1H3OB

Crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
74
structure length
74
Chain Sequence
HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/tbp-associated factors
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT
publication title Crystal Structure of a Subcomplex of Human Transcription Factor TFIID Formed by TATA Binding Protein-Associated Factors Htaf4 (Htaf(II)135) and Htaf12 (Htaf(II)20).
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03847 TFIID_20kDa Transcription initiation factor TFIID subunit A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1h3oB00
3AV2C 3X1TD 3MGRB 3AZEB 1M18A 5B2JC 3KWQC 3AZEC 3LZ1B 3NQUA 5AY8D 4QLCA 3WKJA 4J8UA 5B0YC 3AZJB 4Z66D 2PYOD 3UTBA 2NZDC 5CP6A 3WAAB 3MVDD 4H9PA 5C3IB 1M19B 3WAAC 3LZ0A 5B33A 3R45B 5C3IC 5AVBD 3VH5A 2BYKA 3AV1C 4XUJC 4YM6A 5FUGA 3X1TB 5CHLB 4UUZA 3W99D 5F99A 4NE6A 1N1JA 4CSRB 3REKD 4WZSB 5AV8A 4Z66B 3A6ND 2PYOB 3X1UA 3LELC 3REIC 3MGPC 5GSUA 1U35D 3MVDB 5B1LD 5BNVB 4J8VA 3AZFB 5AVBB 1H3OB 5JRGB 3AZFC 2F8ND 1P3KD 1P3OC 4H9OB 5JRGC 5B32A 1BFMA 4XZQB 3KUYB 5AV9D 3AZMA 4XZQC 3X1VD 3KUYC 5B31D 1KX4D 1AOIA 4Z5TD 3W97D 3AZNA 3W99B 4J8WC 3REKB 3B6GC 3REHD 1Q9CA 3AYWC 3A6NB 3C1CA 4KGCA 1U35B 1P3LC 5B40A 3B6FA 5B1LB 4JJND 5B24B 3UTAB 3MGRA 3AZKD 5B1MD 3AZEA 1S32A 5B24C 1M18C 5BT1D 3LZ1A 2F8NB 4J8XB 3AZJA 4QLCC 5AV6B 4J8UC 5AV6C 4KUDD 5AV9B 1P3BD 3WAAA 5CP6C 3X1VB 1M19A 3B0CW 1KX4B 3LZ0C 5GXQB 4WU8D 3AZLD 3WTPE 1P3PD 1TZYD 5GT3D 4YM6C 3WA9D 5DNMD 3X1TA 3AFAB 4WU9D 3VH6W 1P3FD 4CSRA 4Z66A 2PYOA 5AV8C 1HQ3D 4KUDB 3LJAD 2L5AA 1P3BB 3W98D 3MVDA 5GSUC 5GT0D 5BNVA 5DNNB 4J8VC 1EQZD 5AVBA 1M1AB 5DNNC 2AROB 4LD9D 1H3OA 4WU8B 5JRGA 3TU4D 1M1AC 1P3GD 2AROC 3AZLB 4H9OA 3X1SD 1TAFB 5GT3B 5B32C 4XZQA 4Z2MG 4G92B 3KUYA 1F66D 2IO5B 5DNMB 4G92C 3AZMC 1BH9B 4WU9B 5AV5B 1AOIC 3AZGD 3W99A 3AZNC 3KXBD 1P3ID 3AV2D 1P3FB 5JA4B 4DRBA 4ZUXB 3REKA 3MNNB 2YFWB 3A6NA 1KU5A 5B2JD 3MNNC 3KWQD 1JFIB 1HQ3B 3C1CC 3B0DB 3VH6A 3MGSB 1U35A 5B1LA 4KGCC 2FJ7D 3B0DC 3MGSC 3WTPD 5B40C 3B6FC 5B24A 1S32B 3UTAA 2NZDD 1EQZB 3MGRC 1S32C 3TU4B 2CV5B 2F8NA 4J8XA 3LZ1C 1WWIA 3X1SB 5AV6A 2CV5C 5B2IB 3AZJC 5B2IC 3VH5T 5AV9A 1F66B 4YS3B 3X1VA 5AVCD 1M19C 4YS3C 1KX4A 5CPJB 3AZGB 3REJD 5GXQA 5CPJC 4H9QB 1ZLAB 4R8PD 1ZLAC 1KX3D 3AN2D 1R4VA 3WTPB 2HUEB 3AFAA 3X1TC 3RELD 5AY8B 5B32G 5AY8C 4NFTA 4Z66C 5CPKD 2PYOC 5G49B 4KUDA 1P3BA 1P3OD 4DRAA 3MVDC 5DNNA 1ID3D 3AZHD 4G91B 1M1AA 3REJB 2AROA 4X23D 5AVBC 4WU8A 4G91C 3C1BD 3AZLA 1TAFA 5GT3A 1A7WA 4J8WD 3B6GD 4H9SA 5DNMA 1KX3B 1BH9A 4WU9A 5AV5A 1P3MD 3RELB 4HGAB 4WNNB 5CPID 3W99C 1P3FA 1B67A 5JA4A 4HGAC 4ZUXA 5BO0B 3MNNA 3REKC 3UT9D 2YFWA 5E5AD 1M18D 1JFIA 3A6NC 5CPKB 1HQ3A 3MGSA 1U35C 4QLCD 3WKJD 3AZID 5B1LC 2F8NK 3AZHB 3UTBD 1EQZA 3UTAC 3O62D 4X23B 4ZBJB 3TU4A 1P3KB 2CV5A 3C1BB 4ZBJC 3X1SA 4J8XC 5B33D 1P3KC 5B2IA 1F66A 5AV9C 4YS3A 5B31B 3W97B 4Z5TB 3X1VC 5CPJA 3W96D 3AZGA 1KX4C 4Z5TC 3W97C 5CPIB 4Z2MH 4H9QA 1ZLAA 3REHB 5GXQC 4CAYA 3UT9B 5E5AB 3REHC 5F99D 4KHAB 4JJNB 3AZIB 3WTPA 3AZKB 2RVQD 5B1MB 4JJNC 1B6WA 5B0ZD 3X1UD 3AFAC 3O62B 5B1MC 3AZKC 5AY8A 5BT1C 4J8VD 4AWLB 1KX5D 2NQBD 5G49A 5KDMB 4KUDC 4H9NB 1P3BC 5B32D 3REJA 1P3PB 1TZYB 4WU8C 3AZLC 1AOID 1P3PC 2HIOD 5GT3C 3WA9B 1P34D 1KX3A 2IO5C 4H9SC 5DNMC 4M6BA 2YFVB 3MGQD 5B0ZB 4WU9C 1P3AD 3RELA 5AV5C 4WNNA 3VH6T 2F8NG 5BO0A 1P3FC 4ZUXC 3MGRD 1KX5B 3AZED 2NQBB 5CPKA 3LJAB 2BYMB 1BH8B 3W98B 5B0YD 5GT0B 1HQ3C 3LJAC 3W98C 3AZHA 4LD9B 3VH5W 1EQZC 4X23A 3WAAD 1P3GB 1P3KA 4LD9C 3TU4C 3C1BA 3X1SC 2HIOB 3AV1D 2LY8A 4XUJD 1F66C 1P34B 5B31A 3W97A 4Z5TA 3MGQB 1P3AB 3KXBB 1P3IB 4EO5B 3AV2B 5CPIA 1WWSA 3AZGC 3REHA 1P3IC 4CAYB 3UT9A 5B2JB 5E5AA 3KWQB 4NE5A 4KHAA 5B0YB 4JJNA 2FJ7B 5BNXB 3LELD 3AZIA 3REID 3AZKA 5B1MA 2FJ7C 1P3AC 2NZDB 3WTPC 3MGPD 2HUEC 5BS7A 3O62A 3AZFD 3AV1B 4XUJB 5JRGD 5KDMA 4H9NA 5AVCB 3V9RB 5AVCC 3W96A 4XZQD 3KUYD 3REJC 4R8PB 3NQJB 1P3PA 1TZYA 4R8PC 3WA9A 3AN2B 3AYWD 3LELB 3REIB 1KX3C 3AN2C 2YFVA 5B0ZA 3KSYA 3MGPB 1P3LD 3RELC 5B24D 3UTAD 1KX5A 2NQBA 3LJAA 2BYMA 1BH8A 1P3OB 5CPKC 3W98A 5GT0A 4J8UD 4J8XD 1ID3B 5AV6D 1ID3C 3AZHC 4LD9A 5CP6D 4H9RB 1P3GA 4X23C 3LZ0D 3C1BC 1F1EA 4J8WB 2HIOA 3B6GB 5GXQD 3AYWB 1ULYA 1P34A 4YM6D 3MGQA 5B31C 1P3LB 1P3MB 1P3AA 3KXBA 1P3IA 3AV2A 1P3MC 5CPIC 3AFAD 5B2JA 1M18B 3KWQA 3UT9C 5E5AC 3NQUB 5B0YA 4QLCB 2FJ7A 4J8UB 3WKJB 5BNXA 5AV8D 2F8NH 2NZDA 3UTBB 3AZIC 3WKJC 4NE3A 5GSUD 3B0BA 5BS7C 5CP6B 3UTBC 3O62C 4H9PB 1HTAA 3LZ0B 5B33B 5DNND 3R45A 4AWLC 5B33C 2BYKB 3AV1A 1M1AD 4XUJA 2AROD 2CWEA 5AVCA 3B0CT 3V9RA 4YM6B 3W96B 5FUGB 3AZMD 3W96C 4R8PA 3NQJA 4UUZB 1TZYC 3AZND 5AV5D 5F99B 1N1JB 3WA9C 5F99C 3AN2A 4ZUXD 3MNND 5AV8B 3LELA 3REIA 3X1UB 3C1CD 3MGPA 2RVQC 5B0ZC 4KGCD 5GSUB 3X1UC 5B40D 3MGSD 3B6FD 4J8VB 1S32D 3AZFA 2JSSA 1KX5C 3LZ1D 1P3OA 2NQBC 2CV5D 5B32B 5GT0C 3AZJD 1ID3A 5B31G 5B2ID 3AZMB 4H9RA 4E44A 4WV4B 1M19D 4YS3D 1P3GC 1AOIB 3AZNB 5CPJD 4J8WA 4E45A 3B6GA 2HIOC 1ZLAD 3AYWA 1P34C 3C1CB 1P3MA 1P3LA 3MGQC 4KGCB 5B40B 3B6FB 3KXBC 4EO5C
