3MVDD

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdD00
3UT9B 1P3LD 3AZJC 4YS3A 1P3AA 5CP6A 4KHAA 5JA4A 5DNMD 5B0ZB 1M18D 5CPIB 5AY8B 5F99D 1P3OA 5CPKC 5B32B 3KXBD 4QLCB 3AZGB 3AZKB 3A6NC 5B2IB 4Z5TB 5BO0A 3AN2C 3AV2D 3REKD 1P3GA 1M19D 3MGQB 3RELA 5B31A 5B1LA 4H9PB 3REIA 2NZDD 5DNNB 5AV6A 1P3MB 5AV9C 3LZ1C 3X1SC 3W99C 3LELC 4AWLC 4J8XA 2BYMA 5KDMB 3AZLC 2NQBA 5GT0D 1P3IB 2AROD 3AZFA 4G92B 4ZBJC 1P3LC 5AV5B 4WNNB 3MNNA 4J8WA 3W98A 5C3IC 3AZHB 5AV8D 5F99C 3B6GA 4X23C 3AZMD 4R8PD 4JJNB 2HUEB 1M1AB 3AFAA 3KXBC 2FJ7B 3V9RB 3AZJB 3O62B 1B6WA 1TAFB 3AV2C 3REKC 1P3PA 4J8UD 4H9OB 1EQZB 5BNVA 2BYKA 4WU9D 5CPKB 4LD9A 2YFWB 3UTBC 3W97D 2NZDC 1U35A 4Z66D 5JRGC 1KX5D 3AYWA 3AZED 5GT0C 3REHA 1P3KC 2F8NB 3WTPD 3B6FC 2PYOA 3KWQB 1ID3C 3LZ1B 4ZUXB 3X1SB 5AV8C 3W99B 1BH8A 4AWLB 3X1VB 4KUDA 5B0YA 4R8PC 3TU4A 3AZID 4ZBJB 1P3LB 3X1UA 3B0BA 1R4VA 1TZYA 4CAYB 5C3IB 5DNMB 1M18B 2HIOD 5B31G 4YS3D 5CP6D 5E5AA 5F99B 4H9QA 2F8NH 3MGSA 3UT9C 4WU9C 1ULYA 3KXBB 3MGPA 3MVDA 1H3OB 3W97C 5B0ZC 5GT3A 1KX3A 1HTAA 3AV2B 3REKB 3WKJA 1M19B 2IO5C 3AZKC 1P3GD 3WA9A 3AZEC 2F8NG 3B0CT 5B31D 2NZDB 5B1LD 3REID 5BT1D 4XUJA 1HQ3A 1KX4D 5AV6D 4UUZB 1A7WA 3C1CA 1BFMA 3AZNA 4H9NA 4J8VA 1JFIA 3AZIC 5GT0B 2AROB 3AZFD 3B0DC 2HIOC 3W98D 5CP6C 5AV8B 1P3IC 4G92C 3REJA 3AZMB 4XZQD 5GSUA 3LZ0A 4R8PB 3B6GD 5AV5C 4WU8A 3AFAD 3AZHC 4JJNC 2HUEC 1WWSA 5AY8A 4J8UB 2FJ7C 4WU9B 1P3PD 3UTAD 3NQJA 5B32A 4LD9D 4QLCA 3O62C 3AZGA 3W97B 5B31C 1ZLAA 3X1TA 5B1LC 4Z66B 1EQZC 1U35D 3VH5A 4CSRB 5GXQA 1KX4C 4Z5TA 3KSYA 3WAAA 3VH6W 1KX5B 2IO5B 1P3BD 1P34D 3MGQA 3AZEB 3AYWD 3WTPB 3MGRA 5FUGB 1F66A 4DRBA 3KUYD 4XZQC 3B6GC 3AZIB 3TU4D 3KWQC 4ZUXC 3B0DB 4WV4B 3X1UD 3X1VC 4YM6A 1S32A 2HIOB 2YFVA 3AV1A 5CP6B 4YS3B 5E5AD 3UTAC 3MGSD 1M1AA 1AOIA 5DNMC 1M18C 3MGPD 3MVDD 3V9RA 3AZJA 1TAFA 3C1BA 5AVBD 5BO0B 1P3BC 1P34C 1P3GB 5CPKA 5B40D 2YFWA 4DRAA 5B31B 3A6NA 5B1LB 3REIB 1M19C 1KX4B 5AV6B 1HQ3D 3VH5W 3LJAD 4H9RB 5CPJD 3AN2A 3KUYC 3C1CD 3AZND 2BYMB 3TU4C 4KGCD 2CV5A 3AZFB 5AV9A 3LZ1A 3X1SA 3W98B 3W96D 5BNXB 2AROC 4XZQB 3LELA 3W99A 3B6GB 4E44A 3AZLA 4WU8D 3AFAB 1P3LA 3MGPC 3R45A 1BH9B 3AZMC 4CAYA 5AVBC 4X23A 1P3PB 4M6BA 3UTAB 5B40C 4Z2MH 4LD9B 3KXBA 2L5AA 5AVCA 1P3AD 1ZLAD 3X1TD 4J8UC 1U35B 1P3OD 3LJAC 5GXQD 5CPJC 3AV2A 3REKA 4G91C 1P3BB 3WAAD 3C1CC 1P34B 3AZNC 4Z66C 3AYWB 5BS7A 4KGCC 3UTBA 5B24A 4Z2MG 1KX5C 5G49A 5JRGA 3W96C 3NQUA 3MGRD 3KUYB 3RELD 3WTPC 1F66D 1BH8B 3TU4B 5GT0A 1P3KA 3B6FA 4NFTA 3X1UB 1ID3A 4YM6D 4J8XD 1S32D 2NQBD 5AV8A 4HGAB 3AV1D 5E5AB 4H9QB 4R8PA 3MGSB 5B33A 4H9SA 3MNND 4J8WD 1P3FA 4YS3C 3MGPB 3MVDB 1P3AC 1AOID 2JSSA 3VH6T 5B2JA 1P3OC 5AVBB 5B1MA 3C1BD 3UT9A 4WU9A 5B40B 5B0ZA 5CPIA 3A6ND 2RVQD 1P3GC 1HQ3B 3LJAB 5CPJB 3MGRC 3RELC 4G91B 3AN2D 1N1JB 3C1CB 3AZKA 3AZNB 3REIC 4H9NB 5BT1C 4NE6A 3AZEA 1JFIB 4KGCB 5B2IA 5AV6C 3WTPE 2CV5D 5AV9D 4J8XC 1S32C 3W96B 5FUGA 2NQBC 3LZ1D 3REHD 4H9PA 3AZFC 5DNNA 3LELD 4WU8B 3AZLD 1P3MA 2PYOD 3MNNC 4J8WC 3W98C 5KDMA 4KUDD 2HIOA 5B0YD 1P3IA 1Q9CA 3AFAC 3C1BC 5AV5A 4X23D 4WNNA 3NQJB 1TZYD 3AZHA 1P3AB 3VH5T 4KHAB 5JA4B 1ZLAB 3X1TB 5AVCD 2RVQC 1P3PC 1P3OB 4JJNA 5GXQB 4LD9C 2F8NK 1WWIA 2FJ7A 3WAAB 5CHLB 5GT3D 1U35C 3O62A 1KX3D 1KU5A 3UTBD 2CV5C 5B24D 4H9OA 1EQZA 1KX4A 3WKJD 4EO5C 3AYWC 4H9RA 3MGRB 3RELB 5JRGD 3WA9D 1F1EA 3REHC 1F66B 2PYOC 4XUJD 1P3KD 3B6FD 4KUDC 4YM6B 4J8VD 5B0YC 4J8XB 4WZSB 1S32B 5BNXA 1ID3D 2YFVB 3AV1B 2F8NA 2NQBB 4XZQA 3X1UC 5B33D 1TZYC 3MNNB 3KWQA 4J8WB 4ZUXA 1AOIB 5B32G 1P3FD 1BH9A 4HGAC 5AVCC 3X1VA 5E5AC 3REJD 3MGSC 5GSUD 3LZ0D 5B2JD 3C1BB 5B1MD 3MVDC 3UTAA 3UT9D 4NE3A 5GT3C 1KX3C 4NE5A 5DNMA 5BS7C 1M18A 5F99A 5B24C 5B0ZD 3A6NB 5CPID 5AY8D 3WKJC 2CWEA 2BYKB 5BNVB 3AN2B 3WA9C 1H3OA 5B32D 1P3BA 4QLCD 3AZGD 1P34A 3AZKD 4XUJC 1HQ3C 5B2ID 2CV5B 4Z5TD 1M19A 5AV9B 4J8VC 4EO5B 3MGQD 3KUYA 3REHB 2NZDA 3LELB 3AZLB 2PYOB 5DNND 5B33C 1P3MD 4UUZA 4H9SC 1P3FC 3R45B 3REJC 4KUDB 5GSUC 5B0YB 3LZ0C 5B2JC 4WU8C 2AROA 5B1MC 1P3ID 4X23B 5AV5D 1TZYB 3AZHD 5AVCB 3AZMA 5CPIC 5AY8C 2LY8A 5AVBA 4JJND 1M1AD 1B67A 3VH6A 5B32C 4QLCC 3AZGC 2FJ7D 5B40A 1ZLAC 3X1TC 5GT3B 1KX3B 3AZJD 5GXQC 5B2IC 3O62D 3UTBB 4E45A 4Z5TC 5B24B 4J8UA 3WAAC 3WKJB 5G49B 3LJAA 1EQZD 3MGQC 5CPJA 5JRGB 5CPKD 3WA9B 3W97A 3NQUB 1N1JA 4Z66A 5DNNC 4KGCA 4CSRA 4XUJB 1P3KB 1P3MC 3B6FB 1KX5A 1F66C 4J8VB 3W96A 1ID3B 3WTPA 2F8ND 5B33B 4YM6C 3B0CW 3KWQD 1P3FB 4ZUXD 3X1SD 3AV1C 3REJB 3W99D 5GSUB 3LZ0B 3AZIA 5B2JB 3X1VD 1M1AC 5B1MB 1AOIC
