3MVDD

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdD00
5B0YA 3NQJA 2F8NK 3AZMC 5GT0A 4R8PA 1M1AB 3B6FC 5C3IB 4WU8A 3B6FD 2IO5B 3AN2A 2AROA 2AROD 3W99C 2NZDA 2PYOB 3VH5A 1P34A 1HQ3B 4H9QB 3RELB 3B0BA 5BS7C 3MNNA 1P3PA 4LD9B 5B31G 1A7WA 2HIOC 3VH6W 2YFWA 3A6NC 4YM6B 3UT9B 5AV8B 5AVBC 3X1TC 1P3KC 3AZIC 3A6ND 2YFVA 3AZMB 5AVBD 3AV1D 1KX4D 3REHD 3REJC 3C1CD 2FJ7C 3B0DC 5G49B 1BFMA 4CAYB 1BH8A 3W99B 3LZ0C 3WKJD 4KHAB 5DNNA 3C1BC 3R45A 3AZKD 3AZHA 4HGAC 5BT1C 3AV1A 2NQBD 3X1UC 3AFAA 2HIOB 3X1SA 4QLCA 3X1UD 3X1VA 4KGCA 3X1TB 1P3KB 3WKJA 3AZIB 3MGRD 1U35C 5CPJD 4ZBJC 4NE5A 3REJB 1AOIA 1U35D 2FJ7B 3B0DB 3LZ0B 1P3GC 3C1BB 1S32C 3V9RA 5B2IA 5AV9C 5E5AC 3MGPD 1M19D 3LZ1A 5CPJA 1P3BB 5E5AD 2RVQC 3AZNC 1TAFB 5B33C 2RVQD 4WZSB 2BYKB 5B33D 4J8UC 3AZGA 2CV5D 4J8UD 4ZBJB 4Z5TA 1KX5C 1P3GB 1S32B 1P3LA 3TU4A 5AV9B 4WNNB 5B2JC 5BNXB 5GT3C 2LY8A 3LELC 4E44A 5B32D 3AZNB 3B6GB 5GT3D 5JRGA 3REKA 3WAAC 5B0ZC 3UTAA 1ZLAD 4J8VC 5AV5C 4YS3A 3KXBC 5AVCD 5AV6D 5F99D 3MVDC 1KX5B 1H3OB 4XUJA 3MVDD 3AZJA 1R4VA 5B2JB 1M18A 4H9PA 1P3AD 5DNMA 1ID3C 5B24C 3LELB 2F8NA 3AZED 3AV2C 5B31C 4X23C 1ID3D 3REIA 3WTPA 5B0ZB 3WAAB 5B1MC 3W97A 5GXQC 4J8VB 1P3OD 5AV5B 3KXBB 1P3ID 3AZEA 2BYMA 4WU9D 3MGQC 1BH9A 5KDMA 3AYWD 5GSUD 5BNVB 1P3OA 1TZYC 4J8WD 1KX3B 1B6WA 1N1JA 5B24B 3AZLA 4Z66C 5B31B 4X23B 3AV2B 3B0CT 4H9OB 5B1LA 3UTBC 5B1MB 4Z66D 5B40D 4WU9A 1EQZD 5GXQB 4R8PC 5CP6C 5B0YD 5FUGB 5BO0B 3WTPE 5GT0D 4R8PD 5CPKB 4WU8C 1F66C 3W98D 3AN2C 4G91C 2AROC 4ZUXC 3KWQB 3MGQB 3MGSA 4AWLC 1P34C 5JA4B 2NZDD 1TZYB 4J8XD 1P3PC 4DRAA 1P34D 3O62A 3AZFA 1P3FA 4WV4B 4XZQA 3MNND 1P3PD 3W98A 4JJNA 3NQUB 3UTBB 4EO5C 3NQJB 3W96B 5CP6B 4J8XA 5CHLB 5CPIB 3VH6A 3LJAA 4WU8B 1F66B 1Q9CA 3AN2B 4G91B 2AROB 4ZUXB 4AWLB 5DNND 3AV1C 1KX4C 3REHC 3AZHD 3C1CC 1P3MD 3B6FB 3AFAD 2PYOA 4H9SA 3X1SD 4EO5B 3WKJC 4QLCD 1HQ3A 4H9QA 3X1VD 3AZKC 4KGCD 3WA9D 4LD9A 2NQBC 1P3MA 4YM6A 3UT9A 5AY8D 5AV8A 4H9RB 1AOID 3AZMA 3A6NB 5AVBB 3WA9A 3MGRC 3AV1B 1KX4B 5CPJC 3REHB 5B2ID 3C1CB 5G49A 3LZ1D 4CAYA 5AY8A 3W99A 4KHAA 3WKJB 3AZKB 5BS7A 3MGPC 1M19C 2NQBB 2HIOA 4HGAB 3AZGD 3X1UB 3X1TA 1P3KA 3AZIA 1JFIB 1P3LC 4Z5TD 3MGRB 1B67A 