chains in the Genus database with same CATH superfamily
3AV2C 3X1TD 3MGRB 3AZEB 1M18A 2J8PA 5B2JC 3KWQC 3AZEC 3LZ1B 3NQUA 5AY8D 4QLCA 3WKJA 4J8UA 5B0YC 3AZJB 4Z66D 2Y2KA 2PYOD 3UTBA 2NZDC 5CP6A 3WAAB 3MVDD 4H9PA 5C3IB 1M19B 3WAAC 3LZ0A 5B33A 3R45B 5C3IC 5AVBD 3VH5A 2BYKA 3AV1C 4XUJC 4YM6A 5FUGA 3X1TB 5CHLB 4UUZA 3W99D 5F99A 4NE6A 3IP4C 1N1JA 4CSRB 3REKD 4WZSB 5AV8A 4Z66B 3A6ND 2PYOB 3X1UA 3LELC 3REIC 3MGPC 5GSUA 1U35D 3MVDB 5B1LD 5BNVB 4J8VA 3AZFB 5AVBB 1H3OB 5JRGB 3AZFC 2Y2PA 2F8ND 1P3KD 1P3OC 2JCHA 4H9OB 5JRGC 5B32A 1BFMA 1W2EA 4XZQB 3KUYB 5AV9D 3AZMA 4XZQC 3X1VD 3KUYC 5B31D 1KX4D 1AOIA 4Z5TD 3W97D 3AZNA 3H0MC 3W99B 4J8WC 3REKB 3B6GC 3REHD 1Q9CA 3AYWC 3A6NB 3C1CA 4KGCA 1U35B 1P3LC 5B40A 3B6FA 5B1LB 2ZY3A 4JJND 5B24B 3UTAB 3MGRA 3AZKD 5B1MD 3AZEA 1S32A 5B24C 1M18C 5BT1D 3LZ1A 2F8NB 4J8XB 3AZJA 4QLCC 5AV6B 4J8UC 4WJ3C 2XD1A 5AV6C 4KUDD 5AV9B 1P3BD 3WAAA 5CP6C 3X1VB 1M19A 3B0CW 3EPJA 1KX4B 3LZ0C 5GXQB 4WU8D 2Y2JA 2ZY5A 3AZLD 3WTPE 1P3PD 1TZYD 5GT3D 4YM6C 3EPHA 3WA9D 5DNMD 1Z2CB 3X1TA 3AFAB 4WU9D 2JE5A 3VH6W 1P3FD 4CSRA 4Z66A 2PYOA 5AV8C 1HQ3D 4KUDB 3LJAD 2L5AA 1P3BB 3W98D 3MVDA 5GSUC 5GT0D 5BNVA 2DF4C 5DNNB 4J8VC 1EQZD 5AVBA 1M1AB 5DNNC 2AROB 4LD9D 1H3OA 4WU8B 5JRGA 3TU4D 1M1AC 2ZY4A 2AROC 3AZLB 1P3GD 4H9OA 3X1SD 1TAFB 5GT3B 5B32C 4XZQA 4Z2MG 4G92B 3KUYA 1F66D 2DQNC 2IO5B 5DNMB 4G92C 3AZMC 1BH9B 4WU9B 5AV5B 2Y2HA 3AZGD 1AOIC 3W99A 3AZNC 3KXBD 1P3ID 3AV2D 1P3FB 5JA4B 4DRBA 4ZUXB 3REKA 3MNNB 1PZRA 2YFWB 3A6NA 1KU5A 5B2JD 3MNNC 3KWQD 1JFIB 3AL0C 1HQ3B 3C1CC 3B0DB 3VH6A 3MGSB 1U35A 5B1LA 4KGCC 2FJ7D 3B0DC 3MGSC 3WTPD 5B40C 2UWXA 5B24A 1S32B 3UTAA 3B6FC 2NZDD 3A1IA 1EQZB 3MGRC 1S32C 3TU4B 2CV5B 2F8NA 4J8XA 3LZ1C 4DQYB 1WWIA 3X1SB 5AV6A 2CV5C 5B2IB 3AZJC 5B2IC 3VH5T 5AV9A 1F66B 4YS3B 3X1VA 5AVCD 1M19C 4YS3C 1KX4A 5CPJB 3AZGB 3REJD 5GXQA 5CPJC 4H9QB 1ZLAB 3KXBC 4R8PD 1ZLAC 1KX3D 3AN2D 1R4VA 3WTPB 2HUEB 2F2AC 3AFAA 3X1TC 3RELD 5AY8B 5B32G 5AY8C 4NFTA 4Z66C 5CPKD 2PYOC 5G49B 4KUDA 1P3BA 1P3OD 4DRAA 3MVDC 5DNNA 1ID3D 3AZHD 4G91B 1M1AA 3REJB 2AROA 4X23D 5AVBC 4WU8A 4G91C 2FFFB 3C1BD 3AZLA 1TAFA 5GT3A 1A7WA 4J8WD 3B6GD 4H9SA 5DNMA 1KX3B 1BH9A 4WU9A 2XD5A 3H0RC 5AV5A 1P3MD 3RELB 4HGAB 4WNNB 5CPID 3W99C 1P3FA 1B67A 5JA4A 4HGAC 4ZUXA 5BO0B 3MNNA 3REKC 3UT9D 2YFWA 5E5AD 2ZM5A 1M18D 1JFIA 3A6NC 5CPKB 1HQ3A 3MGSA 1U35C 4QLCD 3WKJD 3AZID 5B1LC 2F8NK 3AZHB 3UTBD 1EQZA 3UTAC 3O62D 4X23B 4ZBJB 3TU4A 2G5IC 1P3KB 2CV5A 3C1BB 4ZBJC 3X1SA 4J8XC 5B33D 1P3KC 5B2IA 2W8SA 1F66A 5AV9C 4YS3A 5B31B 3W97B 4Z5TB 3X1VC 5CPJA 3W96D 3AZGA 1KX4C 4Z5TC 3W97C 5CPIB 4Z2MH 4H9QA 1ZLAA 3REHB 5GXQC 4CAYA 3UT9B 5E5AB 3EPLA 3REHC 5F99D 4KHAB 4JJNB 3AZIB 3WTPA 3AZKB 2RVQD 5B1MB 4JJNC 1B6WA 5B0ZD 3X1UD 3AFAC 3O62B 5B1MC 3AZKC 5AY8A 5BT1C 4J8VD 4AWLB 3F6TA 1KX5D 2NQBD 5G49A 5KDMB 4KUDC 4H9NB 1P3BC 5B32D 3REJA 1P3PB 1TZYB 4WU8C 3AZLC 3EPKA 1AOID 1P3PC 2HIOD 5GT3C 3WA9B 1P34D 4UPKA 1KX3A 2IO5C 4H9SC 5DNMC 4M6BA 2YFVB 3MGQD 5B0ZB 4WU9C 1P3AD 3RELA 5AV5C 4WNNA 3VH6T 2F8NG 5BO0A 1P3FC 4ZUXC 3MGRD 1KX5B 3AZED 2NQBB 5CPKA 3LJAB 2BYMB 1BH8B 3W98B 5B0YD 5GT0B 1HQ3C 3LJAC 3W98C 3AZHA 4LD9B 3VH5W 1EQZC 4X23A 3WAAD 1P3GB 1P3KA 4LD9C 3TU4C 3C1BA 3X1SC 2HIOB 3AV1D 2LY8A 4XUJD 1F66C 1P34B 3H0LC 5B31A 3W97A 4Z5TA 3MGQB 1P3AB 3KXBB 1P3IB 4EO5B 3AV2B 5CPIA 1WWSA 3AZGC 3REHA 1P3IC 4CAYB 2Y2IA 3UT9A 5B2JB 5E5AA 3KWQB 4NE5A 4KHAA 5B0YB 4JJNA 2FJ7B 5BNXB 3LELD 3AZIA 3REID 3AZKA 5B1MA 2FJ7C 1P3AC 2NZDB 3WTPC 3MGPD 5BS7A 2HUEC 2VQRA 2Y2QA 3O62A 3AZFD 3AV1B 4XUJB 5JRGD 5KDMA 4H9NA 5AVCB 3V9RB 5AVCC 3W96A 4XZQD 3KUYD 3REJC 4R8PB 3NQJB 1P3PA 1TZYA 3A1KA 4R8PC 3WA9A 3AN2B 3AYWD 2BG1A 3LELB 3REIB 1KX3C 3AN2C 2YFVA 5B0ZA 3KSYA 3MGPB 1P3LD 3KFUG 3RELC 5B24D 3UTAD 1KX5A 2G5HC 2NQBA 3LJAA 2BYMA 1BH8A 3P5JB 5CPKC 1P3OB 3W98A 5GT0A 4J8UD 4J8XD 1ID3B 5AV6D 1ID3C 3AZHC 4LD9A 5CP6D 2Y2LA 4H9RB 1P3GA 4X23C 3LZ0D 