chains in the Genus database with same CATH superfamily
3UT9B 1P3LD 3AZJC 4YS3A 1P3AA 2Y2KA 5CP6A 4KHAA 5JA4A 5DNMD 5B0ZB 1M18D 5CPIB 5AY8B 5F99D 1P3OA 5CPKC 5B32B 3KXBD 4QLCB 3AZGB 3AZKB 3A6NC 5B2IB 4Z5TB 5BO0A 3AN2C 3AV2D 3REKD 1P3GA 1M19D 3MGQB 3RELA 5B31A 5B1LA 4H9PB 3REIA 2NZDD 5DNNB 5AV6A 1P3MB 5AV9C 3LZ1C 3X1SC 3W99C 2Y2QA 3LELC 4J8XA 4AWLC 2BYMA 2Y2GA 5KDMB 3AZLC 2NQBA 5GT0D 1P3IB 2AROD 3AZFA 4G92B 4ZBJC 1P3LC 5AV5B 4WNNB 3MNNA 4J8WA 3W98A 2DQNC 5C3IC 3AZHB 5AV8D 5F99C 3B6GA 4X23C 3AZMD 4R8PD 4JJNB 2HUEB 1M1AB 3AFAA 3KXBC 2FJ7B 3V9RB 3AZJB 3O62B 1B6WA 1TAFB 1T3UA 3AV2C 3REKC 1P3PA 4J8UD 2F2AC 4H9OB 5BNVA 2BYKA 4WU9D 5CPKB 1EQZB 4LD9A 2YFWB 3UTBC 3W97D 3EPKA 2NZDC 1U35A 4Z66D 5JRGC 2FFFB 1KX5D 3AYWA 3AZED 5GT0C 3REHA 1P3KC 2F8NB 3WTPD 3B6FC 2PYOA 3KWQB 1ID3C 3LZ1B 4ZUXB 3X1SB 5AV8C 3W99B 1BH8A 4AWLB 3X1VB 4KUDA 5B0YA 4R8PC 3TU4A 3AZID 3A1KA 4ZBJB 1P3LB 3X1UA 3B0BA 1R4VA 1TZYA 4CAYB 5C3IB 5DNMB 1M18B 2HIOD 5B31G 4YS3D 5CP6D 5E5AA 5F99B 4H9QA 2F8NH 3MGSA 3UT9C 4WU9C 1ULYA 3KXBB 3MGPA 3MVDA 1H3OB 3W97C 5B0ZC 5GT3A 1KX3A 1HTAA 3AV2B 3REKB 3WKJA 1M19B 2IO5C 3AZKC 1P3GD 3WA9A 3AZEC 2F8NG 3B0CT 5B31D 2NZDB 5B1LD 3REID 5BT1D 4XUJA 1HQ3A 1KX4D 5AV6D 4UUZB 1A7WA 3C1CA 1BFMA 2XD5A 3AZNA 4H9NA 4J8VA 1JFIA 3AZIC 5GT0B 2AROB 2Y2JA 3AZFD 3B0DC 2HIOC 3W98D 5CP6C 5AV8B 1P3IC 4G92C 3REJA 3AZMB 4XZQD 5GSUA 3LZ0A 4R8PB 3B6GD 5AV5C 2UWXA 4WU8A 2ZY4A 3AFAD 3AZHC 4JJNC 2HUEC 3A1IA 1WWSA 5AY8A 4J8UB 2FJ7C 4WU9B 1P3PD 3UTAD 3NQJA 5B32A 4LD9D 4QLCA 3O62C 3AZGA 3W97B 5B31C 1ZLAA 3X1TA 5B1LC 4Z66B 1EQZC 1U35D 3VH5A 4CSRB 5GXQA 1KX4C 4Z5TA 3KSYA 3WAAA 3VH6W 1KX5B 2IO5B 1P3BD 1P34D 3MGQA 3AZEB 3AYWD 3WTPB 3MGRA 2ZY3A 5FUGB 1F66A 4DRBA 3KUYD 4XZQC 3F6TA 3B6GC 3AZIB 3TU4D 3KWQC 2ZY2A 4ZUXC 3B0DB 4WV4B 3X1UD 3X1VC 4YM6A 1S32A 2HIOB 2YFVA 3AV1A 5CP6B 4YS3B 2JE5A 2RIQA 5E5AD 3UTAC 3MGSD 3H0RC 1M1AA 3H0LC 1AOIA 5DNMC 1M18C 3MGPD 3MVDD 3V9RA 3AZJA 1TAFA 3H0MC 3C1BA 5AVBD 5BO0B 2G5HC 1P3BC 1P34C 1P3GB 5CPKA 5B40D 2YFWA 4DRAA 5B31B 3A6NA 2Y2PA 5B1LB 3REIB 1M19C 2VQRA 5AV6B 1KX4B 1HQ3D 3VH5W 3LJAD 4H9RB 5CPJD 3AN2A 3KUYC 3C1CD 3AZND 2BYMB 3TU4C 4KGCD 2CV5A 3AZFB 5AV9A 3LZ1A 3X1SA 3W98B 3W96D 5BNXB 2DF4C 2AROC 2G5IC 4XZQB 3LELA 3W99A 3B6GB 4E44A 3AZLA 4WU8D 3AFAB 1P3LA 3MGPC 3R45A 1BH9B 3AZMC 2JCHA 4CAYA 2J8PA 5AVBC 2Y2LA 4X23A 1P3PB 4M6BA 3UTAB 5B40C 4Z2MH 4LD9B 3KXBA 2L5AA 5AVCA 1P3AD 1ZLAD 3X1TD 4J8UC 1U35B 1P3OD 3LJAC 3KFUG 5GXQD 5CPJC 3AV2A 3REKA 4G91C 1P3BB 3WAAD 3C1CC 1P34B 3AZNC 4Z66C 3AYWB 5BS7A 4KGCC 3UTBA 5B24A 4Z2MG 1KX5C 5G49A 5JRGA 3W96C 3NQUA 3MGRD 3KUYB 3RELD 3WTPC 1F66D 1BH8B 3TU4B 5GT0A 1P3KA 3B6FA 4NFTA 3X1UB 1ID3A 4YM6D 4J8XD 1S32D 2NQBD 5AV8A 4HGAB 3AV1D 5E5AB 4H9QB 4R8PA 3MGSB 5B33A 4H9SA 3MNND 3EPJA 4J8WD 1P3FA 4YS3C 3MGPB 3MVDB 1P3AC 1AOID 2JSSA 3VH6T 5B2JA 1P3OC 2Y2IA 5AVBB 5B1MA 3C1BD 3UT9A 4WU9A 5B40B 5B0ZA 5CPIA 3A6ND 2RVQD 1P3GC 1HQ3B 3LJAB 5CPJB 3MGRC 3RELC 4G91B 3AN2D 1N1JB 3C1CB 3AZKA 3AZNB 3REIC 4H9NB 5BT1C 4NE6A 3AZEA 1JFIB 4KGCB 5B2IA 5AV6C 3WTPE 2CV5D 5AV9D 4J8XC 2Y2HA 1S32C 5FUGA 3W96B 3LZ1D 2NQBC 3REHD 4H9PA 3AZFC 5DNNA 3LELD 4WU8B 3AZLD 1P3MA 2PYOD 3MNNC 4J8WC 3W98C 1PZRA 5KDMA 4KUDD 2HIOA 5B0YD 1P3IA 1Q9CA 3AFAC 3C1BC 5AV5A 4X23D 4WNNA 3NQJB 1TZYD 3AZHA 1P3AB 3VH5T 4KHAB 5JA4B 1ZLAB 3X1TB 5AVCD 2RVQC 1P3PC 1P3OB 4JJNA 5GXQB 4LD9C 2F8NK 1WWIA 1Z2CB 2FJ7A 3WAAB 2ZM5A 5CHLB 5GT3D 1U35C 3O62A 1KX3D 1KU5A 3UTBD 2CV5C 5B24D 4UPKA 4H9OA 1EQZA 1KX4A 3WKJD 4EO5C 3AYWC 4H9RA 3MGRB 3RELB 5JRGD 3WA9D 1F1EA 3REHC 1F66B 2PYOC 4XUJD 3FDDA 1P3KD 1W2EA 3B6FD 3IP4C 4KUDC 4YM6B 4J8VD 5B0YC 4J8XB 4WZSB 1S32B 5BNXA 1ID3D 2YFVB 3AV1B 2F8NA 2NQBB 4XZQA 3X1UC 5B33D 1TZYC 3MNNB 3KWQA 4J8WB 4ZUXA 1AOIB 5B32G 1P3FD 1BH9A 4HGAC 5AVCC 3X1VA 5E5AC 3REJD 3MGSC 5GSUD 3LZ0D 5B2JD 3C1BB 2Y2MA 5B1MD 3MVDC 3UTAA 3UT9D 4NE3A 5GT3C 1KX3C 4NE5A 5DNMA 5BS7C 1M18A 5F99A 5B24C 5B0ZD 3A6NB 5CPID 5AY8D 3WKJC 2CWEA 2BYKB 5BNVB 3AN2B 3WA9C 1H3OA 5B32D 1P3BA 4QLCD 3AZGD 1P34A 3AZKD 4XUJC 1HQ3C 3EPHA 5B2ID 2CV5B 4Z5TD 1M19A 5AV9B 4J8VC 4EO5B 3MGQD 3KUYA 4WJ3C 3REHB 2NZDA 2BG1A 3LELB 3AZLB 2PYOB 5DNND 5B33C 1P3MD 4UUZA 4H9SC 1P3FC 3R45B 3AL0C 3REJC 4KUDB 5GSUC 5B0YB 3LZ0C 5B2JC 4WU8C 2AROA 2XD1A 2Y2NA 5B1MC 1P3ID 2W8SA 4X23B 5AV5D 1TZYB 3AZHD 3P5JB 5AVCB 3AZMA 3EG5B 5CPIC 5AY8C 4DQYB 2LY8A 5AVBA 4JJND 1M1AD 1B67A 3VH6A 5B32C 4QLCC 3AZGC 2FJ7D 5B40A 1ZLAC 3X1TC 5GT3B 1KX3B 3AZJD 5GXQC 5B2IC 3O62D 3UTBB 4E45A 4Z5TC 5B24B 4J8UA 3WAAC 3WKJB 5G49B 3LJAA 3EPLA 1EQZD 3MGQC 5CPJA 5JRGB 5CPKD 3WA9B 3W97A 3NQUB 1N1JA 4Z66A 5DNNC 4KGCA 4CSRA 4XUJB 1P3KB 1P3MC 3B6FB 1KX5A 1F66C 4J8VB 3W96A 1ID3B 2ZY5A 3WTPA 2F8ND 2Y2OA 5B33B 4YM6C 3B0CW 3KWQD 1P3FB 4ZUXD 3X1SD 3AV1C 3REJB 3W99D 5GSUB 3LZ0B 3AZIA 5B2JB 3X1VD 1M1AC 5B1MB 1AOIC
