3MVDD

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
b'TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdD00
5B2JC 4XUJA 3UT9A 1ID3D 3B6FA 1P34B 3C1CB 4ZUXC 1TAFB 1P3FD 4NE6A 5B1MD 3AZFD 5C3IC 1M1AB 4CSRB 3AN2D 4KUDD 3AZMB 2NZDA 5AV8D 3AZEB 1P3GA 1KX4A 4EO5B 3LJAC 2CWEA 5B2IA 1P3MB 5FUGA 4R8PC 5GSUA 3LZ1D 3MNNB 5B24A 3AYWA 5CPJD 5AV9D 1F66D 3AYWC 5AVBA 3AZHB 3TU4A 5BT1D 5AVBC 1P34C 3C1CC 5AV5C 3TU4C 2HIOB 1KX3A 5CPIA 5CPIC 1P3AD 2AROC 1M1AC 3REKB 3X1SB 3AZGD 3AZJD 1H3OA 3C1BC 3W97C 3WAAD 4EO5C 1ULYA 5DNND 4WNNB 5GXQB 5BNXB 5GT0A 5GT0C 3VH5A 3WA9D 3AV1D 5AY8D 2BYMB 1P3PA 2CV5D 4KUDB 3MNNC 1M19D 4WU8A 3REHA 1F1EA 3REHC 1P3IA 3AZHC 1R4VA 4H9QB 5B2JD 5BO0B 3O62A 4ZUXD 1KX5B 3X1TD 3O62C 1BH9B 3X1SC 3LZ1B 3MGPD 2FJ7A 4E45A 5CPJB 2FJ7C 4WU9B 5AV9B 3AZIA 3UTAA 4KGCA 5GXQC 3KWQA 4J8XA 3AZIC 3KXBC 2F8NB 4KGCC 5B0ZC 4J8XC 5B32B 3LJAD 2BYKA 3MVDA 1P3BB 5CPKC 1P3AB 2HUEC 5JA4B 3WTPE 2NQBD 5JRGC 3LELA 4J8WB 4Z5TA 4R8PD 4Z5TC 4Z2MG 5E5AB 1M18A 3B6GA 3AZNB 1M18C 3B6GC 1P34D 2F8NK 4Z66A 3C1CD 3AV1B 5AV5D 4DRAA 1HQ3A 1HQ3C 3A6NB 1M19B 2AROD 1M1AD 4YM6A 4WU9C 1U35C 3NQJA 4YM6C 2L5AA 3AZED 5B33A 5B32C 4NE5A 3W98A 3W98C 4ZUXB 4J8WC 3B0CW 3W96A 5GT3A 5B31G 4XZQA 4JJNA 3MNND 4XZQC 3KUYA 4JJNC 5DNMC 3KUYC 2NZDB 3AZHD 1P3GB 3X1UA 3UTBA 2PYOC 2RVQC 5AV6A 3WTPC 3UTBC 5B2IB 1EQZA 4KHAA 3A6NC 3MGSC 4R8PB 5B1LA 5BS7A 3X1SD 3AV2C 4LD9A 5GSUB 4AWLC 4WV4B 5B24B 3AYWB 4XUJC 3UT9C 3REIA 5GXQD 5AVBB 3KXBD 5AV5B 3B6FC 3TU4B 5B0ZD 3X1VA 5F99A 3RELA 1TZYA 5CPKD 5CPIB 4X23A 3B0CT 2AROB 5JRGD 1S32A 5KDMA 3V9RB 2CV5A 2F8NG 2NZDC 1P3GC 3C1BB 3W97B 2YFWB 1H3OB 1KX4C 5B2IC 5GT0B 3LZ0A 4YS3A 1AOIA 1KX5D 3LZ0C 5B40A 5GSUC 3MGQA 4NFTA 3MGRA 3AFAA 4HGAC 1ZLAA 4WU8B 3MGRC 4WU9D 5B24C 3REHB 1U35D 1P3IB 1N1JA 2F8ND 4J8VA 5B32D 3AZKA 1KX3C 1P3BD 5CP6A 3O62B 1P3LA 5CP6C 4G92C 3REJA 4J8WD 3WKJA 4J8UA 1BH8A 4UUZA 2FJ7B 2F8NH 5E5AD 3AZIB 4KGCB 5DNMD 3KXBB 3AZND 5B0ZB 2YFVA 4J8XB 2PYOD 2RVQD 3WTPD 5CPKB 2BYKB 2HUEB 1P3OA 5JRGB 3A6ND 1P3PC 3VH5W 3LELB 4WU8C 1P3KA 4Z5TB 3AV2D 1P3IC 1P3KC 3AZMA 3W99A 1KU5A 4XUJD 3UT9D 1M18B 3B6GB 3W99C 3B6FD 4H9PA 1P3MA 4NE3A 1HQ3B 1JFIA 1U35B 4YM6B 3VH6A 3NQJB 3UTAC 4H9RB 2NZDD 1P3GD 3KWQC 1KX4D 4QLCA 5B0YA 5B2ID 3W98B 3MVDC 4QLCC 2HIOA 3LELC 3VH5T 3AZLA 5GSUD 4XZQB 3REKA 5AVCA 3AZLC 4JJNB 5BNVA 5B24D 5DNMB 3NQUB 5B31A 3KUYB 3AYWD 2PYOB 5AVBD 1ID3A 3WTPB 3X1UB 3UTBB 3TU4D 4Z66C 5BNXA 1KX3D 5CPID 1P3FA 1EQZB 3MGSB 4KHAB 5B1MA 3AZFA 3AV2B 2BYMA 3AN2A 4KUDA 4LD9B 4AWLB 5B33C 3C1BD 5AV8A 3W97D 3KSYA 4XUJB 3UT9B 5G49A 3B6FB 4H9NA 5GT0D 3X1VB 5F99B 3RELB 3W96C 5GT3C 1KX5A 4X23B 4WZSB 1BH9A 2IO5C 3LZ1A 5KDMB 4WU8D 3REHD 1P3ID 5CPJA 5AV9A 1F66A 1KX4B 3X1UC 1F66C 5AV6C 4E44A 1EQZC 3O62D 3LZ0B 4YS3B 5FUGB 1P3AA 5B1LC 5BS7C 4LD9C 3MGQB 4HGAB 3MGRB 2FJ7D 3AZGA 3AZJA 3WAAA 3AZID 3UTAD 4KGCD 3AZGC 1N1JB 3REIC 4H9SA 5DNNA 3KWQD 4J8XD 4J8VB 1KX3B 2JSSA 3X1VC 5F99C 3AZKB 3MVDD 1TZYC 3RELC 3AV1A 3WA9A 5AY8A 5CP6B 4X23C 3WA9C 4G92B 1P3LB 3LELD 1S32C 3REJB 4Z5TD 4J8UB 1M19A 2CV5C 5B32G 4UUZB 1HTAA 5B2JA 1M18D 3B6GD 2YFVB 4CAYA 4Z66D 4YS3C 1AOIC 4ZUXA 3X1TA 1P3OB 1HQ3D 1P3PB 3X1TC 5B40C 3MGQC 4M6BA 3AFAC 3MGPA 1Q9CA 4YM6D 1ZLAC 1P3KB 3MGPC 4ZBJB 5B33D 4J8VC 3W99B 3LJAA 3AZKC 3W98D 4H9OA 1P3LC 4H9PB 2NQBA 3REJC 3WKJC 3W96D 3R45A 5GT3D 4J8UC 2NQBC 4R8PA 1B67A 1JFIB 4XZQD 4JJND 3UTAB 3KUYD 3KWQB 3X1UD 3UTBD 5AV6D 1P34A 3MVDB 3C1CA 5B0YB 5AV5A 4QLCB 1TAFA 1P3OC 1EQZD 3MGSD 2AROA 5B1LD 1M1AA 4CSRA 3AZLB 3B0DB 4LD9D 4ZBJC 3V9RA 5AVCB 3AZMC 3AZEA 5BNVB 5B31B 3AZEC 3C1BA 3W97A 2YFWA 3REID 1ID3B 4Z66B 3X1VD 5F99D 4DRBA 1P3MC 3RELD 1TZYD 4G91B 1P3FB 4X23D 5B1MB 3AZFB 1S32D 3MNNA 3AN2B 5B33B 5AV8B 3AZHA 3VH6W 3B0BA 5G49B 5B0YC 4H9NB 2HIOC 3LZ0D 4YS3D 1AOID 3W96B 5GT3B 3X1SA 3B0DC 2IO5B 5B40D 3MGQD 3REKC 3MGRD 5AVCC 3AFAD 1ZLAD 5B31C 1F66B 1ID3C 5AV6B 4WNNA 5GXQA 3KXBA 4J8VD 5B0ZA 3AZKD 4G91C 1P3FC 5CP6D 5CPKA 1WWIA 1P3LD 5B1LB 5B1MC 3AZFC 5JRGA 3REJD 3WKJD 4J8UD 3AN2C 4KUDC 5AV8C 2LY8A 3AZGB 3AZJB 4H9QA 3REIB 3VH6T 3WAAB 5BO0A 5DNNB 1TZYB 3WA9B 1P3OD 1P3PD 5AY8B 1KX5C 1S32B 3LZ1C 2CV5B 1P3KD 4WU9A 1A7WA 1U35A 5CPJC 5AV9C 3AZMD 4H9RA 2F8NA 5BT1C 3W99D 5B2JB 5B32A 1P3BA 1AOIB 4CAYB 1P3BC 5JA4A 1P3AC 1BFMA 1P3MD 3X1TB 5B40B 4J8WA 3AFAB 1ZLAB 5CHLB 5C3IB 3MGPB 3AZJC 3WAAC 4Z2MH 5E5AA 1B6WA 5DNMA 3NQUA 4H9SC 5DNNC 3AZNA 5E5AC 3AZNC 2PYOA 4QLCD 5B0YD 3WTPA 3LJAB 3AV1C 5AY8C 2HIOD 4H9OB 3WKJB 1WWSA 2NQBB 3A6NA 1BH8B 3MGSA 3R45B 1M19C 3AZLD 3AV2A 3REKD 5AVCD 5B31D
