4YM6A

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6A00
1S32B 3MGQC 5AV9A 2HIOB 3C1BB 5CPIC 4WU9D 3AYWD 4H9QA 4KGCC 5AVBA 3AZLC 3KUYC 1P3KC 5JRGB 2JSSA 3MGSB 4J8WA 1P3PA 4KUDC 4E45A 1P3BD 3REHC 3X1VD 3MNNA 3RELA 5AV6C 4WU8B 3WTPD 3NQUB 1M18D 3MGRA 4J8XB 5GT0A 1ULYA 3C1CA 3AZHC 3LZ1B 1P3GB 5B40D 4Z66B 5AVCD 3REID 5B31C 3X1UD 5AY8C 3AFAB 1P3AD 1P3LD 5DNMA 5C3IB 3TU4C 3X1TC 2CV5C 2RVQC 3MGPA 4Z5TA 5CPKD 1TZYD 3REJA 1N1JB 4YM6A 5AV5D 1AOIA 2YFVB 1P3FA 4WU9B 3WA9D 3AYWB 3AV1C 4DRBA 3W97A 4J8UD 5B1MD 4G92B 4R8PC 5FUGB 3B6FA 1H3OB 4CAYA 3AZKC 1P3BB 3AZFA 3X1VB 1ZLAD 3AZMA 4H9NB 4QLCA 3WTPB 3MVDC 3REKC 4HGAC 1M18B 2FJ7D 2HIOA 3C1BA 4E44A 1KX5A 3REIB 3AZJD 3X1UB 1P3AB 5AV9C 3LZ0D 3B6GB 5JRGA 2BYMB 5B2JA 4NFTA 5CPKB 1P3MD 5GSUD 4DRAA 5AVBC 5AV5B 5G49B 3AV2A 1P3PC 4J8WC 5CPIA 3WA9B 1M19A 3W98D 1M1AD 3W99D 4J8UB 3MNNC 2NZDD 5B1MB 5F99A 3AFAA 4XUJD 5KDMB 3REHA 3MGRC 3KXBA 3X1SA 5GT0C 1ZLAB 3C1CC 3AN2D 3UTAC 5AV6A 5DNND 4AWLC 4YS3A 4EO5B 4LD9D 2FJ7B 5DNMC 1BH8A 5B2IA 1BH9B 3MGPC 4WU9A 4Z5TC 3AZGD 1BFMA 2AROD 3UT9D 1B6WA 3REJC 5B31A 4X23A 4YM6C 3KSYA 5BNXA 3LZ0B 1AOIC 2BYKB 1P3FC 3W96A 1ID3D 1P3BA 3WKJA 1P3MB 5GSUB 4NE3A 3VH5W 5B32D 1P3ID 3W97C 1P3OA 3O62D 3A6NC 1EQZC 4XZQB 3WTPE 1KX4D 3B6FC 5CP6D 2NQBD 5BT1C 1M1AB 3W99B 4ZUXB 1HQ3D 3R45B 3AZMC 2NZDB 3REIA 4QLCC 4R8PA 1P34D 1P3AA 3VH5A 4XUJB 1JFIB 2HIOC 5B32G 5CPJD 3C1BC 3V9RA 2PYOD 3B6GA 3AN2B 1KX5C 4WNNA 5CPKA 5DNNB 3AZND 3REKA 4LD9B 5GXQD 5JRGC 5B2JC 3AZGB 2AROB 3AV2C 4WU8C 1ID3B 1M19C 5KDMA 3B0DB 5B32B 1P3IB 4J8XC 3O62B 5BNVA 4JJNA 5E5AA 2CWEA 3AZLD 1KX4B 3KUYD 4CSRB 5CP6B 5F99C 3AFAC 2NQBB 2FJ7A 1TAFB 5B0ZB 3KXBC 1HQ3B 3X1SC 4NE6A 1P34B 4YS3C 3LELA 5B2IC 2BYKA 5CPJB 2PYOB 4H9PB 4WU9C 3UTAA 3AZHD 1P3MA 4X23C 5AV8D 3AZEB 5GXQB 4KHAA 4G92C 5AY8D 3W96C 4XZQA 3X1TD 3TU4D 1P3BC 3WKJC 3VH6T 2YFWB 4ZUXA 3R45A 1P3OC 4ZBJB 2HUEB 1F66D 3NQJB 3UTBD 2IO5C 1U35A 1B67A 5GT3D 4UUZB 1M18C 1JFIA 3AN2A 4J8VA 3REIC 3A6NA 1EQZA 4WZSB 3AZLB 1P3AC 3B6GC 4H9OB 5B1LA 5B33A 3AZKD 4G91B 5CPKC 3AZGA 1S32A 3KWQD 5AV5C 3MVDD 1WWIA 3B0CW 1KX3D 5AVCB 5B40B 3WAAD 3AZHB 5AV8B 5B32A 4J8UC 1P3IA 1P3LB 3O62A 5AY8B 3MGSA 4CSRA 3TU4B 3X1TB 1TZYB 5B0ZA 4M6BA 1ZLAC 4JJNC 5E5AC 1F66B 5AVBD 4WU8A 3UTBB 5JA4B 3LJAD 4EO5C 5GT3B 1R4VA 3NQUA 2FJ7C 4J8WD 4J8XA 1P3GA 3LZ1A 4Z66A 3RELD 3LELC 3AZEA 3LZ0C 3MGRD 5GT0D 1P3MC 5GSUC 5B0YD 3KWQB 1N1JA 5B24D 3MVDB 2YFVA 4XZQC 5DNMD 1KX3B 3AZJB 3WAAB 4UUZA 3AYWA 3MGPD 4Z5TD 4ZUXC 5CHLB 3REJD 4YM6D 5FUGA 1U35C 1H3OA 1P3FD 3X1VA 3AN2C 4H9QB 4J8VC 5DNNC 4H9NA 5AVBB 3AZID 3WTPA 5BS7A 3LJAB 4LD9C 3W98B 1M18A 3B6FD 5B1LC 5B33C 3AZGC 3AZFD 2AROC 5B40A 5AVCA 3AZMD 1S32C 5AV8A 3RELB 3X1UA 1P3LA 2LY8A 4QLCD 2BYMA 1ID3C 3MGRB 3VH6A 5GT0B 1TZYA 3B0DC 5B32C 5B0YB 1P3IC 1KX5D 3O62C 5B24B 5AV5A 1F66A 5G49A 3UTBA 1F1EA 5JA4A 3MGSC 3WA9A 2NQBC 5BO0B 5GT3A 3UT9B 5B2JD 3MGPB 4Z5TB 5B0ZC 4J8UA 3REJB 3MGQD 5B1MA 4Z2MG 4YM6B 1P34C 3AV2D 1P3FB 5CPID 2PYOC 1M19D 1ZLAA 1P3GC 4KGCD 3LZ1C 4Z66C 3AZIB 1P3KD 3KWQA 3AZEC 3B6FB 5C3IC 5F99D 1BH9A 4CAYB 3AFAD 4KUDD 3AZFB 3REHD 3AZJA 3KXBD 3X1SD 3AZMB 5AV6D 4ZBJC 4QLCB 3LZ0A 2HUEC 4YS3D 5B2ID 3AZNB 3AYWC 1KX5B 4H9RB 5GSUA 5B31D 4X23D 3LJAA 1A7WA 2CV5D 3W96D 5B2JB 2RVQD 1M1AA 3W99A 3W98A 3X1VC 4G91C 3WKJD 2NZDA 3MGQB 1P3OD 3WTPC 5BS7C 2F8ND 3AV2B 4XUJA 5CPIB 1M19B 5B31G 3AV1D 4KGCB 5AVCC 5B40C 5DNNA 5AV8C 5B0YA 3X1UC 3KUYB 1P3KB 1P3LC 4LD9A 5B24A 4R8PD 5F99B 4KUDB 3REHB 3VH5T 2AROA 3KXBB 5BO0A 3UT9A 3X1SB 3B6GD 1TZYC 2F8NG 5AV6B 1F66C 3REKD 4YS3B 3UTBC 4H9SA 1BH8B 5B2IB 3WA9C 1ID3A 5GT3C 5B31B 4X23B 5B1MC 3AZIA 5AV9D 5BNXB 1KX4A 5CP6A 2NQBA 2CV5B 3W96B 1TAFA 4Z2MH 1HQ3A 3WKJB 1P3OB 3KWQC 4JJND 1P34A 5E5AD 2F8NB 1HTAA 2IO5B 1P3PD 5CPJA 1KU5A 4WV4B 2PYOA 4H9PA 3AV1B 1KX3C 3AZJC 3AZNA 3WAAC 3MNND 4H9RA 5GXQA 4R8PB 4NE5A 3LELD 3AZKB 3V9RB 4WNNB 3C1CD 2YFWA 3UTAD 3MGQA 3REKB 3NQJA 4HGAB 3LJAC 4XZQD 1M1AC 3W98C 3W99C 2NZDC 4KGCA 4ZUXD 5AV9B 3AZLA 3KUYA 3RELC 1P3KA 1AOID 2F8NK 4XUJC 1U35D 4H9OA 4KUDA 2L5AA 3W97D 5BNVB 4J8VD 3VH6W 5B0YC 4JJNB 5E5AB 3A6ND 1EQZD 5B24C 1P3PB 4J8WB 5BT1D 3UT9C 5B1LD 5B33D 3MNNB 3AZHA 1S32D 3B0BA 3LELB 5AY8A 4H9SC 1WWSA 2F8NH 2HIOD 3C1BD 3TU4A 3X1TA 2CV5A 3C1CB 3UTAB 4AWLB 3AZIC 1KX4C 5DNMB 4KHAB 5CP6C 2F8NA 5JRGD 3MGSD 1HQ3C 3AV1A 3AZFC 5B0ZD 1AOIB 4WU8D 1U35B 5CPJC 3B0CT 3AZKA 3W97B 3AZNC 4J8XD 4J8VB 1P3GD 1Q9CA 3LZ1D 3A6NB 1EQZB 4Z66D 5GXQC 3MVDA 3AZED 1KX3A 5B1LB 5B33B 3WAAA
