4YM6A

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6A00
5B32B 4WU9C 4H9QA 5B40B 3B0CT 5CPIA 2F8NB 5B1MC 3LJAA 1P3LD 3B6FD 3X1SB 4H9RA 1P3GD 4WV4B 4YS3A 3B6FC 1P3LC 1P3GC 2HUEC 5DNMB 4DRBA 5AVCA 3TU4A 1ZLAB 5CPKB 1Q9CA 5JRGB 4G91B 4H9NB 5B31B 3W99A 2CV5A 3MGSB 4HGAC 3AZKA 3UT9A 4KUDB 1HQ3A 3AZHA 4H9PB 5AY8D 4J8UA 5C3IB 5GT0D 3AV1A 1M1AC 4WU8B 3KWQA 2NQBB 3AN2D 5AY8C 5F99B 3X1TA 5GT0C 4EO5C 3AZFD 1TZYA 3AN2C 3AZFC 4ZBJB 3B6GA 3AZJD 3AFAA 1U35D 1P3PA 3LZ1D 4J8WD 2NZDD 2BYMA 1ULYA 3VH6A 5GXQD 3AZMD 1P3IA 3AZJC 1U35C 3V9RA 5B1LB 5DNND 3LZ1C 4J8WC 3UTAD 1TAFB 5GXQC 3KXBD 5B1MA 4AWLC 1R4VA 3AZMC 1P34B 1P3OD 4DRAA 5DNNC 3UTAC 5B33A 5CPJD 5AV6D 3KXBC 3AZEC 1P3LA 1BH9A 4J8VD 1KX5B 3AZLD 5AV6C 4J8VC 5E5AB 1HTAA 3AZLC 5B24D 1B67A 4QLCD 5B24C 3WAAA 5AV5B 4QLCC 3LZ0D 3C1BB 4YM6C 3W98A 5B2ID 3A6ND 4CAYB 3LZ0C 3B0DC 4JJNB 5B0ZD 5B2IC 3A6NC 5AVBC 1P3KD 3REJD 1M1AA 5BT1D 1F66D 2FJ7B 1KX4B 1P3KC 4R8PD 3REJC 1P3BA 5GT0A 5GT3A 5BT1C 1F66C 4R8PC 1P3MC 3W97B 2JSSA 1ID3D 3MNNB 3AZJA 3REIB 4E44A 1ID3C 3X1VC 2YFWA 3REKC 5DNNA 3KXBA 3AZEA 3NQJA 2BYKA 5AV6A 3WTPD 3MGQD 4UUZB 4J8VA 5KDMA 3LELD 3AZLA 1S32B 3WTPC 4E45A 3VH5A 2L5AA 4X23D 3MGQC 5AV8B 3LELC 3REHB 1N1JB 3X1UD 4J8XD 4YM6A 2HIOD 3X1UC 4J8XC 4XZQD 3AZID 3LZ0A 3LJAB 2HIOC 2PYOB 4H9RB 4XZQC 3AZIC 5AVBA 3AYWB 3VH6W 3MVDD 4YS3B 3C1CD 4KGCA 4XUJD 3MVDC 5AVCB 3TU4B 3C1CC 5CP6D 4R8PA 4XUJC 4LD9D 1P3MA 5CP6C 3MGRB 5AV9C 4LD9C 3W99B 2CV5B 1KX3D 3AZKB 3WA9D 3AZGD 3REKA 3X1VA 1EQZB 3UT9B 1HQ3B 3KSYA 5BNXB 1KX3C 5JA4A 5B32D 3WA9C 3AZGC 5B40D 2F8ND 3AV1B 3O62B 4Z5TA 3X1SD 5B32C 3KWQB 5GSUB 5B32G 5B40C 3X1TB 1M18A 2F8NG 3X1SC 1TZYB 4WNNA 3W96A 4M6BA 3WTPA 3MGQA 5DNMD 3LELA 1ZLAD 5CPKD 3B6GB 1P3PB 3AFAB 5JRGD 3AZNB 5DNMC 2BYMB 3RELB 5CPKC 1P3IB 5B0YA 4H9SC 5JRGC 3X1UA 3V9RB 4J8XA 2HIOA 3MGSD 5B31G 4XZQA 5B33B 3MGSC 1BH9B 4KUDD 5BS7A 5FUGA 3MVDA 4KUDC 5BO0A 4WU8D 4XUJA 2NQBD 2AROA 5F99D 5C3IC 5AV9A 3UTBD 4WU8C 3WAAB 2NQBC 5F99C 5B2JA 3UTBC 1M19A 5G49A 3W98B 4NE3A 3VH5W 4CSRA 4ZBJC 2NZDC 4WU9A 1KX3A 1WWSA 5B1LD 1M1AB 3MGPB 5B1LC 1A7WA 5B32A 5B40A 1P3BB 5GT3B 3B6FA 1P3OC 3NQUA 1P3GA 1KX5D 5CPJC 3R45B 2F8NH 1P3AB 2YFVB 3B0CW 1KX5C 5E5AD 5E5AC 1B6WA 4H9SA 5AV5D 4AWLB 2YFWB 5DNNB 1WWIA 4G92B 5AV5C 3KXBB 3AV2B 3AZEB 3NQJB 2BYKB 3MGSA 3WKJB 4JJND 1AOIB 5B0ZC 4JJNC 2FJ7D 3AZLB 1KX4D 5AY8A 2FJ7C 4WU8A 3AN2A 1KX4C 2NQBA 3KUYB 3AZFA 3UTBA 4YM6B 3VH6T 1F1EA 1U35A 4NE5A 3MNND 3LZ1A 4J8WA 2NZDA 5AVBB 5GXQA 3AZMA 1JFIA 4ZUXB 3MNNC 3UTAA 4Z66B 4KGCB 1H3OA 2F8NK 1P3OA 5CPJA 1P3MB 1S32D 1P3FB 5AV8D 5E5AA 3REHD 5B24A 1S32C 4X23C 4QLCA 3X1VB 1BH8A 5BNVB 3REHC 3REKB 4H9QB 5CPIB 4Z5TB 3LJAD 5B2IA 2IO5C 3A6NA 2PYOD 1KU5A 1M18B 4YS3D 3AYWD 5B0ZA 2PYOC 1P3KA 3REJA 4WNNB 3W96B 4YS3C 3AYWC 1F66A 5AVCD 3TU4D 5AVCC 3TU4C 5B0YB 4H9OA 3MGRD 3W99D 2CV5D 3MGRC 2HIOB 2CV5C 3AZKD 1ID3A 1EQZD 3UT9D 1HQ3D 3AZHB 3AZKC 4J8UB 5FUGB 1EQZC 3UT9C 5BO0B 3AV1D 3O62D 3KWQD 2AROB 5GSUD 3X1TD 3O62C 4WZSB 5AV9B 3KWQC 1TZYD 3VH5T 5GSUC 5B2JB 4KHAA 3B6GD 1TZYC 1P3PD 3AFAD 3AZND 5G49B 4X23A 1M19B 1ZLAC 4CSRB 2IO5B 5B31D 1N1JA 3REHA 3RELD 1P3ID 3B6GC 3AZNC 4WU9B 1KX3B 4G91C 5B1MB 5B31C 3RELC 1P3IC 3AZIA 5B33D 2CWEA 3B6FB 4Z2MG 1P3LB 3NQUB 2HUEB 1P3GB 2PYOA 5B33C 4NFTA 3AYWA 3C1CA 5CP6A 4LD9A 3WAAD 3MGRA 3WAAC 4HGAB 3W98D 3W98C 3WA9A 3AZGA 1EQZA 1M1AD 5BNXA 1P34D 3MGPD 5AY8B 2F8NA 5GT0B 1P3BD 4EO5B 5GT3D 3O62A 1P34C 3X1SA 3MGPC 3AN2B 5GSUA 1P3BC 5GT3C 1P3AD 3AZFB 3UTBB 5DNMA 1P3AC 1ZLAA 5CPKA 3AZJB 1U35B 5JRGA 3LZ1B 4J8WB 3AZNA 2NZDB 4H9NA 5GXQB 3C1BD 5B31A 3RELA 3AZMB 1JFIB 3UTAB 3C1BC 1H3OB 3AV2D 3AZED 1P3OB 3WKJD 4G92C 4Z2MH 5CPJB 5AV6B 3AV2C 4KUDA 4J8VB 1AOID 3WKJC 5KDMB 4H9PA 1AOIC 5B24B 5F99A 4QLCB 3KUYD 1BH8B 3W97D 4YM6D 3LZ0B 3B0DB 3KUYC 3W97C 2RVQD 5B2IB 3A6NB 3REID 5AVBD 2RVQC 4ZUXD 5B0ZB 5B1LA 4Z66D 3REIC 3REJB 1TAFA 1P3KB 4KGCD 1BFMA 1F66B 4ZUXC 1P34A 3MGPA 4Z66C 4R8PB 3B0BA 4KGCC 1P3MD 1KX5A 4H9OB 3R45A 1P3AA 2LY8A 2YFVA 1P3FD 1ID3B 5AV8C 1P3FC 3X1VD 3REKD 5JA4B 5AV5A 3C1BA 5CPID 4Z5TD 4CAYA 3AV2A 5CPIC 1M18D 3LJAC 4JJNA 3WKJA 4Z5TC 3WTPB 3W96D 3MGQB 1M18C 1AOIA 4KHAB 2FJ7A 3LELB 1KX4A 3W96C 4X23B 5CHLB 3WTPE 5B0YD 3X1UB 4J8XB 3KUYA 3W97A 5B0YC 4XZQB 3W99C 3AZIB 3MNNA 3AZHD 3REIA 3MVDB 4J8UD 3C1CB 1HQ3C 4ZUXA 3AZHC 4Z66A 4XUJB 5BS7C 4J8UC 2AROD 3AV1C 5CP6B 5AV9D 4LD9B 2AROC 3X1TC 4UUZA 5B2JD 1S32A 4NE6A 1M19D 5B2JC 5AV8A 1P3FA 1P3PC 3AFAC 1M19C 4WU9D 3WA9B 3AZGB 5BNVA 5B1MD