3C1BC 1F1EA 4J8WB 2Y2NA 2HIOA 3B6GB 5GXQD 2Y2MA 3AYWB 1ULYA 1P34A 4YM6D 3MGQA 5B31C 1P3LB 1P3MB 1P3AA 3KXBA 1P3IA 3AV2A 1P3MC 5CPIC 3AFAD 5B2JA 1M18B 3KWQA 3UT9C 5E5AC 3NQUB 5B0YA 4QLCB 2FJ7A 2Y2OA 4J8UB 3WKJB 5BNXA 5AV8D 2F8NH 2NZDA 3UTBB 3AZIC 3WKJC 4NE3A 5GSUD 3B0BA 5BS7C 5CP6B 3UTBC 3O62C 4H9PB 1HTAA 3LZ0B 5B33B 5DNND 3R45A 4AWLC 1T3UA 2BYKB 5B33C 3AV1A 4XUJA 1M1AD 2AROD 2CWEA 5AVCA 3B0CT 3V9RA 4YM6B 3W96B 5FUGB 3AZMD 3W96C 4R8PA 3NQJA 4UUZB 1TZYC 3AZND 5AV5D 5F99B 1N1JB 3WA9C 5F99C 3AN2A 4ZUXD 3MNND 5AV8B 3LELA 3REIA 3X1UB 3C1CD 3MGPA 2RVQC 5B0ZC 4KGCD 5GSUB 3X1UC 5B40D 3MGSD 3B6FD 4J8VB 1S32D 3AZFA 2JSSA 1KX5C 2Y2GA 3LZ1D 1P3OA 3EG5B 2NQBC 2CV5D 5B32B 5GT0C 3AZJD 1ID3A 5B31G 3FDDA 5B2ID 3AZMB 4H9RA 4E44A 2ZY2A 4WV4B 1M19D 4YS3D 1P3GC 1AOIB 3AZNB 5CPJD 4J8WA 4E45A 3B6GA 2HIOC 1ZLAD 3AYWA 1P34C 3C1CB 1P3MA 1P3LA 3MGQC 4KGCB 5B40B 3B6FB 2RIQA 4EO5C
chains in the Genus database with same CATH topology
3AV2C 3X1TD 3MGRB 3AZEB 1M18A 2J8PA 5B2JC 3KWQC 3AZEC 3LZ1B 3NQUA 5AY8D 4QLCA 3WKJA 4J8UA 5B0YC 3AZJB 4Z66D 2Y2KA 2PYOD 3UTBA 2NZDC 5CP6A 3WAAB 3MVDD 4H9PA 5C3IB 1M19B 3WAAC 3LZ0A 5B33A 3R45B 5C3IC 5AVBD 3VH5A 2BYKA 3AV1C 4XUJC 4YM6A 5FUGA 3X1TB 5CHLB 4UUZA 3W99D 5F99A 4NE6A 3IP4C 1N1JA 4CSRB 3REKD 4WZSB 5AV8A 4Z66B 3A6ND 2PYOB 3X1UA 3LELC 3REIC 3MGPC 5GSUA 1U35D 3MVDB 5B1LD 5BNVB 4J8VA 3AZFB 5AVBB 1H3OB 5JRGB 3AZFC 2Y2PA 2F8ND 1P3KD 1P3OC 2JCHA 4H9OB 5JRGC 5B32A 1BFMA 1W2EA 4XZQB 3KUYB 5AV9D 3AZMA 4XZQC 3X1VD 3KUYC 5B31D 1KX4D 1AOIA 4Z5TD 3W97D 3AZNA 3H0MC 3W99B 4J8WC 3REKB 3B6GC 3REHD 1Q9CA 3AYWC 3A6NB 3C1CA 4KGCA 1U35B 1P3LC 5B40A 3B6FA 5B1LB 2ZY3A 4JJND 5B24B 3UTAB 3MGRA 3AZKD 5B1MD 3AZEA 1S32A 5B24C 1M18C 5BT1D 3LZ1A 2F8NB 4J8XB 3AZJA 4QLCC 5AV6B 4J8UC 4WJ3C 2XD1A 5AV6C 4KUDD 5AV9B 1P3BD 3WAAA 5CP6C 3X1VB 1M19A 3B0CW 3EPJA 1KX4B 3LZ0C 5GXQB 4WU8D 2Y2JA 2ZY5A 3AZLD 3WTPE 1P3PD 1TZYD 5GT3D 4YM6C 3EPHA 3WA9D 5DNMD 1Z2CB 3X1TA 3AFAB 4WU9D 2JE5A 3VH6W 1P3FD 4CSRA 4Z66A 2PYOA 5AV8C 1HQ3D 4KUDB 3LJAD 2L5AA 1P3BB 3W98D 3MVDA 5GSUC 5GT0D 5BNVA 2DF4C 5DNNB 4J8VC 1EQZD 5AVBA 1M1AB 5DNNC 2AROB 4LD9D 1H3OA 4WU8B 5JRGA 3TU4D 1M1AC 2ZY4A 2AROC 3AZLB 1P3GD 4H9OA 3X1SD 1TAFB 5GT3B 5B32C 4XZQA 4Z2MG 4G92B 3KUYA 1F66D 2DQNC 2IO5B 5DNMB 4G92C 3AZMC 1BH9B 4WU9B 5AV5B 2Y2HA 3AZGD 1AOIC 3W99A 3AZNC 3KXBD 1P3ID 3AV2D 1P3FB 5JA4B 4DRBA 4ZUXB 3REKA 3MNNB 1PZRA 2YFWB 3A6NA 1KU5A 5B2JD 3MNNC 3KWQD 1JFIB 3AL0C 1HQ3B 3C1CC 3B0DB 3VH6A 3MGSB 1U35A 5B1LA 4KGCC 2FJ7D 3B0DC 3MGSC 3WTPD 5B40C 2UWXA 5B24A 1S32B 3UTAA 3B6FC 2NZDD 3A1IA 1EQZB 3MGRC 1S32C 3TU4B 2CV5B 2F8NA 4J8XA 3LZ1C 4DQYB 1WWIA 3X1SB 5AV6A 2CV5C 5B2IB 3AZJC 5B2IC 3VH5T 5AV9A 1F66B 4YS3B 3X1VA 5AVCD 1M19C 4YS3C 1KX4A 5CPJB 3AZGB 3REJD 5GXQA 5CPJC 4H9QB 1ZLAB 3KXBC 4R8PD 1ZLAC 1KX3D 3AN2D 1R4VA 3WTPB 2HUEB 2F2AC 3AFAA 3X1TC 3RELD 5AY8B 5B32G 5AY8C 4NFTA 4Z66C 5CPKD 2PYOC 5G49B 4KUDA 1P3BA 1P3OD 4DRAA 3MVDC 5DNNA 1ID3D 3AZHD 4G91B 1M1AA 3REJB 2AROA 4X23D 5AVBC 4WU8A 4G91C 2FFFB 3C1BD 3AZLA 1TAFA 5GT3A 1A7WA 4J8WD 3B6GD 4H9SA 5DNMA 1KX3B 1BH9A 4WU9A 2XD5A 3H0RC 5AV5A 1P3MD 3RELB 4HGAB 4WNNB 5CPID 3W99C 1P3FA 1B67A 5JA4A 4HGAC 4ZUXA 5BO0B 3MNNA 3REKC 3UT9D 2YFWA 5E5AD 2ZM5A 1M18D 1JFIA 3A6NC 5CPKB 1HQ3A 3MGSA 1U35C 4QLCD 3WKJD 3AZID 5B1LC 2F8NK 3AZHB 3UTBD 1EQZA 3UTAC 3O62D 4X23B 4ZBJB 3TU4A 2G5IC 1P3KB 2CV5A 3C1BB 4ZBJC 3X1SA 4J8XC 5B33D 1P3KC 5B2IA 2W8SA 1F66A 5AV9C 4YS3A 5B31B 3W97B 4Z5TB 3X1VC 5CPJA 3W96D 3AZGA 1KX4C 4Z5TC 3W97C 5CPIB 4Z2MH 4H9QA 1ZLAA 3REHB 5GXQC 4CAYA 3UT9B 5E5AB 3EPLA 3REHC 5F99D 4KHAB 4JJNB 3AZIB 3WTPA 3AZKB 2RVQD 5B1MB 4JJNC 1B6WA 5B0ZD 3X1UD 3AFAC 3O62B 5B1MC 3AZKC 5AY8A 5BT1C 4J8VD 4AWLB 3F6TA 1KX5D 2NQBD 5G49A 5KDMB 4KUDC 4H9NB 1P3BC 5B32D 3REJA 1P3PB 1TZYB 4WU8C 3AZLC 3EPKA 1AOID 1P3PC 2HIOD 5GT3C 3WA9B 1P34D 4UPKA 1KX3A 2IO5C 4H9SC 5DNMC 4M6BA 2YFVB 3MGQD 5B0ZB 4WU9C 1P3AD 3RELA 5AV5C 4WNNA 3VH6T 2F8NG 5BO0A 1P3FC 4ZUXC 3MGRD 1KX5B 3AZED 2NQBB 5CPKA 3LJAB 2BYMB 1BH8B 3W98B 5B0YD 5GT0B 1HQ3C 3LJAC 3W98C 3AZHA 4LD9B 3VH5W 1EQZC 4X23A 3WAAD 1P3GB 1P3KA 4LD9C 3TU4C 3C1BA 3X1SC 2HIOB 3AV1D 2LY8A 4XUJD 1F66C 1P34B 3H0LC 5B31A 3W97A 4Z5TA 3MGQB 1P3AB 3KXBB 1P3IB 4EO5B 3AV2B 5CPIA 1WWSA 3AZGC 3REHA 1P3IC 4CAYB 2Y2IA 3UT9A 5B2JB 5E5AA 3KWQB 4NE5A 4KHAA 5B0YB 4JJNA 2FJ7B 5BNXB 3LELD 3AZIA 3REID 3AZKA 5B1MA 2FJ7C 1P3AC 2NZDB 3WTPC 3MGPD 5BS7A 2HUEC 2VQRA 2Y2QA 3O62A 3AZFD 3AV1B 4XUJB 5JRGD 5KDMA 4H9NA 