chains in the Genus database with same CATH superfamily
1Z2CB 1S32B 3MGQC 5AV9A 2HIOB 3C1BB 2G5HC 3H0LC 5CPIC 4WU9D 3AYWD 4H9QA 4KGCC 5AVBA 3AZLC 3KUYC 1P3KC 5JRGB 2JSSA 3MGSB 4J8WA 1P3PA 4KUDC 4E45A 1P3BD 3REHC 3X1VD 3MNNA 2Y2QA 3RELA 5AV6C 2Y2OA 4WU8B 3WTPD 3EPKA 3NQUB 1M18D 3MGRA 4J8XB 5GT0A 1ULYA 3C1CA 3AZHC 3LZ1B 1P3GB 5B40D 4Z66B 5AVCD 3REID 5B31C 3X1UD 5AY8C 3AFAB 1P3AD 1P3LD 5DNMA 5C3IB 3TU4C 3X1TC 2CV5C 2RVQC 3MGPA 4Z5TA 5CPKD 1TZYD 3REJA 1N1JB 2W8SA 4YM6A 5AV5D 1AOIA 2YFVB 1P3FA 4WU9B 3WA9D 2UWXA 3AYWB 3AV1C 4DRBA 3W97A 4J8UD 3H0RC 5B1MD 4G92B 4R8PC 5FUGB 3B6FA 1H3OB 4CAYA 3EG5B 3AZKC 1P3BB 3AZFA 3X1VB 1ZLAD 3AZMA 4H9NB 4QLCA 3WTPB 3MVDC 3REKC 4HGAC 1M18B 2FJ7D 2HIOA 3C1BA 4E44A 1KX5A 3REIB 3AZJD 3X1UB 1P3AB 5AV9C 3LZ0D 3B6GB 5JRGA 2BYMB 5B2JA 4NFTA 5CPKB 1P3MD 5GSUD 4DRAA 2Y2JA 5AVBC 5AV5B 5G49B 3AV2A 1P3PC 4J8WC 5CPIA 3WA9B 2Y2LA 1M19A 3W98D 1M1AD 3W99D 4J8UB 3MNNC 2NZDD 5B1MB 2Y2KA 5F99A 3AFAA 4XUJD 5KDMB 3REHA 3MGRC 3KXBA 3X1SA 5GT0C 1ZLAB 3C1CC 3AN2D 3UTAC 5AV6A 5DNND 4AWLC 4YS3A 4EO5B 4LD9D 2FJ7B 5DNMC 1BH8A 5B2IA 1BH9B 3MGPC 4WU9A 4Z5TC 3AZGD 1BFMA 2AROD 3UT9D 1B6WA 3REJC 5B31A 4X23A 4YM6C 2DF4C 3KSYA 5BNXA 3LZ0B 2BYKB 1AOIC 1P3FC 3W96A 1ID3D 4DQYB 1P3BA 3WKJA 1P3MB 5GSUB 4NE3A 3VH5W 5B32D 1P3ID 3W97C 1P3OA 3O62D 3A6NC 1EQZC 2DQNC 4XZQB 3WTPE 1KX4D 3B6FC 5CP6D 2NQBD 5BT1C 1M1AB 3W99B 4ZUXB 1HQ3D 3R45B 3AZMC 2NZDB 3REIA 4QLCC 4R8PA 1P34D 1P3AA 3VH5A 4XUJB 1JFIB 2HIOC 5B32G 2J8PA 5CPJD 3V9RA 3C1BC 2PYOD 3B6GA 3AN2B 1KX5C 4WNNA 5CPKA 5DNNB 3AZND 3REKA 4LD9B 5GXQD 5JRGC 5B2JC 3AZGB 2AROB 3AV2C 4WU8C 1ID3B 2ZY4A 1M19C 5KDMA 3B0DB 5B32B 1P3IB 4J8XC 3O62B 5BNVA 4JJNA 5E5AA 2CWEA 3AZLD 1KX4B 3KUYD 4CSRB 5CP6B 5F99C 3AFAC 2NQBB 2FJ7A 1TAFB 5B0ZB 3KXBC 1HQ3B 3X1SC 4NE6A 1P34B 4YS3C 3LELA 5B2IC 2BYKA 5CPJB 2PYOB 4H9PB 4WU9C 3UTAA 3AZHD 1P3MA 4X23C 5AV8D 3AZEB 5GXQB 4KHAA 4G92C 5AY8D 3W96C 4WJ3C 4XZQA 3X1TD 3TU4D 1P3BC 3WKJC 3VH6T 2YFWB 4ZUXA 3R45A 1P3OC 4ZBJB 3KFUG 2HUEB 1F66D 3NQJB 3UTBD 2IO5C 1U35A 2Y2GA 1B67A 5GT3D 4UUZB 1M18C 1JFIA 3AN2A 2RIQA 4J8VA 3REIC 3A6NA 1EQZA 4WZSB 3AZLB 3P5JB 1P3AC 3B6GC 4H9OB 5B1LA 5B33A 3AZKD 4G91B 2ZY3A 3AZGA 5CPKC 1S32A 3KWQD 5AV5C 3MVDD 1WWIA 3B0CW 1KX3D 5AVCB 5B40B 3WAAD 3IP4C 3AZHB 5AV8B 5B32A 4J8UC 1P3IA 1P3LB 3O62A 5AY8B 2ZY5A 3MGSA 4CSRA 3TU4B 3X1TB 1TZYB 5B0ZA 4M6BA 2XD1A 1ZLAC 4JJNC 5E5AC 1F66B 5AVBD 4WU8A 3UTBB 5JA4B 3LJAD 4EO5C 5GT3B 1R4VA 3NQUA 2FJ7C 4J8WD 3F6TA 4J8XA 1P3GA 3LZ1A 4Z66A 3RELD 3LELC 3AZEA 3LZ0C 3MGRD 5GT0D 1P3MC 5GSUC 5B0YD 3KWQB 1N1JA 1W2EA 5B24D 3MVDB 2YFVA 4XZQC 5DNMD 1KX3B 3AZJB 3WAAB 4UUZA 3AYWA 3MGPD 4Z5TD 1PZRA 4ZUXC 5CHLB 3REJD 2ZY2A 3FDDA 4YM6D 5FUGA 1U35C 1H3OA 1P3FD 2JCHA 3X1VA 3AN2C 4H9QB 2Y2MA 4J8VC 5DNNC 4H9NA 5AVBB 3AZID 3WTPA 2XD5A 5BS7A 2Y2IA 3LJAB 4LD9C 3W98B 1M18A 3B6FD 5B1LC 5B33C 3AZGC 3AZFD 2AROC 5B40A 5AVCA 3AZMD 1S32C 5AV8A 3RELB 3X1UA 1P3LA 2LY8A 4QLCD 2BYMA 1ID3C 3MGRB 3VH6A 5GT0B 1TZYA 3B0DC 5B32C 5B0YB 1P3IC 1KX5D 3O62C 5B24B 5AV5A 1F66A 3AL0C 5G49A 3UTBA 1F1EA 5JA4A 3MGSC 3WA9A 2NQBC 5BO0B 5GT3A 3UT9B 5B2JD 3MGPB 4Z5TB 5B0ZC 4J8UA 3REJB 3MGQD 5B1MA 4Z2MG 4YM6B 2Y2NA 1P34C 3AV2D 2FFFB 1P3FB 5CPID 2PYOC 1M19D 2ZM5A 1P3GC 1ZLAA 4KGCD 3LZ1C 4Z66C 3AZIB 1P3KD 3KWQA 4UPKA 3AZEC 3B6FB 2Y2HA 5C3IC 5F99D 1BH9A 4CAYB 3AFAD 4KUDD 3AZFB 3REHD 3AZJA 3KXBD 3X1SD 3AZMB 5AV6D 4ZBJC 4QLCB 3LZ0A 2HUEC 4YS3D 5B2ID 3AZNB 2Y2PA 3AYWC 1KX5B 4H9RB 5GSUA 5B31D 4X23D 3EPJA 3LJAA 1A7WA 2CV5D 3W96D 3H0MC 2RVQD 5B2JB 1M1AA 3W99A 3W98A 3X1VC 4G91C 3WKJD 2NZDA 3MGQB 1P3OD 3WTPC 5BS7C 2F8ND 3AV2B 4XUJA 5CPIB 1M19B 5B31G 3AV1D 4KGCB 5AVCC 5B40C 5DNNA 5AV8C 5B0YA 3X1UC 3KUYB 1P3KB 1P3LC 4LD9A 5B24A 4R8PD 5F99B 4KUDB 3REHB 3VH5T 2AROA 3KXBB 5BO0A 3UT9A 3X1SB 3B6GD 1TZYC 2F8NG 5AV6B 1F66C 3REKD 4YS3B 3UTBC 4H9SA 1BH8B 5B2IB 3WA9C 1ID3A 5GT3C 2G5IC 5B31B 5B1MC 4X23B 3AZIA 2BG1A 5AV9D 5BNXB 1KX4A 1T3UA 5CP6A 2NQBA 2CV5B 3W96B 1TAFA 4Z2MH 1HQ3A 3WKJB 1P3OB 3KWQC 4JJND 1P34A 5E5AD 2F8NB 1HTAA 2IO5B 1P3PD 5CPJA 1KU5A 4WV4B 2PYOA 4H9PA 3AV1B 1KX3C 3AZJC 3AZNA 3WAAC 3MNND 4H9RA 5GXQA 4R8PB 4NE5A 3LELD 3AZKB 3V9RB 4WNNB 3C1CD 2YFWA 3UTAD 3MGQA 3REKB 3NQJA 4HGAB 3LJAC 3EPHA 4XZQD 1M1AC 3W98C 3W99C 3A1KA 2NZDC 4KGCA 4ZUXD 5AV9B 3AZLA 3KUYA 3RELC 1P3KA 1AOID 2F8NK 4XUJC 1U35D 4H9OA 4KUDA 2L5AA 3W97D 5BNVB 4J8VD 3VH6W 5B0YC 4JJNB 5E5AB 3A6ND 1EQZD 5B24C 1P3PB 4J8WB 5BT1D 3UT9C 5B1LD 5B33D 3MNNB 3AZHA 2F2AC 1S32D 3B0BA 3LELB 5AY8A 4H9SC 1WWSA 2F8NH 2HIOD 3C1BD 3TU4A 3X1TA 2CV5A 3A1IA 3C1CB 3UTAB 4AWLB 2VQRA 3AZIC 1KX4C 5DNMB 4KHAB 2JE5A 5CP6C 2F8NA 5JRGD 3MGSD 1HQ3C 3AV1A 3AZFC 5B0ZD 1AOIB 4WU8D 1U35B 5CPJC 3B0CT 3AZKA 3W97B 3AZNC 4J8XD 4J8VB 1P3GD 1Q9CA 3LZ1D 3A6NB 1EQZB 4Z66D 5GXQC 3MVDA 3AZED 1KX3A 5B1LB 5B33B 3WAAA 3EPLA