chains in the Genus database with same CATH superfamily
5B32B 4WU9C 1Z2CB 4H9QA 5B40B 3B0CT 5CPIA 2F8NB 5B1MC 3LJAA 1P3LD 3B6FD 3X1SB 4H9RA 1P3GD 4WV4B 4YS3A 3B6FC 1P3LC 1P3GC 2HUEC 5DNMB 4DRBA 5AVCA 3TU4A 1ZLAB 2Y2OA 5CPKB 1Q9CA 5JRGB 4G91B 2DF4C 4H9NB 5B31B 3W99A 2CV5A 3MGSB 4HGAC 2RIQA 3AZKA 3UT9A 4KUDB 1HQ3A 3AZHA 3A1IA 4H9PB 5AY8D 4J8UA 5C3IB 5GT0D 3AV1A 1M1AC 4WU8B 3KWQA 2NQBB 3AN2D 5AY8C 5F99B 3X1TA 5GT0C 4EO5C 3AZFD 2Y2QA 1TZYA 3AN2C 3AZFC 4ZBJB 3B6GA 3AZJD 3AFAA 1U35D 1P3PA 3LZ1D 4J8WD 2NZDD 2BYMA 1ULYA 3VH6A 5GXQD 3AZMD 1P3IA 3AZJC 1U35C 2BG1A 3V9RA 5B1LB 5DNND 3LZ1C 4J8WC 3UTAD 1TAFB 5GXQC 3KXBD 5B1MA 4AWLC 1R4VA 3AZMC 1P34B 1P3OD 4DRAA 5DNNC 3UTAC 5B33A 5CPJD 5AV6D 3KXBC 3AZEC 1P3LA 1BH9A 4J8VD 1KX5B 3AZLD 5AV6C 4J8VC 5E5AB 1HTAA 3AZLC 5B24D 1B67A 4QLCD 3EG5B 5B24C 3WAAA 2F2AC 5AV5B 4QLCC 3LZ0D 3C1BB 4YM6C 3W98A 5B2ID 3A6ND 4CAYB 3LZ0C 3B0DC 2Y2LA 4JJNB 5B0ZD 5B2IC 3A6NC 5AVBC 1P3KD 3REJD 1M1AA 5BT1D 1F66D 2FJ7B 1KX4B 1P3KC 4R8PD 3REJC 1P3BA 5GT0A 5GT3A 5BT1C 1F66C 4R8PC 2W8SA 1P3MC 3W97B 2JSSA 2DQNC 1ID3D 3MNNB 3AZJA 3REIB 4E44A 1ID3C 3X1VC 2YFWA 3REKC 5DNNA 3KXBA 3AZEA 3NQJA 2BYKA 5AV6A 3WTPD 3MGQD 4UUZB 4J8VA 5KDMA 3LELD 3AZLA 1S32B 3WTPC 4E45A 3VH5A 2L5AA 4X23D 3MGQC 5AV8B 3LELC 3REHB 1N1JB 2XD1A 3X1UD 4J8XD 3F6TA 4YM6A 2HIOD 3X1UC 4J8XC 4XZQD 3AZID 3LZ0A 3LJAB 2HIOC 2PYOB 4H9RB 4XZQC 3AZIC 5AVBA 3AYWB 3VH6W 3MVDD 4YS3B 3C1CD 4KGCA 4XUJD 3MVDC 5AVCB 3TU4B 3C1CC 5CP6D 4R8PA 4XUJC 4LD9D 3AL0C 1P3MA 5CP6C 3MGRB 5AV9C 4LD9C 3W99B 2CV5B 1PZRA 1KX3D 3AZKB 3WA9D 3AZGD 3REKA 3X1VA 1EQZB 3UT9B 1HQ3B 3KSYA 5BNXB 2ZM5A 1KX3C 5JA4A 5B32D 3WA9C 3AZGC 5B40D 2F8ND 3AV1B 3O62B 4Z5TA 3X1SD 5B32C 3KWQB 5GSUB 5B32G 5B40C 3X1TB 1M18A 2F8NG 3X1SC 2VQRA 1TZYB 2XD5A 4WNNA 3W96A 4M6BA 3WTPA 3MGQA 5DNMD 3LELA 1ZLAD 5CPKD 3B6GB 1P3PB 3AFAB 5JRGD 3AZNB 5DNMC 2BYMB 3RELB 5CPKC 1P3IB 5B0YA 4H9SC 5JRGC 3X1UA 3V9RB 4J8XA 3H0MC 2HIOA 3MGSD 5B31G 4XZQA 5B33B 3MGSC 1BH9B 4KUDD 5BS7A 5FUGA 3MVDA 4KUDC 5BO0A 3EPHA 4WU8D 4XUJA 2NQBD 2AROA 5F99D 5C3IC 5AV9A 3UTBD 4WU8C 3WAAB 2NQBC 5F99C 5B2JA 3UTBC 1M19A 5G49A 3W98B 4NE3A 3VH5W 4CSRA 4ZBJC 2NZDC 4WU9A 1KX3A 1WWSA 5B1LD 1M1AB 3MGPB 5B1LC 1A7WA 5B32A 5B40A 1P3BB 5GT3B 3B6FA 1P3OC 3NQUA 1P3GA 2J8PA 1KX5D 3EPJA 5CPJC 3R45B 2F8NH 1P3AB 2YFVB 3B0CW 1KX5C 5E5AD 5E5AC 1B6WA 4H9SA 2ZY3A 5AV5D 3P5JB 4AWLB 2YFWB 2Y2JA 5DNNB 1WWIA 4G92B 5AV5C 3KXBB 3AV2B 3AZEB 3NQJB 2BYKB 3MGSA 3WKJB 4JJND 1AOIB 5B0ZC 4JJNC 2FJ7D 3AZLB 1KX4D 5AY8A 2FJ7C 4WU8A 3AN2A 1KX4C 2NQBA 3KUYB 3AZFA 3UTBA 4YM6B 3VH6T 1F1EA 2ZY2A 1U35A 4NE5A 3MNND 3LZ1A 4J8WA 2NZDA 5AVBB 2ZY5A 5GXQA 3AZMA 1JFIA 4ZUXB 3MNNC 3UTAA 4Z66B 4KGCB 1H3OA 2F8NK 1P3OA 5CPJA 1P3MB 3H0LC 2Y2KA 1S32D 1P3FB 5AV8D 5E5AA 3REHD 5B24A 1S32C 4X23C 4QLCA 3X1VB 1BH8A 5BNVB 3REHC 3REKB 4H9QB 5CPIB 4Z5TB 3LJAD 5B2IA 2IO5C 3A6NA 2PYOD 4UPKA 1KU5A 1M18B 4YS3D 3AYWD 5B0ZA 2Y2GA 2PYOC 1P3KA 3REJA 4WNNB 3W96B 4YS3C 3AYWC 1F66A 5AVCD 3TU4D 2Y2PA 5AVCC 2JE5A 3TU4C 5B0YB 4H9OA 3MGRD 3W99D 2CV5D 3MGRC 2HIOB 2G5IC 2CV5C 3AZKD 1ID3A 1EQZD 3UT9D 1HQ3D 3AZHB 3H0RC 3AZKC 4J8UB 5FUGB 1EQZC 3UT9C 5BO0B 3AV1D 3O62D 3KWQD 3A1KA 2AROB 5GSUD 3X1TD 3O62C 4WZSB 5AV9B 3KWQC 2G5HC 1TZYD 3VH5T 5GSUC 5B2JB 4KHAA 3B6GD 1TZYC 1P3PD 3AFAD 3AZND 5G49B 4X23A 1M19B 1ZLAC 4CSRB 2IO5B 5B31D 1N1JA 3REHA 3RELD 1P3ID 3B6GC 3AZNC 4WU9B 1KX3B 4G91C 5B1MB 5B31C 3RELC 1P3IC 3AZIA 5B33D 2CWEA 3B6FB 4Z2MG 1P3LB 3NQUB 2HUEB 1P3GB 2PYOA 1W2EA 5B33C 4NFTA 3AYWA 3C1CA 5CP6A 4LD9A 4DQYB 3WAAD 3EPKA 3MGRA 3WAAC 4HGAB 2JCHA 3W98D 3W98C 3WA9A 3AZGA 1EQZA 1M1AD 5BNXA 1P34D 3MGPD 5AY8B 2F8NA 5GT0B 1P3BD 4EO5B 5GT3D 3O62A 1P34C 3X1SA 3MGPC 3AN2B 5GSUA 1P3BC 5GT3C 1P3AD 3AZFB 3UTBB 5DNMA 1P3AC 1ZLAA 5CPKA 3AZJB 1U35B 5JRGA 3LZ1B 4J8WB 3FDDA 3AZNA 2NZDB 4H9NA 2Y2MA 5GXQB 5B31A 3C1BD 3RELA 3AZMB 1JFIB 3UTAB 3C1BC 1H3OB 3AV2D 3AZED 1P3OB 3WKJD 4G92C 4Z2MH 5CPJB 5AV6B 3AV2C 4KUDA 4J8VB 1AOID 3WKJC 5KDMB 4H9PA 1AOIC 5B24B 5F99A 4QLCB 3KUYD 1BH8B 3W97D 4YM6D 3LZ0B 3B0DB 3KUYC 3W97C 2RVQD 5B2IB 3A6NB 3REID 5AVBD 2RVQC 2Y2HA 4ZUXD 5B1LA 5B0ZB 4Z66D 3REIC 3REJB 1TAFA 1P3KB 4KGCD 1BFMA 1F66B 4ZUXC 1P34A 3MGPA 4Z66C 4R8PB 3B0BA 4KGCC 3KFUG 1P3MD 1KX5A 4H9OB 3R45A 1P3AA 2LY8A 2YFVA 1P3FD 1ID3B 5AV8C 1P3FC 3X1VD 3REKD 5JA4B 5AV5A 3C1BA 5CPID 4Z5TD 4CAYA 3AV2A 5CPIC 1M18D 3LJAC 4JJNA 3WKJA 4Z5TC 3WTPB 3W96D 3MGQB 3IP4C 1M18C 1AOIA 4KHAB 2FJ7A 2Y2NA 3LELB 1KX4A 3W96C 4X23B 5CHLB 3WTPE 5B0YD 3X1UB 4J8XB 3EPLA 3KUYA 3W97A 5B0YC 2Y2IA 3W99C 4XZQB 3AZIB 3MNNA 3AZHD 3REIA 3MVDB 4J8UD 2FFFB 3C1CB 1HQ3C 4ZUXA 3AZHC 4Z66A 2UWXA 4XUJB 5BS7C 4J8UC 2AROD 1T3UA 3AV1C 5CP6B 5AV9D 4LD9B 2AROC 3X1TC 4WJ3C 4UUZA 5B2JD 1S32A 4NE6A 1M19D 5B2JC 5AV8A 1P3FA 2ZY4A 1P3PC 3AFAC 1M19C 4WU9D 3WA9B 3AZGB 5BNVA 5B1MD