5AVCB 3V9RB 5AVCC 3W96A 4XZQD 3KUYD 3REJC 4R8PB 3NQJB 1P3PA 1TZYA 3A1KA 4R8PC 3WA9A 3AN2B 3AYWD 2BG1A 3LELB 3REIB 1KX3C 3AN2C 2YFVA 5B0ZA 3KSYA 3MGPB 1P3LD 3KFUG 3RELC 5B24D 3UTAD 1KX5A 2G5HC 2NQBA 3LJAA 2BYMA 1BH8A 3P5JB 5CPKC 1P3OB 3W98A 5GT0A 4J8UD 4J8XD 1ID3B 5AV6D 1ID3C 3AZHC 4LD9A 5CP6D 2Y2LA 4H9RB 1P3GA 4X23C 3LZ0D 3C1BC 1F1EA 4J8WB 2Y2NA 2HIOA 3B6GB 5GXQD 2Y2MA 3AYWB 1ULYA 1P34A 4YM6D 3MGQA 5B31C 1P3LB 1P3MB 1P3AA 3KXBA 1P3IA 3AV2A 1P3MC 5CPIC 3AFAD 5B2JA 1M18B 3KWQA 3UT9C 5E5AC 3NQUB 5B0YA 4QLCB 2FJ7A 2Y2OA 4J8UB 3WKJB 5BNXA 5AV8D 2F8NH 2NZDA 3UTBB 3AZIC 3WKJC 4NE3A 5GSUD 3B0BA 5BS7C 5CP6B 3UTBC 3O62C 4H9PB 1HTAA 3LZ0B 5B33B 5DNND 3R45A 4AWLC 1T3UA 2BYKB 5B33C 3AV1A 4XUJA 1M1AD 2AROD 2CWEA 5AVCA 3B0CT 3V9RA 4YM6B 3W96B 5FUGB 3AZMD 3W96C 4R8PA 3NQJA 4UUZB 1TZYC 3AZND 5AV5D 5F99B 1N1JB 3WA9C 5F99C 3AN2A 4ZUXD 3MNND 5AV8B 3LELA 3REIA 3X1UB 3C1CD 3MGPA 2RVQC 5B0ZC 4KGCD 5GSUB 3X1UC 5B40D 3MGSD 3B6FD 4J8VB 1S32D 3AZFA 2JSSA 1KX5C 2Y2GA 3LZ1D 1P3OA 3EG5B 2NQBC 2CV5D 5B32B 5GT0C 3AZJD 1ID3A 5B31G 3FDDA 5B2ID 3AZMB 4H9RA 4E44A 2ZY2A 4WV4B 1M19D 4YS3D 1P3GC 1AOIB 3AZNB 5CPJD 4J8WA 4E45A 3B6GA 2HIOC 1ZLAD 3AYWA 1P34C 3C1CB 1P3MA 1P3LA 3MGQC 4KGCB 5B40B 3B6FB 2RIQA 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 C;  3X1T D;  3MGR B;  3AZE B;  1M18 A;  5B2J C;  3KWQ C;  3AZE C;  3LZ1 B;  3NQU A;  5AY8 D;  4QLC A;  3WKJ A;  4J8U A;  5B0Y C;  3AZJ B;  4Z66 D;  2PYO D;  3UTB A;  2NZD C;  5CP6 A;  3WAA B;  3MVD D;  4H9P A;  5C3I B;  1M19 B;  3WAA C;  3LZ0 A;  5B33 A;  3R45 B;  5C3I C;  5AVB D;  3VH5 A;  2BYK A;  3AV1 C;  4XUJ C;  4YM6 A;  5FUG A;  3X1T B;  5CHL B;  4UUZ A;  3W99 D;  5F99 A;  4NE6 A;  1N1J A;  4CSR B;  3REK D;  4WZS B;  5AV8 A;  4Z66 B;  3A6N D;  2PYO B;  3X1U A;  3LEL C;  3REI C;  3MGP C;  5GSU A;  1U35 D;  3MVD B;  5B1L D;  5BNV B;  4J8V A;  3AZF B;  5AVB B;  1H3O B;  5JRG B;  3AZF C;  2F8N D;  1P3K D;  1P3O C;  4H9O B;  5JRG C;  5B32 A;  1BFM A;  4XZQ B;  3KUY B;  5AV9 D;  3AZM A;  4XZQ C;  3X1V D;  3KUY C;  5B31 D;  1KX4 D;  1AOI A;  4Z5T D;  3W97 D;  3AZN A;  3W99 B;  4J8W C;  3REK B;  3B6G C;  3REH D;  1Q9C A;  3AYW C;  3A6N B;  3C1C A;  4KGC A;  1U35 B;  1P3L C;  5B40 A;  3B6F A;  5B1L B;  4JJN D;  5B24 B;  3UTA B;  3MGR A;  3AZK D;  5B1M D;  3AZE A;  1S32 A;  5B24 C;  1M18 C;  5BT1 D;  3LZ1 A;  2F8N B;  4J8X B;  3AZJ A;  4QLC C;  5AV6 B;  4J8U C;  5AV6 C;  4KUD D;  5AV9 B;  1P3B D;  3WAA A;  5CP6 C;  3X1V B;  1M19 A;  3B0C W;  1KX4 B;  3LZ0 C;  5GXQ B;  4WU8 D;  3AZL D;  3WTP E;  1P3P D;  1TZY D;  5GT3 D;  4YM6 C;  3WA9 D;  5DNM D;  3X1T A;  3AFA B;  4WU9 D;  3VH6 W;  1P3F D;  4CSR A;  4Z66 A;  2PYO A;  5AV8 C;  1HQ3 D;  4KUD B;  3LJA D;  2L5A A;  1P3B B;  3W98 D;  3MVD A;  5GSU C;  5GT0 D;  5BNV A;  5DNN B;  4J8V C;  1EQZ D;  5AVB A;  1M1A B;  5DNN C;  2ARO B;  4LD9 D;  1H3O A;  4WU8 B;  5JRG A;  3TU4 D;  1M1A C;  1P3G D;  2ARO C;  3AZL B;  4H9O A;  3X1S D;  1TAF B;  5GT3 B;  5B32 C;  4XZQ A;  4Z2M G;  4G92 B;  3KUY A;  1F66 D;  2IO5 B;  5DNM B;  4G92 C;  3AZM C;  1BH9 B;  4WU9 B;  5AV5 B;  1AOI C;  3AZG D;  3W99 A;  3AZN C;  3KXB D;  1P3I D;  3AV2 D;  1P3F B;  5JA4 B;  4DRB A;  4ZUX B;  3REK A;  3MNN B;  2YFW B;  3A6N A;  1KU5 A;  5B2J D;  3MNN C;  3KWQ D;  1JFI B;  1HQ3 B;  3C1C C;  3B0D B;  3VH6 A;  3MGS B;  1U35 A;  5B1L A;  4KGC C;  2FJ7 D;  3B0D C;  3MGS C;  3WTP D;  5B40 C;  3B6F C;  5B24 A;  1S32 B;  3UTA A;  2NZD D;  1EQZ B;  3MGR C;  1S32 C;  3TU4 B;  2CV5 B;  2F8N A;  4J8X A;  3LZ1 C;  1WWI A;  3X1S B;  5AV6 A;  2CV5 C;  5B2I B;  3AZJ C;  5B2I C;  3VH5 T;  5AV9 A;  1F66 B;  4YS3 B;  3X1V A;  5AVC D;  1M19 C;  4YS3 C;  1KX4 A;  5CPJ B;  3AZG B;  3REJ D;  5GXQ A;  5CPJ C;  4H9Q B;  1ZLA B;  4R8P D;  1ZLA C;  1KX3 D;  3AN2 D;  1R4V A;  3WTP B;  2HUE B;  3AFA A;  3X1T C;  3REL D;  5AY8 B;  5B32 G;  5AY8 C;  4NFT A;  4Z66 C;  5CPK D;  2PYO C;  5G49 B;  4KUD A;  1P3B A;  1P3O D;  4DRA A;  3MVD C;  5DNN A;  1ID3 D;  3AZH D;  4G91 B;  1M1A A;  3REJ B;  2ARO A;  4X23 D;  5AVB C;  4WU8 A;  4G91 C;  3C1B D;  3AZL A;  1TAF A;  5GT3 A;  1A7W A;  4J8W D;  3B6G D;  4H9S A;  5DNM A;  1KX3 B;  1BH9 A;  4WU9 A;  5AV5 A;  1P3M D;  3REL B;  4HGA B;  4WNN B;  5CPI D;  3W99 C;  1P3F A;  1B67 A;  5JA4 A;  4HGA C;  4ZUX A;  5BO0 B;  3MNN A;  3REK C;  3UT9 D;  2YFW A;  5E5A D;  1M18 D;  1JFI A;  3A6N C;  5CPK B;  1HQ3 A;  3MGS A;  1U35 C;  