chains in the Genus database with same CATH topology
3UT9B 1P3LD 3AZJC 4YS3A 1P3AA 2Y2KA 5CP6A 4KHAA 5JA4A 5DNMD 5B0ZB 1M18D 5CPIB 5AY8B 5F99D 1P3OA 5CPKC 5B32B 3KXBD 4QLCB 3AZGB 3AZKB 3A6NC 5B2IB 4Z5TB 5BO0A 3AN2C 3AV2D 3REKD 1P3GA 1M19D 3MGQB 3RELA 5B31A 5B1LA 4H9PB 3REIA 2NZDD 5DNNB 5AV6A 1P3MB 5AV9C 3LZ1C 3X1SC 3W99C 2Y2QA 3LELC 4J8XA 4AWLC 2BYMA 2Y2GA 5KDMB 3AZLC 2NQBA 5GT0D 1P3IB 2AROD 3AZFA 4G92B 4ZBJC 1P3LC 5AV5B 4WNNB 3MNNA 4J8WA 3W98A 2DQNC 5C3IC 3AZHB 5AV8D 5F99C 3B6GA 4X23C 3AZMD 4R8PD 4JJNB 2HUEB 1M1AB 3AFAA 3KXBC 2FJ7B 3V9RB 3AZJB 3O62B 1B6WA 1TAFB 1T3UA 3AV2C 3REKC 1P3PA 4J8UD 2F2AC 4H9OB 5BNVA 2BYKA 4WU9D 5CPKB 1EQZB 4LD9A 2YFWB 3UTBC 3W97D 3EPKA 2NZDC 1U35A 4Z66D 5JRGC 2FFFB 1KX5D 3AYWA 3AZED 5GT0C 3REHA 1P3KC 2F8NB 3WTPD 3B6FC 2PYOA 3KWQB 1ID3C 3LZ1B 4ZUXB 3X1SB 5AV8C 3W99B 1BH8A 4AWLB 3X1VB 4KUDA 5B0YA 4R8PC 3TU4A 3AZID 3A1KA 4ZBJB 1P3LB 3X1UA 3B0BA 1R4VA 1TZYA 4CAYB 5C3IB 5DNMB 1M18B 2HIOD 5B31G 4YS3D 5CP6D 5E5AA 5F99B 4H9QA 2F8NH 3MGSA 3UT9C 4WU9C 1ULYA 3KXBB 3MGPA 3MVDA 1H3OB 3W97C 5B0ZC 5GT3A 1KX3A 1HTAA 3AV2B 3REKB 3WKJA 1M19B 2IO5C 3AZKC 1P3GD 3WA9A 3AZEC 2F8NG 3B0CT 5B31D 2NZDB 5B1LD 3REID 5BT1D 4XUJA 1HQ3A 1KX4D 5AV6D 4UUZB 1A7WA 3C1CA 1BFMA 2XD5A 3AZNA 4H9NA 4J8VA 1JFIA 3AZIC 5GT0B 2AROB 2Y2JA 3AZFD 3B0DC 2HIOC 3W98D 5CP6C 5AV8B 1P3IC 4G92C 3REJA 3AZMB 4XZQD 5GSUA 3LZ0A 4R8PB 3B6GD 5AV5C 2UWXA 4WU8A 2ZY4A 3AFAD 3AZHC 4JJNC 2HUEC 3A1IA 1WWSA 5AY8A 4J8UB 2FJ7C 4WU9B 1P3PD 3UTAD 3NQJA 5B32A 4LD9D 4QLCA 3O62C 3AZGA 3W97B 5B31C 1ZLAA 3X1TA 5B1LC 4Z66B 1EQZC 1U35D 3VH5A 4CSRB 5GXQA 1KX4C 4Z5TA 3KSYA 3WAAA 3VH6W 1KX5B 2IO5B 1P3BD 1P34D 3MGQA 3AZEB 3AYWD 3WTPB 3MGRA 2ZY3A 5FUGB 1F66A 4DRBA 3KUYD 4XZQC 3F6TA 3B6GC 3AZIB 3TU4D 3KWQC 2ZY2A 4ZUXC 3B0DB 4WV4B 3X1UD 3X1VC 4YM6A 1S32A 2HIOB 2YFVA 3AV1A 5CP6B 4YS3B 2JE5A 2RIQA 5E5AD 3UTAC 3MGSD 3H0RC 1M1AA 3H0LC 1AOIA 5DNMC 1M18C 3MGPD 3MVDD 3V9RA 3AZJA 1TAFA 3H0MC 3C1BA 5AVBD 5BO0B 2G5HC 1P3BC 1P34C 1P3GB 5CPKA 5B40D 2YFWA 4DRAA 5B31B 3A6NA 2Y2PA 5B1LB 3REIB 1M19C 2VQRA 5AV6B 1KX4B 1HQ3D 3VH5W 3LJAD 4H9RB 5CPJD 3AN2A 3KUYC 3C1CD 3AZND 2BYMB 3TU4C 4KGCD 2CV5A 3AZFB 5AV9A 3LZ1A 3X1SA 3W98B 3W96D 5BNXB 2DF4C 2AROC 2G5IC 4XZQB 3LELA 3W99A 3B6GB 4E44A 3AZLA 4WU8D 3AFAB 1P3LA 3MGPC 3R45A 1BH9B 3AZMC 2JCHA 4CAYA 2J8PA 5AVBC 2Y2LA 4X23A 1P3PB 4M6BA 3UTAB 5B40C 4Z2MH 4LD9B 3KXBA 2L5AA 5AVCA 1P3AD 1ZLAD 3X1TD 4J8UC 1U35B 1P3OD 3LJAC 3KFUG 5GXQD 5CPJC 3AV2A 3REKA 4G91C 1P3BB 3WAAD 3C1CC 1P34B 3AZNC 4Z66C 3AYWB 5BS7A 4KGCC 3UTBA 5B24A 4Z2MG 1KX5C 5G49A 5JRGA 3W96C 3NQUA 3MGRD 3KUYB 3RELD 3WTPC 1F66D 1BH8B 3TU4B 5GT0A 1P3KA 3B6FA 4NFTA 3X1UB 1ID3A 4YM6D 4J8XD 1S32D 2NQBD 5AV8A 4HGAB 3AV1D 5E5AB 4H9QB 4R8PA 3MGSB 5B33A 4H9SA 3MNND 3EPJA 4J8WD 1P3FA 4YS3C 3MGPB 3MVDB 1P3AC 1AOID 2JSSA 3VH6T 5B2JA 1P3OC 2Y2IA 5AVBB 5B1MA 3C1BD 3UT9A 4WU9A 5B40B 5B0ZA 5CPIA 3A6ND 2RVQD 1P3GC 1HQ3B 3LJAB 5CPJB 3MGRC 3RELC 4G91B 3AN2D 1N1JB 3C1CB 3AZKA 3AZNB 3REIC 4H9NB 5BT1C 4NE6A 3AZEA 1JFIB 4KGCB 5B2IA 5AV6C 3WTPE 2CV5D 5AV9D 4J8XC 2Y2HA 1S32C 5FUGA 3W96B 3LZ1D 2NQBC 3REHD 4H9PA 3AZFC 5DNNA 3LELD 4WU8B 3AZLD 1P3MA 2PYOD 3MNNC 4J8WC 3W98C 1PZRA 5KDMA 4KUDD 2HIOA 5B0YD 1P3IA 1Q9CA 3AFAC 3C1BC 5AV5A 4X23D 4WNNA 3NQJB 1TZYD 3AZHA 1P3AB 3VH5T 4KHAB 5JA4B 1ZLAB 3X1TB 5AVCD 2RVQC 1P3PC 1P3OB 4JJNA 5GXQB 4LD9C 2F8NK 1WWIA 1Z2CB 2FJ7A 3WAAB 2ZM5A 5CHLB 5GT3D 1U35C 3O62A 1KX3D 1KU5A 3UTBD 2CV5C 5B24D 4UPKA 4H9OA 1EQZA 1KX4A 3WKJD 4EO5C 3AYWC 4H9RA 3MGRB 3RELB 5JRGD 3WA9D 1F1EA 3REHC 1F66B 2PYOC 4XUJD 3FDDA 1P3KD 1W2EA 3B6FD 3IP4C 4KUDC 4YM6B 4J8VD 5B0YC 4J8XB 4WZSB 1S32B 5BNXA 1ID3D 2YFVB 3AV1B 2F8NA 2NQBB 4XZQA 3X1UC 5B33D 1TZYC 3MNNB 3KWQA 4J8WB 4ZUXA 1AOIB 5B32G 1P3FD 1BH9A 4HGAC 5AVCC 3X1VA 5E5AC 3REJD 3MGSC 5GSUD 3LZ0D 5B2JD 3C1BB 2Y2MA 5B1MD 3MVDC 3UTAA 3UT9D 4NE3A 5GT3C 1KX3C 4NE5A 5DNMA 5BS7C 1M18A 5F99A 