GSUB 3REJD 3LELA 1PZRA 3KUYC 5DNMB 4YS3B 2F8NK 3B6FA 5B32A 2FJ7A 5GT0D 5AVBC 2ZM5A 3REHA 2YFWB 5AY8B 4J8XC 1ZLAB 5AV5A 1M18C 4J8UB 5FUGB 1P34D 3MVDC 3AZEA 4WU8B 3KWQC 3B0DB 3NQJB 1P3MA 5AVCA 3WAAC 3AZFD 3X1VC 4EO5B 4AWLC 2IO5B 5AV6D 5AV8B 3B6GA 3C1BA 4XZQA 2RIQA 3AZKA 4X23B 5JA4B 4Z5TA 3LELD 2F8NA 5B32G 1JFIA 2NZDC 3B6FD 5B32D 2FJ7D 3MNNC 3MGSB 3VH5A 5DNNB 5B2IA 1KX4A 1KX5C 4JJNA 3REHD 3W99C 1P3IC 2ZY2A 1P3PC 4LD9B 3WTPC 3MGQC 4NE3A 2G5IC 3LZ0C 1HQ3A 5AV5D 4YM6B 3AZMC 1AOIA 3AZED 3AZLB 1P3MD 5B2JC 5AVCD 1S32A 1P3KB 3B6GD 3C1BD 4XZQD 3AZKD 2F8NG 3O62C 4Z5TD 3AFAC 1P34B 5G49A 5CP6A 4M6BA 4WV4B 3AZFB 5B2ID 1KX4D 5GT3C 2XD5A 4JJND 3B0CT 5B0YC 5AV6B 4H9PB 3W96A 1HQ3D 2BYKA 1P3GC 3REIA 3LELB 2CV5A 5B32B 5CPJC 1AOID 5GSUA 1WWSA 2NQBC 3AZHC 5B1LB 1S32D 4WZSB 5CPKC 4CAYA 4DRBA 4Z66A 3AV1C 3LJAC 1ID3A 4J8VC 1WWIA 3AZEB 1ZLAA 3WKJC 5B0ZB 1P3MB 1N1JB 5AVCB 5CP6D 1U35D 2HIOB 1P3OB 4WNNA 4J8UA 2Y2MA 3B6GB 5F99C 4XZQB 3C1BB 3AZKB 3W96D 5B31C 4Z5TB 4WU9D 3REID 4XUJA 2F8NB 4KUDC 3TU4B 2CV5D 1P3LB 2RVQD 5AV8A 1Q9CA 5B2IB 1KX4B 5B1MB 5GSUD 2Y2GA 3A6NB 5B24C 1TZYA 3UT9C 5DNMC 3AZIA 1HQ3B 4YS3C 3AYWA 1M1AB 4Z66D 1ID3D 4LD9A 3B0BA 2W8SA 1ZLAD 5BS7A 2AROA 4YM6A 2VQRA 1P3BA 1S32B 1BH8A 3RELA 4J8UD 4ZUXA 4KGCC 3IP4C 3AZNC 3AZGB 3WA9A 4WU8C 2Y2OA 3AZLA 5E5AA 4XUJD 5G49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 B;  5CPI C;  3NQU A;  5AV8 D;  5CP6 B;  1P3F B;  3UTB C;  3KXB C;  2PYO A;  1TZY D;  3AZI D;  2BYK B;  3AYW D;  4R8P C;  5DNN C;  4QLC C;  4H9S A;  2CV5 B;  1BH9 A;  4LD9 D;  3R45 B;  3VH6 W;  4UUZ B;  2ARO D;  4YM6 D;  3REJ C;  4G92 C;  1P3B D;  5AVB A;  4HGA C;  4ZBJ B;  4CAY B;  3REL D;  4ZUX D;  3WA9 D;  5BNV B;  4G91 B;  3MGP A;  5GT0 C;  3UTA C;  1P3A A;  4Z66 B;  1ID3 B;  3X1U B;  3AZL D;  1B67 A;  1H3O A;  5B1L A;  5E5A D;  5KDM B;  5GXQ C;  1M18 A;  1P3K D;  3X1S C;  3KWQ A;  4WNN B;  1KX3 A;  2LY8 A;  2PYO D;  3X1V A;  5B0Z A;  1P3O A;  1N1J A;  2HIO A;  4XUJ B;  5B40 B;  4E45 A;  5AV6 C;  1F66 A;  3MNN A;  5AVB D;  3TU4 A;  1TZY B;  3W99 A;  1P3L A;  3X1T A;  3AZI B;  3MGQ A;  3B6F C;  2FJ7 C;  3AYW B;  3MGP D;  5B1M A;  1P3A D;  3REH C;  3A6N A;  5B1L D;  5B33 C;  1M18 D;  2ARO B;  5AV5 C;  3C1C A;  1P3B B;  3KWQ D;  1M1A A;  1BH8 B;  3REL B;  5B2J A;  4ZUX B;  1KX3 D;  3WA9 B;  3X1V D;  3LZ1 B;  5B0Z D;  1P3O D;  5E5A B;  2HIO D;  3AN2 C;  3O62 A;  3NQU B;  3AZG A;  3W98 C;  5BT1 D;  3C1B C;  4XZQ C;  1F66 D;  1TAF A;  4Z5T C;  2F8N D;  2PYO B;  5GT3 A;  5AV9 A;  3MGR B;  3TU4 D;  1P3L D;  3X1T D;  3MGQ D;  1F1E A;  1P3F A;  1EQZ C;  5JRG C;  5B2I C;  5B1M D;  1KX4 C;  1P3G A;  4JJN C;  1BH9 B;  3KUY B;  3A6N D;  3AZJ A;  1M19 A;  5CPJ A;  3C1C D;  5AVB B;  1M1A D;  3R45 A;  4J8X B;  1AOI C;  3MGP B;  