chains in the Genus database with same CATH topology
5B32B 4WU9C 1Z2CB 4H9QA 5B40B 3B0CT 5CPIA 2F8NB 5B1MC 3LJAA 1P3LD 3B6FD 3X1SB 4H9RA 1P3GD 4WV4B 4YS3A 3B6FC 1P3LC 1P3GC 2HUEC 5DNMB 4DRBA 5AVCA 3TU4A 1ZLAB 2Y2OA 5CPKB 1Q9CA 5JRGB 4G91B 2DF4C 4H9NB 5B31B 3W99A 2CV5A 3MGSB 4HGAC 2RIQA 3AZKA 3UT9A 4KUDB 1HQ3A 3AZHA 3A1IA 4H9PB 5AY8D 4J8UA 5C3IB 5GT0D 3AV1A 1M1AC 4WU8B 3KWQA 2NQBB 3AN2D 5AY8C 5F99B 3X1TA 5GT0C 4EO5C 3AZFD 2Y2QA 1TZYA 3AN2C 3AZFC 4ZBJB 3B6GA 3AZJD 3AFAA 1U35D 1P3PA 3LZ1D 4J8WD 2NZDD 2BYMA 1ULYA 3VH6A 5GXQD 3AZMD 1P3IA 3AZJC 1U35C 2BG1A 3V9RA 5B1LB 5DNND 3LZ1C 4J8WC 3UTAD 1TAFB 5GXQC 3KXBD 5B1MA 4AWLC 1R4VA 3AZMC 1P34B 1P3OD 4DRAA 5DNNC 3UTAC 5B33A 5CPJD 5AV6D 3KXBC 3AZEC 1P3LA 1BH9A 4J8VD 1KX5B 3AZLD 5AV6C 4J8VC 5E5AB 1HTAA 3AZLC 5B24D 1B67A 4QLCD 3EG5B 5B24C 3WAAA 2F2AC 5AV5B 4QLCC 3LZ0D 3C1BB 4YM6C 3W98A 5B2ID 3A6ND 4CAYB 3LZ0C 3B0DC 2Y2LA 4JJNB 5B0ZD 5B2IC 3A6NC 5AVBC 1P3KD 3REJD 1M1AA 5BT1D 1F66D 2FJ7B 1KX4B 1P3KC 4R8PD 3REJC 1P3BA 5GT0A 5GT3A 5BT1C 1F66C 4R8PC 2W8SA 1P3MC 3W97B 2JSSA 2DQNC 1ID3D 3MNNB 3AZJA 3REIB 4E44A 1ID3C 3X1VC 2YFWA 3REKC 5DNNA 3KXBA 3AZEA 3NQJA 2BYKA 5AV6A 3WTPD 3MGQD 4UUZB 4J8VA 5KDMA 3LELD 3AZLA 1S32B 3WTPC 4E45A 3VH5A 2L5AA 4X23D 3MGQC 5AV8B 3LELC 3REHB 1N1JB 2XD1A 3X1UD 4J8XD 3F6TA 4YM6A 2HIOD 3X1UC 4J8XC 4XZQD 3AZID 3LZ0A 3LJAB 2HIOC 2PYOB 4H9RB 4XZQC 3AZIC 5AVBA 3AYWB 3VH6W 3MVDD 4YS3B 3C1CD 4KGCA 4XUJD 3MVDC 5AVCB 3TU4B 3C1CC 5CP6D 4R8PA 4XUJC 4LD9D 3AL0C 1P3MA 5CP6C 3MGRB 5AV9C 4LD9C 3W99B 2CV5B 1PZRA 1KX3D 3AZKB 3WA9D 3AZGD 3REKA 3X1VA 1EQZB 3UT9B 1HQ3B 3KSYA 5BNXB 2ZM5A 1KX3C 5JA4A 5B32D 3WA9C 3AZGC 5B40D 2F8ND 3AV1B 3O62B 4Z5TA 3X1SD 5B32C 3KWQB 5GSUB 5B32G 5B40C 3X1TB 1M18A 2F8NG 3X1SC 2VQRA 1TZYB 2XD5A 4WNNA 3W96A 4M6BA 3WTPA 3MGQA 5DNMD 3LELA 1ZLAD 5CPKD 3B6GB 1P3PB 3AFAB 5JRGD 3AZNB 5DNMC 2BYMB 3RELB 5CPKC 1P3IB 5B0YA 4H9SC 5JRGC 3X1UA 3V9RB 4J8XA 3H0MC 2HIOA 3MGSD 5B31G 4XZQA 5B33B 3MGSC 1BH9B 4KUDD 5BS7A 5FUGA 3MVDA 4KUDC 5BO0A 3EPHA 4WU8D 4XUJA 2NQBD 2AROA 5F99D 5C3IC 5AV9A 3UTBD 4WU8C 3WAAB 2NQBC 5F99C 5B2JA 3UTBC 1M19A 5G49A 3W98B 4NE3A 3VH5W 4CSRA 4ZBJC 2NZDC 4WU9A 1KX3A 1WWSA 5B1LD 1M1AB 3MGPB 5B1LC 1A7WA 5B32A 5B40A 1P3BB 5GT3B 3B6FA 1P3OC 3NQUA 1P3GA 2J8PA 1KX5D 3EPJA 5CPJC 3R45B 2F8NH 1P3AB 2YFVB 3B0CW 1KX5C 5E5AD 5E5AC 1B6WA 4H9SA 2ZY3A 5AV5D 3P5JB 4AWLB 2YFWB 2Y2JA 5DNNB 1WWIA 4G92B 5AV5C 3KXBB 3AV2B 3AZEB 3NQJB 2BYKB 3MGSA 3WKJB 4JJND 1AOIB 5B0ZC 4JJNC 2FJ7D 3AZLB 1KX4D 5AY8A 2FJ7C 4WU8A 3AN2A 1KX4C 2NQBA 3KUYB 3AZFA 3UTBA 4YM6B 3VH6T 1F1EA 2ZY2A 1U35A 4NE5A 3MNND 3LZ1A 4J8WA 2NZDA 5AVBB 2ZY5A 5GXQA 3AZMA 1JFIA 4ZUXB 3MNNC 3UTAA 4Z66B 4KGCB 1H3OA 2F8NK 1P3OA 5CPJA 1P3MB 3H0LC 2Y2KA 1S32D 1P3FB 5AV8D 5E5AA 3REHD 5B24A 1S32C 4X23C 4QLCA 3X1VB 1BH8A 5BNVB 3REHC 3REKB 4H9QB 5CPIB 4Z5TB 3LJAD 5B2IA 2IO5C 3A6NA 2PYOD 4UPKA 1KU5A 1M18B 4YS3D 3AYWD 5B0ZA 2Y2GA 2PYOC 1P3KA 3REJA 4WNNB 3W96B 4YS3C 3AYWC 1F66A 5AVCD 3TU4D 2Y2PA 5AVCC 2JE5A 3TU4C 5B0YB 4H9OA 3MGRD 3W99D 2CV5D 3MGRC 2HIOB 2G5IC 2CV5C 3AZKD 1ID3A 1EQZD 3UT9D 1HQ3D 3AZHB 3H0RC 3AZKC 4J8UB 5FUGB 1EQZC 3UT9C 5BO0B 3AV1D 3O62D 3KWQD 3A1KA 2AROB 5GSUD 3X1TD 3O62C 4WZSB 5AV9B 3KWQC 2G5HC 1TZYD 3VH5T 5GSUC 5B2JB 4KHAA 3B6GD 1TZYC 1P3PD 3AFAD 3AZND 5G49B 4X23A 1M19B 1ZLAC 4CSRB 2IO5B 5B31D 1N1JA 3REHA 3RELD 1P3ID 3B6GC 3AZNC 4WU9B 1KX3B 4G91C 5B1MB 5B31C 3RELC 1P3IC 3AZIA 5B33D 2CWEA 3B6FB 4Z2MG 1P3LB 3NQUB 2HUEB 1P3GB 2PYOA 1W2EA 5B33C 4NFTA 3AYWA 3C1CA 5CP6A 4LD9A 4DQYB 3WAAD 3EPKA 3MGRA 3WAAC 4HGAB 2JCHA 3W98D 3W98C 3WA9A 3AZGA 1EQZA 1M1AD 5BNXA 1P34D 3MGPD 5AY8B 2F8NA 5GT0B 1P3BD 4EO5B 5GT3D 3O62A 1P34C 3X1SA 3MGPC 3AN2B 5GSUA 1P3BC 5GT3C 1P3AD 3AZFB 3UTBB 5DNMA 1P3AC 1ZLAA 5CPKA 3AZJB 1U35B 5JRGA 3LZ1B 4J8WB 3FDDA 3AZNA 2NZDB 4H9NA 2Y2MA 5GXQB 5B31A 3C1BD 3RELA 3AZMB 1JFIB 3UTAB 3C1BC 1H3OB 3AV2D 3AZED 1P3OB 3WKJD 