chains in the Genus database with same CATH superfamily
5B2JC 4XUJA 3UT9A 1ID3D 3B6FA 1P34B 3C1CB 4ZUXC 2DQNC 1TAFB 1P3FD 4NE6A 2Y2HA 5B1MD 3AZFD 5C3IC 1M1AB 4CSRB 3AN2D 4KUDD 1T3UA 3AZMB 2NZDA 5AV8D 3AZEB 1P3GA 2Y2LA 1KX4A 4EO5B 3LJAC 2CWEA 5B2IA 1P3MB 5FUGA 4R8PC 5GSUA 3LZ1D 3MNNB 5B24A 3AYWA 5CPJD 5AV9D 1F66D 3AYWC 5AVBA 3AZHB 3TU4A 5BT1D 5AVBC 1P34C 3C1CC 5AV5C 2G5IC 3TU4C 2HIOB 1KX3A 5CPIA 5CPIC 1P3AD 3AL0C 2AROC 1M1AC 3REKB 3X1SB 3AZGD 3AZJD 1H3OA 3C1BC 3W97C 3WAAD 4EO5C 2JE5A 1ULYA 3A1KA 3A1IA 4WNNB 5GXQB 5DNND 5BNXB 5GT0A 5GT0C 3VH5A 3WA9D 3AV1D 5AY8D 2BYMB 1P3PA 2CV5D 4KUDB 3MNNC 3P5JB 4WU8A 3REHA 1F1EA 1M19D 3REHC 1P3IA 3AZHC 1R4VA 4H9QB 5B2JD 5BO0B 3O62A 3EPKA 4ZUXD 1KX5B 3X1TD 3O62C 1BH9B 3X1SC 3LZ1B 3MGPD 2FJ7A 4E45A 5CPJB 2FJ7C 4WU9B 5AV9B 3AZIA 3UTAA 4KGCA 5GXQC 3KWQA 4J8XA 3AZIC 3KXBC 2F8NB 4KGCC 5B0ZC 4J8XC 5B32B 3LJAD 2BYKA 3MVDA 1P3BB 5CPKC 1P3AB 2HUEC 5JA4B 3WTPE 2NQBD 5JRGC 2Y2IA 3LELA 4J8WB 4Z5TA 4R8PD 4Z5TC 4Z2MG 5E5AB 1M18A 3B6GA 3AZNB 2DF4C 1M18C 3B6GC 2FFFB 1P34D 2F8NK 4Z66A 3C1CD 3AV1B 5AV5D 4DRAA 1HQ3A 1HQ3C 3A6NB 1M19B 2AROD 1M1AD 4YM6A 4WU9C 1U35C 3NQJA 4YM6C 2L5AA 3AZED 5B33A 2ZY2A 5B32C 4NE5A 3W98A 3W98C 4ZUXB 4J8WC 3B0CW 3W96A 5GT3A 5B31G 4XZQA 4JJNA 3MNND 4XZQC 4DQYB 3KUYA 4JJNC 5DNMC 3KUYC 2ZM5A 2NZDB 3AZHD 1P3GB 3X1UA 3UTBA 2PYOC 2RVQC 5AV6A 3WTPC 3UTBC 5B2IB 1EQZA 4KHAA 3A6NC 3MGSC 4R8PB 5B1LA 5BS7A 3X1SD 3AV2C 4LD9A 5GSUB 3EPHA 4AWLC 4WV4B 5B24B 3AYWB 2VQRA 4XUJC 3UT9C 3REIA 5GXQD 5AVBB 3KXBD 5AV5B 3B6FC 3TU4B 5B0ZD 3X1VA 5F99A 3RELA 1TZYA 5CPKD 5CPIB 4X23A 3B0CT 2AROB 5JRGD 1S32A 5KDMA 3V9RB 2Y2PA 2CV5A 2F8NG 2NZDC 1P3GC 3C1BB 3W97B 2YFWB 1H3OB 1KX4C 5B2IC 5GT0B 3LZ0A 4YS3A 1AOIA 1KX5D 3F6TA 3LZ0C 5B40A 5GSUC 3MGQA 4NFTA 3MGRA 3AFAA 4HGAC 1ZLAA 4WU8B 3MGRC 4WU9D 5B24C 2Y2MA 3REHB 1U35D 1P3IB 1N1JA 2F8ND 4J8VA 5B32D 3AZKA 1KX3C 1P3BD 5CP6A 3O62B 1P3LA 5CP6C 4G92C 3REJA 4J8WD 3WKJA 4J8UA 1BH8A 4UUZA 2FJ7B 2F8NH 5E5AD 3AZIB 4KGCB 5DNMD 3KXBB 3AZND 5B0ZB 2YFVA 4J8XB 2PYOD 2RVQD 3WTPD 5CPKB 2BYKB 2HUEB 1P3OA 5JRGB 3A6ND 1P3PC 3VH5W 3LELB 4WU8C 1P3KA 4Z5TB 3AV2D 1P3IC 1P3KC 3AZMA 3W99A 1KU5A 4XUJD 3UT9D 1M18B 3B6GB 3W99C 3B6FD 4H9PA 1P3MA 4NE3A 1HQ3B 1JFIA 1U35B 4YM6B 3VH6A 3NQJB 3UTAC 4H9RB 2NZDD 1P3GD 3KWQC 1KX4D 4QLCA 5B0YA 5B2ID 3W98B 3MVDC 4QLCC 2HIOA 3EPLA 3LELC 3VH5T 3FDDA 3AZLA 5GSUD 4XZQB 3REKA 5AVCA 3AZLC 4JJNB 3IP4C 5BNVA 5B24D 5DNMB 3NQUB 5B31A 3KUYB 3AYWD 2PYOB 5AVBD 1ID3A 3WTPB 3X1UB 3UTBB 3TU4D 4Z66C 5BNXA 1KX3D 5CPID 1P3FA 1EQZB 3MGSB 4KHAB 5B1MA 3AZFA 3AV2B 2XD1A 2BYMA 3AN2A 4KUDA 3EPJA 4AWLB 4LD9B 5B33C 3C1BD 5AV8A 3W97D 3KSYA 4XUJB 3UT9B 5G49A 3B6FB 4H9NA 5GT0D 3X1VB 5F99B 3RELB 3W96C 5GT3C 1KX5A 4X23B 4WZSB 1BH9A 2IO5C 3LZ1A 5KDMB 4WU8D 3REHD 1P3ID 5CPJA 5AV9A 1F66A 1KX4B 3X1UC 1F66C 5AV6C 3H0RC 4E44A 2RIQA 3EG5B 1EQZC 3O62D 3LZ0B 4YS3B 5FUGB 1P3AA 2F2AC 2Y2KA 5B1LC 5BS7C 4LD9C 3MGQB 4HGAB 3MGRB 2FJ7D 3AZGA 3AZJA 3WAAA 3AZID 3UTAD 4KGCD 3AZGC 1N1JB 3REIC 4H9SA 5DNNA 3KWQD 4J8XD 4J8VB 1KX3B 2JSSA 3X1VC 5F99C 3AZKB 3MVDD 1TZYC 3RELC 3AV1A 3WA9A 5AY8A 5CP6B 4X23C 3WA9C 4G92B 1P3LB 3LELD 1S32C 3REJB 4UPKA 4Z5TD 4J8UB 1M19A 2CV5C 5B32G 4UUZB 2G5HC 1HTAA 5B2JA 1M18D 3B6GD 2YFVB 4CAYA 4Z66D 4YS3C 1AOIC 4ZUXA 3X1TA 1P3OB 1HQ3D 1P3PB 3X1TC 5B40C 3MGQC 4M6BA 3AFAC 2Y2NA 1Q9CA 4YM6D 3MGPA 1ZLAC 1P3KB 3MGPC 4ZBJB 5B33D 2Y2QA 4J8VC 2UWXA 3W99B 3LJAA 3AZKC 3W98D 4H9OA 1P3LC 4H9PB 2NQBA 3REJC 3WKJC 3W96D 3R45A 5GT3D 4J8UC 2NQBC 4R8PA 1B67A 1JFIB 4XZQD 2JCHA 4JJND 1Z2CB 3UTAB 3KUYD 3KWQB 2W8SA 3X1UD 3UTBD 5AV6D 1P34A 3MVDB 3C1CA 5B0YB 5AV5A 4QLCB 1TAFA 1P3OC 1EQZD 3MGSD 2AROA 5B1LD 1M1AA 4CSRA 3AZLB 3B0DB 4LD9D 4ZBJC 3V9RA 5AVCB 3AZMC 3AZEA 2Y2OA 5BNVB 5B31B 3AZEC 3C1BA 3W97A 2YFWA 2Y2GA 3REID 1ID3B 4Z66B 3X1VD 5F99D 4DRBA 1P3MC 3RELD 1TZYD 4G91B 1P3FB 4X23D 2Y2JA 5B1MB 3AZFB 1S32D 3MNNA 3AN2B 5B33B 5AV8B 3AZHA 3VH6W 3B0BA 5G49B 5B0YC 4H9NB 2HIOC 3LZ0D 4YS3D 1AOID 3W96B 5GT3B 3KFUG 3X1SA 3B0DC 2IO5B 5B40D 3MGQD 3REKC 3MGRD 5AVCC 3AFAD 1ZLAD 3H0LC 5B31C 1F66B 1ID3C 5AV6B 4WNNA 5GXQA 3KXBA 4J8VD 5B0ZA 3AZKD 4G91C 1P3FC 5CP6D 5CPKA 1WWIA 1P3LD 5B1LB 5B1MC 3AZFC 5JRGA 3REJD 3WKJD 1PZRA 4J8UD 3AN2C 2BG1A 4KUDC 2ZY3A 5AV8C 2LY8A 3AZGB 3AZJB 4H9QA 3REIB 3VH6T 3WAAB 5BO0A 5DNNB 1TZYB 3WA9B 2XD5A 1P3OD 1P3PD 5AY8B 1KX5C 4WJ3C 1S32B 3LZ1C 2CV5B 1P3KD 4WU9A 1A7WA 1U35A 5CPJC 2ZY4A 5AV9C 3AZMD 4H9RA 2F8NA 5BT1C 3W99D 5B2JB 5B32A 1P3BA 1AOIB 4CAYB 1P3BC 5JA4A 2J8PA 1P3AC 1P3MD 1BFMA 3X1TB 5B40B 4J8WA 3AFAB 1ZLAB 5CHLB 1W2EA 5C3IB 3MGPB 3AZJC 3WAAC 4Z2MH 3H0MC 5E5AA 1B6WA 5DNMA 3NQUA 4H9SC 5DNNC 3AZNA 5E5AC 3AZNC 2PYOA 4QLCD 5B0YD 3WTPA 3LJAB 3AV1C 5AY8C 2HIOD 4H9OB 3WKJB 1WWSA 2NQBB 3A6NA 1BH8B 3MGSA 2ZY5A 3R45B 1M19C 3AZLD 3AV2A 3REKD 5AVCD 5B31D