5B24C 5B0ZD 3A6NB 5CPID 5AY8D 3WKJC 2CWEA 2BYKB 5BNVB 3AN2B 3WA9C 1H3OA 5B32D 1P3BA 4QLCD 3AZGD 1P34A 3AZKD 4XUJC 1HQ3C 3EPHA 5B2ID 2CV5B 4Z5TD 1M19A 5AV9B 4J8VC 4EO5B 3MGQD 3KUYA 4WJ3C 3REHB 2NZDA 2BG1A 3LELB 3AZLB 2PYOB 5DNND 5B33C 1P3MD 4UUZA 4H9SC 1P3FC 3R45B 3AL0C 3REJC 4KUDB 5GSUC 5B0YB 3LZ0C 5B2JC 4WU8C 2AROA 2XD1A 2Y2NA 5B1MC 1P3ID 2W8SA 4X23B 5AV5D 1TZYB 3AZHD 3P5JB 5AVCB 3AZMA 3EG5B 5CPIC 5AY8C 4DQYB 2LY8A 5AVBA 4JJND 1M1AD 1B67A 3VH6A 5B32C 4QLCC 3AZGC 2FJ7D 5B40A 1ZLAC 3X1TC 5GT3B 1KX3B 3AZJD 5GXQC 5B2IC 3O62D 3UTBB 4E45A 4Z5TC 5B24B 4J8UA 3WAAC 3WKJB 5G49B 3LJAA 3EPLA 1EQZD 3MGQC 5CPJA 5JRGB 5CPKD 3WA9B 3W97A 3NQUB 1N1JA 4Z66A 5DNNC 4KGCA 4CSRA 4XUJB 1P3KB 1P3MC 3B6FB 1KX5A 1F66C 4J8VB 3W96A 1ID3B 2ZY5A 3WTPA 2F8ND 2Y2OA 5B33B 4YM6C 3B0CW 3KWQD 1P3FB 4ZUXD 3X1SD 3AV1C 3REJB 3W99D 5GSUB 3LZ0B 3AZIA 5B2JB 3X1VD 1M1AC 5B1MB 1AOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 B;  1P3L D;  3AZJ C;  4YS3 A;  1P3A A;  5CP6 A;  4KHA A;  5JA4 A;  5DNM D;  5B0Z B;  1M18 D;  5CPI B;  5AY8 B;  5F99 D;  1P3O A;  5CPK C;  5B32 B;  3KXB D;  4QLC B;  3AZG B;  3AZK B;  3A6N C;  5B2I B;  4Z5T B;  5BO0 A;  3AN2 C;  3AV2 D;  3REK D;  1P3G A;  1M19 D;  3MGQ B;  3REL A;  5B31 A;  5B1L A;  4H9P B;  3REI A;  2NZD D;  5DNN B;  5AV6 A;  1P3M B;  5AV9 C;  3LZ1 C;  3X1S C;  3W99 C;  3LEL C;  4AWL C;  4J8X A;  2BYM A;  5KDM B;  3AZL C;  2NQB A;  5GT0 D;  1P3I B;  2ARO D;  3AZF A;  4G92 B;  4ZBJ C;  1P3L C;  5AV5 B;  4WNN B;  3MNN A;  4J8W A;  3W98 A;  5C3I C;  3AZH B;  5AV8 D;  5F99 C;  3B6G A;  4X23 C;  3AZM D;  4R8P D;  4JJN B;  2HUE B;  1M1A B;  3AFA A;  3KXB C;  2FJ7 B;  3V9R B;  3AZJ B;  3O62 B;  1B6W A;  1TAF B;  3AV2 C;  3REK C;  1P3P A;  4J8U D;  4H9O B;  1EQZ B;  5BNV A;  2BYK A;  4WU9 D;  5CPK B;  4LD9 A;  2YFW B;  3UTB C;  3W97 D;  2NZD C;  1U35 A;  4Z66 D;  5JRG C;  1KX5 D;  3AYW A;  3AZE D;  5GT0 C;  3REH A;  1P3K C;  2F8N B;  3WTP D;  3B6F C;  2PYO A;  3KWQ B;  1ID3 C;  3LZ1 B;  4ZUX B;  3X1S B;  5AV8 C;  3W99 B;  1BH8 A;  4AWL B;  3X1V B;  4KUD A;  5B0Y A;  4R8P C;  3TU4 A;  3AZI D;  4ZBJ B;  1P3L B;  3X1U A;  3B0B A;  1R4V A;  1TZY A;  4CAY B;  5C3I B;  5DNM B;  1M18 B;  2HIO D;  5B31 G;  4YS3 D;  5CP6 D;  5E5A A;  5F99 B;  4H9Q A;  2F8N H;  3MGS A;  3UT9 C;  4WU9 C;  1ULY A;  3KXB B;  3MGP A;  3MVD A;  1H3O B;  3W97 C;  5B0Z C;  5GT3 A;  1KX3 A;  1HTA A;  3AV2 B;  3REK B;  3WKJ A;  1M19 B;  2IO5 C;  3AZK C;  1P3G D;  3WA9 A;  3AZE C;  2F8N G;  3B0C T;  5B31 D;  2NZD B;  5B1L D;  3REI D;  5BT1 D;  4XUJ A;  1HQ3 A;  1KX4 D;  5AV6 D;  4UUZ B;  1A7W A;  3C1C A;  1BFM A;  3AZN A;  4H9N A;  4J8V A;  1JFI A;  3AZI C;  5GT0 B;  2ARO B;  3AZF D;  3B0D C;  2HIO C;  3W98 D;  5CP6 C;  5AV8 B;  1P3I C;  4G92 C;  3REJ A;  3AZM B;  4XZQ D;  5GSU A;  3LZ0 A;  4R8P B;  3B6G D;  5AV5 C;  4WU8 A;  3AFA D;  3AZH C;  4JJN C;  2HUE C;  1WWS A;  5AY8 A;  4J8U B;  2FJ7 C;  4WU9 B;  1P3P D;  3UTA D;  3NQJ A;  5B32 A;  4LD9 D;  4QLC A;  3O62 C;  3AZG A;  3W97 B;  5B31 C;  1ZLA A;  3X1T A;  5B1L C;  4Z66 B;  1EQZ C;  1U35 D;  3VH5 A;  4CSR B;  5GXQ A;  1KX4 C;  4Z5T A;  3KSY A;  3WAA A;  3VH6 W;  1KX5 B;  2IO5 B;  1P3B D;  1P34 D;  3MGQ A;  3AZE B;  3AYW D;  3WTP B;  3MGR A;  5FUG B;  1F66 A;  4DRB A;  3KUY D;  4XZQ C;  3B6G C;  3AZI B;  3TU4 D;  3KWQ C;  4ZUX C;  3B0D B;  4WV4 B;  3X1U D;  3X1V C;  4YM6 A;  1S32 A;  2HIO B;  2YFV A;  3AV1 A;  5CP6 B;  4YS3 B;  5E5A D;  3UTA C;  3MGS D;  1M1A A;  1AOI A;  5DNM C;  1M18 C;  3MGP D;  3MVD D;  3V9R A;  3AZJ A;  1TAF A;  3C1B A;  5AVB D;  5BO0 B;  1P3B C;  1P34 C;  1P3G B;  5CPK A;  5B40 D;  2YFW A;  4DRA A;  5B31 B;  3A6N A;  5B1L B;  3REI B;  1M19 C;  1KX4 B;  5AV6 B;  1HQ3 D;  3VH5 W;  3LJA D;  4H9R B;  5CPJ D;  3AN2 A;  3KUY C;  3C1C D;  3AZN D;  2BYM B;  3TU4 C;  4KGC D;  2CV5 A;  3AZF B;  5AV9 A;  3LZ1 A;  3X1S A;  3W98 B;  3W96 D;  5BNX B;  2ARO C;  4XZQ B;  3LEL A;  3W99 A;  3B6G B;  4E44 A;  3AZL A;  4WU8 D;  3AFA B;  1P3L A;  3MGP C;  3R45 A;  1BH9 B;  3AZM C;  4CAY A;  5AVB C;  4X23 A;  1P3P B;  4M6B A;  3UTA B;  5B40 C;  4Z2M H;  4LD9 B;  3KXB A;  2L5A A;  5AVC A;  1P3A D;  1ZLA D;  3X1T D;  4J8U C;  1U35 B;  1P3O D;  3LJA C;  5GXQ D;  5CPJ C;  3AV2 A;  3REK A;  4G91 C;  1P3B B;  3WAA D;  3C1C C;  1P34 B;  3AZN C;  4Z66 C;  3AYW B;  5BS7 A;  4KGC