4G92C 4Z2MH 5CPJB 5AV6B 3AV2C 4KUDA 4J8VB 1AOID 3WKJC 5KDMB 4H9PA 1AOIC 5B24B 5F99A 4QLCB 3KUYD 1BH8B 3W97D 4YM6D 3LZ0B 3B0DB 3KUYC 3W97C 2RVQD 5B2IB 3A6NB 3REID 5AVBD 2RVQC 2Y2HA 4ZUXD 5B1LA 5B0ZB 4Z66D 3REIC 3REJB 1TAFA 1P3KB 4KGCD 1BFMA 1F66B 4ZUXC 1P34A 3MGPA 4Z66C 4R8PB 3B0BA 4KGCC 3KFUG 1P3MD 1KX5A 4H9OB 3R45A 1P3AA 2LY8A 2YFVA 1P3FD 1ID3B 5AV8C 1P3FC 3X1VD 3REKD 5JA4B 5AV5A 3C1BA 5CPID 4Z5TD 4CAYA 3AV2A 5CPIC 1M18D 3LJAC 4JJNA 3WKJA 4Z5TC 3WTPB 3W96D 3MGQB 3IP4C 1M18C 1AOIA 4KHAB 2FJ7A 2Y2NA 3LELB 1KX4A 3W96C 4X23B 5CHLB 3WTPE 5B0YD 3X1UB 4J8XB 3EPLA 3KUYA 3W97A 5B0YC 2Y2IA 3W99C 4XZQB 3AZIB 3MNNA 3AZHD 3REIA 3MVDB 4J8UD 2FFFB 3C1CB 1HQ3C 4ZUXA 3AZHC 4Z66A 2UWXA 4XUJB 5BS7C 4J8UC 2AROD 1T3UA 3AV1C 5CP6B 5AV9D 4LD9B 2AROC 3X1TC 4WJ3C 4UUZA 5B2JD 1S32A 4NE6A 1M19D 5B2JC 5AV8A 1P3FA 2ZY4A 1P3PC 3AFAC 1M19C 4WU9D 3WA9B 3AZGB 5BNVA 5B1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 B;  4WU9 C;  4H9Q A;  5B40 B;  3B0C T;  5CPI A;  2F8N B;  5B1M C;  3LJA A;  1P3L D;  3B6F D;  3X1S B;  4H9R A;  1P3G D;  4WV4 B;  4YS3 A;  3B6F C;  1P3L C;  1P3G C;  2HUE C;  5DNM B;  4DRB A;  5AVC A;  3TU4 A;  1ZLA B;  5CPK B;  1Q9C A;  5JRG B;  4G91 B;  4H9N B;  5B31 B;  3W99 A;  2CV5 A;  3MGS B;  4HGA C;  3AZK A;  3UT9 A;  4KUD B;  1HQ3 A;  3AZH A;  4H9P B;  5AY8 D;  4J8U A;  5C3I B;  5GT0 D;  3AV1 A;  1M1A C;  4WU8 B;  3KWQ A;  2NQB B;  3AN2 D;  5AY8 C;  5F99 B;  3X1T A;  5GT0 C;  4EO5 C;  3AZF D;  1TZY A;  3AN2 C;  3AZF C;  4ZBJ B;  3B6G A;  3AZJ D;  3AFA A;  1U35 D;  1P3P A;  3LZ1 D;  4J8W D;  2NZD D;  2BYM A;  1ULY A;  3VH6 A;  5GXQ D;  3AZM D;  1P3I A;  3AZJ C;  1U35 C;  3V9R A;  5B1L B;  5DNN D;  3LZ1 C;  4J8W C;  3UTA D;  1TAF B;  5GXQ C;  3KXB D;  5B1M A;  4AWL C;  1R4V A;  3AZM C;  1P34 B;  1P3O D;  4DRA A;  5DNN C;  3UTA C;  5B33 A;  5CPJ D;  5AV6 D;  3KXB C;  3AZE C;  1P3L A;  1BH9 A;  4J8V D;  1KX5 B;  3AZL D;  5AV6 C;  4J8V C;  5E5A B;  1HTA A;  3AZL C;  5B24 D;  1B67 A;  4QLC D;  5B24 C;  3WAA A;  5AV5 B;  4QLC C;  3LZ0 D;  3C1B B;  4YM6 C;  3W98 A;  5B2I D;  3A6N D;  4CAY B;  3LZ0 C;  3B0D C;  4JJN B;  5B0Z D;  5B2I C;  3A6N C;  5AVB C;  1P3K D;  3REJ D;  1M1A A;  5BT1 D;  1F66 D;  2FJ7 B;  1KX4 B;  1P3K C;  4R8P D;  3REJ C;  1P3B A;  5GT0 A;  5GT3 A;  5BT1 C;  1F66 C;  4R8P C;  1P3M C;  3W97 B;  2JSS A;  1ID3 D;  3MNN B;  3AZJ A;  3REI B;  4E44 A;  1ID3 C;  3X1V C;  2YFW A;  3REK C;  5DNN A;  3KXB A;  3AZE A;  3NQJ A;  2BYK A;  5AV6 A;  3WTP D;  3MGQ D;  4UUZ B;  4J8V A;  5KDM A;  3LEL D;  3AZL A;  1S32 B;  3WTP C;  4E45 A;  3VH5 A;  2L5A A;  4X23 D;  3MGQ C;  5AV8 B;  3LEL C;  3REH B;  1N1J B;  3X1U D;  4J8X D;  4YM6 A;  2HIO D;  3X1U C;  4J8X C;  4XZQ D;  3AZI D;  3LZ0 A;  3LJA B;  2HIO C;  2PYO B;  4H9R B;  4XZQ C;  3AZI C;  5AVB A;  3AYW B;  3VH6 W;  3MVD D;  4YS3 B;  3C1C D;  4KGC A;  4XUJ D;  3MVD C;  5AVC B;  3TU4 B;  3C1C C;  5CP6 D;  4R8P A;  4XUJ C;  4LD9 D;  1P3M A;  5CP6 C;  3MGR B;  5AV9 C;  4LD9 C;  3W99 B;  2CV5 B;  1KX3 D;  3AZK B;  3WA9 D;  3AZG D;  3REK A;  3X1V A;  1EQZ B;  3UT9 B;  1HQ3 B;  3KSY A;  5BNX B;  1KX3 C;  5JA4 A;  5B32 D;  3WA9 C;  3AZG C;  5B40 D;  2F8N D;  3AV1 B;  3O62 B;  4Z5T A;  3X1S D;  5B32 C;  3KWQ B;  5GSU B;  5B32 G;  5B40 C;  3X1T B;  1M18 A;  2F8N G;  3X1S C;  1TZY B;  4WNN A;  3W96 A;  4M6B A;  3WTP A;  3MGQ A;  5DNM D;  3LEL A;  1ZLA D;  5CPK D;  3B6G B;  1P3P B;  3AFA B;  5JRG D;  3AZN B;  5DNM C;  2BYM B;  3REL B;  5CPK C;  1P3I B;  5B0Y A;  4H9S C;  5JRG C;  3X1U A;  3V9R B;  4J8X A;  2HIO A;  3MGS D;  5B31 G;  4XZQ A;  5B33 B;  3MGS C;  1BH9 B;  4KUD D;  5BS7 A;  5FUG A;  3MVD A;  4KUD C;  5BO0 A;  4WU8 D;  4XUJ A;  2NQB D;  2ARO A;  5F99 D;  5C3I C;  5AV9 A;  3UTB D;  4WU8 C;  3WAA B;  2NQB C;  5F99 C;  5B2J A;  3UTB C;  1M19 A;  5G49 A;  3W98 B;  4NE3 A;  3VH5 W;  4CSR A;  4ZBJ C;  2NZD C;  4WU9 A;  1KX3 A;  1WWS A;  5B1L D;  1M1A B;  3MGP B;  5B1L C;  1A7W A;  5B32 A;  5B40 A;  1P3B B;  5GT3 B;  3B6F A;  1P3O C;  3NQU A;  1P3G A;  1KX5 D;  5CPJ C;  3R45 B;  2F8N H;  1P3A B;  2YFV B;  3B0C W;  1KX5 C;  5E5A D;  5E5A C;  1B6W A;  4H9S A;  5AV5 D;  4AWL B;  2YFW B;  5DNN B;  1WWI A;  4G92 B;  5AV5 C;  3KXB B;  3AV2 B;  3AZE B;  3NQJ B;  2BYK B;  3MGS A;  3WKJ B;  4JJN D;  1AOI B;  5B0Z C;  4JJN C;  2FJ7 D;  3AZL B;  1KX4 D;  5AY8 