chains in the Genus database with same CATH topology
1Z2CB 1S32B 3MGQC 5AV9A 2HIOB 3C1BB 2G5HC 3H0LC 5CPIC 4WU9D 3AYWD 4H9QA 4KGCC 5AVBA 3AZLC 3KUYC 1P3KC 5JRGB 2JSSA 3MGSB 4J8WA 1P3PA 4KUDC 4E45A 1P3BD 3REHC 3X1VD 3MNNA 2Y2QA 3RELA 5AV6C 2Y2OA 4WU8B 3WTPD 3EPKA 3NQUB 1M18D 3MGRA 4J8XB 5GT0A 1ULYA 3C1CA 3AZHC 3LZ1B 1P3GB 5B40D 4Z66B 5AVCD 3REID 5B31C 3X1UD 5AY8C 3AFAB 1P3AD 1P3LD 5DNMA 5C3IB 3TU4C 3X1TC 2CV5C 2RVQC 3MGPA 4Z5TA 5CPKD 1TZYD 3REJA 1N1JB 2W8SA 4YM6A 5AV5D 1AOIA 2YFVB 1P3FA 4WU9B 3WA9D 2UWXA 3AYWB 3AV1C 4DRBA 3W97A 4J8UD 3H0RC 5B1MD 4G92B 4R8PC 5FUGB 3B6FA 1H3OB 4CAYA 3EG5B 3AZKC 1P3BB 3AZFA 3X1VB 1ZLAD 3AZMA 4H9NB 4QLCA 3WTPB 3MVDC 3REKC 4HGAC 1M18B 2FJ7D 2HIOA 3C1BA 4E44A 1KX5A 3REIB 3AZJD 3X1UB 1P3AB 5AV9C 3LZ0D 3B6GB 5JRGA 2BYMB 5B2JA 4NFTA 5CPKB 1P3MD 5GSUD 4DRAA 2Y2JA 5AVBC 5AV5B 5G49B 3AV2A 1P3PC 4J8WC 5CPIA 3WA9B 2Y2LA 1M19A 3W98D 1M1AD 3W99D 4J8UB 3MNNC 2NZDD 5B1MB 2Y2KA 5F99A 3AFAA 4XUJD 5KDMB 3REHA 3MGRC 3KXBA 3X1SA 5GT0C 1ZLAB 3C1CC 3AN2D 3UTAC 5AV6A 5DNND 4AWLC 4YS3A 4EO5B 4LD9D 2FJ7B 5DNMC 1BH8A 5B2IA 1BH9B 3MGPC 4WU9A 4Z5TC 3AZGD 1BFMA 2AROD 3UT9D 1B6WA 3REJC 5B31A 4X23A 4YM6C 2DF4C 3KSYA 5BNXA 3LZ0B 2BYKB 1AOIC 1P3FC 3W96A 1ID3D 4DQYB 1P3BA 3WKJA 1P3MB 5GSUB 4NE3A 3VH5W 5B32D 1P3ID 3W97C 1P3OA 3O62D 3A6NC 1EQZC 2DQNC 4XZQB 3WTPE 1KX4D 3B6FC 5CP6D 2NQBD 5BT1C 1M1AB 3W99B 4ZUXB 1HQ3D 3R45B 3AZMC 2NZDB 3REIA 4QLCC 4R8PA 1P34D 1P3AA 3VH5A 4XUJB 1JFIB 2HIOC 5B32G 2J8PA 5CPJD 3V9RA 3C1BC 2PYOD 3B6GA 3AN2B 1KX5C 4WNNA 5CPKA 5DNNB 3AZND 3REKA 4LD9B 5GXQD 5JRGC 5B2JC 3AZGB 2AROB 3AV2C 4WU8C 1ID3B 2ZY4A 1M19C 5KDMA 3B0DB 5B32B 1P3IB 4J8XC 3O62B 5BNVA 4JJNA 5E5AA 2CWEA 3AZLD 1KX4B 3KUYD 4CSRB 5CP6B 5F99C 3AFAC 2NQBB 2FJ7A 1TAFB 5B0ZB 3KXBC 1HQ3B 3X1SC 4NE6A 1P34B 4YS3C 3LELA 5B2IC 2BYKA 5CPJB 2PYOB 4H9PB 4WU9C 3UTAA 3AZHD 1P3MA 4X23C 5AV8D 3AZEB 5GXQB 4KHAA 4G92C 5AY8D 3W96C 4WJ3C 4XZQA 3X1TD 3TU4D 1P3BC 3WKJC 3VH6T 2YFWB 4ZUXA 3R45A 1P3OC 4ZBJB 3KFUG 2HUEB 1F66D 3NQJB 3UTBD 2IO5C 1U35A 2Y2GA 1B67A 5GT3D 4UUZB 1M18C 1JFIA 3AN2A 2RIQA 4J8VA 3REIC 3A6NA 1EQZA 4WZSB 3AZLB 3P5JB 1P3AC 3B6GC 4H9OB 5B1LA 5B33A 3AZKD 4G91B 2ZY3A 3AZGA 5CPKC 1S32A 3KWQD 5AV5C 3MVDD 1WWIA 3B0CW 1KX3D 5AVCB 5B40B 3WAAD 3IP4C 3AZHB 5AV8B 5B32A 4J8UC 1P3IA 1P3LB 3O62A 5AY8B 2ZY5A 3MGSA 4CSRA 3TU4B 3X1TB 1TZYB 5B0ZA 4M6BA 2XD1A 1ZLAC 4JJNC 5E5AC 1F66B 5AVBD 4WU8A 3UTBB 5JA4B 3LJAD 4EO5C 5GT3B 1R4VA 3NQUA 2FJ7C 4J8WD 3F6TA 4J8XA 1P3GA 3LZ1A 4Z66A 3RELD 3LELC 3AZEA 3LZ0C 3MGRD 5GT0D 1P3MC 5GSUC 5B0YD 3KWQB 1N1JA 1W2EA 5B24D 3MVDB 2YFVA 4XZQC 5DNMD 1KX3B 3AZJB 3WAAB 4UUZA 3AYWA 3MGPD 4Z5TD 1PZRA 4ZUXC 5CHLB 3REJD 2ZY2A 3FDDA 4YM6D 5FUGA 1U35C 1H3OA 1P3FD 2JCHA 3X1VA 3AN2C 4H9QB 2Y2MA 4J8VC 5DNNC 4H9NA 5AVBB 3AZID 3WTPA 2XD5A 5BS7A 2Y2IA 3LJAB 4LD9C 3W98B 1M18A 3B6FD 5B1LC 5B33C 3AZGC 3AZFD 2AROC 5B40A 5AVCA 3AZMD 1S32C 5AV8A 3RELB 3X1UA 1P3LA 2LY8A 4QLCD 2BYMA 1ID3C 3MGRB 3VH6A 5GT0B 1TZYA 3B0DC 5B32C 5B0YB 1P3IC 1KX5D 3O62C 5B24B 5AV5A 1F66A 3AL0C 5G49A 3UTBA 1F1EA 5JA4A 3MGSC 3WA9A 2NQBC 5BO0B 5GT3A 3UT9B 5B2JD 3MGPB 4Z5TB 5B0ZC 4J8UA 3REJB 3MGQD 5B1MA 4Z2MG 4YM6B 2Y2NA 1P34C 3AV2D 2FFFB 1P3FB 5CPID 2PYOC 1M19D 2ZM5A 1P3GC 1ZLAA 4KGCD 3LZ1C 4Z66C 3AZIB 1P3KD 3KWQA 4UPKA 3AZEC 3B6FB 2Y2HA 5C3IC 5F99D 1BH9A 4CAYB 3AFAD 4KUDD 3AZFB 3REHD 3AZJA 3KXBD 3X1SD 3AZMB 5AV6D 4ZBJC 4QLCB 3LZ0A 2HUEC 4YS3D 5B2ID 3AZNB 2Y2PA 3AYWC 1KX5B 4H9RB 5GSUA 5B31D 4X23D 3EPJA 3LJAA 1A7WA 2CV5D 3W96D 3H0MC 2RVQD 5B2JB 1M1AA 3W99A 3W98A 3X1VC 4G91C 3WKJD 2NZDA 3MGQB 1P3OD 3WTPC 5BS7C 2F8ND 3AV2B 4XUJA 5CPIB 1M19B 5B31G 3AV1D 4KGCB 5AVCC 5B40C 5DNNA 5AV8C 5B0YA 3X1UC 3KUYB 1P3KB 1P3LC 4LD9A 5B24A 4R8PD 5F99B 4KUDB 3REHB 3VH5T 2AROA 3KXBB 5BO0A 3UT9A 3X1SB 3B6GD 1TZYC 2F8NG 5AV6B 1F66C 3REKD 4YS3B 3UTBC 4H9SA 1BH8B 5B2IB 3WA9C 1ID3A 5GT3C 2G5IC 5B31B 5B1MC 4X23B 3AZIA 