1P3LD 3REJA 5CPJB 3TU4D 2CV5C 2FJ7A 1U35B 1KU5A 3C1BA 5JRGC 3REKC 5JRGD 3REKD 3MGPB 1M19B 1P3BA 3UTAD 5E5AB 1F1EA 1TAFA 4YS3C 5B32C 4UUZB 4YS3D 4XUJC 5B33B 1WWIA 3AZJC 1ZLAC 1M18C 4XUJD 2CV5B 4J8UB 5DNMC 3AZJD 4CSRB 1M18D 5AVCC 5AV6C 5F99C 5DNMD 1P3GA 2F8ND 5AV9A 3W97C 3REID 4KUDD 3WTPD 3W97D 1P3AC 3AZNA 3B6GA 1WWSA 5B32B 4E45A 3AZEC 5GT3B 4Z2MG 2JSSA 1ZLAB 4KUDA 1P3OC 5AVCB 5AV6B 1P3IC 5F99B 1H3OA 3AZLD 4WU9C 5B2JA 3MVDB 3AYWC 3VH6T 5GSUC 5B1LD 3LELA 4J8WC 1P3AB 2HUEC 3AZEB 4H9NB 1ID3B 3WAAA 5B40C 3MGSC 5KDMB 4J8VA 1EQZC 5AV5A 5B0YC 3KXBA 1P3OB 3MGSD 5GT0C 1P3IB 3KUYD 3W98C 3O62D 3AZFD 1P3FD 4XZQD 4WU9B 5BNVA 3AYWB 4JJND 5GSUB 2NZDC 1KX3A 5B24A 4J8XC 4J8WB 3AV2A 2HUEB 4X23A 3LJAC 3KUYA 3MNNC 2F8NG 4H9OA 3LJAD 4Z66B 5B40B 5GXQA 1EQZB 5BO0A 5B0YB 5CPKA 5GT0B 4R8PB 3W98B 3KWQA 3MGQA 5JA4A 1TZYA 2PYOD 2NZDB 4J8XB 5DNNC 1HQ3D 3RELD 1P34B 1M1AA 3AZHC 4LD9D 1P3PB 3MNNB 1P3MC 4YM6C 3NQUA 3UTBA 5AV8C 3AFAC 3W96A 3X1SC 2YFWB 4QLCC 4YM6D 3UT9D 3X1VC 5CP6A 5AV8D 4KGCC 3WA9C 3AZMD 5CPIA 2YFVB 3RELA 1F66A 4ZUXA 5AY8C 1AOIC 3W99D 1BH8B 3VH5W 5DNNB 3R45B 5B2IC 3AZHB 3B6FA 4NFTA 1P3MB 2HIOD 3LZ1C 3AFAB 3X1SB 2F8NH 4QLCB 4NE6A 3X1VB 3X1TD 1P3KD 3AZID 4KGCB 3WA9B 3B0CW 4H9RA 3AZGC 3REJD 5AY8B 4NE3A 2FJ7D 4DRBA 3A6NA 1AOIB 5AVBA 3LZ0D 3C1BD 1KX4A 4Z5TC 3REHA 1P3BC 5BT1D 3TU4C 3V9RB 3C1CA 5B2IB 3LZ1B 1P3BD 3AZKA 3LZ0A 2NQBA 3UTAC 3X1UA 3AZGB 4G92C 1JFIA 1P3GD 3MGRA 4Z5TB 1S32D 2BYKA 5AV9D 1P3LB 3TU4B 1U35A 3B6GC 3AZND 3B6GD 3MGPA 5JRGB 1M19A 1S32A 3REIC 4KUDC 3REKB 3WTPC 4WNNA 5E5AA 3UTAB 5BNXA 4UUZA 4G92B 4YS3B 5B33A 1KX5D 1HTAA 2CV5A 4J8UA 4XUJB 4CSRA 2L5AA 5B2JD 3AZJB 1M18B 4H9PB 3KSYA 3LELD 5DNMB 3AZLC 2F8NB 1KX5A 5B0ZD 3WAAD 3REIB 4KUDB 5B1LC 3WTPB 3W97B 5B32A 4J8VD 5AV5D 5GT3A 3KXBD 1ZLAA 2BYMB 5B0ZA 1KX3C 1BH9B 5AV6A 5AVCA 5F99A 1KX3D 5B24D 3KUYC 3O62C 1N1JB 3AZFC 3AV2D 4M6BA 5B31D 4X23D 3MVDA 3AZLB 1P3FC 4XZQC 5B1MD 4JJNC 5B1LB 1P3AA 5GXQD 5CPKC 3VH5T 4H9NA 1ID3A 5CPKD 3KWQC 5B31A 3KWQD 5B1MA 3MGQD 4Z2MH 3MGSB 3UT9C 1P3IA 1M1AC 1TZYD 5FUGA 3KUYB 5C3IC 3O62B 3AZFB 1M1AD 3W96C 1P3FB 3AYWA 4XZQB 2IO5C 5GSUA 3UTBD 4JJNB 5B32G 4H9SC 2CWEA 4J8WA 2PYOC 3W96D 5CPIC 1HQ3C 5CP6D 3RELC 4LD9C 5CPID 4Z66A 5B40A 4WU8D 1F66D 1ULYA 3LJAB 1EQZA 3AN2D 4ZUXD