4UUZ A;  1P3A B;  1H3O B;  3AV1 A;  5C3I B;  1M18 B;  3REK A;  1S32 C;  2JSS A;  5BNV A;  3AZG D;  3KWQ B;  4J8W C;  3X1U A;  1KX3 B;  5KDM A;  3WAA B;  2BYM A;  3X1V B;  5GT3 D;  5AV9 D;  5F99 A;  1U35 C;  5CP6 C;  1P3F D;  4KUD A;  3AZJ D;  1M19 D;  2NZD B;  3W96 C;  1F66 B;  3MNN B;  2CWE A;  4WU9 C;  3REI C;  1KX5 B;  5B40 A;  3W97 A;  3W99 B;  3X1T B;  2CV5 C;  2RVQ C;  3WTP B;  5B24 A;  3MGQ B;  3LZ0 B;  5GSU C;  3VH6 T;  3AV1 D;  4ZBJ C;  3REK D;  3C1C B;  4Z66 C;  3X1U D;  5B2J B;  5AY8 C;  4KGC A;  1ZLA C;  3AZN A;  5F99 D;  3AV2 A;  3O62 B;  4J8U C;  2F8N H;  5CPI A;  3B0D C;  3LZ1 A;  1TAF B;  5GT3 B;  5B40 D;  3UTB A;  3W97 D;  4EO5 C;  3KXB A;  2IO5 C;  5AV8 C;  4X23 C;  1P3G B;  4R8P A;  2HUE B;  3MGR A;  3AZJ B;  1M19 B;  1TZY C;  5CPJ B;  3MGS C;  3AYW C;  3V9R A;  3KUY A;  4LD9 C;  4KGC D;  5BS7 C;  4YM6 C;  3AZN D;  5GT0 A;  3UTA A;  3AV2 D;  3AV1 B;  3LJA B;  4CSR A;  3REK B;  4J8V B;  4ZUX C;  5GXQ A;  4J8X A;  5CPI D;  3LZ1 D;  3X1S A;  3AZL C;  2BYM B;  4NE6 A;  3UTB D;  3KXB D;  3MVD A;  3VH6 A;  5F99 B;  1P3K C;  4KHA B;  3WAA A;  1P34 C;  4KUD B;  4R8P D;  2PYO C;  3MGR D;  3AZF C;  3W97 B;  4H9S C;  3KUY D;  5B24 B;  3UT9 B;  2NZD A;  4H9R A;  3LEL C;  1KX5 A;  3UTA D;  1P3I A;  1HTA A;  1P3P A;  3WTP A;  5B33 A;  5B32 C;  5GXQ D;  4J8X D;  3LZ0 A;  3MGP C;  1P3A C;  3X1S D;  3AZM A;  5B1L C;  5C3I C;  4KGC B;  3MVD D;  3AZN B;  2L5A A;  4Z2M G;  3AV2 B;  3VH5 W;  1KX3 C;  3AN2 A;  3WAA D;  3AZE C;  5CPI B;  3W98 A;  5B0Z C;  1P3M C;  1P3O C;  5AVC C;  2HIO C;  3UTB B;  3AFA A;  3KXB B;  3B6G C;  5BT1 C;  3AZK C;  2NZD D;  1F66 C;  3MNN D;  1EQZ A;  5JRG A;  4R8P B;  1KX5 D;  4QLC B;  3W99 D;  5B0Y A;  3TU4 C;  1P3I D;  1P3L C;  3X1T C;  3WTP D;  5B33 D;  1P3P D;  3V9R B;  3LZ0 D;  5B1M C;  3REJ B;  4G92 B;  3AZM D;  4HGA B;  3A6N C;  4H9O B;  4NE5 A;  1HQ3 C;  5GT0 B;  3C1C C;  3UTA B;  2NQB A;  1M1A C;  4CSR B;  3AZH A;  5B2J D;  3AN2 D;  5GXQ B;  5CPK A;  3W98 D;  3X1S B;  1ULY A;  4J8W A;  3LJA A;  4J8V A;  3O62 D;  3AFA D;  3MVD B;  3AZG C;  3WKJ A;  4H9N A;  5BNX A;  1U35 A;  1EQZ D;  5JRG D;  4AWL B;  5AV9 C;  2YFV A;  5B0Y D;  5BO0 A;  4H9Q A;  4KHA A;  1P3F C;  5B31 A;  1P3G D;  4WU9 A;  2HUE C;  3AZJ C;  1M19 C;  4H9R B;  5CPJ D;  3B6F B;  2FJ7 B;  2NQB D;  1P3I B;  3REH B;  5CHL B;  1P3P B;  3AZH D;  5B33 B;  3UT9 A;  5DNM A;  5CPK D;  4YS3 A;  5AV5 B;  3AZM B;  4J8W D;  4Z2M H;  3LJA D;  4J8V D;  3REK C;  2YFW A;  5AY8 A;  4DRA A;  4G91 C;  3WKJ D;  1ID3 C;  3X1U C;  3AN2 B;  5FUG A;  5B31 G;  3W98 B;  1BFM A;  4WU8 A;  3NQJ A;  5B31 D;  3AFA B;  4KUD D;  1JFI B;  3B0C W;  1EQZ B;  5JRG B;  4XUJ C;  4X23 A;  5B40 C;  5JA4 A;  4JJN B;  5B0Y B;  3W97 C;  5B24 D;  3UT9 D;  