2BG1A 5AV9D 5BNXB 1KX4A 1T3UA 5CP6A 2NQBA 2CV5B 3W96B 1TAFA 4Z2MH 1HQ3A 3WKJB 1P3OB 3KWQC 4JJND 1P34A 5E5AD 2F8NB 1HTAA 2IO5B 1P3PD 5CPJA 1KU5A 4WV4B 2PYOA 4H9PA 3AV1B 1KX3C 3AZJC 3AZNA 3WAAC 3MNND 4H9RA 5GXQA 4R8PB 4NE5A 3LELD 3AZKB 3V9RB 4WNNB 3C1CD 2YFWA 3UTAD 3MGQA 3REKB 3NQJA 4HGAB 3LJAC 3EPHA 4XZQD 1M1AC 3W98C 3W99C 3A1KA 2NZDC 4KGCA 4ZUXD 5AV9B 3AZLA 3KUYA 3RELC 1P3KA 1AOID 2F8NK 4XUJC 1U35D 4H9OA 4KUDA 2L5AA 3W97D 5BNVB 4J8VD 3VH6W 5B0YC 4JJNB 5E5AB 3A6ND 1EQZD 5B24C 1P3PB 4J8WB 5BT1D 3UT9C 5B1LD 5B33D 3MNNB 3AZHA 2F2AC 1S32D 3B0BA 3LELB 5AY8A 4H9SC 1WWSA 2F8NH 2HIOD 3C1BD 3TU4A 3X1TA 2CV5A 3A1IA 3C1CB 3UTAB 4AWLB 2VQRA 3AZIC 1KX4C 5DNMB 4KHAB 2JE5A 5CP6C 2F8NA 5JRGD 3MGSD 1HQ3C 3AV1A 3AZFC 5B0ZD 1AOIB 4WU8D 1U35B 5CPJC 3B0CT 3AZKA 3W97B 3AZNC 4J8XD 4J8VB 1P3GD 1Q9CA 3LZ1D 3A6NB 1EQZB 4Z66D 5GXQC 3MVDA 3AZED 1KX3A 5B1LB 5B33B 3WAAA 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 B;  3MGQ C;  5AV9 A;  2HIO B;  3C1B B;  5CPI C;  4WU9 D;  3AYW D;  4H9Q A;  4KGC C;  5AVB A;  3AZL C;  3KUY C;  1P3K C;  5JRG B;  2JSS A;  3MGS B;  4J8W A;  1P3P A;  4KUD C;  4E45 A;  1P3B D;  3REH C;  3X1V D;  3MNN A;  3REL A;  5AV6 C;  4WU8 B;  3WTP D;  3NQU B;  1M18 D;  3MGR A;  4J8X B;  5GT0 A;  1ULY A;  3C1C A;  3AZH C;  3LZ1 B;  1P3G B;  5B40 D;  4Z66 B;  5AVC D;  3REI D;  5B31 C;  3X1U D;  5AY8 C;  3AFA B;  1P3A D;  1P3L D;  5DNM A;  5C3I B;  3TU4 C;  3X1T C;  2CV5 C;  2RVQ C;  3MGP A;  4Z5T A;  5CPK D;  1TZY D;  3REJ A;  1N1J B;  4YM6 A;  5AV5 D;  1AOI A;  2YFV B;  1P3F A;  4WU9 B;  3WA9 D;  3AYW B;  3AV1 C;  4DRB A;  3W97 A;  4J8U D;  5B1M D;  4G92 B;  4R8P C;  5FUG B;  3B6F A;  1H3O B;  4CAY A;  3AZK C;  1P3B B;  3AZF A;  3X1V B;  1ZLA D;  3AZM A;  4H9N B;  4QLC A;  3WTP B;  3MVD C;  3REK C;  4HGA C;  1M18 B;  2FJ7 D;  2HIO A;  3C1B A;  4E44 A;  1KX5 A;  3REI B;  3AZJ D;  3X1U B;  1P3A B;  5AV9 C;  3LZ0 D;  3B6G B;  5JRG A;  2BYM B;  5B2J A;  4NFT A;  5CPK B;  1P3M D;  5GSU D;  4DRA A;  5AVB C;  5AV5 B;  5G49 B;  3AV2 A;  1P3P C;  4J8W C;  5CPI A;  3WA9 B;  1M19 A;  3W98 D;  1M1A D;  3W99 D;  4J8U B;  3MNN C;  2NZD D;  5B1M B;  5F99 A;  3AFA A;  4XUJ D;  5KDM B;  3REH A;  3MGR C;  3KXB A;  3X1S A;  5GT0 C;  1ZLA B;  3C1C C;  3AN2 D;  3UTA C;  5AV6 A;  5DNN D;  4AWL C;  4YS3 A;  4EO5 B;  4LD9 D;  2FJ7 B;  5DNM C;  1BH8 A;  5B2I A;  1BH9 B;  3MGP C;  4WU9 A;  4Z5T C;  3AZG D;  1BFM A;  2ARO D;  3UT9 D;  1B6W A;  3REJ C;  5B31 A;  4X23 A;  4YM6 C;  3KSY A;  5BNX A;  3LZ0 B;  1AOI C;  2BYK B;  1P3F C;  3W96 A;  1ID3 D;  1P3B A;  3WKJ A;  1P3M B;  5GSU B;  4NE3 A;  3VH5 W;  5B32 D;  1P3I D;  3W97 C;  1P3O A;  3O62 D;  3A6N C;  1EQZ C;  4XZQ B;  3WTP E;  1KX4 D;  3B6F C;  5CP6 D;  2NQB D;  5BT1 C;  1M1A B;  3W99 B;  4ZUX B;  1HQ3 D;  3R45 B;  3AZM C;  2NZD B;  3REI A;  4QLC C;  4R8P A;  1P34 D;  1P3A A;  3VH5 A;  4XUJ B;  1JFI B;  2HIO C;  5B32 G;  5CPJ D;  3C1B C;  3V9R A;  2PYO D;  3B6G A;  3AN2 B;  1KX5 C;  4WNN A;  5CPK A;  5DNN B;  3AZN D;  3REK A;  4LD9 B;  5GXQ D;  5JRG C;  5B2J C;  3AZG B;  2ARO B;  3AV2 C;  4WU8 C;  1ID3 B;  1M19 C;  5KDM A;  3B0D B;  5B32 B;  1P3I B;  4J8X C;  3O62 B;  5BNV A;  4JJN A;  5E5A A;  2CWE A;  3AZL D;  1KX4 B;  3KUY D;  4CSR B;  5CP6 B;  5F99 C;  3AFA C;  2NQB B;  2FJ7 A;  1TAF B;  5B0Z B;  3KXB C;  1HQ3 B;  3X1S C;  4NE6 A;  1P34 B;  4YS3 C;  3LEL A;  5B2I C;  2BYK A;  5CPJ B;  2PYO B;  4H9P B;  4WU9 C;  3UTA A;  3AZH D;  1P3M A;  4X23 C;  5AV8 D;  3AZE B;  5GXQ B;  4KHA A;  4G92 C;  5AY8 D;  3W96 C;  4XZQ A;  3X1T D;  3TU4 D;  1P3B C;  3WKJ C;  3VH6 T;  2YFW B;  4ZUX A;  3R45 A;  1P3O C;  4ZBJ B;  2HUE B;  1F66 D;  3NQJ B;  3UTB D;  2IO5 C;  1U35 A;  1B67 A;  5GT3 D;  4UUZ B;  1M18 C;  1JFI A;  3AN2 A;  4J8V A;  3REI C;  3A6N A;  1EQZ A;  4WZS B;  3AZL B;  1P3A C;  3B6G C;  4H9O B;  5B1L A;  5B33 A;  3AZK D;  4G91 B;  5CPK C;  3AZG A;  1S32 A;  3KWQ D;  5AV5 C;  3MVD D;  1WWI A;  3B0C W;  1KX3 D;  5AVC B;  5B40 B;  3WAA D;  3AZH B;  5AV8 B;  5B32 A;  4J8U C;  1P3I A;  1P3L B;  3O62 A;  5AY8 B;  3MGS A;  4CSR A;  3TU4 B;  3X1T B;  1TZY B;  5B0Z A;  4M6B A;  1ZLA C;  4JJN C;  5E5A C;  1F66 B;  5AVB D;  4WU8 A;  3UTB B;  5JA4 B;  3LJA D;  4EO5 C;  5GT3 B;  1R4V A;  3NQU A;  2FJ7 C;  4J8W D;  4J8X A;  1P3G A;  3LZ1 A;  4Z66 A;  3REL D;  3LEL C;  3AZE A;  3LZ0 