chains in the Genus database with same CATH topology
5B2JC 4XUJA 3UT9A 1ID3D 3B6FA 1P34B 3C1CB 4ZUXC 2DQNC 1TAFB 1P3FD 4NE6A 2Y2HA 5B1MD 3AZFD 5C3IC 1M1AB 4CSRB 3AN2D 4KUDD 1T3UA 3AZMB 2NZDA 5AV8D 3AZEB 1P3GA 2Y2LA 1KX4A 4EO5B 3LJAC 2CWEA 5B2IA 1P3MB 5FUGA 4R8PC 5GSUA 3LZ1D 3MNNB 5B24A 3AYWA 5CPJD 5AV9D 1F66D 3AYWC 5AVBA 3AZHB 3TU4A 5BT1D 5AVBC 1P34C 3C1CC 5AV5C 2G5IC 3TU4C 2HIOB 1KX3A 5CPIA 5CPIC 1P3AD 3AL0C 2AROC 1M1AC 3REKB 3X1SB 3AZGD 3AZJD 1H3OA 3C1BC 3W97C 3WAAD 4EO5C 2JE5A 1ULYA 3A1KA 3A1IA 4WNNB 5GXQB 5DNND 5BNXB 5GT0A 5GT0C 3VH5A 3WA9D 3AV1D 5AY8D 2BYMB 1P3PA 2CV5D 4KUDB 3MNNC 3P5JB 4WU8A 3REHA 1F1EA 1M19D 3REHC 1P3IA 3AZHC 1R4VA 4H9QB 5B2JD 5BO0B 3O62A 3EPKA 4ZUXD 1KX5B 3X1TD 3O62C 1BH9B 3X1SC 3LZ1B 3MGPD 2FJ7A 4E45A 5CPJB 2FJ7C 4WU9B 5AV9B 3AZIA 3UTAA 4KGCA 5GXQC 3KWQA 4J8XA 3AZIC 3KXBC 2F8NB 4KGCC 5B0ZC 4J8XC 5B32B 3LJAD 2BYKA 3MVDA 1P3BB 5CPKC 1P3AB 2HUEC 5JA4B 3WTPE 2NQBD 5JRGC 2Y2IA 3LELA 4J8WB 4Z5TA 4R8PD 4Z5TC 4Z2MG 5E5AB 1M18A 3B6GA 3AZNB 2DF4C 1M18C 3B6GC 2FFFB 1P34D 2F8NK 4Z66A 3C1CD 3AV1B 5AV5D 4DRAA 1HQ3A 1HQ3C 3A6NB 1M19B 2AROD 1M1AD 4YM6A 4WU9C 1U35C 3NQJA 4YM6C 2L5AA 3AZED 5B33A 2ZY2A 5B32C 4NE5A 3W98A 3W98C 4ZUXB 4J8WC 3B0CW 3W96A 5GT3A 5B31G 4XZQA 4JJNA 3MNND 4XZQC 4DQYB 3KUYA 4JJNC 5DNMC 3KUYC 2ZM5A 2NZDB 3AZHD 1P3GB 3X1UA 3UTBA 2PYOC 2RVQC 5AV6A 3WTPC 3UTBC 5B2IB 1EQZA 4KHAA 3A6NC 3MGSC 4R8PB 5B1LA 5BS7A 3X1SD 3AV2C 4LD9A 5GSUB 3EPHA 4AWLC 4WV4B 5B24B 3AYWB 2VQRA 4XUJC 3UT9C 3REIA 5GXQD 5AVBB 3KXBD 5AV5B 3B6FC 3TU4B 5B0ZD 3X1VA 5F99A 3RELA 1TZYA 5CPKD 5CPIB 4X23A 3B0CT 2AROB 5JRGD 1S32A 5KDMA 3V9RB 2Y2PA 2CV5A 2F8NG 2NZDC 1P3GC 3C1BB 3W97B 2YFWB 1H3OB 1KX4C 5B2IC 5GT0B 3LZ0A 4YS3A 1AOIA 1KX5D 3F6TA 3LZ0C 5B40A 5GSUC 3MGQA 4NFTA 3MGRA 3AFAA 4HGAC 1ZLAA 4WU8B 3MGRC 4WU9D 5B24C 2Y2MA 3REHB 1U35D 1P3IB 1N1JA 2F8ND 4J8VA 5B32D 3AZKA 1KX3C 1P3BD 5CP6A 3O62B 1P3LA 5CP6C 4G92C 3REJA 4J8WD 3WKJA 4J8UA 1BH8A 4UUZA 2FJ7B 2F8NH 5E5AD 3AZIB 4KGCB 5DNMD 3KXBB 3AZND 5B0ZB 2YFVA 4J8XB 2PYOD 2RVQD 3WTPD 5CPKB 2BYKB 2HUEB 1P3OA 5JRGB 3A6ND 1P3PC 3VH5W 3LELB 4WU8C 1P3KA 4Z5TB 3AV2D 1P3IC 1P3KC 3AZMA 3W99A 1KU5A 4XUJD 3UT9D 1M18B 3B6GB 3W99C 3B6FD 4H9PA 1P3MA 4NE3A 1HQ3B 1JFIA 1U35B 4YM6B 3VH6A 3NQJB 3UTAC 4H9RB 2NZDD 1P3GD 3KWQC 1KX4D 4QLCA 5B0YA 5B2ID 3W98B 3MVDC 4QLCC 2HIOA 3EPLA 3LELC 3VH5T 3FDDA 3AZLA 5GSUD 4XZQB 3REKA 5AVCA 3AZLC 4JJNB 3IP4C 5BNVA 5B24D 5DNMB 3NQUB 5B31A 3KUYB 3AYWD 2PYOB 5AVBD 1ID3A 3WTPB 3X1UB 3UTBB 3TU4D 4Z66C 5BNXA 1KX3D 5CPID 1P3FA 1EQZB 3MGSB 4KHAB 5B1MA 3AZFA 3AV2B 2XD1A 2BYMA 3AN2A 4KUDA 3EPJA 4AWLB 4LD9B 5B33C 3C1BD 5AV8A 3W97D 3KSYA 4XUJB 3UT9B 5G49A 3B6FB 4H9NA 5GT0D 3X1VB 5F99B 3RELB 3W96C 5GT3C 1KX5A 4X23B 4WZSB 1BH9A 2IO5C 3LZ1A 5KDMB 4WU8D 3REHD 1P3ID 5CPJA 5AV9A 1F66A 1KX4B 3X1UC 1F66C 5AV6C 3H0RC 4E44A 2RIQA 3EG5B 1EQZC 3O62D 3LZ0B 4YS3B 5FUGB 1P3AA 2F2AC 2Y2KA 5B1LC 5BS7C 4LD9C 3MGQB 4HGAB 3MGRB 2FJ7D 3AZGA 3AZJA 3WAAA 3AZID 3UTAD 4KGCD 3AZGC 1N1JB 3REIC 4H9SA 5DNNA 3KWQD 4J8XD 4J8VB 1KX3B 2JSSA 3X1VC 5F99C 3AZKB 3MVDD 1TZYC 3RELC 3AV1A 3WA9A 5AY8A 5CP6B 4X23C 3WA9C 4G92B 1P3LB 3LELD 1S32C 3REJB 4UPKA 4Z5TD 4J8UB 1M19A 2CV5C 5B32G 4UUZB 2G5HC 1HTAA 5B2JA 1M18D 3B6GD 2YFVB 4CAYA 4Z66D 4YS3C 1AOIC 4ZUXA 3X1TA 1P3OB 1HQ3D 1P3PB 3X1TC 5B40C 3MGQC 4M6BA 3AFAC 2Y2NA 1Q9CA 4YM6D 3MGPA 1ZLAC 1P3KB 3MGPC 4ZBJB 5B33D 2Y2QA 4J8VC 2UWXA 3W99B 3LJAA 3AZKC 3W98D 4H9OA 1P3LC 4H9PB 2NQBA 3REJC 3WKJC 3W96D 3R45A 5GT3D 4J8UC 2NQBC 4R8PA 1B67A 1JFIB 4XZQD 2JCHA 4JJND 1Z2CB 3UTAB 3KUYD 3KWQB 2W8SA 3X1UD 3UTBD 5AV6D 1P34A 3MVDB 3C1CA 5B0YB 5AV5A 4QLCB 1TAFA 1P3OC 1EQZD 3MGSD 2AROA 5B1LD 1M1AA 4CSRA 3AZLB 3B0DB 4LD9D 4ZBJC 3V9RA 5AVCB 3AZMC 3AZEA 2Y2OA 5BNVB 5B31B 3AZEC 3C1BA 3W97A 2YFWA 2Y2GA 3REID 1ID3B 4Z66B 3X1VD 5F99D 4DRBA 1P3MC 3RELD 1TZYD 4G91B 1P3FB 4X23D 2Y2JA 