5DNM D;  4YS3 D;  3MGS A;  5DNN A;  4QLC A;  3AZI C;  1AOI B;  1A7W A;  5AY8 D;  2NQB B;  3WTP E;  3REJ A;  3AZH B;  1KU5 A;  1R4V A;  5CPK B;  4H9O A;  2ARO C;  4WU8 D;  4J8W B;  1P3B C;  3AV2 C;  1B6W A;  3REL C;  3WA9 C;  3KSY A;  3VH5 T;  3WKJ B;  4H9N B;  5BNX B;  1P3K A;  3LZ1 C;  1U35 B;  5E5A C;  4X23 D;  2YFV B;  1P34 A;  5BO0 B;  4H9Q B;  4E44 A;  3W96 B;  5B31 B;  3MGS D;  3REI B;  4WU9 B;  3AZF A;  5DNN D;  4QLC D;  3MGR C;  5AV6 A;  4H9P A;  4NFT A;  5GSU B;  3REJ D;  3LEL A;  3KUY C;  5DNM B;  4YS3 B;  2F8N K;  3B6F A;  5B32 A;  2FJ7 A;  5GT0 D;  5AVB C;  3REH A;  2YFW B;  5AY8 B;  4J8X C;  1ZLA B;  5AV5 A;  1M18 C;  4J8U B;  5FUG B;  1P34 D;  3MVD C;  3AZE A;  4WU8 B;  3KWQ C;  3B0D B;  3NQJ B;  1P3M A;  5AVC A;  3WAA C;  3AZF D;  3X1V C;  4EO5 B;  4AWL C;  2IO5 B;  5AV6 D;  5AV8 B;  3B6G A;  3C1B A;  4XZQ A;  3AZK A;  4X23 B;  5JA4 B;  4Z5T A;  3LEL D;  2F8N A;  5B32 G;  1JFI A;  2NZD C;  3B6F D;  5B32 D;  2FJ7 D;  3MNN C;  3MGS B;  3VH5 A;  5DNN B;  5B2I A;  1KX4 A;  1KX5 C;  4JJN A;  3REH D;  3W99 C;  1P3I C;  1P3P C;  4LD9 B;  3WTP C;  3MGQ C;  4NE3 A;  3LZ0 C;  1HQ3 A;  5AV5 D;  4YM6 B;  3AZM C;  1AOI A;  3AZE D;  3AZL B;  1P3M D;  5B2J C;  5AVC D;  1S32 A;  1P3K B;  3B6G D;  3C1B D;  4XZQ D;  3AZK D;  2F8N G;  3O62 C;  4Z5T D;  3AFA C;  1P34 B;  5G49 A;  5CP6 A;  4M6B A;  4WV4 B;  3AZF B;  5B2I D;  1KX4 D;  5GT3 C;  4JJN D;  3B0C T;  5B0Y C;  5AV6 B;  4H9P B;  3W96 A;  1HQ3 D;  2BYK A;  1P3G C;  3REI A;  3LEL B;  2CV5 A;  5B32 B;  5CPJ C;  1AOI D;  5GSU A;  1WWS A;  2NQB C;  3AZH C;  5B1L B;  1S32 D;  4WZS B;  5CPK C;  4CAY A;  4DRB A;  4Z66 A;  3AV1 C;  3LJA C;  1ID3 A;  4J8V C;  1WWI A;  3AZE B;  1ZLA A;  3WKJ C;  5B0Z B;  1P3M B;  1N1J B;  5AVC B;  5CP6 D;  1U35 D;  2HIO B;  1P3O B;  4WNN A;  4J8U A;  3B6G B;  5F99 C;  4XZQ B;  3C1B B;  3AZK B;  3W96 D;  5B31 C;  4Z5T B;  4WU9 D;  3REI D;  4XUJ A;  2F8N B;  4KUD C;  3TU4 B;  2CV5 D;  1P3L B;  2RVQ D;  5AV8 A;  1Q9C A;  5B2I B;  1KX4 B;  5B1M B;  5GSU D;  3A6N B;  5B24 C;  1TZY A;  3UT9 C;  5DNM C;  3AZI A;  1HQ3 B;  4YS3 C;  3AYW A;  1M1A B;  4Z66 D;  1ID3 D;  4LD9 A;  3B0B A;  1ZLA D;  5BS7 A;  2ARO A;  4YM6 A;  1P3B A;  1S32 B;  1BH8 A;  3REL A;  4J8U D;  4ZUX A;  4KGC C;  3WA9 A;  3AZN C;  3AZG B;  4WU8 C;  3AZL A;  5E5A A;  4XUJ D;  5G49 B; 
#chains in the Genus database with same CATH topology