C;  3UTB A;  5B24 A;  4Z2M G;  1KX5 C;  5G49 A;  5JRG A;  3W96 C;  3NQU A;  3MGR D;  3KUY B;  3REL D;  3WTP C;  1F66 D;  1BH8 B;  3TU4 B;  5GT0 A;  1P3K A;  3B6F A;  4NFT A;  3X1U B;  1ID3 A;  4YM6 D;  4J8X D;  1S32 D;  2NQB D;  5AV8 A;  4HGA B;  3AV1 D;  5E5A B;  4H9Q B;  4R8P A;  3MGS B;  5B33 A;  4H9S A;  3MNN D;  4J8W D;  1P3F A;  4YS3 C;  3MGP B;  3MVD B;  1P3A C;  1AOI D;  2JSS A;  3VH6 T;  5B2J A;  1P3O C;  5AVB B;  5B1M A;  3C1B D;  3UT9 A;  4WU9 A;  5B40 B;  5B0Z A;  5CPI A;  3A6N D;  2RVQ D;  1P3G C;  1HQ3 B;  3LJA B;  5CPJ B;  3MGR C;  3REL C;  4G91 B;  3AN2 D;  1N1J B;  3C1C B;  3AZK A;  3AZN B;  3REI C;  4H9N B;  5BT1 C;  4NE6 A;  3AZE A;  1JFI B;  4KGC B;  5B2I A;  5AV6 C;  3WTP E;  2CV5 D;  5AV9 D;  4J8X C;  1S32 C;  3W96 B;  5FUG A;  2NQB C;  3LZ1 D;  3REH D;  4H9P A;  3AZF C;  5DNN A;  3LEL D;  4WU8 B;  3AZL D;  1P3M A;  2PYO D;  3MNN C;  4J8W C;  3W98 C;  5KDM A;  4KUD D;  2HIO A;  5B0Y D;  1P3I A;  1Q9C A;  3AFA C;  3C1B C;  5AV5 A;  4X23 D;  4WNN A;  3NQJ B;  1TZY D;  3AZH A;  1P3A B;  3VH5 T;  4KHA B;  5JA4 B;  1ZLA B;  3X1T B;  5AVC D;  2RVQ C;  1P3P C;  1P3O B;  4JJN A;  5GXQ B;  4LD9 C;  2F8N K;  1WWI A;  2FJ7 A;  3WAA B;  5CHL B;  5GT3 D;  1U35 C;  3O62 A;  1KX3 D;  1KU5 A;  3UTB D;  2CV5 C;  5B24 D;  4H9O A;  1EQZ A;  1KX4 A;  3WKJ D;  4EO5 C;  3AYW C;  4H9R A;  3MGR B;  3REL B;  5JRG D;  3WA9 D;  1F1E A;  3REH C;  1F66 B;  2PYO C;  4XUJ D;  1P3K D;  3B6F D;  4KUD C;  4YM6 B;  4J8V D;  5B0Y C;  4J8X B;  4WZS B;  1S32 B;  5BNX A;  1ID3 D;  2YFV B;  3AV1 B;  2F8N A;  2NQB B;  4XZQ A;  3X1U C;  5B33 D;  1TZY C;  3MNN B;  3KWQ A;  4J8W B;  4ZUX A;  1AOI B;  5B32 G;  1P3F D;  1BH9 A;  4HGA C;  5AVC C;  3X1V A;  5E5A C;  3REJ D;  3MGS C;  5GSU D;  3LZ0 D;  5B2J D;  3C1B B;  5B1M D;  3MVD C;  3UTA A;  3UT9 D;  4NE3 A;  5GT3 C;  1KX3 C;  4NE5 A;  5DNM A;  5BS7 C;  1M18 A;  5F99 A;  5B24 C;  5B0Z D;  3A6N B;  5CPI D;  5AY8 D;  3WKJ C;  2CWE A;  2BYK B;  5BNV B;  3AN2 B;  3WA9 C;  1H3O A;  5B32 D;  1P3B A;  4QLC D;  3AZG D;  1P34 A;  3AZK D;  4XUJ C;  1HQ3 C;  5B2I D;  2CV5 B;  4Z5T D;  1M19 A;  5AV9 B;  4J8V C;  4EO5 B;  3MGQ D;  3KUY A;  3REH B;  2NZD A;  3LEL B;  3AZL B;  2PYO B;  5DNN D;  5B33 C;  1P3M D;  4UUZ A;  4H9S C;  1P3F C;  3R45 B;  3REJ C;  4KUD B;  5GSU C;  5B0Y B;  3LZ0 C;  5B2J C;  4WU8 C;  2ARO A;  5B1M C;  1P3I D;  4X23 B;  5AV5 D;  1TZY B;  3AZH D;  5AVC B;  3AZM A;  5CPI C;  5AY8 C;  2LY8 A;  5AVB A;  4JJN D;  1M1A D;  1B67 A;  3VH6 A;  5B32 C;  4QLC C;  3AZG C;  2FJ7 D;  5B40 A;  1ZLA C;  3X1T C;  5GT3 B;  1KX3 B;  3AZJ D;  5GXQ C;  5B2I C;  3O62 D;  3UTB B;  4E45 A;  4Z5T C;  5B24 B;  4J8U A;  3WAA C;  3WKJ B;  5G49 B;  3LJA A;  1EQZ D;  3MGQ C;  5CPJ A;  5JRG B;  5CPK D;  3WA9 B;  3W97 A;  3NQU B;  1N1J A;  4Z66 A;  5DNN C;  4KGC A;  4CSR A;  4XUJ B;  1P3K B;  1P3M C;  3B6F B;  1KX5 A;  1F66 C;  4J8V B;  3W96 A;  1ID3 B;  3WTP A;  2F8N D;  5B33 B;  4YM6 C;  3B0C W;  3KWQ D;  1P3F B;  4ZUX D;  3X1S D;  3AV1 C;  3REJ B;  3W99 D;  5GSU B;  3LZ0 B;  3AZI A;  5B2J B;  3X1V D;  1M1A C;  5B1M B;  1AOI C; 
#chains in the Genus database with same CATH topology
 3UT9 B;  1P3L D;  3AZJ C;  4YS3 A;  1P3A A;  2Y2K A;  5CP6 A;  4KHA A;  5JA4 A;  5DNM D;  5B0Z B;  1M18 D;  5CPI B;  5AY8 B;  5F99 D;  1P3O A;  5CPK C;  5B32 B;  3KXB D;  4QLC B;  3AZG B;  3AZK B;  3A6N C;  5B2I B;  4Z5T B;  5BO0 A;  3AN2 C;  3AV2 D;  3REK D;  1P3G A;  1M19 D;  3MGQ B;  3REL A;  5B31 A;  5B1L A;  4H9P B;  3REI A;  2NZD D;  5DNN B;  5AV6 A;  1P3M B;  5AV9 C;  3LZ1 C;  3X1S C;  3W99 C;  2Y2Q A;  3LEL C;  4J8X A;  4AWL C;  2BYM A;  2Y2G A;  5KDM B;  3AZL C;  2NQB A;  5GT0 D;  1P3I B;  2ARO D;  3AZF A;  4G92 B;  4ZBJ C;  1P3L C;  5AV5 B;  4WNN B;  3MNN A;  4J8W A;  3W98 A;  2DQN C;  5C3I C;  3AZH B;  5AV8 D;  5F99 C;  3B6G A;  4X23 C;  3AZM D;  4R8P D;  4JJN B;  2HUE B;  1M1A B;  3AFA A;  3KXB C;  2FJ7 B;  3V9R B;  3AZJ B;  3O62 B;  1B6W A;  1TAF B;  1T3U A;  3AV2 C;  3REK C;  1P3P A;  4J8U D;  2F2A C;  4H9O B;  5BNV A;  2BYK A;  4WU9 D;  5CPK B;  1EQZ B;  4LD9 A;  2YFW B;  3UTB C;  3W97 D;  3EPK A;  2NZD C;  1U35 A;  4Z66 D;  5JRG C;  2FFF B;  1KX5 D;  3AYW A;  3AZE D;  5GT0 C;  3REH A;  1P3K C;  2F8N B;  3WTP D;  3B6F C;  2PYO A;  3KWQ B;  1ID3 C;  3LZ1 B;  4ZUX B;  3X1S B;  5AV8 C;  