5B1MB 3AZFB 1S32D 3MNNA 3AN2B 5B33B 5AV8B 3AZHA 3VH6W 3B0BA 5G49B 5B0YC 4H9NB 2HIOC 3LZ0D 4YS3D 1AOID 3W96B 5GT3B 3KFUG 3X1SA 3B0DC 2IO5B 5B40D 3MGQD 3REKC 3MGRD 5AVCC 3AFAD 1ZLAD 3H0LC 5B31C 1F66B 1ID3C 5AV6B 4WNNA 5GXQA 3KXBA 4J8VD 5B0ZA 3AZKD 4G91C 1P3FC 5CP6D 5CPKA 1WWIA 1P3LD 5B1LB 5B1MC 3AZFC 5JRGA 3REJD 3WKJD 1PZRA 4J8UD 3AN2C 2BG1A 4KUDC 2ZY3A 5AV8C 2LY8A 3AZGB 3AZJB 4H9QA 3REIB 3VH6T 3WAAB 5BO0A 5DNNB 1TZYB 3WA9B 2XD5A 1P3OD 1P3PD 5AY8B 1KX5C 4WJ3C 1S32B 3LZ1C 2CV5B 1P3KD 4WU9A 1A7WA 1U35A 5CPJC 2ZY4A 5AV9C 3AZMD 4H9RA 2F8NA 5BT1C 3W99D 5B2JB 5B32A 1P3BA 1AOIB 4CAYB 1P3BC 5JA4A 2J8PA 1P3AC 1P3MD 1BFMA 3X1TB 5B40B 4J8WA 3AFAB 1ZLAB 5CHLB 1W2EA 5C3IB 3MGPB 3AZJC 3WAAC 4Z2MH 3H0MC 5E5AA 1B6WA 5DNMA 3NQUA 4H9SC 5DNNC 3AZNA 5E5AC 3AZNC 2PYOA 4QLCD 5B0YD 3WTPA 3LJAB 3AV1C 5AY8C 2HIOD 4H9OB 3WKJB 1WWSA 2NQBB 3A6NA 1BH8B 3MGSA 2ZY5A 3R45B 1M19C 3AZLD 3AV2A 3REKD 5AVCD 5B31D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J C;  4XUJ A;  3UT9 A;  1ID3 D;  3B6F A;  1P34 B;  3C1C B;  4ZUX C;  1TAF B;  1P3F D;  4NE6 A;  5B1M D;  3AZF D;  5C3I C;  1M1A B;  4CSR B;  3AN2 D;  4KUD D;  3AZM B;  2NZD A;  5AV8 D;  3AZE B;  1P3G A;  1KX4 A;  4EO5 B;  3LJA C;  2CWE A;  5B2I A;  1P3M B;  5FUG A;  4R8P C;  5GSU A;  3LZ1 D;  3MNN B;  5B24 A;  3AYW A;  5CPJ D;  5AV9 D;  1F66 D;  3AYW C;  5AVB A;  3AZH B;  3TU4 A;  5BT1 D;  5AVB C;  1P34 C;  3C1C C;  5AV5 C;  3TU4 C;  2HIO B;  1KX3 A;  5CPI A;  5CPI C;  1P3A D;  2ARO C;  1M1A C;  3REK B;  3X1S B;  3AZG D;  3AZJ D;  1H3O A;  3C1B C;  3W97 C;  3WAA D;  4EO5 C;  1ULY A;  5DNN D;  4WNN B;  5GXQ B;  5BNX B;  5GT0 A;  5GT0 C;  3VH5 A;  3WA9 D;  3AV1 D;  5AY8 D;  2BYM B;  1P3P A;  2CV5 D;  4KUD B;  3MNN C;  1M19 D;  4WU8 A;  3REH A;  1F1E A;  3REH C;  1P3I A;  3AZH C;  1R4V A;  4H9Q B;  5B2J D;  5BO0 B;  3O62 A;  4ZUX D;  1KX5 B;  3X1T D;  3O62 C;  1BH9 B;  3X1S C;  3LZ1 B;  3MGP D;  2FJ7 A;  4E45 A;  5CPJ B;  2FJ7 C;  4WU9 B;  5AV9 B;  3AZI A;  3UTA A;  4KGC A;  5GXQ C;  3KWQ A;  4J8X A;  3AZI C;  3KXB C;  2F8N B;  4KGC C;  5B0Z C;  4J8X C;  5B32 B;  3LJA D;  2BYK A;  3MVD A;  1P3B B;  5CPK C;  1P3A B;  2HUE C;  5JA4 B;  3WTP E;  2NQB D;  5JRG C;  3LEL A;  4J8W B;  4Z5T A;  4R8P D;  4Z5T C;  4Z2M G;  5E5A B;  1M18 A;  3B6G A;  3AZN B;  1M18 C;  3B6G C;  1P34 D;  2F8N K;  4Z66 A;  3C1C D;  3AV1 B;  5AV5 D;  4DRA A;  1HQ3 A;  1HQ3 C;  3A6N B;  1M19 B;  2ARO D;  1M1A D;  4YM6 A;  4WU9 C;  1U35 C;  3NQJ A;  4YM6 C;  2L5A A;  3AZE D;  5B33 A;  5B32 C;  4NE5 A;  3W98 A;  3W98 C;  4ZUX B;  4J8W C;  3B0C W;  3W96 A;  5GT3 A;  5B31 G;  4XZQ A;  4JJN A;  3MNN D;  4XZQ C;  3KUY A;  4JJN C;  5DNM C;  3KUY C;  2NZD B;  3AZH D;  1P3G B;  3X1U A;  3UTB A;  2PYO C;  2RVQ C;  5AV6 A;  3WTP C;  3UTB C;  5B2I B;  1EQZ A;  4KHA A;  3A6N C;  3MGS C;  4R8P B;  5B1L A;  5BS7 A;  3X1S D;  3AV2 C;  4LD9 A;  5GSU B;  4AWL C;  4WV4 B;  5B24 B;  3AYW B;  4XUJ C;  3UT9 C;  3REI A;  5GXQ D;  5AVB B;  3KXB D;  5AV5 B;  3B6F C;  3TU4 B;  5B0Z D;  3X1V A;  5F99 A;  3REL A;  1TZY A;  5CPK D;  5CPI B;  4X23 A;  3B0C T;  2ARO B;  5JRG D;  1S32 A;  5KDM A;  3V9R B;  2CV5 A;  2F8N G;  2NZD C;  1P3G C;  3C1B B;  3W97 B;  2YFW B;  1H3O B;  1KX4 C;  5B2I C;  5GT0 B;  3LZ0 A;  4YS3 A;  1AOI A;  1KX5 D;  3LZ0 C;  5B40 A;  5GSU C;  3MGQ A;  4NFT A;  3MGR A;  3AFA A;  4HGA C;  1ZLA A;  4WU8 B;  3MGR C;  4WU9 D;  5B24 C;  3REH B;  1U35 D;  1P3I B;  1N1J A;  2F8N D;  4J8V A;  5B32 D;  3AZK A;  1KX3 C;  1P3B D;  5CP6 A;  3O62 B;  1P3L A;  5CP6 C;  4G92 C;  3REJ A;  4J8W D;  3WKJ A;  4J8U A;  1BH8 A;  4UUZ A;  2FJ7 B;  2F8N H;  5E5A D;  3AZI B;  4KGC B;  5DNM D;  3KXB B;  3AZN D;  5B0Z B;  2YFV A;  4J8X B;  2PYO D;  2RVQ D;  3WTP D;  5CPK B;  2BYK B;  2HUE B;  1P3O A;  5JRG B;  3A6N D;  1P3P C;  3VH5 W;  3LEL B;  4WU8 C;  1P3K A;  4Z5T B;  3AV2 D;  1P3I C;  1P3K C;  3AZM A;  3W99 A;  1KU5 A;  4XUJ D;  3UT9 D;  1M18 B;  3B6G B;  3W99 C;  3B6F D;  4H9P A;  1P3M A;  4NE3 A;  1HQ3 B;  1JFI A;  1U35 B;  4YM6 B;  3VH6 A;  3NQJ B;  3UTA C;  4H9R B;  2NZD D;  1P3G D;  3KWQ C;  1KX4 D;  4QLC A;  5B0Y A;  5B2I D;  3W98 B;  3MVD C;  4QLC C;  2HIO A;  3LEL C;  3VH5 T;  3AZL A;  5GSU D;  4XZQ B;  3REK A;  5AVC A;  3AZL C;  4JJN B;  5BNV A;  5B24 D;  5DNM B;  3NQU B;  5B31 A;  3KUY B;  3AYW D;  2PYO B;  5AVB D;  1ID3 A;  