 5AV9 B;  5CPI C;  3NQU A;  5AV8 D;  5CP6 B;  1P3F B;  3UTB C;  3KXB C;  2PYO A;  1TZY D;  3AZI D;  2BYK B;  2DF4 C;  3AYW D;  4R8P C;  5DNN C;  3P5J B;  4H9S A;  4QLC C;  2CV5 B;  1BH9 A;  4LD9 D;  3R45 B;  3VH6 W;  4UUZ B;  2ARO D;  4YM6 D;  3REJ C;  4G92 C;  1P3B D;  5AVB A;  4HGA C;  4ZBJ B;  4CAY B;  3REL D;  4ZUX D;  3WA9 D;  5BNV B;  4G91 B;  3MGP A;  5GT0 C;  3UTA C;  1P3A A;  4Z66 B;  1ID3 B;  3X1U B;  3AZL D;  1B67 A;  1H3O A;  5B1L A;  5E5A D;  5KDM B;  5GXQ C;  1M18 A;  1P3K D;  3X1S C;  3KWQ A;  4WNN B;  1KX3 A;  2LY8 A;  2PYO D;  3X1V A;  2J8P A;  5B0Z A;  1P3O A;  1N1J A;  2HIO A;  4XUJ B;  2BG1 A;  5B40 B;  4E45 A;  5AV6 C;  1F66 A;  3MNN A;  1T3U A;  3KFU G;  5AVB D;  2Y2N A;  3TU4 A;  1TZY B;  3W99 A;  1P3L A;  3X1T A;  3AZI B;  3MGQ A;  3B6F C;  2FJ7 C;  2Y2I A;  3AYW B;  3MGP D;  5B1M A;  1P3A D;  3REH C;  3A6N A;  5B1L D;  5B33 C;  1M18 D;  2ARO B;  5AV5 C;  3C1C A;  1P3B B;  3KWQ D;  1M1A A;  1BH8 B;  3REL B;  5B2J A;  4ZUX B;  1KX3 D;  3WA9 B;  3X1V D;  3LZ1 B;  5B0Z D;  1P3O D;  5E5A B;  2HIO D;  3AN2 C;  3O62 A;  4DQY B;  3NQU B;  2ZY5 A;  3AZG A;  3W98 C;  5BT1 D;  3C1B C;  4XZQ C;  3H0L C;  1F66 D;  1TAF A;  4Z5T C;  2F8N D;  2PYO B;  5GT3 A;  5AV9 A;  3MGR B;  3TU4 D;  1P3L D;  3X1T D;  3MGQ D;  1F1E A;  1P3F A;  1EQZ C;  5JRG C;  5B2I C;  5B1M D;  1KX4 C;  1P3G A;  4JJN C;  1BH9 B;  3KUY B;  3A6N D;  3AZJ A;  1M19 A;  5CPJ A;  3C1C D;  5AVB B;  1M1A D;  3R45 A;  4J8X B;  1AOI C;  3MGP B;  4UUZ A;  1P3A B;  1H3O B;  3AV1 A;  5C3I B;  1M18 B;  3REK A;  1S32 C;  2JSS A;  5BNV A;  3AZG D;  3KWQ B;  4J8W C;  3X1U A;  1KX3 B;  5KDM A;  3WAA B;  2BYM A;  3X1V B;  5GT3 D;  5AV9 D;  5F99 A;  1U35 C;  5CP6 C;  1P3F D;  4KUD A;  3AZJ D;  1M19 D;  3H0R C;  2NZD B;  3W96 C;  1F66 B;  3MNN B;  2CWE A;  4WU9 C;  3REI C;  1KX5 B;  5B40 A;  3W97 A;  3W99 B;  3X1T B;  2CV5 C;  2RVQ C;  3WTP B;  5B24 A;  3MGQ B;  3LZ0 B;  2ZY4 A;  5GSU C;  3VH6 T;  2JE5 A;  3AV1 D;  4ZBJ C;  3REK D;  2Y2J A;  3C1C B;  4Z66 C;  3X1U D;  5B2J B;  5AY8 C;  4KGC A;  1ZLA C;  3AZN A;  5F99 D;  3AV2 A;  3O62 B;  4J8U C;  2F8N H;  5CPI A;  2ZY3 A;  3B0D C;  3LZ1 A;  1TAF B;  5GT3 B;  5B40 D;  3EG5 B;  3UTB A;  4EO5 C;  3KXB A;  3W97 D;  2IO5 C;  5AV8 C;  4X23 C;  1P3G B;  4R8P A;  2HUE B;  3MGR A;  3AZJ B;  1M19 B;  1TZY C;  2Y2K A;  5CPJ B;  3MGS C;  2F2A C;  3V9R A;  3AYW C;  3KUY A;  4LD9 C;  4KGC D;  5BS7 C;  4YM6 C;  3AZN D;  5GT0 A;  3UTA A;  3AV2 D;  3AV1 B;  3LJA B;  4CSR A;  3REK B;  4J8V B;  2JCH A;  4UPK A;  4ZUX C;  5GXQ A;  4J8X A;  5CPI D;  3LZ1 D;  3X1S A;  3AZL C;  2BYM B;  4NE6 A;  3UTB D;  3KXB D;  3MVD A;  3VH6 A;  5F99 B;  1P3K C;  4KHA B;  3H0M C;  3WAA A;  1P34 C;  4KUD B;  4R8P D;  2PYO C;  3MGR D;  3AZF C;  3W97 B;  4H9S C;  3KUY D;  5B24 B;  3UT9 B;  2NZD A;  4H9R A;  1Z2C B;  3LEL C;  1KX5 A;  3UTA D;  1P3I A;  1HTA A;  1P3P A;  3WTP A;  5B33 A;  5B32 C;  5GXQ D;  4J8X D;  3LZ0 A;  3MGP C;  1P3A C;  3X1S D;  3AZM A;  5B1L C;  5C3I C;  4KGC B;  3MVD D;  3AZN B;  2L5A A;  4Z2M G;  3AV2 B;  3VH5 W;  1KX3 C;  3AN2 A;  3WAA D;  3AZE