C;  3MGR D;  5GT0 D;  1P3M C;  5GSU C;  5B0Y D;  3KWQ B;  1N1J A;  5B24 D;  3MVD B;  2YFV A;  4XZQ C;  5DNM D;  1KX3 B;  3AZJ B;  3WAA B;  4UUZ A;  3AYW A;  3MGP D;  4Z5T D;  4ZUX C;  5CHL B;  3REJ D;  4YM6 D;  5FUG A;  1U35 C;  1H3O A;  1P3F D;  3X1V A;  3AN2 C;  4H9Q B;  4J8V C;  5DNN C;  4H9N A;  5AVB B;  3AZI D;  3WTP A;  5BS7 A;  3LJA B;  4LD9 C;  3W98 B;  1M18 A;  3B6F D;  5B1L C;  5B33 C;  3AZG C;  3AZF D;  2ARO C;  5B40 A;  5AVC A;  3AZM D;  1S32 C;  5AV8 A;  3REL B;  3X1U A;  1P3L A;  2LY8 A;  4QLC D;  2BYM A;  1ID3 C;  3MGR B;  3VH6 A;  5GT0 B;  1TZY A;  3B0D C;  5B32 C;  5B0Y B;  1P3I C;  1KX5 D;  3O62 C;  5B24 B;  5AV5 A;  1F66 A;  5G49 A;  3UTB A;  1F1E A;  5JA4 A;  3MGS C;  3WA9 A;  2NQB C;  5BO0 B;  5GT3 A;  3UT9 B;  5B2J D;  3MGP B;  4Z5T B;  5B0Z C;  4J8U A;  3REJ B;  3MGQ D;  5B1M A;  4Z2M G;  4YM6 B;  1P34 C;  3AV2 D;  1P3F B;  5CPI D;  2PYO C;  1M19 D;  1ZLA A;  1P3G C;  4KGC D;  3LZ1 C;  4Z66 C;  3AZI B;  1P3K D;  3KWQ A;  3AZE C;  3B6F B;  5C3I C;  5F99 D;  1BH9 A;  4CAY B;  3AFA D;  4KUD D;  3AZF B;  3REH D;  3AZJ A;  3KXB D;  3X1S D;  3AZM B;  5AV6 D;  4ZBJ C;  4QLC B;  3LZ0 A;  2HUE C;  4YS3 D;  5B2I D;  3AZN B;  3AYW C;  1KX5 B;  4H9R B;  5GSU A;  5B31 D;  4X23 D;  3LJA A;  1A7W A;  2CV5 D;  3W96 D;  5B2J B;  2RVQ D;  1M1A A;  3W99 A;  3W98 A;  3X1V C;  4G91 C;  3WKJ D;  2NZD A;  3MGQ B;  1P3O D;  3WTP C;  5BS7 C;  2F8N D;  3AV2 B;  4XUJ A;  5CPI B;  1M19 B;  5B31 G;  3AV1 D;  4KGC B;  5AVC C;  5B40 C;  5DNN A;  5AV8 C;  5B0Y A;  3X1U C;  3KUY B;  1P3K B;  1P3L C;  4LD9 A;  5B24 A;  4R8P D;  5F99 B;  4KUD B;  3REH B;  3VH5 T;  2ARO A;  3KXB B;  5BO0 A;  3UT9 A;  3X1S B;  3B6G D;  1TZY C;  2F8N G;  5AV6 B;  1F66 C;  3REK D;  4YS3 B;  3UTB C;  4H9S A;  1BH8 B;  5B2I B;  3WA9 C;  1ID3 A;  5GT3 C;  5B31 B;  4X23 B;  5B1M C;  3AZI A;  5AV9 D;  5BNX B;  1KX4 A;  5CP6 A;  2NQB A;  2CV5 B;  3W96 B;  1TAF A;  4Z2M H;  1HQ3 A;  3WKJ B;  1P3O B;  3KWQ C;  4JJN D;  1P34 A;  5E5A D;  2F8N B;  1HTA A;  2IO5 B;  1P3P D;  5CPJ A;  1KU5 A;  4WV4 B;  2PYO A;  4H9P A;  3AV1 B;  1KX3 C;  3AZJ C;  3AZN A;  3WAA C;  3MNN D;  4H9R A;  5GXQ A;  4R8P B;  4NE5 A;  3LEL D;  3AZK B;  3V9R B;  4WNN B;  3C1C D;  2YFW A;  3UTA D;  3MGQ A;  3REK B;  3NQJ A;  4HGA B;  3LJA C;  4XZQ D;  1M1A C;  3W98 C;  3W99 C;  2NZD C;  4KGC A;  4ZUX D;  5AV9 B;  3AZL A;  3KUY A;  3REL C;  1P3K A;  1AOI D;  2F8N K;  4XUJ C;  1U35 D;  4H9O A;  4KUD A;  2L5A A;  3W97 D;  5BNV B;  4J8V D;  3VH6 W;  5B0Y C;  4JJN B;  5E5A B;  3A6N D;  1EQZ D;  5B24 C;  1P3P B;  4J8W B;  5BT1 D;  3UT9 C;  5B1L D;  5B33 D;  3MNN B;  3AZH A;  1S32 D;  3B0B A;  3LEL B;  5AY8 A;  4H9S C;  1WWS A;  2F8N H;  2HIO D;  3C1B D;  3TU4 A;  3X1T A;  2CV5 A;  3C1C B;  3UTA B;  4AWL B;  3AZI C;  1KX4 C;  5DNM B;  4KHA B;  5CP6 C;  2F8N A;  5JRG D;  3MGS D;  1HQ3 C;  3AV1 A;  3AZF C;  5B0Z D;  1AOI B;  4WU8 D;  1U35 B;  5CPJ C;  3B0C T;  3AZK A;  3W97 B;  3AZN C;  4J8X D;  4J8V B;  1P3G D;  1Q9C A;  3LZ1 D;  3A6N B;  1EQZ B;  4Z66 D;  5GXQ C;  3MVD A;  3AZE D;  1KX3 A;  5B1L B;  5B33 B;  3WAA A; 
#chains in the Genus database with same CATH topology
 1Z2C B;  1S32 B;  3MGQ C;  5AV9 A;  2HIO B;  3C1B B;  2G5H C;  3H0L C;  5CPI C;  4WU9 D;  3AYW D;  4H9Q A;  4KGC C;  5AVB A;  3AZL C;  3KUY C;  1P3K C;  5JRG B;  2JSS A;  3MGS B;  4J8W A;  1P3P A;  4KUD C;  4E45 A;  1P3B D;  3REH C;  3X1V D;  3MNN A;  2Y2Q A;  3REL A;  5AV6 C;  2Y2O A;  4WU8 B;  3WTP D;  3EPK A;  3NQU B;  1M18 D;  3MGR A;  4J8X B;  5GT0 A;  1ULY A;  3C1C A;  3AZH C;  3LZ1 B;  1P3G B;  5B40 D;  4Z66 B;  5AVC D;  3REI D;  5B31 C;  3X1U D;  5AY8 C;  3AFA B;  1P3A D;  1P3L D;  5DNM A;  5C3I B;  3TU4 C;  3X1T C;  2CV5 C;  2RVQ C;  3MGP A;  4Z5T A;  5CPK D;  1TZY D;  3REJ A;  1N1J B;  2W8S A;  4YM6 A;  5AV5 D;  1AOI A;  2YFV B;  1P3F A;  4WU9 B;  3WA9 D;  2UWX A;  3AYW B;  3AV1 C;  4DRB A;  3W97 A;  4J8U D;  3H0R C;  5B1M D;  4G92 B;  4R8P C;  5FUG B;  3B6F A;  1H3O B;  4CAY A;  3EG5 B;  3AZK C;  1P3B B;  3AZF A;  3X1V B;  1ZLA D;  3AZM A;  4H9N B;  4QLC A;  3WTP B;  3MVD C;  3REK C;  4HGA C;  1M18 B;  2FJ7 D;  2HIO A;  3C1B A;  4E44 A;  1KX5 A;  3REI B;  3AZJ D;  3X1U B;  1P3A B;  5AV9 C;  3LZ0 D;  3B6G B;  5JRG A;  2BYM B;  5B2J A;  4NFT A;  5CPK B;  1P3M D;  5GSU D;  4DRA A;  2Y2J