A;  2FJ7 C;  4WU8 A;  3AN2 A;  1KX4 C;  2NQB A;  3KUY B;  3AZF A;  3UTB A;  4YM6 B;  3VH6 T;  1F1E A;  1U35 A;  4NE5 A;  3MNN D;  3LZ1 A;  4J8W A;  2NZD A;  5AVB B;  5GXQ A;  3AZM A;  1JFI A;  4ZUX B;  3MNN C;  3UTA A;  4Z66 B;  4KGC B;  1H3O A;  2F8N K;  1P3O A;  5CPJ A;  1P3M B;  1S32 D;  1P3F B;  5AV8 D;  5E5A A;  3REH D;  5B24 A;  1S32 C;  4X23 C;  4QLC A;  3X1V B;  1BH8 A;  5BNV B;  3REH C;  3REK B;  4H9Q B;  5CPI B;  4Z5T B;  3LJA D;  5B2I A;  2IO5 C;  3A6N A;  2PYO D;  1KU5 A;  1M18 B;  4YS3 D;  3AYW D;  5B0Z A;  2PYO C;  1P3K A;  3REJ A;  4WNN B;  3W96 B;  4YS3 C;  3AYW C;  1F66 A;  5AVC D;  3TU4 D;  5AVC C;  3TU4 C;  5B0Y B;  4H9O A;  3MGR D;  3W99 D;  2CV5 D;  3MGR C;  2HIO B;  2CV5 C;  3AZK D;  1ID3 A;  1EQZ D;  3UT9 D;  1HQ3 D;  3AZH B;  3AZK C;  4J8U B;  5FUG B;  1EQZ C;  3UT9 C;  5BO0 B;  3AV1 D;  3O62 D;  3KWQ D;  2ARO B;  5GSU D;  3X1T D;  3O62 C;  4WZS B;  5AV9 B;  3KWQ C;  1TZY D;  3VH5 T;  5GSU C;  5B2J B;  4KHA A;  3B6G D;  1TZY C;  1P3P D;  3AFA D;  3AZN D;  5G49 B;  4X23 A;  1M19 B;  1ZLA C;  4CSR B;  2IO5 B;  5B31 D;  1N1J A;  3REH A;  3REL D;  1P3I D;  3B6G C;  3AZN C;  4WU9 B;  1KX3 B;  4G91 C;  5B1M B;  5B31 C;  3REL C;  1P3I C;  3AZI A;  5B33 D;  2CWE A;  3B6F B;  4Z2M G;  1P3L B;  3NQU B;  2HUE B;  1P3G B;  2PYO A;  5B33 C;  4NFT A;  3AYW A;  3C1C A;  5CP6 A;  4LD9 A;  3WAA D;  3MGR A;  3WAA C;  4HGA B;  3W98 D;  3W98 C;  3WA9 A;  3AZG A;  1EQZ A;  1M1A D;  5BNX A;  1P34 D;  3MGP D;  5AY8 B;  2F8N A;  5GT0 B;  1P3B D;  4EO5 B;  5GT3 D;  3O62 A;  1P34 C;  3X1S A;  3MGP C;  3AN2 B;  5GSU A;  1P3B C;  5GT3 C;  1P3A D;  3AZF B;  3UTB B;  5DNM A;  1P3A C;  1ZLA A;  5CPK A;  3AZJ B;  1U35 B;  5JRG A;  3LZ1 B;  4J8W B;  3AZN A;  2NZD B;  4H9N A;  5GXQ B;  3C1B D;  5B31 A;  3REL A;  3AZM B;  1JFI B;  3UTA B;  3C1B C;  1H3O B;  3AV2 D;  3AZE D;  1P3O B;  3WKJ D;  4G92 C;  4Z2M H;  5CPJ B;  5AV6 B;  3AV2 C;  4KUD A;  4J8V B;  1AOI D;  3WKJ C;  5KDM B;  4H9P A;  1AOI C;  5B24 B;  5F99 A;  4QLC B;  3KUY D;  1BH8 B;  3W97 D;  4YM6 D;  3LZ0 B;  3B0D B;  3KUY C;  3W97 C;  2RVQ D;  5B2I B;  3A6N B;  3REI D;  5AVB D;  2RVQ C;  4ZUX D;  5B0Z B;  5B1L A;  4Z66 D;  3REI C;  3REJ B;  1TAF A;  1P3K B;  4KGC D;  1BFM A;  1F66 B;  4ZUX C;  1P34 A;  3MGP A;  4Z66 C;  4R8P B;  3B0B A;  4KGC C;  1P3M D;  1KX5 A;  4H9O B;  3R45 A;  1P3A A;  2LY8 A;  2YFV A;  1P3F D;  1ID3 B;  5AV8 C;  1P3F C;  3X1V D;  3REK D;  5JA4 B;  5AV5 A;  3C1B A;  5CPI D;  4Z5T D;  4CAY A;  3AV2 A;  5CPI C;  1M18 D;  3LJA C;  4JJN A;  3WKJ A;  4Z5T C;  3WTP B;  3W96 D;  3MGQ B;  1M18 C;  1AOI A;  4KHA B;  2FJ7 A;  3LEL B;  1KX4 A;  3W96 C;  4X23 B;  5CHL B;  3WTP E;  5B0Y D;  3X1U B;  4J8X B;  3KUY A;  3W97 A;  5B0Y C;  4XZQ B;  3W99 C;  3AZI B;  3MNN A;  3AZH D;  3REI A;  3MVD B;  4J8U D;  3C1C B;  1HQ3 C;  4ZUX A;  3AZH C;  4Z66 A;  4XUJ B;  5BS7 C;  4J8U C;  2ARO D;  3AV1 C;  5CP6 B;  5AV9 D;  4LD9 B;  2ARO C;  3X1T C;  4UUZ A;  5B2J D;  1S32 A;  4NE6 A;  1M19 D;  5B2J C;  5AV8 A;  1P3F A;  1P3P C;  3AFA C;  1M19 C;  4WU9 D;  3WA9 B;  3AZG B;  5BNV A;  5B1M D; 
#chains in the Genus database with same CATH topology
 5B32 B;  4WU9 C;  1Z2C B;  4H9Q A;  5B40 B;  3B0C T;  5CPI A;  2F8N B;  5B1M C;  3LJA A;  1P3L D;  3B6F D;  3X1S B;  4H9R A;  1P3G D;  4WV4 B;  4YS3 A;  3B6F C;  1P3L C;  1P3G C;  2HUE C;  5DNM B;  4DRB A;  5AVC A;  3TU4 A;  1ZLA B;  2Y2O A;  5CPK B;  1Q9C A;  5JRG B;  4G91 B;  2DF4 C;  4H9N B;  5B31 B;  3W99 A;  2CV5 A;  3MGS B;  4HGA C;  2RIQ A;  3AZK A;  3UT9 A;  4KUD B;  1HQ3 A;  3AZH A;  3A1I A;  4H9P B;  5AY8 D;  4J8U A;  5C3I B;  5GT0 D;  3AV1 A;  1M1A C;  4WU8 B;  3KWQ A;  2NQB B;  3AN2 D;  5AY8 C;  5F99 B;  3X1T A;  5GT0 C;  4EO5 C;  3AZF D;  2Y2Q A;  1TZY A;  3AN2 C;  3AZF C;  4ZBJ B;  3B6G A;  3AZJ D;  3AFA A;  1U35 D;  1P3P A;  3LZ1 D;  4J8W D;  2NZD D;  2BYM A;  1ULY A;  3VH6 A;  5GXQ D;  3AZM D;  1P3I A;  3AZJ C;  1U35 C;  2BG1 A;  3V9R A;  5B1L B;  5DNN D;  3LZ1 C;  4J8W C;  3UTA D;  1TAF B;  5GXQ C;  3KXB D;  5B1M A;  4AWL C;  1R4V A;  3AZM C;  1P34 B;  1P3O D;  4DRA A;  5DNN C;  3UTA C;  5B33 A;  5CPJ D;  5AV6 D;  3KXB C;  3AZE C;  1P3L A;  1BH9 A;  4J8V D;  1KX5 B;  3AZL D;  5AV6 C;  4J8V C;  5E5A B;  1HTA A;  3AZL C;  5B24 D;  1B67 A;  4QLC D;  3EG5 B;  5B24 C;  3WAA A;  2F2A C;  