4QLC D;  3WKJ D;  3AZI D;  5B1L C;  2F8N K;  3AZH B;  3UTB D;  1EQZ A;  3UTA C;  3O62 D;  4X23 B;  4ZBJ B;  3TU4 A;  1P3K B;  2CV5 A;  3C1B B;  4ZBJ C;  3X1S A;  4J8X C;  5B33 D;  1P3K C;  5B2I A;  1F66 A;  5AV9 C;  4YS3 A;  5B31 B;  3W97 B;  4Z5T B;  3X1V C;  5CPJ A;  3W96 D;  3AZG A;  1KX4 C;  4Z5T C;  3W97 C;  5CPI B;  4Z2M H;  4H9Q A;  1ZLA A;  3REH B;  5GXQ C;  4CAY A;  3UT9 B;  5E5A B;  3REH C;  5F99 D;  4KHA B;  4JJN B;  3AZI B;  3WTP A;  3AZK B;  2RVQ D;  5B1M B;  4JJN C;  1B6W A;  5B0Z D;  3X1U D;  3AFA C;  3O62 B;  5B1M C;  3AZK C;  5AY8 A;  5BT1 C;  4J8V D;  4AWL B;  1KX5 D;  2NQB D;  5G49 A;  5KDM B;  4KUD C;  4H9N B;  1P3B C;  5B32 D;  3REJ A;  1P3P B;  1TZY B;  4WU8 C;  3AZL C;  1AOI D;  1P3P C;  2HIO D;  5GT3 C;  3WA9 B;  1P34 D;  1KX3 A;  2IO5 C;  4H9S C;  5DNM C;  4M6B A;  2YFV B;  3MGQ D;  5B0Z B;  4WU9 C;  1P3A D;  3REL A;  5AV5 C;  4WNN A;  3VH6 T;  2F8N G;  5BO0 A;  1P3F C;  4ZUX C;  3MGR D;  1KX5 B;  3AZE D;  2NQB B;  5CPK A;  3LJA B;  2BYM B;  1BH8 B;  3W98 B;  5B0Y D;  5GT0 B;  1HQ3 C;  3LJA C;  3W98 C;  3AZH A;  4LD9 B;  3VH5 W;  1EQZ C;  4X23 A;  3WAA D;  1P3G B;  1P3K A;  4LD9 C;  3TU4 C;  3C1B A;  3X1S C;  2HIO B;  3AV1 D;  2LY8 A;  4XUJ D;  1F66 C;  1P34 B;  5B31 A;  3W97 A;  4Z5T A;  3MGQ B;  1P3A B;  3KXB B;  1P3I B;  4EO5 B;  3AV2 B;  5CPI A;  1WWS A;  3AZG C;  3REH A;  1P3I C;  4CAY B;  3UT9 A;  5B2J B;  5E5A A;  3KWQ B;  4NE5 A;  4KHA A;  5B0Y B;  4JJN A;  2FJ7 B;  5BNX B;  3LEL D;  3AZI A;  3REI D;  3AZK A;  5B1M A;  2FJ7 C;  1P3A C;  2NZD B;  3WTP C;  3MGP D;  2HUE C;  5BS7 A;  3O62 A;  3AZF D;  3AV1 B;  4XUJ B;  5JRG D;  5KDM A;  4H9N A;  5AVC B;  3V9R B;  5AVC C;  3W96 A;  4XZQ D;  3KUY D;  3REJ C;  4R8P B;  3NQJ B;  1P3P A;  1TZY A;  4R8P C;  3WA9 A;  3AN2 B;  3AYW D;  3LEL B;  3REI B;  1KX3 C;  3AN2 C;  2YFV A;  5B0Z A;  3KSY A;  3MGP B;  1P3L D;  3REL C;  5B24 D;  3UTA D;  1KX5 A;  2NQB A;  3LJA A;  2BYM A;  1BH8 A;  1P3O B;  5CPK C;  3W98 A;  5GT0 A;  4J8U D;  4J8X D;  1ID3 B;  5AV6 D;  1ID3 C;  3AZH C;  4LD9 A;  5CP6 D;  4H9R B;  1P3G A;  4X23 C;  3LZ0 D;  3C1B C;  1F1E A;  4J8W B;  2HIO A;  3B6G B;  5GXQ D;  3AYW B;  1ULY A;  1P34 A;  4YM6 D;  3MGQ A;  5B31 C;  1P3L B;  1P3M B;  1P3A A;  3KXB A;  1P3I A;  3AV2 A;  1P3M C;  5CPI C;  3AFA D;  5B2J A;  1M18 B;  3KWQ A;  3UT9 C;  5E5A C;  3NQU B;  5B0Y A;  4QLC B;  2FJ7 A;  4J8U B;  3WKJ B;  5BNX A;  5AV8 D;  2F8N H;  2NZD A;  3UTB B;  3AZI C;  3WKJ C;  4NE3 A;  5GSU D;  3B0B A;  5BS7 C;  5CP6 B;  3UTB C;  3O62 C;  4H9P B;  1HTA A;  3LZ0 B;  5B33 B;  5DNN D;  3R45 A;  4AWL C;  5B33 C;  2BYK B;  3AV1 A;  1M1A D;  4XUJ A;  2ARO D;  2CWE A;  5AVC A;  3B0C T;  3V9R A;  4YM6 B;  3W96 B;  5FUG B;  3AZM D;  3W96 C;  4R8P A;  3NQJ A;  4UUZ B;  1TZY C;  3AZN D;  5AV5 D;  5F99 B;  1N1J B;  3WA9 C;  5F99 C;  3AN2 A;  4ZUX D;  3MNN D;  5AV8 B;  3LEL A;  3REI A;  3X1U B;  3C1C D;  3MGP A;  2RVQ C;  5B0Z C;  4KGC D;  5GSU B;  3X1U C;  5B40 D;  3MGS D;  3B6F D;  4J8V B;  1S32 D;  3AZF A;  2JSS A;  1KX5 C;  3LZ1 D;  1P3O A;  2NQB C;  2CV5 D;  5B32 B;  5GT0 C;  3AZJ D;  1ID3 A;  5B31 G;  5B2I D;  3AZM B;  4H9R A;  4E44 A;  4WV4 B;  1M19 D;  4YS3 D;  1P3G C;  1AOI B;  3AZN B;  5CPJ D;  4J8W A;  4E45 A;  3B6G A;  2HIO C;  1ZLA D;  3AYW A;  1P34 C;  3C1C B;  1P3M A;  1P3L A;  3MGQ C;  4KGC B;  5B40 B;  3B6F B;  3KXB C;  4EO5 C; 
#chains in the Genus database with same CATH topology
 3AV2 C;  3X1T D;  3MGR B;  3AZE B;  1M18 A;  2J8P A;  5B2J C;  3KWQ C;  3AZE C;  3LZ1 B;  3NQU A;  5AY8 D;  4QLC A;  3WKJ A;  4J8U A;  5B0Y C;  3AZJ B;  4Z66 D;  2Y2K A;  2PYO D;  3UTB A;  2NZD C;  5CP6 A;  3WAA B;  3MVD D;  4H9P A;  5C3I B;  1M19 B;  3WAA C;  3LZ0 A;  5B33 A;  3R45 B;  5C3I C;  5AVB D;  3VH5 A;  2BYK A;  3AV1 C;  4XUJ C;  4YM6 A;  5FUG A;  3X1T B;  5CHL B;  4UUZ A;  3W99 D;  5F99 A;  4NE6 A;  3IP4 C;  1N1J A;  4CSR B;  3REK D;  4WZS B;  5AV8 A;  4Z66 B;  3A6N D;  2PYO B;  3X1U A;  3LEL C;  3REI C;  3MGP C;  5GSU A;  1U35 D;  3MVD B;  5B1L D;  5BNV B;  4J8V A;  3AZF B;  5AVB B;  1H3O B;  5JRG B;  3AZF C;  2Y2P A;  2F8N D;  1P3K D;  1P3O C;  2JCH A;  4H9O B;  5JRG C;  5B32 A;  1BFM A;  1W2E A;  4XZQ B;  3KUY B;  5AV9 D;  3AZM A;  4XZQ C;  3X1V D;  3KUY C;  5B31 D;  1KX4 D;  1AOI A;  4Z5T D;  3W97 D;  3AZN A;  3H0M C;  3W99 B;  4J8W C;  3REK B;  3B6G C;  3REH D;  1Q9C A;  3AYW C;  3A6N