3W99 B;  1BH8 A;  4AWL B;  3X1V B;  4KUD A;  5B0Y A;  4R8P C;  3TU4 A;  3AZI D;  3A1K A;  4ZBJ B;  1P3L B;  3X1U A;  3B0B A;  1R4V A;  1TZY A;  4CAY B;  5C3I B;  5DNM B;  1M18 B;  2HIO D;  5B31 G;  4YS3 D;  5CP6 D;  5E5A A;  5F99 B;  4H9Q A;  2F8N H;  3MGS A;  3UT9 C;  4WU9 C;  1ULY A;  3KXB B;  3MGP A;  3MVD A;  1H3O B;  3W97 C;  5B0Z C;  5GT3 A;  1KX3 A;  1HTA A;  3AV2 B;  3REK B;  3WKJ A;  1M19 B;  2IO5 C;  3AZK C;  1P3G D;  3WA9 A;  3AZE C;  2F8N G;  3B0C T;  5B31 D;  2NZD B;  5B1L D;  3REI D;  5BT1 D;  4XUJ A;  1HQ3 A;  1KX4 D;  5AV6 D;  4UUZ B;  1A7W A;  3C1C A;  1BFM A;  2XD5 A;  3AZN A;  4H9N A;  4J8V A;  1JFI A;  3AZI C;  5GT0 B;  2ARO B;  2Y2J A;  3AZF D;  3B0D C;  2HIO C;  3W98 D;  5CP6 C;  5AV8 B;  1P3I C;  4G92 C;  3REJ A;  3AZM B;  4XZQ D;  5GSU A;  3LZ0 A;  4R8P B;  3B6G D;  5AV5 C;  2UWX A;  4WU8 A;  2ZY4 A;  3AFA D;  3AZH C;  4JJN C;  2HUE C;  3A1I A;  1WWS A;  5AY8 A;  4J8U B;  2FJ7 C;  4WU9 B;  1P3P D;  3UTA D;  3NQJ A;  5B32 A;  4LD9 D;  4QLC A;  3O62 C;  3AZG A;  3W97 B;  5B31 C;  1ZLA A;  3X1T A;  5B1L C;  4Z66 B;  1EQZ C;  1U35 D;  3VH5 A;  4CSR B;  5GXQ A;  1KX4 C;  4Z5T A;  3KSY A;  3WAA A;  3VH6 W;  1KX5 B;  2IO5 B;  1P3B D;  1P34 D;  3MGQ A;  3AZE B;  3AYW D;  3WTP B;  3MGR A;  2ZY3 A;  5FUG B;  1F66 A;  4DRB A;  3KUY D;  4XZQ C;  3F6T A;  3B6G C;  3AZI B;  3TU4 D;  3KWQ C;  2ZY2 A;  4ZUX C;  3B0D B;  4WV4 B;  3X1U D;  3X1V C;  4YM6 A;  1S32 A;  2HIO B;  2YFV A;  3AV1 A;  5CP6 B;  4YS3 B;  2JE5 A;  2RIQ A;  5E5A D;  3UTA C;  3MGS D;  3H0R C;  1M1A A;  3H0L C;  1AOI A;  5DNM C;  1M18 C;  3MGP D;  3MVD D;  3V9R A;  3AZJ A;  1TAF A;  3H0M C;  3C1B A;  5AVB D;  5BO0 B;  2G5H C;  1P3B C;  1P34 C;  1P3G B;  5CPK A;  5B40 D;  2YFW A;  4DRA A;  5B31 B;  3A6N A;  2Y2P A;  5B1L B;  3REI B;  1M19 C;  2VQR A;  5AV6 B;  1KX4 B;  1HQ3 D;  3VH5 W;  3LJA D;  4H9R B;  5CPJ D;  3AN2 A;  3KUY C;  3C1C D;  3AZN D;  2BYM B;  3TU4 C;  4KGC D;  2CV5 A;  3AZF B;  5AV9 A;  3LZ1 A;  3X1S A;  3W98 B;  3W96 D;  5BNX B;  2DF4 C;  2ARO C;  2G5I C;  4XZQ B;  3LEL A;  3W99 A;  3B6G B;  4E44 A;  3AZL A;  4WU8 D;  3AFA B;  1P3L A;  3MGP C;  3R45 A;  1BH9 B;  3AZM C;  2JCH A;  4CAY A;  2J8P A;  5AVB C;  2Y2L A;  4X23 A;  1P3P B;  4M6B A;  3UTA B;  5B40 C;  4Z2M H;  4LD9 B;  3KXB A;  2L5A A;  5AVC A;  1P3A D;  1ZLA D;  3X1T D;  4J8U C;  1U35 B;  1P3O D;  3LJA C;  3KFU G;  5GXQ D;  5CPJ C;  3AV2 A;  3REK A;  4G91 C;  1P3B B;  3WAA D;  3C1C C;  1P34 B;  3AZN C;  4Z66 C;  3AYW B;  5BS7 A;  4KGC C;  3UTB A;  5B24 A;  4Z2M G;  1KX5 C;  5G49 A;  5JRG A;  3W96 C;  3NQU A;  3MGR D;  3KUY B;  3REL D;  3WTP C;  1F66 D;  1BH8 B;  3TU4 B;  5GT0 A;  1P3K A;  3B6F A;  4NFT A;  3X1U B;  1ID3 A;  4YM6 D;  4J8X D;  1S32 D;  2NQB D;  5AV8 A;  4HGA B;  3AV1 D;  5E5A B;  4H9Q B;  4R8P A;  3MGS B;  5B33 A;  4H9S A;  3MNN D;  3EPJ A;  4J8W D;  1P3F A;  4YS3 C;  3MGP B;  3MVD B;  1P3A C;  1AOI D;  2JSS A;  3VH6 T;  5B2J A;  1P3O C;  2Y2I A;  5AVB B;  5B1M A;  3C1B D;  3UT9 A;  4WU9 A;  5B40 B;  5B0Z A;  5CPI A;  3A6N D;  2RVQ D;  1P3G C;  1HQ3 B;  3LJA B;  5CPJ B;  3MGR C;  3REL C;  4G91 B;  3AN2 D;  1N1J B;  3C1C B;  3AZK A;  3AZN B;  3REI C;  4H9N B;  5BT1 C;  4NE6 A;  3AZE A;  1JFI B;  4KGC B;  5B2I A;  5AV6 C;  3WTP E;  2CV5 D;  5AV9 D;  4J8X C;  2Y2H A;  1S32 C;  5FUG A;  3W96 B;  3LZ1 D;  2NQB C;  3REH D;  4H9P A;  3AZF C;  5DNN A;  3LEL D;  4WU8 B;  3AZL D;  1P3M A;  2PYO D;  3MNN C;  4J8W C;  3W98 C;  1PZR A;  5KDM A;  4KUD D;  2HIO A;  5B0Y D;  1P3I A;  1Q9C A;  3AFA C;  3C1B C;  5AV5 A;  4X23 D;  4WNN A;  3NQJ B;  1TZY D;  3AZH A;  1P3A B;  3VH5 T;  4KHA B;  5JA4 B;  1ZLA B;  3X1T B;  5AVC D;  2RVQ C;  1P3P C;  1P3O B;  4JJN A;  5GXQ B;  4LD9 C;  2F8N K;  1WWI A;  1Z2C B;  2FJ7 A;  3WAA B;  2ZM5 A;  5CHL B;  5GT3 D;  1U35 C;  3O62 A;  1KX3 D;  1KU5 A;  3UTB D;  2CV5 C;  5B24 D;  4UPK A;  4H9O A;  1EQZ A;  1KX4 A;  3WKJ D;  4EO5 C;  3AYW C;  4H9R A;  3MGR B;  3REL B;  5JRG D;  3WA9 D;  1F1E A;  3REH C;  1F66 B;  2PYO C;  4XUJ D;  3FDD A;  1P3K D;  1W2E A;  3B6F D;  3IP4 C;  4KUD C;  4YM6 B;  4J8V D;  5B0Y C;  4J8X B;  4WZS B;  1S32 B;  5BNX A;  1ID3 D;  2YFV B;  3AV1 B;  2F8N A;  2NQB B;  4XZQ A;  3X1U C;  5B33 D;  1TZY C;  3MNN B;  3KWQ A;  4J8W B;  4ZUX A;  1AOI B;  5B32 G;  1P3F D;  1BH9 A;  4HGA C;  5AVC C;  3X1V A;  5E5A C;  3REJ D;  3MGS C;  5GSU D;  3LZ0 D;  5B2J D;  3C1B B;  2Y2M A;  5B1M D;  3MVD C;  3UTA A;  3UT9 D;  4NE3 A;  5GT3 C;  1KX3 C;  4NE5 A;  5DNM A;  5BS7 C;  1M18 A;  5F99 A;  5B24 C;  5B0Z D;  3A6N B;  5CPI D;  5AY8 D;  3WKJ C;  2CWE A;  2BYK B;  5BNV B;  3AN2 B;  3WA9 C;  1H3O A;  5B32 D;  1P3B A;  4QLC D;  3AZG D;  1P34 A;  3AZK D;  4XUJ C;  1HQ3 C;  3EPH A;  5B2I D;  2CV5 B;  4Z5T D;  1M19 A;  5AV9 B;  4J8V C;  4EO5 B;  3MGQ D;  3KUY A;  4WJ3 C;  3REH B;  2NZD A;  2BG1 A;  3LEL B;  3AZL B;  2PYO B;  5DNN D;  5B33 C;  1P3M D;  4UUZ A;  4H9S C;  1P3F C;  3R45 B;  3AL0 C;  3REJ C;  4KUD B;  5GSU C;  5B0Y B;  3LZ0 C;  5B2J C;  4WU8 C;  2ARO A;  2XD1 A;  2Y2N A;  5B1M C;  1P3I D;  2W8S A;  4X23 B;  5AV5 D;  1TZY B;  3AZH D;  3P5J B;  5AVC B;  3AZM A;  3EG5 B;  5CPI C;  5AY8 C;  4DQY B;  2LY8 A;  5AVB A;  4JJN D;  1M1A D;  1B67 A;  3VH6 A;  5B32 C;  4QLC C;  3AZG C;  2FJ7 D;  5B40 A;  1ZLA C;  3X1T C;  5GT3 B;  1KX3 B;  3AZJ D;  5GXQ C;  5B2I C;  3O62 D;  3UTB B;  4E45 A;  4Z5T C;  5B24 B;  4J8U A;  3WAA C;  3WKJ B;  5G49 B;  3LJA A;  3EPL A;  1EQZ D;  3MGQ C;  5CPJ A;  5JRG B;  5CPK D;  3WA9 B;  3W97 A;  3NQU B;  1N1J A;  4Z66 A;  5DNN C;  4KGC A;  4CSR A;  4XUJ B;  1P3K B;  1P3M C;  3B6F B;  1KX5 A;  1F66 C;  4J8V B;  3W96 A;  1ID3 B;  2ZY5 A;  3WTP A;  2F8N D;  2Y2O A;  5B33 B;  4YM6 C;  3B0C W;  3KWQ D;  1P3F B;  4ZUX D;  3X1S D;  3AV1 C;  3REJ B;  3W99 D;  5GSU B;  3LZ0 B;  3AZI A;  5B2J B;  3X1V D;  1M1A C;  5B1M B;  1AOI C; 
#chains in the Genus database with same CATH homology
 3UT9 B;  1P3L D;  3AZJ C;  4YS3 A;  1P3A A;  2Y2K A;  5CP6 A;  4KHA A;  5JA4 A;  5DNM D;  5B0Z B;  1M18 D;  5CPI B;  5AY8 B;  5F99 D;  1P3O A;  5CPK C;  5B32 B;  3KXB D;  4QLC B;  3AZG B;  3AZK B;  3A6N C;  5B2I B;  4Z5T B;  5BO0 A;  3AN2 C;  3AV2 D;  3REK D;  1P3G A;  1M19 D;  3MGQ B;  3REL A;  5B31 A;  5B1L A;  4H9P B;  3REI A;  2NZD D;  5DNN B;  5AV6 A;  1P3M B;  5AV9 C;  3LZ1 C;  3X1S C;  3W99 C;  2Y2Q A;  3LEL C;  4J8X A;  4AWL C;  2BYM A;  2Y2G A;  5KDM B;  3AZL C;  2NQB A;  5GT0 D;  1P3I B;  2ARO D;  3AZF A;  4G92 B;  4ZBJ C;  1P3L C;  5AV5 B;  4WNN B;  3MNN A;  4J8W A;  3W98 A;  2DQN C;  5C3I C;  3AZH B;  5AV8 D;  5F99 C;  3B6G A;  4X23 C;  3AZM D;  4R8P D;  4JJN B;  2HUE B;  1M1A B;  3AFA A;  3KXB C;  2FJ7 B;  3V9R B;  3AZJ B;  3O62 B;  1B6W A;  1TAF B;  1T3U A;  3AV2 C;  3REK C;  1P3P A;  4J8U D;  2F2A C;  4H9O B;  5BNV A;  2BYK A;  4WU9 D;  5CPK B;  1EQZ B;  4LD9 A;  2YFW B;  3UTB C;  3W97 D;  3EPK A;  2NZD C;  1U35 A;  4Z66 D;  5JRG C;  2FFF B;  1KX5 D;  3AYW A;  3AZE D;  5GT0 C;  3REH A;  1P3K C;  2F8N B;  3WTP D;  3B6F C;  2PYO A;  3KWQ B;  1ID3 C;  3LZ1 B;  4ZUX B;  3X1S B;  5AV8 C;  3W99 B;  1BH8 A;  4AWL B;  3X1V B;  4KUD A;  5B0Y A;  4R8P C;  3TU4 A;  3AZI D;  3A1K A;  4ZBJ B;  1P3L B;  3X1U A;  3B0B A;  1R4V A;  1TZY A;  4CAY B;  5C3I B;  5DNM B;  1M18 B;  2HIO D;  5B31 G;  4YS3 D;  5CP6 D;  5E5A A;  5F99 B;  4H9Q A;  2F8N H;  3MGS A;  3UT9 C;  4WU9 C;  1ULY A;  3KXB B;  3MGP A;  3MVD A;  1H3O B;  3W97 C;  5B0Z C;  5GT3 A;  1KX3 A;  1HTA A;  3AV2 B;  3REK B;  3WKJ A;  1M19 B;  2IO5 C;  3AZK C;  1P3G D;  3WA9 A;  3AZE C;  2F8N G;  3B0C T;  5B31 D;  2NZD B;  5B1L D;  3REI D;  5BT1 D;  4XUJ A;  1HQ3 A;  1KX4 D;  5AV6 D;  4UUZ B;  1A7W A;  3C1C A;  1BFM A;  2XD5 A;  3AZN A;  4H9N A;  4J8V A;  1JFI A;  3AZI C;  5GT0 B;  2ARO B;  2Y2J A;  3AZF D;  3B0D C;  2HIO C;  3W98 D;  5CP6 C;  5AV8 B;  1P3I C;  4G92 C;  3REJ A;  3AZM B;  4XZQ D;  5GSU A;  3LZ0 A;  4R8P B;  3B6G D;  5AV5 C;  2UWX A;  4WU8 A;  2ZY4 A;  3AFA D;  3AZH C;  4JJN C;  2HUE C;  3A1I A;  1WWS A;  5AY8 A;  4J8U B;  2FJ7 C;  4WU9 B;  1P3P D;  3UTA D;  3NQJ A;  5B32 A;  4LD9 D;  4QLC A;  3O62 C;  3AZG A;  3W97 B;  5B31 C;  1ZLA A;  3X1T A;  5B1L C;  4Z66 B;  1EQZ C;  1U35 D;  3VH5 A;  4CSR B;  5GXQ A;  1KX4 C;  4Z5T A;  3KSY A;  3WAA A;  3VH6 W;  1KX5 B;  2IO5 B;  1P3B D;  1P34 D;  3MGQ A;  3AZE B;  3AYW D;  3WTP B;  3MGR A;  2ZY3 A;  5FUG B;  1F66 A;  4DRB A;  3KUY D;  4XZQ C;  3F6T A;  3B6G C;  3AZI B;  3TU4 D;  3KWQ C;  2ZY2 A;  4ZUX C;  3B0D B;  4WV4 B;  3X1U D;  3X1V C;  4YM6 A;  1S32 A;  2HIO B;  2YFV A;  3AV1 A;  5CP6 B;  4YS3 B;  2JE5 A;  2RIQ A;  5E5A D;  3UTA C;  3MGS D;  3H0R C;  1M1A A;  3H0L C;  1AOI A;  