A;  5AVB C;  5AV5 B;  5G49 B;  3AV2 A;  1P3P C;  4J8W C;  5CPI A;  3WA9 B;  2Y2L A;  1M19 A;  3W98 D;  1M1A D;  3W99 D;  4J8U B;  3MNN C;  2NZD D;  5B1M B;  2Y2K A;  5F99 A;  3AFA A;  4XUJ D;  5KDM B;  3REH A;  3MGR C;  3KXB A;  3X1S A;  5GT0 C;  1ZLA B;  3C1C C;  3AN2 D;  3UTA C;  5AV6 A;  5DNN D;  4AWL C;  4YS3 A;  4EO5 B;  4LD9 D;  2FJ7 B;  5DNM C;  1BH8 A;  5B2I A;  1BH9 B;  3MGP C;  4WU9 A;  4Z5T C;  3AZG D;  1BFM A;  2ARO D;  3UT9 D;  1B6W A;  3REJ C;  5B31 A;  4X23 A;  4YM6 C;  2DF4 C;  3KSY A;  5BNX A;  3LZ0 B;  2BYK B;  1AOI C;  1P3F C;  3W96 A;  1ID3 D;  4DQY B;  1P3B A;  3WKJ A;  1P3M B;  5GSU B;  4NE3 A;  3VH5 W;  5B32 D;  1P3I D;  3W97 C;  1P3O A;  3O62 D;  3A6N C;  1EQZ C;  2DQN C;  4XZQ B;  3WTP E;  1KX4 D;  3B6F C;  5CP6 D;  2NQB D;  5BT1 C;  1M1A B;  3W99 B;  4ZUX B;  1HQ3 D;  3R45 B;  3AZM C;  2NZD B;  3REI A;  4QLC C;  4R8P A;  1P34 D;  1P3A A;  3VH5 A;  4XUJ B;  1JFI B;  2HIO C;  5B32 G;  2J8P A;  5CPJ D;  3V9R A;  3C1B C;  2PYO D;  3B6G A;  3AN2 B;  1KX5 C;  4WNN A;  5CPK A;  5DNN B;  3AZN D;  3REK A;  4LD9 B;  5GXQ D;  5JRG C;  5B2J C;  3AZG B;  2ARO B;  3AV2 C;  4WU8 C;  1ID3 B;  2ZY4 A;  1M19 C;  5KDM A;  3B0D B;  5B32 B;  1P3I B;  4J8X C;  3O62 B;  5BNV A;  4JJN A;  5E5A A;  2CWE A;  3AZL D;  1KX4 B;  3KUY D;  4CSR B;  5CP6 B;  5F99 C;  3AFA C;  2NQB B;  2FJ7 A;  1TAF B;  5B0Z B;  3KXB C;  1HQ3 B;  3X1S C;  4NE6 A;  1P34 B;  4YS3 C;  3LEL A;  5B2I C;  2BYK A;  5CPJ B;  2PYO B;  4H9P B;  4WU9 C;  3UTA A;  3AZH D;  1P3M A;  4X23 C;  5AV8 D;  3AZE B;  5GXQ B;  4KHA A;  4G92 C;  5AY8 D;  3W96 C;  4WJ3 C;  4XZQ A;  3X1T D;  3TU4 D;  1P3B C;  3WKJ C;  3VH6 T;  2YFW B;  4ZUX A;  3R45 A;  1P3O C;  4ZBJ B;  3KFU G;  2HUE B;  1F66 D;  3NQJ B;  3UTB D;  2IO5 C;  1U35 A;  2Y2G A;  1B67 A;  5GT3 D;  4UUZ B;  1M18 C;  1JFI A;  3AN2 A;  2RIQ A;  4J8V A;  3REI C;  3A6N A;  1EQZ A;  4WZS B;  3AZL B;  3P5J B;  1P3A C;  3B6G C;  4H9O B;  5B1L A;  5B33 A;  3AZK D;  4G91 B;  2ZY3 A;  3AZG A;  5CPK C;  1S32 A;  3KWQ D;  5AV5 C;  3MVD D;  1WWI A;  3B0C W;  1KX3 D;  5AVC B;  5B40 B;  3WAA D;  3IP4 C;  3AZH B;  5AV8 B;  5B32 A;  4J8U C;  1P3I A;  1P3L B;  3O62 A;  5AY8 B;  2ZY5 A;  3MGS A;  4CSR A;  3TU4 B;  3X1T B;  1TZY B;  5B0Z A;  4M6B A;  2XD1 A;  1ZLA C;  4JJN C;  5E5A C;  1F66 B;  5AVB D;  4WU8 A;  3UTB B;  5JA4 B;  3LJA D;  4EO5 C;  5GT3 B;  1R4V A;  3NQU A;  2FJ7 C;  4J8W D;  3F6T A;  4J8X A;  1P3G A;  3LZ1 A;  4Z66 A;  3REL D;  3LEL C;  3AZE A;  3LZ0 C;  3MGR D;  5GT0 D;  1P3M C;  5GSU C;  5B0Y D;  3KWQ B;  1N1J A;  1W2E A;  5B24 D;  3MVD B;  2YFV A;  4XZQ C;  5DNM D;  1KX3 B;  3AZJ B;  3WAA B;  4UUZ A;  3AYW A;  3MGP D;  4Z5T D;  1PZR A;  4ZUX C;  5CHL B;  3REJ D;  2ZY2 A;  3FDD A;  4YM6 D;  5FUG A;  1U35 C;  1H3O A;  1P3F D;  2JCH A;  3X1V A;  3AN2 C;  4H9Q B;  2Y2M A;  4J8V C;  5DNN C;  4H9N A;  5AVB B;  3AZI D;  3WTP A;  2XD5 A;  5BS7 A;  2Y2I A;  3LJA B;  4LD9 C;  3W98 B;  1M18 A;  3B6F D;  5B1L C;  5B33 C;  3AZG C;  3AZF D;  2ARO C;  5B40 A;  5AVC A;  3AZM D;  1S32 C;  5AV8 A;  3REL B;  3X1U A;  1P3L A;  2LY8 A;  4QLC D;  2BYM A;  1ID3 C;  3MGR B;  3VH6 A;  5GT0 B;  1TZY A;  3B0D C;  5B32 C;  5B0Y B;  1P3I C;  1KX5 D;  3O62 C;  5B24 B;  5AV5 A;  1F66 A;  3AL0 C;  5G49 A;  3UTB A;  1F1E A;  5JA4 A;  3MGS C;  3WA9 A;  2NQB C;  5BO0 B;  5GT3 A;  3UT9 B;  5B2J D;  3MGP B;  4Z5T B;  5B0Z C;  4J8U A;  3REJ B;  3MGQ D;  5B1M A;  4Z2M G;  4YM6 B;  2Y2N A;  1P34 C;  3AV2 D;  2FFF B;  1P3F B;  5CPI D;  2PYO C;  1M19 D;  2ZM5 A;  1P3G C;  1ZLA A;  4KGC D;  3LZ1 C;  4Z66 C;  3AZI B;  1P3K D;  3KWQ A;  4UPK A;  3AZE C;  3B6F B;  2Y2H A;  5C3I C;  5F99 D;  1BH9 A;  4CAY B;  3AFA D;  4KUD D;  3AZF B;  3REH D;  3AZJ A;  3KXB D;  3X1S D;  3AZM B;  5AV6 D;  4ZBJ C;  4QLC B;  3LZ0 A;  2HUE C;  4YS3 D;  5B2I D;  3AZN B;  2Y2P A;  3AYW C;  1KX5 B;  4H9R B;  5GSU A;  5B31 D;  4X23 D;  3EPJ A;  3LJA A;  1A7W A;  2CV5 D;  3W96 D;  3H0M C;  2RVQ D;  5B2J B;  1M1A A;  3W99 A;  3W98 A;  3X1V C;  4G91 C;  3WKJ D;  2NZD A;  3MGQ B;  1P3O D;  3WTP C;  5BS7 C;  2F8N D;  3AV2 B;  4XUJ A;  5CPI B;  1M19 B;  5B31 G;  3AV1 D;  4KGC B;  5AVC C;  5B40 C;  5DNN A;  5AV8 C;  5B0Y A;  3X1U C;  3KUY B;  1P3K B;  1P3L C;  4LD9 A;  5B24 A;  4R8P D;  5F99 B;  4KUD B;  3REH B;  3VH5 T;  2ARO A;  3KXB B;  5BO0 A;  