B;  3C1C A;  4KGC A;  1U35 B;  1P3L C;  5B40 A;  3B6F A;  5B1L B;  2ZY3 A;  4JJN D;  5B24 B;  3UTA B;  3MGR A;  3AZK D;  5B1M D;  3AZE A;  1S32 A;  5B24 C;  1M18 C;  5BT1 D;  3LZ1 A;  2F8N B;  4J8X B;  3AZJ A;  4QLC C;  5AV6 B;  4J8U C;  4WJ3 C;  2XD1 A;  5AV6 C;  4KUD D;  5AV9 B;  1P3B D;  3WAA A;  5CP6 C;  3X1V B;  1M19 A;  3B0C W;  3EPJ A;  1KX4 B;  3LZ0 C;  5GXQ B;  4WU8 D;  2Y2J A;  2ZY5 A;  3AZL D;  3WTP E;  1P3P D;  1TZY D;  5GT3 D;  4YM6 C;  3EPH A;  3WA9 D;  5DNM D;  1Z2C B;  3X1T A;  3AFA B;  4WU9 D;  2JE5 A;  3VH6 W;  1P3F D;  4CSR A;  4Z66 A;  2PYO A;  5AV8 C;  1HQ3 D;  4KUD B;  3LJA D;  2L5A A;  1P3B B;  3W98 D;  3MVD A;  5GSU C;  5GT0 D;  5BNV A;  2DF4 C;  5DNN B;  4J8V C;  1EQZ D;  5AVB A;  1M1A B;  5DNN C;  2ARO B;  4LD9 D;  1H3O A;  4WU8 B;  5JRG A;  3TU4 D;  1M1A C;  2ZY4 A;  2ARO C;  3AZL B;  1P3G D;  4H9O A;  3X1S D;  1TAF B;  5GT3 B;  5B32 C;  4XZQ A;  4Z2M G;  4G92 B;  3KUY A;  1F66 D;  2DQN C;  2IO5 B;  5DNM B;  4G92 C;  3AZM C;  1BH9 B;  4WU9 B;  5AV5 B;  2Y2H A;  3AZG D;  1AOI C;  3W99 A;  3AZN C;  3KXB D;  1P3I D;  3AV2 D;  1P3F B;  5JA4 B;  4DRB A;  4ZUX B;  3REK A;  3MNN B;  1PZR A;  2YFW B;  3A6N A;  1KU5 A;  5B2J D;  3MNN C;  3KWQ D;  1JFI B;  3AL0 C;  1HQ3 B;  3C1C C;  3B0D B;  3VH6 A;  3MGS B;  1U35 A;  5B1L A;  4KGC C;  2FJ7 D;  3B0D C;  3MGS C;  3WTP D;  5B40 C;  2UWX A;  5B24 A;  1S32 B;  3UTA A;  3B6F C;  2NZD D;  3A1I A;  1EQZ B;  3MGR C;  1S32 C;  3TU4 B;  2CV5 B;  2F8N A;  4J8X A;  3LZ1 C;  4DQY B;  1WWI A;  3X1S B;  5AV6 A;  2CV5 C;  5B2I B;  3AZJ C;  5B2I C;  3VH5 T;  5AV9 A;  1F66 B;  4YS3 B;  3X1V A;  5AVC D;  1M19 C;  4YS3 C;  1KX4 A;  5CPJ B;  3AZG B;  3REJ D;  5GXQ A;  5CPJ C;  4H9Q B;  1ZLA B;  3KXB C;  4R8P D;  1ZLA C;  1KX3 D;  3AN2 D;  1R4V A;  3WTP B;  2HUE B;  2F2A C;  3AFA A;  3X1T C;  3REL D;  5AY8 B;  5B32 G;  5AY8 C;  4NFT A;  4Z66 C;  5CPK D;  2PYO C;  5G49 B;  4KUD A;  1P3B A;  1P3O D;  4DRA A;  3MVD C;  5DNN A;  1ID3 D;  3AZH D;  4G91 B;  1M1A A;  3REJ B;  2ARO A;  4X23 D;  5AVB C;  4WU8 A;  4G91 C;  2FFF B;  3C1B D;  3AZL A;  1TAF A;  5GT3 A;  1A7W A;  4J8W D;  3B6G D;  4H9S A;  5DNM A;  1KX3 B;  1BH9 A;  4WU9 A;  2XD5 A;  3H0R C;  5AV5 A;  1P3M D;  3REL B;  4HGA B;  4WNN B;  5CPI D;  3W99 C;  1P3F A;  1B67 A;  5JA4 A;  4HGA C;  4ZUX A;  5BO0 B;  3MNN A;  3REK C;  3UT9 D;  2YFW A;  5E5A D;  2ZM5 A;  1M18 D;  1JFI A;  3A6N C;  5CPK B;  1HQ3 A;  3MGS A;  1U35 C;  4QLC D;  3WKJ D;  3AZI D;  5B1L C;  2F8N K;  3AZH B;  3UTB D;  1EQZ A;  3UTA C;  3O62 D;  4X23 B;  4ZBJ B;  3TU4 A;  2G5I C;  1P3K B;  2CV5 A;  3C1B B;  4ZBJ C;  3X1S A;  4J8X C;  5B33 D;  1P3K C;  5B2I A;  2W8S A;  1F66 A;  5AV9 C;  4YS3 A;  5B31 B;  3W97 B;  4Z5T B;  3X1V C;  5CPJ A;  3W96 D;  3AZG A;  1KX4 C;  4Z5T C;  3W97 C;  5CPI B;  4Z2M H;  4H9Q A;  1ZLA A;  3REH B;  5GXQ C;  4CAY A;  3UT9 B;  5E5A B;  3EPL A;  3REH C;  5F99 D;  4KHA B;  4JJN B;  3AZI B;  3WTP A;  3AZK B;  2RVQ D;  5B1M B;  4JJN C;  1B6W A;  5B0Z D;  3X1U D;  3AFA C;  3O62 B;  5B1M C;  3AZK C;  5AY8 A;  5BT1 C;  4J8V D;  4AWL B;  3F6T A;  1KX5 D;  2NQB D;  5G49 A;  5KDM B;  4KUD C;  4H9N B;  1P3B C;  5B32 D;  3REJ A;  1P3P B;  1TZY B;  4WU8 C;  3AZL C;  3EPK A;  1AOI D;  1P3P C;  2HIO D;  5GT3 C;  3WA9 B;  1P34 D;  4UPK A;  1KX3 A;  2IO5 C;  4H9S C;  5DNM C;  4M6B A;  2YFV B;  3MGQ D;  5B0Z B;  4WU9 C;  1P3A D;  3REL A;  5AV5 C;  4WNN A;  3VH6 T;  2F8N G;  5BO0 A;  1P3F C;  4ZUX C;  3MGR D;  1KX5 B;  3AZE D;  2NQB B;  5CPK A;  3LJA B;  2BYM B;  1BH8 B;  3W98 B;  5B0Y D;  5GT0 B;  1HQ3 C;  3LJA C;  3W98 C;  3AZH A;  4LD9 B;  3VH5 W;  1EQZ C;  4X23 A;  3WAA D;  1P3G B;  1P3K A;  4LD9 C;  3TU4 C;  3C1B A;  3X1S C;  2HIO B;  3AV1 D;  2LY8 A;  4XUJ D;  1F66 C;  1P34 B;  3H0L C;  5B31 A;  3W97 A;  4Z5T A;  3MGQ B;  1P3A B;  3KXB B;  1P3I B;  4EO5 B;  3AV2 B;  5CPI A;  1WWS A;  3AZG C;  3REH A;  1P3I C;  4CAY B;  2Y2I A;  3UT9 A;  5B2J B;  5E5A A;  3KWQ B;  4NE5 A;  4KHA A;  5B0Y B;  4JJN A;  2FJ7 B;  5BNX B;  3LEL D;  3AZI A;  3REI D;  3AZK A;  5B1M A;  2FJ7 C;  1P3A C;  2NZD B;  3WTP C;  3MGP D;  5BS7 A;  2HUE C;  2VQR A;  2Y2Q A;  3O62 A;  3AZF D;  3AV1 B;  4XUJ B;  5JRG D;  5KDM A;  4H9N A;  5AVC B;  3V9R B;  5AVC C;  3W96 A;  4XZQ D;  3KUY D;  3REJ C;  4R8P B;  3NQJ B;  1P3P A;  1TZY A;  3A1K A;  4R8P C;  3WA9 A;  3AN2 B;  3AYW D;  2BG1 A;  3LEL B;  3REI B;  1KX3 