5AV5 B;  4QLC C;  3LZ0 D;  3C1B B;  4YM6 C;  3W98 A;  5B2I D;  3A6N D;  4CAY B;  3LZ0 C;  3B0D C;  2Y2L A;  4JJN B;  5B0Z D;  5B2I C;  3A6N C;  5AVB C;  1P3K D;  3REJ D;  1M1A A;  5BT1 D;  1F66 D;  2FJ7 B;  1KX4 B;  1P3K C;  4R8P D;  3REJ C;  1P3B A;  5GT0 A;  5GT3 A;  5BT1 C;  1F66 C;  4R8P C;  2W8S A;  1P3M C;  3W97 B;  2JSS A;  2DQN C;  1ID3 D;  3MNN B;  3AZJ A;  3REI B;  4E44 A;  1ID3 C;  3X1V C;  2YFW A;  3REK C;  5DNN A;  3KXB A;  3AZE A;  3NQJ A;  2BYK A;  5AV6 A;  3WTP D;  3MGQ D;  4UUZ B;  4J8V A;  5KDM A;  3LEL D;  3AZL A;  1S32 B;  3WTP C;  4E45 A;  3VH5 A;  2L5A A;  4X23 D;  3MGQ C;  5AV8 B;  3LEL C;  3REH B;  1N1J B;  2XD1 A;  3X1U D;  4J8X D;  3F6T A;  4YM6 A;  2HIO D;  3X1U C;  4J8X C;  4XZQ D;  3AZI D;  3LZ0 A;  3LJA B;  2HIO C;  2PYO B;  4H9R B;  4XZQ C;  3AZI C;  5AVB A;  3AYW B;  3VH6 W;  3MVD D;  4YS3 B;  3C1C D;  4KGC A;  4XUJ D;  3MVD C;  5AVC B;  3TU4 B;  3C1C C;  5CP6 D;  4R8P A;  4XUJ C;  4LD9 D;  3AL0 C;  1P3M A;  5CP6 C;  3MGR B;  5AV9 C;  4LD9 C;  3W99 B;  2CV5 B;  1PZR A;  1KX3 D;  3AZK B;  3WA9 D;  3AZG D;  3REK A;  3X1V A;  1EQZ B;  3UT9 B;  1HQ3 B;  3KSY A;  5BNX B;  2ZM5 A;  1KX3 C;  5JA4 A;  5B32 D;  3WA9 C;  3AZG C;  5B40 D;  2F8N D;  3AV1 B;  3O62 B;  4Z5T A;  3X1S D;  5B32 C;  3KWQ B;  5GSU B;  5B32 G;  5B40 C;  3X1T B;  1M18 A;  2F8N G;  3X1S C;  2VQR A;  1TZY B;  2XD5 A;  4WNN A;  3W96 A;  4M6B A;  3WTP A;  3MGQ A;  5DNM D;  3LEL A;  1ZLA D;  5CPK D;  3B6G B;  1P3P B;  3AFA B;  5JRG D;  3AZN B;  5DNM C;  2BYM B;  3REL B;  5CPK C;  1P3I B;  5B0Y A;  4H9S C;  5JRG C;  3X1U A;  3V9R B;  4J8X A;  3H0M C;  2HIO A;  3MGS D;  5B31 G;  4XZQ A;  5B33 B;  3MGS C;  1BH9 B;  4KUD D;  5BS7 A;  5FUG A;  3MVD A;  4KUD C;  5BO0 A;  3EPH A;  4WU8 D;  4XUJ A;  2NQB D;  2ARO A;  5F99 D;  5C3I C;  5AV9 A;  3UTB D;  4WU8 C;  3WAA B;  2NQB C;  5F99 C;  5B2J A;  3UTB C;  1M19 A;  5G49 A;  3W98 B;  4NE3 A;  3VH5 W;  4CSR A;  4ZBJ C;  2NZD C;  4WU9 A;  1KX3 A;  1WWS A;  5B1L D;  1M1A B;  3MGP B;  5B1L C;  1A7W A;  5B32 A;  5B40 A;  1P3B B;  5GT3 B;  3B6F A;  1P3O C;  3NQU A;  1P3G A;  2J8P A;  1KX5 D;  3EPJ A;  5CPJ C;  3R45 B;  2F8N H;  1P3A B;  2YFV B;  3B0C W;  1KX5 C;  5E5A D;  5E5A C;  1B6W A;  4H9S A;  2ZY3 A;  5AV5 D;  3P5J B;  4AWL B;  2YFW B;  2Y2J A;  5DNN B;  1WWI A;  4G92 B;  5AV5 C;  3KXB B;  3AV2 B;  3AZE B;  3NQJ B;  2BYK B;  3MGS A;  3WKJ B;  4JJN D;  1AOI B;  5B0Z C;  4JJN C;  2FJ7 D;  3AZL B;  1KX4 D;  5AY8 A;  2FJ7 C;  4WU8 A;  3AN2 A;  1KX4 C;  2NQB A;  3KUY B;  3AZF A;  3UTB A;  4YM6 B;  3VH6 T;  1F1E A;  2ZY2 A;  1U35 A;  4NE5 A;  3MNN D;  3LZ1 A;  4J8W A;  2NZD A;  5AVB B;  2ZY5 A;  5GXQ A;  3AZM A;  1JFI A;  4ZUX B;  3MNN C;  3UTA A;  4Z66 B;  4KGC B;  1H3O A;  2F8N K;  1P3O A;  5CPJ A;  1P3M B;  3H0L C;  2Y2K A;  1S32 D;  1P3F B;  5AV8 D;  5E5A A;  3REH D;  5B24 A;  1S32 C;  4X23 C;  4QLC A;  3X1V B;  1BH8 A;  5BNV B;  3REH C;  3REK B;  4H9Q B;  5CPI B;  4Z5T B;  3LJA D;  5B2I A;  2IO5 C;  3A6N A;  2PYO D;  4UPK A;  1KU5 A;  1M18 B;  4YS3 D;  3AYW D;  5B0Z A;  2Y2G A;  2PYO C;  1P3K A;  3REJ A;  4WNN B;  3W96 B;  4YS3 C;  3AYW C;  1F66 A;  5AVC D;  3TU4 D;  2Y2P A;  5AVC C;  2JE5 A;  3TU4 C;  5B0Y B;  4H9O A;  3MGR D;  3W99 D;  2CV5 D;  3MGR C;  2HIO B;  2G5I C;  2CV5 C;  3AZK D;  1ID3 A;  1EQZ D;  3UT9 D;  1HQ3 D;  3AZH B;  3H0R C;  3AZK C;  4J8U B;  5FUG B;  1EQZ C;  3UT9 C;  5BO0 B;  3AV1 D;  3O62 D;  3KWQ D;  3A1K A;  2ARO B;  5GSU D;  3X1T D;  3O62 C;  4WZS B;  5AV9 B;  3KWQ C;  2G5H C;  1TZY D;  3VH5 T;  5GSU C;  5B2J B;  4KHA A;  3B6G D;  1TZY C;  1P3P D;  3AFA D;  3AZN D;  5G49 B;  4X23 A;  1M19 B;  1ZLA C;  4CSR B;  2IO5 B;  5B31 D;  1N1J A;  3REH A;  3REL D;  1P3I D;  3B6G C;  3AZN C;  4WU9 B;  1KX3 B;  4G91 C;  5B1M B;  5B31 C;  3REL C;  1P3I C;  3AZI A;  5B33 D;  2CWE A;  3B6F B;  4Z2M G;  1P3L B;  3NQU B;  2HUE B;  1P3G B;  2PYO A;  1W2E A;  5B33 C;  4NFT A;  3AYW A;  3C1C A;  5CP6 A;  4LD9 A;  4DQY B;  3WAA D;  3EPK A;  3MGR A;  3WAA C;  4HGA B;  2JCH A;  3W98 D;  3W98 C;  3WA9 A;  3AZG A;  1EQZ A;  1M1A D;  5BNX A;  1P34 D;  3MGP D;  5AY8 B;  2F8N A;  5GT0 B;  1P3B D;  4EO5 B;  5GT3 D;  3O62 A;  1P34 C;  3X1S A;  3MGP C;  3AN2 B;  5GSU A;  1P3B C;  5GT3 C;  1P3A D;  3AZF B;  3UTB B;  5DNM A;  1P3A C;  1ZLA A;  5CPK A;  3AZJ B;  1U35 