3WTP B;  3X1U B;  3UTB B;  3TU4 D;  4Z66 C;  5BNX A;  1KX3 D;  5CPI D;  1P3F A;  1EQZ B;  3MGS B;  4KHA B;  5B1M A;  3AZF A;  3AV2 B;  2BYM A;  3AN2 A;  4KUD A;  4LD9 B;  4AWL B;  5B33 C;  3C1B D;  5AV8 A;  3W97 D;  3KSY A;  4XUJ B;  3UT9 B;  5G49 A;  3B6F B;  4H9N A;  5GT0 D;  3X1V B;  5F99 B;  3REL B;  3W96 C;  5GT3 C;  1KX5 A;  4X23 B;  4WZS B;  1BH9 A;  2IO5 C;  3LZ1 A;  5KDM B;  4WU8 D;  3REH D;  1P3I D;  5CPJ A;  5AV9 A;  1F66 A;  1KX4 B;  3X1U C;  1F66 C;  5AV6 C;  4E44 A;  1EQZ C;  3O62 D;  3LZ0 B;  4YS3 B;  5FUG B;  1P3A A;  5B1L C;  5BS7 C;  4LD9 C;  3MGQ B;  4HGA B;  3MGR B;  2FJ7 D;  3AZG A;  3AZJ A;  3WAA A;  3AZI D;  3UTA D;  4KGC D;  3AZG C;  1N1J B;  3REI C;  4H9S A;  5DNN A;  3KWQ D;  4J8X D;  4J8V B;  1KX3 B;  2JSS A;  3X1V C;  5F99 C;  3AZK B;  3MVD D;  1TZY C;  3REL C;  3AV1 A;  3WA9 A;  5AY8 A;  5CP6 B;  4X23 C;  3WA9 C;  4G92 B;  1P3L B;  3LEL D;  1S32 C;  3REJ B;  4Z5T D;  4J8U B;  1M19 A;  2CV5 C;  5B32 G;  4UUZ B;  1HTA A;  5B2J A;  1M18 D;  3B6G D;  2YFV B;  4CAY A;  4Z66 D;  4YS3 C;  1AOI C;  4ZUX A;  3X1T A;  1P3O B;  1HQ3 D;  1P3P B;  3X1T C;  5B40 C;  3MGQ C;  4M6B A;  3AFA C;  3MGP A;  1Q9C A;  4YM6 D;  1ZLA C;  1P3K B;  3MGP C;  4ZBJ B;  5B33 D;  4J8V C;  3W99 B;  3LJA A;  3AZK C;  3W98 D;  4H9O A;  1P3L C;  4H9P B;  2NQB A;  3REJ C;  3WKJ C;  3W96 D;  3R45 A;  5GT3 D;  4J8U C;  2NQB C;  4R8P A;  1B67 A;  1JFI B;  4XZQ D;  4JJN D;  3UTA B;  3KUY D;  3KWQ B;  3X1U D;  3UTB D;  5AV6 D;  1P34 A;  3MVD B;  3C1C A;  5B0Y B;  5AV5 A;  4QLC B;  1TAF A;  1P3O C;  1EQZ D;  3MGS D;  2ARO A;  5B1L D;  1M1A A;  4CSR A;  3AZL B;  3B0D B;  4LD9 D;  4ZBJ C;  3V9R A;  5AVC B;  3AZM C;  3AZE A;  5BNV B;  5B31 B;  3AZE C;  3C1B A;  3W97 A;  2YFW A;  3REI D;  1ID3 B;  4Z66 B;  3X1V D;  5F99 D;  4DRB A;  1P3M C;  3REL D;  1TZY D;  4G91 B;  1P3F B;  4X23 D;  5B1M B;  3AZF B;  1S32 D;  3MNN A;  3AN2 B;  5B33 B;  5AV8 B;  3AZH A;  3VH6 W;  3B0B A;  5G49 B;  5B0Y C;  4H9N B;  2HIO C;  3LZ0 D;  4YS3 D;  1AOI D;  3W96 B;  5GT3 B;  3X1S A;  3B0D C;  2IO5 B;  5B40 D;  3MGQ D;  3REK C;  3MGR D;  5AVC C;  3AFA D;  1ZLA D;  5B31 C;  1F66 B;  1ID3 C;  5AV6 B;  4WNN A;  5GXQ A;  3KXB A;  4J8V D;  5B0Z A;  3AZK D;  4G91 C;  1P3F C;  5CP6 D;  5CPK A;  1WWI A;  1P3L D;  5B1L B;  5B1M C;  3AZF C;  5JRG A;  3REJ D;  3WKJ D;  4J8U D;  3AN2 C;  4KUD C;  5AV8 C;  2LY8 A;  3AZG B;  3AZJ B;  4H9Q A;  3REI B;  3VH6 T;  3WAA B;  5BO0 A;  5DNN B;  1TZY B;  3WA9 B;  1P3O D;  1P3P D;  5AY8 B;  1KX5 C;  1S32 B;  3LZ1 C;  2CV5 B;  1P3K D;  4WU9 A;  1A7W A;  1U35 A;  5CPJ C;  5AV9 C;  3AZM D;  4H9R A;  2F8N A;  5BT1 C;  3W99 D;  5B2J B;  5B32 A;  1P3B A;  1AOI B;  4CAY B;  1P3B C;  5JA4 A;  1P3A C;  1BFM A;  1P3M D;  3X1T B;  5B40 B;  4J8W A;  3AFA B;  1ZLA B;  5CHL B;  5C3I B;  3MGP B;  3AZJ C;  3WAA C;  4Z2M H;  5E5A A;  1B6W A;  5DNM A;  3NQU A;  4H9S C;  5DNN C;  3AZN A;  5E5A C;  3AZN C;  2PYO A;  4QLC D;  5B0Y D;  3WTP A;  3LJA B;  3AV1 C;  5AY8 C;  2HIO D;  4H9O B;  3WKJ B;  1WWS A;  2NQB B;  3A6N A;  1BH8 B;  3MGS A;  3R45 B;  1M19 C;  3AZL D;  3AV2 A;  3REK D;  5AVC D;  5B31 D; 
#chains in the Genus database with same CATH topology
 5B2J C;  4XUJ A;  3UT9 A;  1ID3 D;  3B6F A;  1P34 B;  3C1C B;  4ZUX C;  2DQN C;  1TAF B;  1P3F D;  4NE6 A;  2Y2H A;  5B1M D;  3AZF D;  5C3I C;  1M1A B;  4CSR B;  3AN2 D;  4KUD D;  1T3U A;  3AZM B;  2NZD A;  5AV8 D;  3AZE B;  1P3G A;  2Y2L A;  1KX4 A;  4EO5 B;  3LJA C;  2CWE A;  5B2I A;  1P3M B;  5FUG A;  4R8P C;  5GSU A;  3LZ1 D;  3MNN B;  5B24 A;  3AYW A;  5CPJ D;  5AV9 D;  1F66 D;  3AYW C;  5AVB A;  3AZH B;  3TU4 A;  5BT1 D;  5AVB C;  1P34 C;  3C1C C;  5AV5 C;  2G5I C;  3TU4 C;  2HIO B;  1KX3 A;  5CPI A;  5CPI C;  1P3A D;  3AL0 C;  2ARO C;  1M1A C;  3REK B;  3X1S B;  3AZG D;  3AZJ D;  1H3O A;  3C1B C;  3W97 C;  3WAA D;  4EO5 C;  2JE5 A;  1ULY A;  3A1K A;  3A1I A;  4WNN B;  5GXQ B;  5DNN D;  5BNX B;  5GT0 A;  5GT0 C;  3VH5 A;  3WA9 D;  3AV1 D;  5AY8 D;  2BYM B;  1P3P A;  2CV5 D;  4KUD B;  3MNN C;  3P5J B;  4WU8 A;  3REH A;  1F1E A;  1M19 D;  3REH C;  1P3I A;  3AZH C;  1R4V A;  4H9Q B;  5B2J D;  5BO0 B;  3O62 A;  3EPK A;  4ZUX D;  1KX5 B;  3X1T D;  3O62 C;  1BH9 B;  3X1S C;  3LZ1 B;  3MGP D;  2FJ7 A;  4E45 A;  5CPJ B;  2FJ7 C;  4WU9 B;  5AV9 B;  3AZI A;  3UTA A;  4KGC A;  5GXQ C;  3KWQ A;  4J8X A;  3AZI C;  3KXB C;  2F8N B;  4KGC C;  5B0Z C;  4J8X C;  5B32 B;  3LJA D;  2BYK A;  3MVD A;  1P3B B;  5CPK C;  1P3A B;  2HUE C;  5JA4 B;  3WTP E;  2NQB D;  5JRG C;  2Y2I A;  3LEL A;  4J8W B;  4Z5T A;  4R8P D;  4Z5T C;  4Z2M G;  5E5A B;  1M18 A;  3B6G A;  3AZN B;  2DF4 C;  1M18 C;  3B6G C;  2FFF B;  1P34 D;  2F8N K;  4Z66 A;  3C1C D;  3AV1 B;  5AV5 D;  4DRA A;  1HQ3 A;  1HQ3 C;  3A6N B;  1M19 B;  2ARO D;  1M1A D;  4YM6 A;  4WU9 C;  1U35 C;  3NQJ A;  4YM6 C;  2L5A A;  3AZE D;  5B33 A;  2ZY2 A;  5B32 C;  4NE5 A;  3W98 A;  3W98 C;  4ZUX B;  4J8W C;  3B0C W;  3W96 A;  5GT3 A;  5B31 G;  4XZQ A;  4JJN A;  3MNN D;  4XZQ C;  4DQY B;  3KUY A;  4JJN C;  5DNM C;  3KUY C;  2ZM5 A;  2NZD B;  3AZH D;  1P3G B;  3X1U A;  3UTB A;  2PYO C;  2RVQ C;  5AV6 A;  3WTP C;  3UTB C;  5B2I B;  1EQZ A;  4KHA A;  3A6N C;  3MGS C;  4R8P B;  5B1L A;  5BS7 A;  3X1S D;  3AV2 C;  4LD9 A;  5GSU B;  3EPH A;  4AWL C;  4WV4 B;  5B24 B;  3AYW B;  2VQR A;  4XUJ C;  3UT9 C;  3REI A;  5GXQ D;  5AVB B;  3KXB D;  5AV5 B;  3B6F C;  3TU4 B;  5B0Z D;  3X1V A;  5F99 A;  3REL A;  1TZY A;  5CPK D;  5CPI B;  4X23 A;  3B0C T;  2ARO B;  5JRG D;  1S32 A;  5KDM A;  3V9R B;  2Y2P A;  2CV5 A;  2F8N G;  2NZD C;  1P3G C;  3C1B B;  3W97 B;  2YFW B;  1H3O B;  1KX4 C;  5B2I C;  5GT0 B;  3LZ0 A;  4YS3 A;  1AOI A;  1KX5 D;  3F6T A;  3LZ0 C;  5B40 A;  5GSU C;  3MGQ A;  4NFT A;  3MGR A;  3AFA A;  4HGA C;  1ZLA A;  4WU8 B;  3MGR C;  4WU9 D;  5B24 C;  2Y2M A;  3REH B;  1U35 D;  1P3I B;  1N1J A;  2F8N D;  4J8V A;  5B32 D;  3AZK A;  1KX3 C;  1P3B D;  5CP6 A;  3O62 B;  1P3L A;  5CP6 C;  4G92 C;  3REJ A;  4J8W D;  3WKJ A;  4J8U A;  1BH8 A;  4UUZ A;  2FJ7 B;  2F8N H;  5E5A D;  3AZI B;  4KGC B;  5DNM D;  3KXB B;  3AZN D;  5B0Z B;  2YFV A;  4J8X B;  2PYO D;  2RVQ D;  3WTP D;  5CPK B;  2BYK B;  2HUE B;  1P3O A;  5JRG B;  3A6N D;  1P3P C;  3VH5 W;  3LEL B;  4WU8 C;  1P3K A;  4Z5T B;  3AV2 D;  1P3I C;  1P3K C;  3AZM A;  3W99 A;  1KU5 A;  4XUJ D;  3UT9 D;  1M18 B;  3B6G B;  3W99 C;  3B6F D;  4H9P A;  1P3M A;  4NE3 A;  1HQ3 B;  1JFI A;  1U35 B;  4YM6 B;  3VH6 A;  3NQJ B;  3UTA C;  4H9R B;  2NZD D;  1P3G D;  3KWQ C;  1KX4 D;  4QLC A;  5B0Y A;  5B2I D;  3W98 B;  3MVD C;  4QLC C;  2HIO A;  3EPL A;  3LEL C;  3VH5 T;  3FDD A;  3AZL A;  5GSU D;  4XZQ B;  3REK A;  5AVC A;  3AZL C;  4JJN B;  3IP4 C;  5BNV A;  5B24 D;  5DNM B;  3NQU B;  5B31 A;  3KUY B;  3AYW D;  2PYO B;  5AVB D;  1ID3 A;  3WTP B;  3X1U B;  3UTB B;  3TU4 D;  4Z66 C;  5BNX A;  1KX3 D;  5CPI D;  1P3F A;  1EQZ B;  3MGS B;  4KHA B;  5B1M A;  3AZF A;  3AV2 B;  2XD1 A;  2BYM A;  3AN2 A;  4KUD A;  3EPJ A;  4AWL B;  4LD9 B;  5B33 C;  3C1B D;  5AV8 A;  3W97 D;  3KSY A;  4XUJ B;  3UT9 B;  5G49 A;  3B6F B;  4H9N A;  5GT0 D;  3X1V B;  5F99 B;  3REL B;  3W96 C;  5GT3 C;  1KX5 A;  4X23 B;  4WZS B;  1BH9 A;  2IO5 C;  3LZ1 A;  5KDM B;  4WU8 D;  3REH D;  1P3I D;  5CPJ A;  5AV9 A;  1F66 A;  1KX4 B;  3X1U C;  1F66 C;  5AV6 C;  3H0R C;  4E44 A;  2RIQ A;  3EG5 B;  1EQZ C;  3O62 D;  3LZ0 B;  4YS3 B;  5FUG B;  1P3A A;  2F2A C;  2Y2K A;  5B1L C;  5BS7 C;  4LD9 C;  3MGQ B;  4HGA B;  3MGR B;  2FJ7 D;  3AZG A;  3AZJ A;  3WAA A;  3AZI D;  3UTA D;  4KGC D;  3AZG C;  1N1J B;  3REI C;  4H9S A;  5DNN A;  3KWQ D;  4J8X D;  4J8V B;  1KX3 B;  2JSS A;  3X1V C;  5F99 C;  3AZK B;  3MVD D;  1TZY C;  3REL C;  3AV1 A;  3WA9 A;  5AY8 A;  5CP6 B;  4X23 C;  3WA9 C;  4G92 B;  1P3L B;  3LEL D;  1S32 C;  3REJ B;  4UPK A;  4Z5T D;  4J8U B;  1M19 A;  2CV5 C;  5B32 G;  4UUZ B;  2G5H C;  1HTA A;  5B2J A;  1M18 D;  3B6G D;  2YFV B;  4CAY A;  4Z66 D;  4YS3 C;  1AOI C;  4ZUX A;  3X1T A;  1P3O B;  1HQ3 D;  1P3P B;  3X1T C;  5B40 C;  3MGQ C;  4M6B A;  3AFA C;  2Y2N A;  1Q9C A;  4YM6 D;  3MGP A;  1ZLA C;  1P3K B;  3MGP C;  4ZBJ B;  5B33 D;  2Y2Q A;  4J8V C;  2UWX A;  3W99 B;  3LJA A;  3AZK C;  3W98 D;  4H9O A;  1P3L C;  4H9P B;  2NQB A;  3REJ C;  3WKJ C;  3W96 D;  3R45 A;  5GT3 D;  4J8U C;  2NQB C;  4R8P A;  1B67 A;  1JFI B;  4XZQ D;  2JCH A;  4JJN D;  1Z2C B;  3UTA B;  3KUY D;  3KWQ B;  2W8S A;  3X1U D;  3UTB D;  5AV6 D;  1P34 A;  3MVD B;  3C1C A;  5B0Y B;  5AV5 A;  4QLC B;  1TAF A;  1P3O C;  1EQZ D;  3MGS D;  2ARO A;  5B1L D;  1M1A A;  4CSR A;  3AZL B;  3B0D B;  4LD9 D;  4ZBJ C;  3V9R A;  5AVC B;  3AZM C;  3AZE A;  2Y2O A;  5BNV B;  5B31 B;  3AZE C;  