C;  5CPI B;  3AL0 C;  3W98 A;  5B0Z C;  1P3M C;  1P3O C;  5AVC C;  2HIO C;  3UTB B;  3AFA A;  3KXB B;  3B6G C;  5BT1 C;  3AZK C;  2NZD D;  1F66 C;  3MNN D;  1EQZ A;  5JRG A;  4R8P B;  1KX5 D;  4QLC B;  3W99 D;  5B0Y A;  3TU4 C;  3A1K A;  1P3I D;  3X1T C;  3WTP D;  5B33 D;  1P3L C;  1P3P D;  1W2E A;  3V9R B;  3LZ0 D;  5B1M C;  3REJ B;  4G92 B;  3AZM D;  4HGA B;  3A6N C;  3FDD A;  4H9O B;  4NE5 A;  1HQ3 C;  2Y2L A;  5GT0 B;  3C1C C;  3UTA B;  2NQB A;  4WJ3 C;  1M1A C;  4CSR B;  3AZH A;  5B2J D;  3AN2 D;  5GXQ B;  5CPK A;  3EPJ A;  3W98 D;  3X1S B;  1ULY A;  4J8W A;  3LJA A;  4J8V A;  3O62 D;  3AFA D;  3MVD B;  2Y2Q A;  3AZG C;  3WKJ A;  3EPL A;  4H9N A;  5BNX A;  1U35 A;  1EQZ D;  3A1I A;  3EPH A;  5JRG D;  4AWL B;  5AV9 C;  2YFV A;  5B0Y D;  5BO0 A;  4H9Q A;  4KHA A;  1P3F C;  5B31 A;  1P3G D;  4WU9 A;  2HUE C;  3AZJ C;  1M19 C;  4H9R B;  5CPJ D;  3B6F B;  2FJ7 B;  2NQB D;  2FFF B;  1P3I B;  3REH B;  5CHL B;  1P3P B;  2UWX A;  3AZH D;  5B33 B;  3UT9 A;  5DNM A;  5CPK D;  4YS3 A;  5AV5 B;  3AZM B;  4J8W D;  2Y2H A;  4Z2M H;  3LJA D;  4J8V D;  3REK C;  2YFW A;  5AY8 A;  4DRA A;  4G91 C;  3WKJ D;  2DQN C;  1ID3 C;  3EPK A;  3X1U C;  3AN2 B;  5FUG A;  5B31 G;  3W98 B;  2G5H C;  1BFM A;  4WU8 A;  3NQJ A;  5B31 D;  3AFA B;  4KUD D;  1JFI B;  3F6T A;  3B0C W;  1EQZ B;  5JRG B;  4XUJ C;  4X23 A;  5B40 C;  5JA4 A;  4JJN B;  5B0Y B;  3W97 C;  5B24 D;  3UT9 D;  5DNM D;  4YS3 D;  3MGS A;  5DNN A;  4QLC A;  3AZI C;  1AOI B;  1A7W A;  5AY8 D;  2NQB B;  3WTP E;  3REJ A;  3AZH B;  1KU5 A;  1R4V A;  5CPK B;  4H9O A;  2ARO C;  4WU8 D;  4J8W B;  1P3B C;  3AV2 C;  1B6W A;  3REL C;  3WA9 C;  3KSY A;  3VH5 T;  3WKJ B;  4H9N B;  5BNX B;  1P3K A;  3LZ1 C;  1U35 B;  5E5A C;  4X23 D;  2YFV B;  1P34 A;  5BO0 B;  4H9Q B;  2Y2P A;  4E44 A;  2XD1 A;  3W96 B;  5B31 B;  3MGS D;  3REI B;  4WU9 B;  3AZF A;  5DNN D;  4QLC D;  3MGR C;  5AV6 A;  4H9P A;  4NFT A;  5GSU B;  3REJ D;  3LEL A;  1PZR A;  3KUY C;  5DNM B;  4YS3 B;  2F8N K;  3B6F A;  5B32 A;  2FJ7 A;  5GT0 D;  5AVB C;  2ZM5 A;  3REH A;  2YFW B;  5AY8 B;  4J8X C;  1ZLA B;  5AV5 A;  1M18 C;  4J8U B;  5FUG B;  1P34 D;  3MVD C;  3AZE A;  4WU8 B;  3KWQ C;  3B0D B;  3NQJ B;  1P3M A;  5AVC A;  3WAA C;  3AZF D;  3X1V C;  4EO5 B;  4AWL C;  2IO5 B;  5AV6 D;  5AV8 B;  3B6G A;  3C1B A;  4XZQ A;  2RIQ A;  3AZK A;  4X23 B;  5JA4 B;  4Z5T A;  3LEL D;  2F8N A;  5B32 G;  1JFI A;  2NZD C;  3B6F D;  5B32 D;  2FJ7 D;  3MNN C;  3MGS B;  3VH5 A;  5DNN B;  5B2I A;  1KX4 A;  1KX5 C;  4JJN A;  3REH D;  3W99 C;  1P3I C;  2ZY2 A;  1P3P C;  4LD9 B;  3WTP C;  3MGQ C;  4NE3 A;  2G5I C;  3LZ0 C;  1HQ3 A;  5AV5 D;  4YM6 B;  3AZM C;  1AOI A;  3AZE D;  3AZL B;  1P3M D;  5B2J C;  5AVC D;  1S32 A;  1P3K B;  3B6G D;  