B;  5JRG A;  3LZ1 B;  4J8W B;  3FDD A;  3AZN A;  2NZD B;  4H9N A;  2Y2M A;  5GXQ B;  5B31 A;  3C1B D;  3REL A;  3AZM B;  1JFI B;  3UTA B;  3C1B C;  1H3O B;  3AV2 D;  3AZE D;  1P3O B;  3WKJ D;  4G92 C;  4Z2M H;  5CPJ B;  5AV6 B;  3AV2 C;  4KUD A;  4J8V B;  1AOI D;  3WKJ C;  5KDM B;  4H9P A;  1AOI C;  5B24 B;  5F99 A;  4QLC B;  3KUY D;  1BH8 B;  3W97 D;  4YM6 D;  3LZ0 B;  3B0D B;  3KUY C;  3W97 C;  2RVQ D;  5B2I B;  3A6N B;  3REI D;  5AVB D;  2RVQ C;  2Y2H A;  4ZUX D;  5B1L A;  5B0Z B;  4Z66 D;  3REI C;  3REJ B;  1TAF A;  1P3K B;  4KGC D;  1BFM A;  1F66 B;  4ZUX C;  1P34 A;  3MGP A;  4Z66 C;  4R8P B;  3B0B A;  4KGC C;  3KFU G;  1P3M D;  1KX5 A;  4H9O B;  3R45 A;  1P3A A;  2LY8 A;  2YFV A;  1P3F D;  1ID3 B;  5AV8 C;  1P3F C;  3X1V D;  3REK D;  5JA4 B;  5AV5 A;  3C1B A;  5CPI D;  4Z5T D;  4CAY A;  3AV2 A;  5CPI C;  1M18 D;  3LJA C;  4JJN A;  3WKJ A;  4Z5T C;  3WTP B;  3W96 D;  3MGQ B;  3IP4 C;  1M18 C;  1AOI A;  4KHA B;  2FJ7 A;  2Y2N A;  3LEL B;  1KX4 A;  3W96 C;  4X23 B;  5CHL B;  3WTP E;  5B0Y D;  3X1U B;  4J8X B;  3EPL A;  3KUY A;  3W97 A;  5B0Y C;  2Y2I A;  3W99 C;  4XZQ B;  3AZI B;  3MNN A;  3AZH D;  3REI A;  3MVD B;  4J8U D;  2FFF B;  3C1C B;  1HQ3 C;  4ZUX A;  3AZH C;  4Z66 A;  2UWX A;  4XUJ B;  5BS7 C;  4J8U C;  2ARO D;  1T3U A;  3AV1 C;  5CP6 B;  5AV9 D;  4LD9 B;  2ARO C;  3X1T C;  4WJ3 C;  4UUZ A;  5B2J D;  1S32 A;  4NE6 A;  1M19 D;  5B2J C;  5AV8 A;  1P3F A;  2ZY4 A;  1P3P C;  3AFA C;  1M19 C;  4WU9 D;  3WA9 B;  3AZG B;  5BNV A;  5B1M D; 
#chains in the Genus database with same CATH homology
 5B32 B;  4WU9 C;  1Z2C B;  4H9Q A;  5B40 B;  3B0C T;  5CPI A;  2F8N B;  5B1M C;  3LJA A;  1P3L D;  3B6F D;  3X1S B;  4H9R A;  1P3G D;  4WV4 B;  4YS3 A;  3B6F C;  1P3L C;  1P3G C;  2HUE C;  5DNM B;  4DRB A;  5AVC A;  3TU4 A;  1ZLA B;  2Y2O A;  5CPK B;  1Q9C A;  5JRG B;  4G91 B;  2DF4 C;  4H9N B;  5B31 B;  3W99 A;  2CV5 A;  3MGS B;  4HGA C;  2RIQ A;  3AZK A;  3UT9 A;  4KUD B;  1HQ3 A;  3AZH A;  3A1I A;  4H9P B;  5AY8 D;  4J8U A;  5C3I B;  5GT0 D;  3AV1 A;  1M1A C;  4WU8 B;  3KWQ A;  2NQB B;  3AN2 D;  5AY8 C;  5F99 B;  3X1T A;  5GT0 C;  4EO5 C;  3AZF D;  2Y2Q A;  1TZY A;  3AN2 C;  3AZF C;  4ZBJ B;  3B6G A;  3AZJ D;  3AFA A;  1U35 D;  1P3P A;  3LZ1 D;  4J8W D;  2NZD D;  2BYM A;  1ULY A;  3VH6 A;  5GXQ D;  3AZM D;  1P3I A;  3AZJ C;  1U35 C;  2BG1 A;  3V9R A;  5B1L B;  5DNN D;  3LZ1 C;  4J8W C;  3UTA D;  1TAF B;  5GXQ C;  3KXB D;  5B1M A;  4AWL C;  1R4V A;  3AZM C;  1P34 B;  1P3O D;  4DRA A;  5DNN C;  3UTA C;  5B33 A;  5CPJ D;  5AV6 D;  3KXB C;  3AZE C;  1P3L A;  1BH9 A;  4J8V D;  1KX5 B;  3AZL D;  5AV6 C;  4J8V C;  5E5A B;  1HTA A;  3AZL C;  5B24 D;  1B67 A;  4QLC D;  3EG5 B;  5B24 C;  3WAA A;  2F2A C;  5AV5 B;  4QLC C;  3LZ0 D;  3C1B B;  4YM6 C;  3W98 A;  5B2I D;  3A6N D;  4CAY B;  3LZ0 C;  3B0D C;  2Y2L A;  4JJN B;  5B0Z D;  5B2I C;  3A6N C;  5AVB C;  1P3K D;  3REJ D;  1M1A A;  5BT1 D;  1F66 D;  2FJ7 B;  1KX4 B;  1P3K C;  4R8P D;  3REJ C;  1P3B A;  5GT0 A;  5GT3 A;  5BT1 C;  1F66 C;  4R8P C;  2W8S A;  1P3M C;  3W97 B;  2JSS A;  2DQN C;  1ID3 D;  3MNN B;  3AZJ A;  3REI B;  4E44 A;  1ID3 C;  3X1V C;  2YFW A;  3REK C;  5DNN A;  3KXB A;  3AZE A;  3NQJ A;  2BYK A;  5AV6 A;  3WTP D;  3MGQ D;  4UUZ B;  4J8V A;  5KDM A;  3LEL D;  3AZL A;  1S32 B;  3WTP C;  4E45 A;  3VH5 A;  2L5A A;  4X23 D;  3MGQ C;  5AV8 B;  3LEL C;  3REH B;  1N1J B;  2XD1 A;  3X1U D;  4J8X D;  3F6T A;  4YM6 A;  2HIO D;  3X1U C;  4J8X C;  4XZQ D;  3AZI D;  3LZ0 A;  3LJA B;  2HIO C;  2PYO B;  4H9R B;  4XZQ C;  3AZI C;  5AVB A;  3AYW B;  3VH6 W;  3MVD D;  4YS3 B;  3C1C D;  4KGC A;  4XUJ D;  3MVD C;  5AVC B;  3TU4 B;  3C1C C;  5CP6 D;  4R8P A;  4XUJ C;  4LD9 D;  3AL0 C;  1P3M A;  5CP6 C;  3MGR B;  5AV9 C;  4LD9 C;  3W99 B;  2CV5 B;  1PZR A;  1KX3 D;  3AZK B;  3WA9 D;  3AZG D;  3REK A;  3X1V A;  1EQZ B;  3UT9 B;  1HQ3 B;  3KSY A;  5BNX B;  2ZM5 A;  1KX3 C;  5JA4 A;  5B32 D;  3WA9 C;  3AZG C;  5B40 D;  2F8N D;  3AV1 B;  3O62 B;  4Z5T A;  3X1S D;  5B32 C;  3KWQ B;  5GSU B;  5B32 G;  5B40 C;  3X1T B;  1M18 A;  2F8N G;  3X1S C;  2VQR A;  1TZY B;  2XD5 A;  4WNN A;  3W96 A;  4M6B A;  3WTP A;  3MGQ A;  5DNM D;  3LEL A;  1ZLA D;  5CPK D;  3B6G B;  1P3P B;  3AFA B;  5JRG D;  3AZN B;  5DNM C;  2BYM B;  3REL B;  5CPK C;  1P3I B;  5B0Y A;  4H9S C;  