3C1B A;  3W97 A;  2YFW A;  2Y2G A;  3REI D;  1ID3 B;  4Z66 B;  3X1V D;  5F99 D;  4DRB A;  1P3M C;  3REL D;  1TZY D;  4G91 B;  1P3F B;  4X23 D;  2Y2J A;  5B1M B;  3AZF B;  1S32 D;  3MNN A;  3AN2 B;  5B33 B;  5AV8 B;  3AZH A;  3VH6 W;  3B0B A;  5G49 B;  5B0Y C;  4H9N B;  2HIO C;  3LZ0 D;  4YS3 D;  1AOI D;  3W96 B;  5GT3 B;  3KFU G;  3X1S A;  3B0D C;  2IO5 B;  5B40 D;  3MGQ D;  3REK C;  3MGR D;  5AVC C;  3AFA D;  1ZLA D;  3H0L C;  5B31 C;  1F66 B;  1ID3 C;  5AV6 B;  4WNN A;  5GXQ A;  3KXB A;  4J8V D;  5B0Z A;  3AZK D;  4G91 C;  1P3F C;  5CP6 D;  5CPK A;  1WWI A;  1P3L D;  5B1L B;  5B1M C;  3AZF C;  5JRG A;  3REJ D;  3WKJ D;  1PZR A;  4J8U D;  3AN2 C;  2BG1 A;  4KUD C;  2ZY3 A;  5AV8 C;  2LY8 A;  3AZG B;  3AZJ B;  4H9Q A;  3REI B;  3VH6 T;  3WAA B;  5BO0 A;  5DNN B;  1TZY B;  3WA9 B;  2XD5 A;  1P3O D;  1P3P D;  5AY8 B;  1KX5 C;  4WJ3 C;  1S32 B;  3LZ1 C;  2CV5 B;  1P3K D;  4WU9 A;  1A7W A;  1U35 A;  5CPJ C;  2ZY4 A;  5AV9 C;  3AZM D;  4H9R A;  2F8N A;  5BT1 C;  3W99 D;  5B2J B;  5B32 A;  1P3B A;  1AOI B;  4CAY B;  1P3B C;  5JA4 A;  2J8P A;  1P3A C;  1P3M D;  1BFM A;  3X1T B;  5B40 B;  4J8W A;  3AFA B;  1ZLA B;  5CHL B;  1W2E A;  5C3I B;  3MGP B;  3AZJ C;  3WAA C;  4Z2M H;  3H0M C;  5E5A A;  1B6W A;  5DNM A;  3NQU A;  4H9S C;  5DNN C;  3AZN A;  5E5A C;  3AZN C;  2PYO A;  4QLC D;  5B0Y D;  3WTP A;  3LJA B;  3AV1 C;  5AY8 C;  2HIO D;  4H9O B;  3WKJ B;  1WWS A;  2NQB B;  3A6N A;  1BH8 B;  3MGS A;  2ZY5 A;  3R45 B;  1M19 C;  3AZL D;  3AV2 A;  3REK D;  5AVC D;  5B31 D; 
#chains in the Genus database with same CATH homology
 5B2J C;  4XUJ A;  3UT9 A;  1ID3 D;  3B6F A;  1P34 B;  3C1C B;  4ZUX C;  2DQN C;  1TAF B;  1P3F D;  4NE6 A;  2Y2H A;  5B1M D;  3AZF D;  5C3I C;  1M1A B;  4CSR B;  3AN2 D;  4KUD D;  1T3U A;  3AZM B;  2NZD A;  5AV8 D;  3AZE B;  1P3G A;  2Y2L A;  1KX4 A;  4EO5 B;  3LJA C;  2CWE A;  5B2I A;  1P3M B;  5FUG A;  4R8P C;  5GSU A;  3LZ1 D;  3MNN B;  5B24 A;  3AYW A;  5CPJ D;  5AV9 D;  1F66 D;  3AYW C;  5AVB A;  3AZH B;  3TU4 A;  5BT1 D;  5AVB C;  1P34 C;  3C1C C;  5AV5 C;  2G5I C;  3TU4 C;  2HIO B;  1KX3 A;  5CPI A;  5CPI C;  1P3A D;  3AL0 C;  2ARO C;  1M1A C;  3REK B;  3X1S B;  3AZG D;  3AZJ D;  1H3O A;  3C1B C;  3W97 C;  3WAA D;  4EO5 C;  2JE5 A;  1ULY A;  3A1K A;  3A1I A;  4WNN B;  5GXQ B;  5DNN D;  5BNX B;  5GT0 A;  5GT0 C;  3VH5 A;  3WA9 D;  3AV1 D;  5AY8 D;  2BYM B;  1P3P A;  2CV5 D;  4KUD B;  3MNN C;  3P5J B;  4WU8 A;  3REH A;  1F1E A;  1M19 D;  3REH C;  1P3I A;  3AZH C;  1R4V A;  4H9Q B;  5B2J D;  5BO0 B;  3O62 A;  3EPK A;  4ZUX D;  1KX5 B;  3X1T D;  3O62 C;  1BH9 B;  3X1S C;  3LZ1 B;  3MGP D;  2FJ7 A;  4E45 A;  5CPJ B;  2FJ7 C;  4WU9 B;  5AV9 B;  3AZI A;  3UTA A;  4KGC A;  5GXQ C;  3KWQ A;  4J8X A;  3AZI C;  3KXB C;  2F8N B;  4KGC C;  5B0Z C;  4J8X C;  5B32 B;  3LJA D;  2BYK A;  3MVD A;  1P3B B;  5CPK C;  1P3A B;  2HUE C;  5JA4 B;  3WTP E;  2NQB D;  5JRG C;  2Y2I A;  3LEL A;  4J8W B;  4Z5T A;  4R8P D;  4Z5T C;  4Z2M G;  5E5A B;  1M18 A;  3B6G A;  3AZN B;  2DF4 C;  1M18 C;  3B6G C;  2FFF B;  1P34 D;  2F8N K;  4Z66 A;  3C1C D;  3AV1 B;  5AV5 D;  4DRA A;  1HQ3 A;  1HQ3 C;  3A6N B;  1M19 B;  2ARO D;  1M1A D;  4YM6 A;  4WU9 C;  1U35 C;  3NQJ A;  4YM6 C;  2L5A A;  3AZE D;  5B33 A;  2ZY2 A;  5B32 C;  4NE5 A;  3W98 A;  3W98 C;  4ZUX B;  4J8W C;  3B0C W;  3W96 A;  5GT3 A;  5B31 G;  4XZQ A;  4JJN A;  3MNN D;  4XZQ C;  4DQY B;  3KUY A;  4JJN C;  5DNM C;  3KUY C;  2ZM5 A;  2NZD B;  3AZH D;  1P3G B;  3X1U A;  3UTB A;  2PYO C;  2RVQ C;  5AV6 A;  3WTP C;  3UTB C;  5B2I B;  1EQZ A;  4KHA A;  3A6N C;  3MGS C;  4R8P B;  5B1L A;  5BS7 A;  3X1S D;  3AV2 C;  4LD9 A;  5GSU B;  3EPH A;  4AWL C;  4WV4 B;  5B24 B;  3AYW B;  2VQR A;  4XUJ C;  3UT9 C;  3REI A;  5GXQ D;  5AVB B;  3KXB D;  5AV5 B;  3B6F C;  3TU4 B;  5B0Z D;  3X1V A;  5F99 A;  3REL A;  1TZY A;  5CPK D;  5CPI B;  4X23 A;  3B0C T;  2ARO B;  5JRG D;  1S32 A;  5KDM A;  3V9R B;  2Y2P A;  2CV5 A;  2F8N G;  2NZD C;  1P3G C;  3C1B B;  3W97 B;  2YFW B;  1H3O B;  1KX4 C;  5B2I C;  5GT0 B;  3LZ0 A;  4YS3 A;  1AOI A;  1KX5 D;  3F6T A;  3LZ0 C;  5B40 A;  5GSU C;  3MGQ A;  4NFT A;  3MGR A;  3AFA A;  4HGA C;  1ZLA A;  4WU8 B;  3MGR C;  4WU9 D;  5B24 C;  2Y2M A;  3REH B;  1U35 D;  1P3I B;  1N1J A;  2F8N D;  4J8V A;  5B32 D;  3AZK A;  1KX3 C;  1P3B D;  5CP6 A;  3O62 