3C1B D;  4XZQ D;  3AZK D;  2F8N G;  3O62 C;  4Z5T D;  3AFA C;  1P34 B;  5G49 A;  5CP6 A;  4M6B A;  4WV4 B;  3AZF B;  5B2I D;  1KX4 D;  5GT3 C;  2XD5 A;  4JJN D;  3B0C T;  5B0Y C;  5AV6 B;  4H9P B;  3W96 A;  1HQ3 D;  2BYK A;  1P3G C;  3REI A;  3LEL B;  2CV5 A;  5B32 B;  5CPJ C;  1AOI D;  5GSU A;  1WWS A;  2NQB C;  3AZH C;  5B1L B;  1S32 D;  4WZS B;  5CPK C;  4CAY A;  4DRB A;  4Z66 A;  3AV1 C;  3LJA C;  1ID3 A;  4J8V C;  1WWI A;  3AZE B;  1ZLA A;  3WKJ C;  5B0Z B;  1P3M B;  1N1J B;  5AVC B;  5CP6 D;  1U35 D;  2HIO B;  1P3O B;  4WNN A;  4J8U A;  2Y2M A;  3B6G B;  5F99 C;  4XZQ B;  3C1B B;  3AZK B;  3W96 D;  5B31 C;  4Z5T B;  4WU9 D;  3REI D;  4XUJ A;  2F8N B;  4KUD C;  3TU4 B;  2CV5 D;  1P3L B;  2RVQ D;  5AV8 A;  1Q9C A;  5B2I B;  1KX4 B;  5B1M B;  5GSU D;  2Y2G A;  3A6N B;  5B24 C;  1TZY A;  3UT9 C;  5DNM C;  3AZI A;  1HQ3 B;  4YS3 C;  3AYW A;  1M1A B;  4Z66 D;  1ID3 D;  4LD9 A;  3B0B A;  2W8S A;  1ZLA D;  5BS7 A;  2ARO A;  4YM6 A;  2VQR A;  1P3B A;  1S32 B;  1BH8 A;  3REL A;  4J8U D;  4ZUX A;  4KGC C;  3IP4 C;  3AZN C;  3AZG B;  3WA9 A;  4WU8 C;  2Y2O A;  3AZL A;  5E5A A;  4XUJ D;  5G49 B; 
#chains in the Genus database with same CATH homology
 5AV9 B;  5CPI C;  3NQU A;  5AV8 D;  5CP6 B;  1P3F B;  3UTB C;  3KXB C;  2PYO A;  1TZY D;  3AZI D;  2BYK B;  2DF4 C;  3AYW D;  4R8P C;  5DNN C;  3P5J B;  4H9S A;  4QLC C;  2CV5 B;  1BH9 A;  4LD9 D;  3R45 B;  3VH6 W;  4UUZ B;  2ARO D;  4YM6 D;  3REJ C;  4G92 C;  1P3B D;  5AVB A;  4HGA C;  4ZBJ B;  4CAY B;  3REL D;  4ZUX D;  3WA9 D;  5BNV B;  4G91 B;  3MGP A;  5GT0 C;  3UTA C;  1P3A A;  4Z66 B;  1ID3 B;  3X1U B;  3AZL D;  1B67 A;  1H3O A;  5B1L A;  5E5A D;  5KDM B;  5GXQ C;  1M18 A;  1P3K D;  3X1S C;  3KWQ A;  4WNN B;  1KX3 A;  2LY8 A;  2PYO D;  3X1V A;  2J8P A;  5B0Z A;  1P3O A;  1N1J A;  2HIO A;  4XUJ B;  2BG1 A;  5B40 B;  4E45 A;  5AV6 C;  1F66 A;  3MNN A;  1T3U A;  3KFU G;  5AVB D;  2Y2N A;  3TU4 A;  1TZY B;  3W99 A;  1P3L A;  3X1T A;  3AZI B;  3MGQ A;  3B6F C;  2FJ7 C;  2Y2I A;  3AYW B;  3MGP D;  5B1M A;  1P3A D;  3REH C;  3A6N A;  5B1L D;  5B33 C;  1M18 D;  2ARO B;  5AV5 C;  3C1C A;  1P3B B;  3KWQ D;  1M1A A;  1BH8 B;  3REL B;  5B2J A;  4ZUX B;  1KX3 D;  3WA9 B;  3X1V D;  3LZ1 B;  5B0Z D;  1P3O D;  5E5A B;  2HIO D;  3AN2 C;  3O62 A;  4DQY B;  3NQU B;  2ZY5 A;  3AZG A;  3W98 C;  5BT1 D;  3C1B C;  4XZQ C;  3H0L C;  1F66 D;  1TAF A;  4Z5T C;  2F8N D;  2PYO B;  5GT3 A;  5AV9 A;  3MGR B;  3TU4 D;  1P3L D;  3X1T D;  3MGQ D;  1F1E A;  1P3F A;  1EQZ C;  5JRG C;  5B2I C;  5B1M D;  1KX4 C;  1P3G A;  4JJN C;  1BH9 B;  3KUY B;  3A6N D;  3AZJ A;  1M19 A;  5CPJ A;  3C1C D;  5AVB B;  1M1A D;  3R45 A;  4J8X B;  1AOI C;  3MGP B;  4UUZ A;  1P3A B;  1H3O B;  3AV1 A;  5C3I B;  1M18 B;  