3UT9 A;  3X1S B;  3B6G D;  1TZY C;  2F8N G;  5AV6 B;  1F66 C;  3REK D;  4YS3 B;  3UTB C;  4H9S A;  1BH8 B;  5B2I B;  3WA9 C;  1ID3 A;  5GT3 C;  2G5I C;  5B31 B;  5B1M C;  4X23 B;  3AZI A;  2BG1 A;  5AV9 D;  5BNX B;  1KX4 A;  1T3U A;  5CP6 A;  2NQB A;  2CV5 B;  3W96 B;  1TAF A;  4Z2M H;  1HQ3 A;  3WKJ B;  1P3O B;  3KWQ C;  4JJN D;  1P34 A;  5E5A D;  2F8N B;  1HTA A;  2IO5 B;  1P3P D;  5CPJ A;  1KU5 A;  4WV4 B;  2PYO A;  4H9P A;  3AV1 B;  1KX3 C;  3AZJ C;  3AZN A;  3WAA C;  3MNN D;  4H9R A;  5GXQ A;  4R8P B;  4NE5 A;  3LEL D;  3AZK B;  3V9R B;  4WNN B;  3C1C D;  2YFW A;  3UTA D;  3MGQ A;  3REK B;  3NQJ A;  4HGA B;  3LJA C;  3EPH A;  4XZQ D;  1M1A C;  3W98 C;  3W99 C;  3A1K A;  2NZD C;  4KGC A;  4ZUX D;  5AV9 B;  3AZL A;  3KUY A;  3REL C;  1P3K A;  1AOI D;  2F8N K;  4XUJ C;  1U35 D;  4H9O A;  4KUD A;  2L5A A;  3W97 D;  5BNV B;  4J8V D;  3VH6 W;  5B0Y C;  4JJN B;  5E5A B;  3A6N D;  1EQZ D;  5B24 C;  1P3P B;  4J8W B;  5BT1 D;  3UT9 C;  5B1L D;  5B33 D;  3MNN B;  3AZH A;  2F2A C;  1S32 D;  3B0B A;  3LEL B;  5AY8 A;  4H9S C;  1WWS A;  2F8N H;  2HIO D;  3C1B D;  3TU4 A;  3X1T A;  2CV5 A;  3A1I A;  3C1C B;  3UTA B;  4AWL B;  2VQR A;  3AZI C;  1KX4 C;  5DNM B;  4KHA B;  2JE5 A;  5CP6 C;  2F8N A;  5JRG D;  3MGS D;  1HQ3 C;  3AV1 A;  3AZF C;  5B0Z D;  1AOI B;  4WU8 D;  1U35 B;  5CPJ C;  3B0C T;  3AZK A;  3W97 B;  3AZN C;  4J8X D;  4J8V B;  1P3G D;  1Q9C A;  3LZ1 D;  3A6N B;  1EQZ B;  4Z66 D;  5GXQ C;  3MVD A;  3AZE D;  1KX3 A;  5B1L B;  5B33 B;  3WAA A;  3EPL A; 
#chains in the Genus database with same CATH homology
 1Z2C B;  1S32 B;  3MGQ C;  5AV9 A;  2HIO B;  3C1B B;  2G5H C;  3H0L C;  5CPI C;  4WU9 D;  3AYW D;  4H9Q A;  4KGC C;  5AVB A;  3AZL C;  3KUY C;  1P3K C;  5JRG B;  2JSS A;  3MGS B;  4J8W A;  1P3P A;  4KUD C;  4E45 A;  1P3B D;  3REH C;  3X1V D;  3MNN A;  2Y2Q A;  3REL A;  5AV6 C;  2Y2O A;  4WU8 B;  3WTP D;  3EPK A;  3NQU B;  1M18 D;  3MGR A;  4J8X B;  5GT0 A;  1ULY A;  3C1C A;  3AZH C;  3LZ1 B;  1P3G B;  5B40 D;  4Z66 B;  5AVC D;  3REI D;  5B31 C;  3X1U D;  5AY8 C;  3AFA B;  1P3A D;  1P3L D;  5DNM A;  5C3I B;  3TU4 C;  3X1T C;  2CV5 C;  2RVQ C;  3MGP A;  4Z5T A;  5CPK D;  1TZY D;  3REJ A;  1N1J B;  2W8S A;  4YM6 A;  5AV5 D;  1AOI A;  2YFV B;  1P3F A;  4WU9 B;  3WA9 D;  2UWX A;  3AYW B;  3AV1 C;  4DRB A;  3W97 A;  4J8U D;  3H0R C;  5B1M D;  4G92 B;  4R8P C;  5FUG B;  3B6F A;  1H3O B;  4CAY A;  3EG5 B;  3AZK C;  1P3B B;  3AZF A;  3X1V B;  1ZLA D;  3AZM A;  4H9N B;  4QLC A;  3WTP B;  3MVD C;  3REK C;  4HGA C;  1M18 B;  2FJ7 D;  2HIO A;  3C1B A;  4E44 A;  1KX5 A;  3REI B;  3AZJ D;  3X1U B;  1P3A B;  5AV9 C;  3LZ0 D;  3B6G B;  5JRG A;  2BYM B;  5B2J A;  4NFT A;  5CPK B;  1P3M D;  5GSU D;  4DRA A;  2Y2J A;  5AVB C;  5AV5 B;  5G49 B;  3AV2 A;  1P3P C;  4J8W C;  5CPI A;  3WA9 B;  2Y2L A;  1M19 A;  3W98 D;  1M1A D;  3W99 D;  4J8U B;  3MNN C;  2NZD D;  5B1M B;  2Y2K A;  5F99 A;  3AFA A;  4XUJ D;  5KDM B;  3REH A;  3MGR C;  3KXB A;  3X1S A;  5GT0 C;  1ZLA B;  3C1C C;  3AN2 D;  3UTA C;  5AV6 A;  5DNN D;  4AWL C;  4YS3 A;  4EO5 B;  4LD9 D;  2FJ7 B;  5DNM C;  1BH8 A;  5B2I A;  1BH9 B;  3MGP C;  4WU9 A;  4Z5T C;  3AZG D;  1BFM A;  2ARO D;  3UT9 D;  1B6W A;  3REJ C;  5B31 A;  4X23 A;  4YM6 C;  2DF4 C;  3KSY A;  5BNX A;  3LZ0 B;  2BYK B;  1AOI C;  1P3F C;  3W96 A;  1ID3 D;  4DQY B;  1P3B A;  3WKJ A;  1P3M B;  5GSU B;  4NE3 A;  3VH5 W;  5B32 D;  1P3I D;  3W97 C;  1P3O A;  3O62 D;  3A6N C;  1EQZ C;  2DQN C;  4XZQ B;  3WTP E;  1KX4 D;  3B6F C;  5CP6 D;  2NQB D;  5BT1 C;  1M1A B;  3W99 B;  4ZUX B;  1HQ3 D;  3R45 B;  3AZM C;  2NZD B;  3REI A;  4QLC C;  4R8P A;  1P34 D;  1P3A A;  3VH5 A;  4XUJ B;  1JFI B;  2HIO C;  5B32 G;  2J8P A;  5CPJ D;  3V9R A;  3C1B C;  2PYO D;  3B6G A;  3AN2 B;  1KX5 C;  4WNN A;  5CPK A;  5DNN B;  3AZN D;  3REK A;  4LD9 B;  5GXQ D;  5JRG C;  5B2J C;  3AZG B;  2ARO B;  3AV2 C;  4WU8 C;  1ID3 B;  2ZY4 A;  1M19 C;  5KDM A;  3B0D B;  5B32 B;  1P3I B;  4J8X C;  3O62 B;  5BNV A;  4JJN A;  5E5A A;  2CWE A;  3AZL D;  1KX4 B;  3KUY D;  4CSR B;  5CP6 B;  5F99 C;  3AFA C;  2NQB B;  2FJ7 A;  1TAF B;  5B0Z B;  3KXB C;  1HQ3 B;  3X1S C;  4NE6 A;  1P34 B;  4YS3 C;  3LEL A;  5B2I C;  2BYK A;  5CPJ B;  2PYO B;  4H9P B;  4WU9 C;  3UTA A;  3AZH D;  1P3M A;  4X23 C;  5AV8 D;  3AZE B;  5GXQ B;  4KHA A;  4G92 