C;  3AN2 C;  2YFV A;  5B0Z A;  3KSY A;  3MGP B;  1P3L D;  3KFU G;  3REL C;  5B24 D;  3UTA D;  1KX5 A;  2G5H C;  2NQB A;  3LJA A;  2BYM A;  1BH8 A;  3P5J B;  5CPK C;  1P3O B;  3W98 A;  5GT0 A;  4J8U D;  4J8X D;  1ID3 B;  5AV6 D;  1ID3 C;  3AZH C;  4LD9 A;  5CP6 D;  2Y2L A;  4H9R B;  1P3G A;  4X23 C;  3LZ0 D;  3C1B C;  1F1E A;  4J8W B;  2Y2N A;  2HIO A;  3B6G B;  5GXQ D;  2Y2M A;  3AYW B;  1ULY A;  1P34 A;  4YM6 D;  3MGQ A;  5B31 C;  1P3L B;  1P3M B;  1P3A A;  3KXB A;  1P3I A;  3AV2 A;  1P3M C;  5CPI C;  3AFA D;  5B2J A;  1M18 B;  3KWQ A;  3UT9 C;  5E5A C;  3NQU B;  5B0Y A;  4QLC B;  2FJ7 A;  2Y2O A;  4J8U B;  3WKJ B;  5BNX A;  5AV8 D;  2F8N H;  2NZD A;  3UTB B;  3AZI C;  3WKJ C;  4NE3 A;  5GSU D;  3B0B A;  5BS7 C;  5CP6 B;  3UTB C;  3O62 C;  4H9P B;  1HTA A;  3LZ0 B;  5B33 B;  5DNN D;  3R45 A;  4AWL C;  1T3U A;  2BYK B;  5B33 C;  3AV1 A;  4XUJ A;  1M1A D;  2ARO D;  2CWE A;  5AVC A;  3B0C T;  3V9R A;  4YM6 B;  3W96 B;  5FUG B;  3AZM D;  3W96 C;  4R8P A;  3NQJ A;  4UUZ B;  1TZY C;  3AZN D;  5AV5 D;  5F99 B;  1N1J B;  3WA9 C;  5F99 C;  3AN2 A;  4ZUX D;  3MNN D;  5AV8 B;  3LEL A;  3REI A;  3X1U B;  3C1C D;  3MGP A;  2RVQ C;  5B0Z C;  4KGC D;  5GSU B;  3X1U C;  5B40 D;  3MGS D;  3B6F D;  4J8V B;  1S32 D;  3AZF A;  2JSS A;  1KX5 C;  2Y2G A;  3LZ1 D;  1P3O A;  3EG5 B;  2NQB C;  2CV5 D;  5B32 B;  5GT0 C;  3AZJ D;  1ID3 A;  5B31 G;  3FDD A;  5B2I D;  3AZM B;  4H9R A;  4E44 A;  2ZY2 A;  4WV4 B;  1M19 D;  4YS3 D;  1P3G C;  1AOI B;  3AZN B;  5CPJ D;  4J8W A;  4E45 A;  3B6G A;  2HIO C;  1ZLA D;  3AYW A;  1P34 C;  3C1C B;  1P3M A;  1P3L A;  3MGQ C;  4KGC B;  5B40 B;  3B6F B;  2RIQ A;  4EO5 C; 
#chains in the Genus database with same CATH homology
 3AV2 C;  3X1T D;  3MGR B;  3AZE B;  1M18 A;  2J8P A;  5B2J C;  3KWQ C;  3AZE C;  3LZ1 B;  3NQU A;  5AY8 D;  4QLC A;  3WKJ A;  4J8U A;  5B0Y C;  3AZJ B;  4Z66 D;  2Y2K A;  2PYO D;  3UTB A;  2NZD C;  5CP6 A;  3WAA B;  3MVD D;  4H9P A;  5C3I B;  1M19 B;  3WAA C;  3LZ0 A;  5B33 A;  3R45 B;  5C3I C;  5AVB D;  3VH5 A;  2BYK A;  3AV1 C;  4XUJ C;  4YM6 A;  5FUG A;  3X1T B;  5CHL B;  4UUZ A;  3W99 D;  5F99 A;  4NE6 A;  3IP4 C;  1N1J A;  4CSR B;  3REK D;  4WZS B;  5AV8 A;  4Z66 B;  3A6N D;  2PYO B;  3X1U A;  3LEL C;  3REI C;  3MGP C;  5GSU A;  1U35 D;  3MVD B;  5B1L D;  5BNV B;  4J8V A;  3AZF B;  5AVB B;  1H3O B;  5JRG B;  3AZF C;  2Y2P A;  2F8N D;  1P3K D;  1P3O C;  2JCH A;  4H9O B;  5JRG C;  5B32 A;  1BFM A;  1W2E A;  4XZQ B;  3KUY B;  5AV9 D;  3AZM A;  4XZQ C;  3X1V D;  3KUY C;  5B31 D;  1KX4 D;  1AOI A;  4Z5T D;  3W97 D;  3AZN A;  3H0M C;  3W99 B;  4J8W C;  3REK B;  3B6G C;  3REH D;  1Q9C A;  3AYW C;  3A6N B;  3C1C A;  4KGC A;  1U35 B;  1P3L C;  5B40 A;  3B6F A;  5B1L B;  2ZY3 A;  4JJN D;  5B24 B;  3UTA B;  3MGR A;  3AZK D;  5B1M D;  3AZE A;  1S32 A;  5B24 C;  1M18 C;  5BT1 D;  3LZ1 A;  2F8N B;  4J8X B;  3AZJ A;  4QLC C;  5AV6 B;  4J8U C;  4WJ3 C;  2XD1 A;  5AV6 C;  4KUD D;  5AV9 B;  1P3B D;  3WAA A;  5CP6 C;  3X1V B;  1M19 A;  3B0C W;  3EPJ A;  1KX4 B;  3LZ0 C;  5GXQ B;  4WU8 D;  2Y2J A;  2ZY5 A;  3AZL D;  3WTP E;  1P3P D;  1TZY D;  5GT3 D;  4YM6 C;  3EPH A;  3WA9 D;  5DNM D;  1Z2C B;  3X1T A;  3AFA B;  4WU9 D;  2JE5 A;  3VH6 W;  1P3F D;  4CSR A;  4Z66 A;  2PYO A;  5AV8 C;  1HQ3 D;  4KUD B;  3LJA D;  2L5A A;  1P3B B;  3W98 D;  3MVD A;  5GSU C;  5GT0 D;  5BNV A;  2DF4 C;  5DNN B;  4J8V C;  1EQZ D;  5AVB A;  1M1A B;  5DNN C;  2ARO B;  4LD9 D;  1H3O A;  4WU8 B;  5JRG A;  3TU4 D;  1M1A C;  2ZY4 A;  2ARO C;  3AZL B;  1P3G D;  4H9O A;  3X1S D;  1TAF B;  5GT3 B;  5B32 C;  4XZQ A;  4Z2M G;  4G92 B;  3KUY A;  1F66 D;  2DQN C;  2IO5 B;  5DNM B;  4G92 C;  3AZM C;  1BH9 B;  4WU9 B;  5AV5 B;  2Y2H A;  3AZG D;  1AOI C;  3W99 A;  3AZN C;  3KXB D;  1P3I D;  3AV2 D;  1P3F B;  5JA4 B;  4DRB A;  4ZUX B;  3REK A;  3MNN B;  1PZR A;  2YFW B;  3A6N A;  1KU5 A;  5B2J D;  3MNN C;  3KWQ D;  1JFI B;  3AL0 C;  1HQ3 B;  3C1C C;  3B0D B;  3VH6 A;  3MGS B;  1U35 A;  5B1L A;  4KGC C;  2FJ7 D;  3B0D C;  3MGS C;  3WTP D;  5B40 C;  2UWX A;  5B24 A;  1S32 B;  3UTA A;  3B6F C;  2NZD D;  3A1I A;  1EQZ B;  3MGR C;  1S32 C;  3TU4 B;  2CV5 B;  2F8N A;  4J8X A;  3LZ1 C;  4DQY B;  1WWI A;  3X1S B;  5AV6 A;  2CV5 C;  5B2I B;  3AZJ C;  5B2I C;  3VH5 T;  5AV9 A;  1F66 B;  4YS3 B;  3X1V A;  5AVC D;  1M19 C;  4YS3 C;  1KX4 A;  5CPJ B;  3AZG B;  3REJ D;  5GXQ A;  5CPJ C;  