B;  1P3L A;  5CP6 C;  4G92 C;  3REJ A;  4J8W D;  3WKJ A;  4J8U A;  1BH8 A;  4UUZ A;  2FJ7 B;  2F8N H;  5E5A D;  3AZI B;  4KGC B;  5DNM D;  3KXB B;  3AZN D;  5B0Z B;  2YFV A;  4J8X B;  2PYO D;  2RVQ D;  3WTP D;  5CPK B;  2BYK B;  2HUE B;  1P3O A;  5JRG B;  3A6N D;  1P3P C;  3VH5 W;  3LEL B;  4WU8 C;  1P3K A;  4Z5T B;  3AV2 D;  1P3I C;  1P3K C;  3AZM A;  3W99 A;  1KU5 A;  4XUJ D;  3UT9 D;  1M18 B;  3B6G B;  3W99 C;  3B6F D;  4H9P A;  1P3M A;  4NE3 A;  1HQ3 B;  1JFI A;  1U35 B;  4YM6 B;  3VH6 A;  3NQJ B;  3UTA C;  4H9R B;  2NZD D;  1P3G D;  3KWQ C;  1KX4 D;  4QLC A;  5B0Y A;  5B2I D;  3W98 B;  3MVD C;  4QLC C;  2HIO A;  3EPL A;  3LEL C;  3VH5 T;  3FDD A;  3AZL A;  5GSU D;  4XZQ B;  3REK A;  5AVC A;  3AZL C;  4JJN B;  3IP4 C;  5BNV A;  5B24 D;  5DNM B;  3NQU B;  5B31 A;  3KUY B;  3AYW D;  2PYO B;  5AVB D;  1ID3 A;  3WTP B;  3X1U B;  3UTB B;  3TU4 D;  4Z66 C;  5BNX A;  1KX3 D;  5CPI D;  1P3F A;  1EQZ B;  3MGS B;  4KHA B;  5B1M A;  3AZF A;  3AV2 B;  2XD1 A;  2BYM A;  3AN2 A;  4KUD A;  3EPJ A;  4AWL B;  4LD9 B;  5B33 C;  3C1B D;  5AV8 A;  3W97 D;  3KSY A;  4XUJ B;  3UT9 B;  5G49 A;  3B6F B;  4H9N A;  5GT0 D;  3X1V B;  5F99 B;  3REL B;  3W96 C;  5GT3 C;  1KX5 A;  4X23 B;  4WZS B;  1BH9 A;  2IO5 C;  3LZ1 A;  5KDM B;  4WU8 D;  3REH D;  1P3I D;  5CPJ A;  5AV9 A;  1F66 A;  1KX4 B;  3X1U C;  1F66 C;  5AV6 C;  3H0R C;  4E44 A;  2RIQ A;  3EG5 B;  1EQZ C;  3O62 D;  3LZ0 B;  4YS3 B;  5FUG B;  1P3A A;  2F2A C;  2Y2K A;  5B1L C;  5BS7 C;  4LD9 C;  3MGQ B;  4HGA B;  3MGR B;  2FJ7 D;  3AZG A;  3AZJ A;  3WAA A;  3AZI D;  3UTA D;  4KGC D;  3AZG C;  1N1J B;  3REI C;  4H9S A;  5DNN A;  3KWQ D;  4J8X D;  4J8V B;  1KX3 B;  2JSS A;  3X1V C;  5F99 C;  3AZK B;  3MVD D;  1TZY C;  3REL C;  3AV1 A;  3WA9 A;  5AY8 A;  5CP6 B;  4X23 C;  3WA9 C;  4G92 B;  1P3L B;  3LEL D;  1S32 C;  3REJ B;  4UPK A;  4Z5T D;  4J8U B;  1M19 A;  2CV5 C;  5B32 G;  4UUZ B;  2G5H C;  1HTA A;  5B2J A;  1M18 D;  3B6G D;  2YFV B;  4CAY A;  4Z66 D;  4YS3 C;  1AOI C;  4ZUX A;  3X1T A;  1P3O B;  1HQ3 D;  1P3P B;  3X1T C;  5B40 C;  3MGQ C;  4M6B A;  3AFA C;  2Y2N A;  1Q9C A;  4YM6 D;  3MGP A;  1ZLA C;  1P3K B;  3MGP C;  4ZBJ B;  5B33 D;  2Y2Q A;  4J8V C;  2UWX A;  3W99 B;  3LJA A;  3AZK C;  3W98 D;  4H9O A;  1P3L C;  4H9P B;  2NQB A;  3REJ C;  3WKJ C;  3W96 D;  3R45 A;  5GT3 D;  4J8U C;  2NQB C;  4R8P A;  1B67 A;  1JFI B;  4XZQ D;  2JCH A;  4JJN D;  1Z2C B;  3UTA B;  3KUY D;  3KWQ B;  2W8S A;  3X1U D;  3UTB D;  5AV6 D;  1P34 A;  3MVD B;  3C1C A;  5B0Y B;  5AV5 A;  4QLC B;  1TAF A;  1P3O C;  1EQZ D;  3MGS D;  2ARO A;  5B1L D;  1M1A A;  4CSR A;  3AZL B;  3B0D B;  4LD9 D;  4ZBJ C;  3V9R A;  5AVC B;  3AZM C;  3AZE A;  2Y2O A;  5BNV B;  5B31 B;  3AZE C;  3C1B A;  3W97 A;  2YFW A;  2Y2G A;  3REI D;  1ID3 B;  4Z66 B;  3X1V D;  5F99 D;  4DRB A;  1P3M C;  3REL D;  1TZY D;  4G91 B;  1P3F B;  4X23 D;  2Y2J A;  5B1M B;  3AZF B;  1S32 D;  3MNN A;  3AN2 B;  5B33 B;  5AV8 B;  3AZH A;  3VH6 W;  3B0B A;  5G49 B;  5B0Y C;  4H9N B;  2HIO C;  3LZ0 D;  4YS3 D;  1AOI D;  3W96 B;  5GT3 B;  3KFU G;  3X1S A;  3B0D C;  2IO5 B;  5B40 D;  3MGQ D;  3REK C;  3MGR D;  5AVC C;  3AFA D;  1ZLA D;  3H0L C;  5B31 C;  1F66 B;  1ID3 C;  5AV6 B;  4WNN A;  5GXQ A;  3KXB A;  4J8V D;  5B0Z A;  3AZK D;  4G91 C;  1P3F C;  5CP6 D;  5CPK A;  1WWI A;  1P3L D;  5B1L B;  5B1M C;  3AZF C;  5JRG A;  3REJ D;  3WKJ D;  1PZR A;  4J8U D;  3AN2 C;  2BG1 A;  4KUD C;  2ZY3 A;  5AV8 C;  2LY8 A;  3AZG B;  3AZJ B;  4H9Q A;  3REI B;  3VH6 T;  3WAA B;  5BO0 A;  5DNN B;  1TZY B;  3WA9 B;  2XD5 A;  1P3O D;  1P3P D;  5AY8 B;  1KX5 C;  4WJ3 C;  1S32 B;  3LZ1 C;  2CV5 B;  1P3K D;  4WU9 A;  1A7W A;  1U35 A;  5CPJ C;  2ZY4 A;  5AV9 C;  3AZM D;  4H9R A;  2F8N A;  5BT1 C;  3W99 D;  5B2J B;  5B32 A;  1P3B A;  1AOI B;  4CAY B;  1P3B C;  5JA4 A;  2J8P A;  1P3A C;  1P3M D;  1BFM A;  3X1T B;  5B40 B;  4J8W A;  3AFA B;  1ZLA B;  5CHL B;  1W2E A;  5C3I B;  3MGP B;  3AZJ C;  3WAA C;  4Z2M H;  3H0M C;  5E5A A;  1B6W A;  5DNM A;  3NQU A;  4H9S C;  5DNN C;  3AZN A;  5E5A C;  3AZN C;  2PYO A;  4QLC D;  5B0Y D;  3WTP A;  3LJA B;  3AV1 C;  5AY8 C;  2HIO D;  4H9O B;  3WKJ B;  1WWS A;  2NQB B;  3A6N A;  1BH8 B;  3MGS A;  2ZY5 A;  3R45 B;  1M19 C;  3AZL D;  3AV2 A;  3REK D;  5AVC D;  5B31 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...