5JRG C;  3X1U A;  3V9R B;  4J8X A;  3H0M C;  2HIO A;  3MGS D;  5B31 G;  4XZQ A;  5B33 B;  3MGS C;  1BH9 B;  4KUD D;  5BS7 A;  5FUG A;  3MVD A;  4KUD C;  5BO0 A;  3EPH A;  4WU8 D;  4XUJ A;  2NQB D;  2ARO A;  5F99 D;  5C3I C;  5AV9 A;  3UTB D;  4WU8 C;  3WAA B;  2NQB C;  5F99 C;  5B2J A;  3UTB C;  1M19 A;  5G49 A;  3W98 B;  4NE3 A;  3VH5 W;  4CSR A;  4ZBJ C;  2NZD C;  4WU9 A;  1KX3 A;  1WWS A;  5B1L D;  1M1A B;  3MGP B;  5B1L C;  1A7W A;  5B32 A;  5B40 A;  1P3B B;  5GT3 B;  3B6F A;  1P3O C;  3NQU A;  1P3G A;  2J8P A;  1KX5 D;  3EPJ A;  5CPJ C;  3R45 B;  2F8N H;  1P3A B;  2YFV B;  3B0C W;  1KX5 C;  5E5A D;  5E5A C;  1B6W A;  4H9S A;  2ZY3 A;  5AV5 D;  3P5J B;  4AWL B;  2YFW B;  2Y2J A;  5DNN B;  1WWI A;  4G92 B;  5AV5 C;  3KXB B;  3AV2 B;  3AZE B;  3NQJ B;  2BYK B;  3MGS A;  3WKJ B;  4JJN D;  1AOI B;  5B0Z C;  4JJN C;  2FJ7 D;  3AZL B;  1KX4 D;  5AY8 A;  2FJ7 C;  4WU8 A;  3AN2 A;  1KX4 C;  2NQB A;  3KUY B;  3AZF A;  3UTB A;  4YM6 B;  3VH6 T;  1F1E A;  2ZY2 A;  1U35 A;  4NE5 A;  3MNN D;  3LZ1 A;  4J8W A;  2NZD A;  5AVB B;  2ZY5 A;  5GXQ A;  3AZM A;  1JFI A;  4ZUX B;  3MNN C;  3UTA A;  4Z66 B;  4KGC B;  1H3O A;  2F8N K;  1P3O A;  5CPJ A;  1P3M B;  3H0L C;  2Y2K A;  1S32 D;  1P3F B;  5AV8 D;  5E5A A;  3REH D;  5B24 A;  1S32 C;  4X23 C;  4QLC A;  3X1V B;  1BH8 A;  5BNV B;  3REH C;  3REK B;  4H9Q B;  5CPI B;  4Z5T B;  3LJA D;  5B2I A;  2IO5 C;  3A6N A;  2PYO D;  4UPK A;  1KU5 A;  1M18 B;  4YS3 D;  3AYW D;  5B0Z A;  2Y2G A;  2PYO C;  1P3K A;  3REJ A;  4WNN B;  3W96 B;  4YS3 C;  3AYW C;  1F66 A;  5AVC D;  3TU4 D;  2Y2P A;  5AVC C;  2JE5 A;  3TU4 C;  5B0Y B;  4H9O A;  3MGR D;  3W99 D;  2CV5 D;  3MGR C;  2HIO B;  2G5I C;  2CV5 C;  3AZK D;  1ID3 A;  1EQZ D;  3UT9 D;  1HQ3 D;  3AZH B;  3H0R C;  3AZK C;  4J8U B;  5FUG B;  1EQZ C;  3UT9 C;  5BO0 B;  3AV1 D;  3O62 D;  3KWQ D;  3A1K A;  2ARO B;  5GSU D;  3X1T D;  3O62 C;  4WZS B;  5AV9 B;  3KWQ C;  2G5H C;  1TZY D;  3VH5 T;  5GSU C;  5B2J B;  4KHA A;  3B6G D;  1TZY C;  1P3P D;  3AFA D;  3AZN D;  5G49 B;  4X23 A;  1M19 B;  1ZLA C;  4CSR B;  2IO5 B;  5B31 D;  1N1J A;  3REH A;  3REL D;  1P3I D;  3B6G C;  3AZN C;  4WU9 B;  1KX3 B;  4G91 C;  5B1M B;  5B31 C;  3REL C;  1P3I C;  3AZI A;  5B33 D;  2CWE A;  3B6F B;  4Z2M G;  1P3L B;  3NQU B;  2HUE B;  1P3G B;  2PYO A;  1W2E A;  5B33 C;  4NFT A;  3AYW A;  3C1C A;  5CP6 A;  4LD9 A;  4DQY B;  3WAA D;  3EPK A;  3MGR A;  3WAA C;  4HGA B;  2JCH A;  3W98 D;  3W98 C;  3WA9 A;  3AZG A;  1EQZ A;  1M1A D;  5BNX A;  1P34 D;  3MGP D;  5AY8 B;  2F8N A;  5GT0 B;  1P3B D;  4EO5 B;  5GT3 D;  3O62 A;  1P34 C;  3X1S A;  3MGP C;  3AN2 B;  5GSU A;  1P3B C;  5GT3 C;  1P3A D;  3AZF B;  3UTB B;  5DNM A;  1P3A C;  1ZLA A;  5CPK A;  3AZJ B;  1U35 B;  5JRG A;  3LZ1 B;  4J8W B;  3FDD A;  3AZN A;  2NZD B;  4H9N A;  2Y2M A;  5GXQ B;  5B31 A;  3C1B D;  3REL A;  3AZM B;  1JFI B;  3UTA B;  3C1B C;  1H3O B;  3AV2 D;  3AZE D;  1P3O B;  3WKJ D;  4G92 C;  4Z2M H;  5CPJ B;  5AV6 B;  3AV2 C;  4KUD A;  4J8V B;  1AOI D;  3WKJ C;  5KDM B;  4H9P A;  1AOI C;  5B24 B;  5F99 A;  4QLC B;  3KUY D;  1BH8 B;  3W97 D;  4YM6 D;  3LZ0 B;  3B0D B;  3KUY C;  3W97 C;  2RVQ D;  5B2I B;  3A6N B;  3REI D;  5AVB D;  2RVQ C;  2Y2H A;  4ZUX D;  5B1L A;  5B0Z B;  4Z66 D;  3REI C;  3REJ B;  1TAF A;  1P3K B;  4KGC D;  1BFM A;  1F66 B;  4ZUX C;  1P34 A;  3MGP A;  4Z66 C;  4R8P B;  3B0B A;  4KGC C;  3KFU G;  1P3M D;  1KX5 A;  4H9O B;  3R45 A;  1P3A A;  2LY8 A;  2YFV A;  1P3F D;  1ID3 B;  5AV8 C;  1P3F C;  3X1V D;  3REK D;  5JA4 B;  5AV5 A;  3C1B A;  5CPI D;  4Z5T D;  4CAY A;  3AV2 A;  5CPI C;  1M18 D;  3LJA C;  4JJN A;  3WKJ A;  4Z5T C;  3WTP B;  3W96 D;  3MGQ B;  3IP4 C;  1M18 C;  1AOI A;  4KHA B;  2FJ7 A;  2Y2N A;  3LEL B;  1KX4 A;  3W96 C;  4X23 B;  5CHL B;  3WTP E;  5B0Y D;  3X1U B;  4J8X B;  3EPL A;  3KUY A;  3W97 A;  5B0Y C;  2Y2I A;  3W99 C;  4XZQ B;  3AZI B;  3MNN A;  3AZH D;  3REI A;  3MVD B;  4J8U D;  2FFF B;  3C1C B;  1HQ3 C;  4ZUX A;  3AZH C;  4Z66 A;  2UWX A;  4XUJ B;  5BS7 C;  4J8U C;  2ARO D;  1T3U A;  3AV1 C;  5CP6 B;  5AV9 D;  4LD9 B;  2ARO C;  3X1T C;  4WJ3 C;  4UUZ A;  5B2J D;  1S32 A;  4NE6 A;  1M19 D;  5B2J C;  5AV8 A;  1P3F A;  2ZY4 A;  1P3P C;  3AFA C;  1M19 C;  4WU9 D;  3WA9 B;  3AZG B;  5BNV A;  5B1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...