5DNM C;  1M18 C;  3MGP D;  3MVD D;  3V9R A;  3AZJ A;  1TAF A;  3H0M C;  3C1B A;  5AVB D;  5BO0 B;  2G5H C;  1P3B C;  1P34 C;  1P3G B;  5CPK A;  5B40 D;  2YFW A;  4DRA A;  5B31 B;  3A6N A;  2Y2P A;  5B1L B;  3REI B;  1M19 C;  2VQR A;  5AV6 B;  1KX4 B;  1HQ3 D;  3VH5 W;  3LJA D;  4H9R B;  5CPJ D;  3AN2 A;  3KUY C;  3C1C D;  3AZN D;  2BYM B;  3TU4 C;  4KGC D;  2CV5 A;  3AZF B;  5AV9 A;  3LZ1 A;  3X1S A;  3W98 B;  3W96 D;  5BNX B;  2DF4 C;  2ARO C;  2G5I C;  4XZQ B;  3LEL A;  3W99 A;  3B6G B;  4E44 A;  3AZL A;  4WU8 D;  3AFA B;  1P3L A;  3MGP C;  3R45 A;  1BH9 B;  3AZM C;  2JCH A;  4CAY A;  2J8P A;  5AVB C;  2Y2L A;  4X23 A;  1P3P B;  4M6B A;  3UTA B;  5B40 C;  4Z2M H;  4LD9 B;  3KXB A;  2L5A A;  5AVC A;  1P3A D;  1ZLA D;  3X1T D;  4J8U C;  1U35 B;  1P3O D;  3LJA C;  3KFU G;  5GXQ D;  5CPJ C;  3AV2 A;  3REK A;  4G91 C;  1P3B B;  3WAA D;  3C1C C;  1P34 B;  3AZN C;  4Z66 C;  3AYW B;  5BS7 A;  4KGC C;  3UTB A;  5B24 A;  4Z2M G;  1KX5 C;  5G49 A;  5JRG A;  3W96 C;  3NQU A;  3MGR D;  3KUY B;  3REL D;  3WTP C;  1F66 D;  1BH8 B;  3TU4 B;  5GT0 A;  1P3K A;  3B6F A;  4NFT A;  3X1U B;  1ID3 A;  4YM6 D;  4J8X D;  1S32 D;  2NQB D;  5AV8 A;  4HGA B;  3AV1 D;  5E5A B;  4H9Q B;  4R8P A;  3MGS B;  5B33 A;  4H9S A;  3MNN D;  3EPJ A;  4J8W D;  1P3F A;  4YS3 C;  3MGP B;  3MVD B;  1P3A C;  1AOI D;  2JSS A;  3VH6 T;  5B2J A;  1P3O C;  2Y2I A;  5AVB B;  5B1M A;  3C1B D;  3UT9 A;  4WU9 A;  5B40 B;  5B0Z A;  5CPI A;  3A6N D;  2RVQ D;  1P3G C;  1HQ3 B;  3LJA B;  5CPJ B;  3MGR C;  3REL C;  4G91 B;  3AN2 D;  1N1J B;  3C1C B;  3AZK A;  3AZN B;  3REI C;  4H9N B;  5BT1 C;  4NE6 A;  3AZE A;  1JFI B;  4KGC B;  5B2I A;  5AV6 C;  3WTP E;  2CV5 D;  5AV9 D;  4J8X C;  2Y2H A;  1S32 C;  5FUG A;  3W96 B;  3LZ1 D;  2NQB C;  3REH D;  4H9P A;  3AZF C;  5DNN A;  3LEL D;  4WU8 B;  3AZL D;  1P3M A;  2PYO D;  3MNN C;  4J8W C;  3W98 C;  1PZR A;  5KDM A;  4KUD D;  2HIO A;  5B0Y D;  1P3I A;  1Q9C A;  3AFA C;  3C1B C;  5AV5 A;  4X23 D;  4WNN A;  3NQJ B;  1TZY D;  3AZH A;  1P3A B;  3VH5 T;  4KHA B;  5JA4 B;  1ZLA B;  3X1T B;  5AVC D;  2RVQ C;  1P3P C;  1P3O B;  4JJN A;  5GXQ B;  4LD9 C;  2F8N K;  1WWI A;  1Z2C B;  2FJ7 A;  3WAA B;  2ZM5 A;  5CHL B;  5GT3 D;  1U35 C;  3O62 A;  1KX3 D;  1KU5 A;  3UTB D;  2CV5 C;  5B24 D;  4UPK A;  4H9O A;  1EQZ A;  1KX4 A;  3WKJ D;  4EO5 C;  3AYW C;  4H9R A;  3MGR B;  3REL B;  5JRG D;  3WA9 D;  1F1E A;  3REH C;  1F66 B;  2PYO C;  4XUJ D;  3FDD A;  1P3K D;  1W2E A;  3B6F D;  3IP4 C;  4KUD C;  4YM6 B;  4J8V D;  5B0Y C;  4J8X B;  4WZS B;  1S32 B;  5BNX A;  1ID3 D;  2YFV B;  3AV1 B;  2F8N A;  2NQB B;  4XZQ A;  3X1U C;  5B33 D;  1TZY C;  3MNN B;  3KWQ A;  4J8W B;  4ZUX A;  1AOI B;  5B32 G;  1P3F D;  1BH9 A;  4HGA C;  5AVC C;  3X1V A;  5E5A C;  3REJ D;  3MGS C;  5GSU D;  3LZ0 D;  5B2J D;  3C1B B;  2Y2M A;  5B1M D;  3MVD C;  3UTA A;  3UT9 D;  4NE3 A;  5GT3 C;  1KX3 C;  4NE5 A;  5DNM A;  5BS7 C;  1M18 A;  5F99 A;  5B24 C;  5B0Z D;  3A6N B;  5CPI D;  5AY8 D;  3WKJ C;  2CWE A;  2BYK B;  5BNV B;  3AN2 B;  3WA9 C;  1H3O A;  5B32 D;  1P3B A;  4QLC D;  3AZG D;  1P34 A;  3AZK D;  4XUJ C;  1HQ3 C;  3EPH A;  5B2I D;  2CV5 B;  4Z5T D;  1M19 A;  5AV9 B;  4J8V C;  4EO5 B;  3MGQ D;  3KUY A;  4WJ3 C;  3REH B;  2NZD A;  2BG1 A;  3LEL B;  3AZL B;  2PYO B;  5DNN D;  5B33 C;  1P3M D;  4UUZ A;  4H9S C;  1P3F C;  3R45 B;  3AL0 C;  3REJ C;  4KUD B;  5GSU C;  5B0Y B;  3LZ0 C;  5B2J C;  4WU8 C;  2ARO A;  2XD1 A;  2Y2N A;  5B1M C;  1P3I D;  2W8S A;  4X23 B;  5AV5 D;  1TZY B;  3AZH D;  3P5J B;  5AVC B;  3AZM A;  3EG5 B;  5CPI C;  5AY8 C;  4DQY B;  2LY8 A;  5AVB A;  4JJN D;  1M1A D;  1B67 A;  3VH6 A;  5B32 C;  4QLC C;  3AZG C;  2FJ7 D;  5B40 A;  1ZLA C;  3X1T C;  5GT3 B;  1KX3 B;  3AZJ D;  5GXQ C;  5B2I C;  3O62 D;  3UTB B;  4E45 A;  4Z5T C;  5B24 B;  4J8U A;  3WAA C;  3WKJ B;  5G49 B;  3LJA A;  3EPL A;  1EQZ D;  3MGQ C;  5CPJ A;  5JRG B;  5CPK D;  3WA9 B;  3W97 A;  3NQU B;  1N1J A;  4Z66 A;  5DNN C;  4KGC A;  4CSR A;  4XUJ B;  1P3K B;  1P3M C;  3B6F B;  1KX5 A;  1F66 C;  4J8V B;  3W96 A;  1ID3 B;  2ZY5 A;  3WTP A;  2F8N D;  2Y2O A;  5B33 B;  4YM6 C;  3B0C W;  3KWQ D;  1P3F B;  4ZUX D;  3X1S D;  3AV1 C;  3REJ B;  3W99 D;  5GSU B;  3LZ0 B;  3AZI A;  5B2J B;  3X1V D;  1M1A C;  5B1M B;  1AOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...