4H9Q B;  1ZLA B;  3KXB C;  4R8P D;  1ZLA C;  1KX3 D;  3AN2 D;  1R4V A;  3WTP B;  2HUE B;  2F2A C;  3AFA A;  3X1T C;  3REL D;  5AY8 B;  5B32 G;  5AY8 C;  4NFT A;  4Z66 C;  5CPK D;  2PYO C;  5G49 B;  4KUD A;  1P3B A;  1P3O D;  4DRA A;  3MVD C;  5DNN A;  1ID3 D;  3AZH D;  4G91 B;  1M1A A;  3REJ B;  2ARO A;  4X23 D;  5AVB C;  4WU8 A;  4G91 C;  2FFF B;  3C1B D;  3AZL A;  1TAF A;  5GT3 A;  1A7W A;  4J8W D;  3B6G D;  4H9S A;  5DNM A;  1KX3 B;  1BH9 A;  4WU9 A;  2XD5 A;  3H0R C;  5AV5 A;  1P3M D;  3REL B;  4HGA B;  4WNN B;  5CPI D;  3W99 C;  1P3F A;  1B67 A;  5JA4 A;  4HGA C;  4ZUX A;  5BO0 B;  3MNN A;  3REK C;  3UT9 D;  2YFW A;  5E5A D;  2ZM5 A;  1M18 D;  1JFI A;  3A6N C;  5CPK B;  1HQ3 A;  3MGS A;  1U35 C;  4QLC D;  3WKJ D;  3AZI D;  5B1L C;  2F8N K;  3AZH B;  3UTB D;  1EQZ A;  3UTA C;  3O62 D;  4X23 B;  4ZBJ B;  3TU4 A;  2G5I C;  1P3K B;  2CV5 A;  3C1B B;  4ZBJ C;  3X1S A;  4J8X C;  5B33 D;  1P3K C;  5B2I A;  2W8S A;  1F66 A;  5AV9 C;  4YS3 A;  5B31 B;  3W97 B;  4Z5T B;  3X1V C;  5CPJ A;  3W96 D;  3AZG A;  1KX4 C;  4Z5T C;  3W97 C;  5CPI B;  4Z2M H;  4H9Q A;  1ZLA A;  3REH B;  5GXQ C;  4CAY A;  3UT9 B;  5E5A B;  3EPL A;  3REH C;  5F99 D;  4KHA B;  4JJN B;  3AZI B;  3WTP A;  3AZK B;  2RVQ D;  5B1M B;  4JJN C;  1B6W A;  5B0Z D;  3X1U D;  3AFA C;  3O62 B;  5B1M C;  3AZK C;  5AY8 A;  5BT1 C;  4J8V D;  4AWL B;  3F6T A;  1KX5 D;  2NQB D;  5G49 A;  5KDM B;  4KUD C;  4H9N B;  1P3B C;  5B32 D;  3REJ A;  1P3P B;  1TZY B;  4WU8 C;  3AZL C;  3EPK A;  1AOI D;  1P3P C;  2HIO D;  5GT3 C;  3WA9 B;  1P34 D;  4UPK A;  1KX3 A;  2IO5 C;  4H9S C;  5DNM C;  4M6B A;  2YFV B;  3MGQ D;  5B0Z B;  4WU9 C;  1P3A D;  3REL A;  5AV5 C;  4WNN A;  3VH6 T;  2F8N G;  5BO0 A;  1P3F C;  4ZUX C;  3MGR D;  1KX5 B;  3AZE D;  2NQB B;  5CPK A;  3LJA B;  2BYM B;  1BH8 B;  3W98 B;  5B0Y D;  5GT0 B;  1HQ3 C;  3LJA C;  3W98 C;  3AZH A;  4LD9 B;  3VH5 W;  1EQZ C;  4X23 A;  3WAA D;  1P3G B;  1P3K A;  4LD9 C;  3TU4 C;  3C1B A;  3X1S C;  2HIO B;  3AV1 D;  2LY8 A;  4XUJ D;  1F66 C;  1P34 B;  3H0L C;  5B31 A;  3W97 A;  4Z5T A;  3MGQ B;  1P3A B;  3KXB B;  1P3I B;  4EO5 B;  3AV2 B;  5CPI A;  1WWS A;  3AZG C;  3REH A;  1P3I C;  4CAY B;  2Y2I A;  3UT9 A;  5B2J B;  5E5A A;  3KWQ B;  4NE5 A;  4KHA A;  5B0Y B;  4JJN A;  2FJ7 B;  5BNX B;  3LEL D;  3AZI A;  3REI D;  3AZK A;  5B1M A;  2FJ7 C;  1P3A C;  2NZD B;  3WTP C;  3MGP D;  5BS7 A;  2HUE C;  2VQR A;  2Y2Q A;  3O62 A;  3AZF D;  3AV1 B;  4XUJ B;  5JRG D;  5KDM A;  4H9N A;  5AVC B;  3V9R B;  5AVC C;  3W96 A;  4XZQ D;  3KUY D;  3REJ C;  4R8P B;  3NQJ B;  1P3P A;  1TZY A;  3A1K A;  4R8P C;  3WA9 A;  3AN2 B;  3AYW D;  2BG1 A;  3LEL B;  3REI B;  1KX3 C;  3AN2 C;  2YFV A;  5B0Z A;  3KSY A;  3MGP B;  1P3L D;  3KFU G;  3REL C;  5B24 D;  3UTA D;  1KX5 A;  2G5H C;  2NQB A;  3LJA A;  2BYM A;  1BH8 A;  3P5J B;  5CPK C;  1P3O B;  3W98 A;  5GT0 A;  4J8U D;  4J8X D;  1ID3 B;  5AV6 D;  1ID3 C;  3AZH C;  4LD9 A;  5CP6 D;  2Y2L A;  4H9R B;  1P3G A;  4X23 C;  3LZ0 D;  3C1B C;  1F1E A;  4J8W B;  2Y2N A;  2HIO A;  3B6G B;  5GXQ D;  2Y2M A;  3AYW B;  1ULY A;  1P34 A;  4YM6 D;  3MGQ A;  5B31 C;  1P3L B;  1P3M B;  1P3A A;  3KXB A;  1P3I A;  3AV2 A;  1P3M C;  5CPI C;  3AFA D;  5B2J A;  1M18 B;  3KWQ A;  3UT9 C;  5E5A C;  3NQU B;  5B0Y A;  4QLC B;  2FJ7 A;  2Y2O A;  4J8U B;  3WKJ B;  5BNX A;  5AV8 D;  2F8N H;  2NZD A;  3UTB B;  3AZI C;  3WKJ C;  4NE3 A;  5GSU D;  3B0B A;  5BS7 C;  5CP6 B;  3UTB C;  3O62 C;  4H9P B;  1HTA A;  3LZ0 B;  5B33 B;  5DNN D;  3R45 A;  4AWL C;  1T3U A;  2BYK B;  5B33 C;  3AV1 A;  4XUJ A;  1M1A D;  2ARO D;  2CWE A;  5AVC A;  3B0C T;  3V9R A;  4YM6 B;  3W96 B;  5FUG B;  3AZM D;  3W96 C;  4R8P A;  3NQJ A;  4UUZ B;  1TZY C;  3AZN D;  5AV5 D;  5F99 B;  1N1J B;  3WA9 C;  5F99 C;  3AN2 A;  4ZUX D;  3MNN D;  5AV8 B;  3LEL A;  3REI A;  3X1U B;  3C1C D;  3MGP A;  2RVQ C;  5B0Z C;  4KGC D;  5GSU B;  3X1U C;  5B40 D;  3MGS D;  3B6F D;  4J8V B;  1S32 D;  3AZF A;  2JSS A;  1KX5 C;  2Y2G A;  3LZ1 D;  1P3O A;  3EG5 B;  2NQB C;  2CV5 D;  5B32 B;  5GT0 C;  3AZJ D;  1ID3 A;  5B31 G;  3FDD A;  5B2I D;  3AZM B;  4H9R A;  4E44 A;  2ZY2 A;  4WV4 B;  1M19 D;  4YS3 D;  1P3G C;  1AOI B;  3AZN B;  5CPJ D;  4J8W A;  4E45 A;  3B6G A;  2HIO C;  1ZLA D;  3AYW A;  1P34 C;  3C1C B;  1P3M A;  1P3L A;  3MGQ C;  4KGC B;  5B40 B;  3B6F B;  2RIQ A;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...