3REK A;  1S32 C;  2JSS A;  5BNV A;  3AZG D;  3KWQ B;  4J8W C;  3X1U A;  1KX3 B;  5KDM A;  3WAA B;  2BYM A;  3X1V B;  5GT3 D;  5AV9 D;  5F99 A;  1U35 C;  5CP6 C;  1P3F D;  4KUD A;  3AZJ D;  1M19 D;  3H0R C;  2NZD B;  3W96 C;  1F66 B;  3MNN B;  2CWE A;  4WU9 C;  3REI C;  1KX5 B;  5B40 A;  3W97 A;  3W99 B;  3X1T B;  2CV5 C;  2RVQ C;  3WTP B;  5B24 A;  3MGQ B;  3LZ0 B;  2ZY4 A;  5GSU C;  3VH6 T;  2JE5 A;  3AV1 D;  4ZBJ C;  3REK D;  2Y2J A;  3C1C B;  4Z66 C;  3X1U D;  5B2J B;  5AY8 C;  4KGC A;  1ZLA C;  3AZN A;  5F99 D;  3AV2 A;  3O62 B;  4J8U C;  2F8N H;  5CPI A;  2ZY3 A;  3B0D C;  3LZ1 A;  1TAF B;  5GT3 B;  5B40 D;  3EG5 B;  3UTB A;  4EO5 C;  3KXB A;  3W97 D;  2IO5 C;  5AV8 C;  4X23 C;  1P3G B;  4R8P A;  2HUE B;  3MGR A;  3AZJ B;  1M19 B;  1TZY C;  2Y2K A;  5CPJ B;  3MGS C;  2F2A C;  3V9R A;  3AYW C;  3KUY A;  4LD9 C;  4KGC D;  5BS7 C;  4YM6 C;  3AZN D;  5GT0 A;  3UTA A;  3AV2 D;  3AV1 B;  3LJA B;  4CSR A;  3REK B;  4J8V B;  2JCH A;  4UPK A;  4ZUX C;  5GXQ A;  4J8X A;  5CPI D;  3LZ1 D;  3X1S A;  3AZL C;  2BYM B;  4NE6 A;  3UTB D;  3KXB D;  3MVD A;  3VH6 A;  5F99 B;  1P3K C;  4KHA B;  3H0M C;  3WAA A;  1P34 C;  4KUD B;  4R8P D;  2PYO C;  3MGR D;  3AZF C;  3W97 B;  4H9S C;  3KUY D;  5B24 B;  3UT9 B;  2NZD A;  4H9R A;  1Z2C B;  3LEL C;  1KX5 A;  3UTA D;  1P3I A;  1HTA A;  1P3P A;  3WTP A;  5B33 A;  5B32 C;  5GXQ D;  4J8X D;  3LZ0 A;  3MGP C;  1P3A C;  3X1S D;  3AZM A;  5B1L C;  5C3I C;  4KGC B;  3MVD D;  3AZN B;  2L5A A;  4Z2M G;  3AV2 B;  3VH5 W;  1KX3 C;  3AN2 A;  3WAA D;  3AZE C;  5CPI B;  3AL0 C;  3W98 A;  5B0Z C;  1P3M C;  1P3O C;  5AVC C;  2HIO C;  3UTB B;  3AFA A;  3KXB B;  3B6G C;  5BT1 C;  3AZK C;  2NZD D;  1F66 C;  3MNN D;  1EQZ A;  5JRG A;  4R8P B;  1KX5 D;  4QLC B;  3W99 D;  5B0Y A;  3TU4 C;  3A1K A;  1P3I D;  3X1T C;  3WTP D;  5B33 D;  1P3L C;  1P3P D;  1W2E A;  3V9R B;  3LZ0 D;  5B1M C;  3REJ B;  4G92 B;  3AZM D;  4HGA B;  3A6N C;  3FDD A;  4H9O B;  4NE5 A;  1HQ3 C;  2Y2L A;  5GT0 B;  3C1C C;  3UTA B;  2NQB A;  4WJ3 C;  1M1A C;  4CSR B;  3AZH A;  5B2J D;  3AN2 D;  5GXQ B;  5CPK A;  3EPJ A;  3W98 D;  3X1S B;  1ULY A;  4J8W A;  3LJA A;  4J8V A;  3O62 D;  3AFA D;  3MVD B;  2Y2Q A;  3AZG C;  3WKJ A;  3EPL A;  4H9N A;  5BNX A;  1U35 A;  1EQZ D;  3A1I A;  3EPH A;  5JRG D;  4AWL B;  5AV9 C;  2YFV A;  5B0Y D;  5BO0 A;  4H9Q A;  4KHA A;  1P3F C;  5B31 A;  1P3G D;  4WU9 A;  2HUE C;  3AZJ C;  1M19 C;  4H9R B;  5CPJ D;  3B6F B;  2FJ7 B;  2NQB D;  2FFF B;  1P3I B;  3REH B;  5CHL B;  1P3P B;  2UWX A;  3AZH D;  5B33 B;  3UT9 A;  5DNM A;  5CPK D;  4YS3 A;  5AV5 B;  3AZM B;  4J8W D;  2Y2H A;  4Z2M H;  3LJA D;  4J8V D;  3REK C;  2YFW A;  5AY8 A;  4DRA A;  4G91 C;  3WKJ D;  2DQN C;  1ID3 C;  3EPK A;  3X1U C;  3AN2 B;  