C;  5AY8 D;  3W96 C;  4WJ3 C;  4XZQ A;  3X1T D;  3TU4 D;  1P3B C;  3WKJ C;  3VH6 T;  2YFW B;  4ZUX A;  3R45 A;  1P3O C;  4ZBJ B;  3KFU G;  2HUE B;  1F66 D;  3NQJ B;  3UTB D;  2IO5 C;  1U35 A;  2Y2G A;  1B67 A;  5GT3 D;  4UUZ B;  1M18 C;  1JFI A;  3AN2 A;  2RIQ A;  4J8V A;  3REI C;  3A6N A;  1EQZ A;  4WZS B;  3AZL B;  3P5J B;  1P3A C;  3B6G C;  4H9O B;  5B1L A;  5B33 A;  3AZK D;  4G91 B;  2ZY3 A;  3AZG A;  5CPK C;  1S32 A;  3KWQ D;  5AV5 C;  3MVD D;  1WWI A;  3B0C W;  1KX3 D;  5AVC B;  5B40 B;  3WAA D;  3IP4 C;  3AZH B;  5AV8 B;  5B32 A;  4J8U C;  1P3I A;  1P3L B;  3O62 A;  5AY8 B;  2ZY5 A;  3MGS A;  4CSR A;  3TU4 B;  3X1T B;  1TZY B;  5B0Z A;  4M6B A;  2XD1 A;  1ZLA C;  4JJN C;  5E5A C;  1F66 B;  5AVB D;  4WU8 A;  3UTB B;  5JA4 B;  3LJA D;  4EO5 C;  5GT3 B;  1R4V A;  3NQU A;  2FJ7 C;  4J8W D;  3F6T A;  4J8X A;  1P3G A;  3LZ1 A;  4Z66 A;  3REL D;  3LEL C;  3AZE A;  3LZ0 C;  3MGR D;  5GT0 D;  1P3M C;  5GSU C;  5B0Y D;  3KWQ B;  1N1J A;  1W2E A;  5B24 D;  3MVD B;  2YFV A;  4XZQ C;  5DNM D;  1KX3 B;  3AZJ B;  3WAA B;  4UUZ A;  3AYW A;  3MGP D;  4Z5T D;  1PZR A;  4ZUX C;  5CHL B;  3REJ D;  2ZY2 A;  3FDD A;  4YM6 D;  5FUG A;  1U35 C;  1H3O A;  1P3F D;  2JCH A;  3X1V A;  3AN2 C;  4H9Q B;  2Y2M A;  4J8V C;  5DNN C;  4H9N A;  5AVB B;  3AZI D;  3WTP A;  2XD5 A;  5BS7 A;  2Y2I A;  3LJA B;  4LD9 C;  3W98 B;  1M18 A;  3B6F D;  5B1L C;  5B33 C;  3AZG C;  3AZF D;  2ARO C;  5B40 A;  5AVC A;  3AZM D;  1S32 C;  5AV8 A;  3REL B;  3X1U A;  1P3L A;  2LY8 A;  4QLC D;  2BYM A;  1ID3 C;  3MGR B;  3VH6 A;  5GT0 B;  1TZY A;  3B0D C;  5B32 C;  5B0Y B;  1P3I C;  1KX5 D;  3O62 C;  5B24 B;  5AV5 A;  1F66 A;  3AL0 C;  5G49 A;  3UTB A;  1F1E A;  5JA4 A;  3MGS C;  3WA9 A;  2NQB C;  5BO0 B;  5GT3 A;  3UT9 B;  5B2J D;  3MGP B;  4Z5T B;  5B0Z C;  4J8U A;  3REJ B;  3MGQ D;  5B1M A;  4Z2M G;  4YM6 B;  2Y2N A;  1P34 C;  3AV2 D;  2FFF B;  1P3F B;  5CPI D;  2PYO C;  1M19 D;  2ZM5 A;  1P3G C;  1ZLA A;  4KGC D;  3LZ1 C;  4Z66 C;  3AZI B;  1P3K D;  3KWQ A;  4UPK A;  3AZE C;  3B6F B;  2Y2H A;  5C3I C;  5F99 D;  1BH9 A;  4CAY B;  3AFA D;  4KUD D;  3AZF B;  3REH D;  3AZJ A;  3KXB D;  3X1S D;  3AZM B;  5AV6 D;  4ZBJ C;  4QLC B;  3LZ0 A;  2HUE C;  4YS3 D;  5B2I D;  3AZN B;  2Y2P A;  3AYW C;  1KX5 B;  4H9R B;  5GSU A;  5B31 D;  4X23 D;  3EPJ A;  3LJA A;  1A7W A;  2CV5 D;  3W96 D;  3H0M C;  2RVQ D;  5B2J B;  1M1A A;  3W99 A;  3W98 A;  3X1V C;  4G91 C;  3WKJ D;  2NZD A;  3MGQ B;  1P3O D;  3WTP C;  5BS7 C;  2F8N D;  3AV2 B;  4XUJ A;  5CPI B;  1M19 B;  5B31 G;  3AV1 D;  4KGC B;  5AVC C;  5B40 C;  5DNN A;  5AV8 C;  5B0Y A;  3X1U C;  3KUY B;  1P3K B;  1P3L C;  4LD9 A;  5B24 A;  4R8P D;  5F99 B;  4KUD B;  3REH B;  3VH5 T;  2ARO A;  3KXB B;  5BO0 A;  3UT9 A;  3X1S B;  3B6G D;  1TZY C;  2F8N G;  5AV6 B;  1F66 C;  3REK D;  4YS3 B;  3UTB C;  4H9S A;  1BH8 B;  5B2I B;  3WA9 C;  1ID3 A;  5GT3 C;  2G5I C;  5B31 B;  5B1M C;  4X23 B;  3AZI A;  2BG1 A;  5AV9 D;  5BNX B;  1KX4 A;  1T3U A;  5CP6 A;  2NQB A;  2CV5 B;  3W96 B;  1TAF A;  4Z2M H;  1HQ3 A;  3WKJ B;  1P3O B;  3KWQ C;  4JJN D;  1P34 A;  5E5A D;  2F8N B;  1HTA A;  2IO5 B;  1P3P D;  5CPJ A;  1KU5 A;  4WV4 B;  2PYO A;  4H9P A;  3AV1 B;  1KX3 C;  3AZJ C;  3AZN A;  3WAA C;  3MNN D;  4H9R A;  5GXQ A;  4R8P B;  4NE5 A;  3LEL D;  3AZK B;  3V9R B;  4WNN B;  3C1C D;  2YFW A;  3UTA D;  3MGQ A;  3REK B;  3NQJ A;  4HGA B;  3LJA C;  3EPH A;  4XZQ D;  1M1A C;  3W98 C;  3W99 C;  3A1K A;  2NZD C;  4KGC A;  4ZUX D;  5AV9 B;  3AZL A;  3KUY A;  3REL C;  1P3K A;  1AOI D;  2F8N K;  4XUJ C;  1U35 D;  4H9O A;  4KUD A;  2L5A A;  3W97 D;  5BNV B;  4J8V D;  3VH6 W;  5B0Y C;  4JJN B;  5E5A B;  3A6N D;  1EQZ D;  5B24 C;  1P3P B;  4J8W B;  5BT1 D;  3UT9 C;  5B1L D;  5B33 D;  3MNN B;  3AZH A;  2F2A C;  1S32 D;  3B0B A;  3LEL B;  5AY8 A;  4H9S C;  1WWS A;  2F8N H;  2HIO D;  3C1B D;  3TU4 A;  3X1T A;  2CV5 A;  3A1I A;  3C1C B;  3UTA B;  4AWL B;  2VQR A;  3AZI C;  1KX4 C;  5DNM B;  4KHA B;  2JE5 A;  5CP6 C;  2F8N A;  5JRG D;  3MGS D;  1HQ3 C;  3AV1 A;  3AZF C;  5B0Z D;  1AOI B;  4WU8 D;  1U35 B;  5CPJ C;  3B0C T;  3AZK A;  3W97 B;  3AZN C;  4J8X D;  4J8V B;  1P3G D;  1Q9C A;  3LZ1 D;  3A6N B;  1EQZ B;  4Z66 D;  5GXQ C;  3MVD A;  3AZE D;  1KX3 A;  5B1L B;  5B33 B;  3WAA A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...