5FUG A;  5B31 G;  3W98 B;  2G5H C;  1BFM A;  4WU8 A;  3NQJ A;  5B31 D;  3AFA B;  4KUD D;  1JFI B;  3F6T A;  3B0C W;  1EQZ B;  5JRG B;  4XUJ C;  4X23 A;  5B40 C;  5JA4 A;  4JJN B;  5B0Y B;  3W97 C;  5B24 D;  3UT9 D;  5DNM D;  4YS3 D;  3MGS A;  5DNN A;  4QLC A;  3AZI C;  1AOI B;  1A7W A;  5AY8 D;  2NQB B;  3WTP E;  3REJ A;  3AZH B;  1KU5 A;  1R4V A;  5CPK B;  4H9O A;  2ARO C;  4WU8 D;  4J8W B;  1P3B C;  3AV2 C;  1B6W A;  3REL C;  3WA9 C;  3KSY A;  3VH5 T;  3WKJ B;  4H9N B;  5BNX B;  1P3K A;  3LZ1 C;  1U35 B;  5E5A C;  4X23 D;  2YFV B;  1P34 A;  5BO0 B;  4H9Q B;  2Y2P A;  4E44 A;  2XD1 A;  3W96 B;  5B31 B;  3MGS D;  3REI B;  4WU9 B;  3AZF A;  5DNN D;  4QLC D;  3MGR C;  5AV6 A;  4H9P A;  4NFT A;  5GSU B;  3REJ D;  3LEL A;  1PZR A;  3KUY C;  5DNM B;  4YS3 B;  2F8N K;  3B6F A;  5B32 A;  2FJ7 A;  5GT0 D;  5AVB C;  2ZM5 A;  3REH A;  2YFW B;  5AY8 B;  4J8X C;  1ZLA B;  5AV5 A;  1M18 C;  4J8U B;  5FUG B;  1P34 D;  3MVD C;  3AZE A;  4WU8 B;  3KWQ C;  3B0D B;  3NQJ B;  1P3M A;  5AVC A;  3WAA C;  3AZF D;  3X1V C;  4EO5 B;  4AWL C;  2IO5 B;  5AV6 D;  5AV8 B;  3B6G A;  3C1B A;  4XZQ A;  2RIQ A;  3AZK A;  4X23 B;  5JA4 B;  4Z5T A;  3LEL D;  2F8N A;  5B32 G;  1JFI A;  2NZD C;  3B6F D;  5B32 D;  2FJ7 D;  3MNN C;  3MGS B;  3VH5 A;  5DNN B;  5B2I A;  1KX4 A;  1KX5 C;  4JJN A;  3REH D;  3W99 C;  1P3I C;  2ZY2 A;  1P3P C;  4LD9 B;  3WTP C;  3MGQ C;  4NE3 A;  2G5I C;  3LZ0 C;  1HQ3 A;  5AV5 D;  4YM6 B;  3AZM C;  1AOI A;  3AZE D;  3AZL B;  1P3M D;  5B2J C;  5AVC D;  1S32 A;  1P3K B;  3B6G D;  3C1B D;  4XZQ D;  3AZK D;  2F8N G;  3O62 C;  4Z5T D;  3AFA C;  1P34 B;  5G49 A;  5CP6 A;  4M6B A;  4WV4 B;  3AZF B;  5B2I D;  1KX4 D;  5GT3 C;  2XD5 A;  4JJN D;  3B0C T;  5B0Y C;  5AV6 B;  4H9P B;  3W96 A;  1HQ3 D;  2BYK A;  1P3G C;  3REI A;  3LEL B;  2CV5 A;  5B32 B;  5CPJ C;  1AOI D;  5GSU A;  1WWS A;  2NQB C;  3AZH C;  5B1L B;  1S32 D;  4WZS B;  5CPK C;  4CAY A;  4DRB A;  4Z66 A;  3AV1 C;  3LJA C;  1ID3 A;  4J8V C;  1WWI A;  3AZE B;  1ZLA A;  3WKJ C;  5B0Z B;  1P3M B;  1N1J B;  5AVC B;  5CP6 D;  1U35 D;  2HIO B;  1P3O B;  4WNN A;  4J8U A;  2Y2M A;  3B6G B;  5F99 C;  4XZQ B;  3C1B B;  3AZK B;  3W96 D;  5B31 C;  4Z5T B;  4WU9 D;  3REI D;  4XUJ A;  2F8N B;  4KUD C;  3TU4 B;  2CV5 D;  1P3L B;  2RVQ D;  5AV8 A;  1Q9C A;  5B2I B;  1KX4 B;  5B1M B;  5GSU D;  2Y2G A;  3A6N B;  5B24 C;  1TZY A;  3UT9 C;  5DNM C;  3AZI A;  1HQ3 B;  4YS3 C;  3AYW A;  1M1A B;  4Z66 D;  1ID3 D;  4LD9 A;  3B0B A;  2W8S A;  1ZLA D;  5BS7 A;  2ARO A;  4YM6 A;  2VQR A;  1P3B A;  1S32 B;  1BH8 A;  3REL A;  4J8U D;  4ZUX A;  4KGC C;  3IP4 C;  3AZN C;  3AZG B;  3WA9 A;  4WU8 C;  2Y2O A;  3AZL A;  5E5A A;  4XUJ D;  5G49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...