chains in the Genus database with same CATH superfamily
5B0YA 3NQJA 2F8NK 3AZMC 5GT0A 4R8PA 1M1AB 3B6FC 5C3IB 4WU8A 3B6FD 3P5JB 2IO5B 3AN2A 2AROA 2AROD 3W99C 2NZDA 2PYOB 3VH5A 1P34A 1HQ3B 4H9QB 3RELB 3B0BA 5BS7C 2ZY4A 3MNNA 1P3PA 4LD9B 5B31G 1A7WA 2HIOC 3VH6W 2YFWA 3A6NC 4YM6B 3UT9B 5AV8B 5AVBC 3X1TC 1P3KC 2Y2JA 3AZIC 3A6ND 2YFVA 3AZMB 5AVBD 3AV1D 1KX4D 3REHD 3REJC 3C1CD 2FJ7C 3B0DC 5G49B 1BFMA 4CAYB 1BH8A 3W99B 3LZ0C 3WKJD 4KHAB 5DNNA 3C1BC 3R45A 3AZKD 3AZHA 4HGAC 5BT1C 3AV1A 2NQBD 3X1UC 3AFAA 2HIOB 3X1SA 4QLCA 3X1UD 3X1VA 3H0RC 4KGCA 3X1TB 1P3KB 3WKJA 3AZIB 3MGRD 1U35C 5CPJD 4ZBJC 4NE5A 3REJB 1AOIA 1U35D 2FJ7B 3B0DB 3LZ0B 3EPHA 1P3GC 3C1BB 1S32C 3V9RA 5B2IA 5AV9C 5E5AC 3MGPD 1M19D 3LZ1A 5CPJA 1P3BB 5E5AD 2G5HC 2RVQC 3AZNC 1TAFB 5B33C 3AL0C 2RVQD 4WZSB 2BYKB 5B33D 4J8UC 3AZGA 2CV5D 4J8UD 4ZBJB 4Z5TA 1KX5C 1P3GB 1S32B 1P3LA 2Y2LA 3TU4A 5AV9B 4WNNB 5B2JC 4WJ3C 5BNXB 5GT3C 2LY8A 3LELC 4E44A 5B32D 3AZNB 3B6GB 3EPJA 5GT3D 5JRGA 2Y2IA 3REKA 3WAAC 5B0ZC 3UTAA 1ZLAD 4J8VC 5AV5C 4YS3A 3KXBC 5AVCD 5AV6D 5F99D 3MVDC 1KX5B 1H3OB 4XUJA 3MVDD 3AZJA 1R4VA 5B2JB 1M18A 4H9PA 1P3AD 5DNMA 1ID3C 5B24C 3LELB 2F8NA 3AZED 3AV2C 5B31C 4X23C 1ID3D 3REIA 3WTPA 5B0ZB 3WAAB 5B1MC 3W97A 2FFFB 5GXQC 4J8VB 1P3OD 5AV5B 3KXBB 1P3ID 3AZEA 2BYMA 2Y2KA 2ZY5A 4WU9D 3MGQC 1BH9A 1PZRA 5KDMA 5GSUD 3AYWD 5BNVB 1P3OA 1TZYC 4J8WD 1KX3B 1B6WA 1N1JA 5B24B 3AZLA 4Z66C 5B31B 4X23B 3AV2B 3B0CT 4H9OB 5B1LA 3UTBC 5B1MB 4Z66D 5B40D 4WU9A 1EQZD 2DQNC 5GXQB 4R8PC 5CP6C 5B0YD 5FUGB 5BO0B 3WTPE 5GT0D 4R8PD 5CPKB 4WU8C 1F66C 3W98D 3AN2C 4G91C 2AROC 4ZUXC 3KWQB 3MGQB 2UWXA 3MGSA 4AWLC 1P34C 5JA4B 2NZDD 1TZYB 4J8XD 1P3PC 4DRAA 1P34D 3O62A 3AZFA 2DF4C 2J8PA 1P3FA 1W2EA 4WV4B 4XZQA 3MNND 1P3PD 3W98A 4JJNA 3NQUB 3UTBB 4EO5C 3NQJB 3W96B 5CP6B 4J8XA 5CHLB 5CPIB 3VH6A 3LJAA 4WU8B 1F66B 1Q9CA 2Y2OA 2W8SA 4G91B 3AN2B 2AROB 4ZUXB 4AWLB 5DNND 3AV1C 1KX4C 3REHC 3AZHD 3C1CC 1P3MD 3B6FB 3AFAD 2PYOA 4H9SA 3X1SD 4EO5B 3WKJC 4QLCD 2ZY3A 1HQ3A 4H9QA 3X1VD 3AZKC 4KGCD 3WA9D 4LD9A 2NQBC 2VQRA 1P3MA 4YM6A 3UT9A 5AY8D 5AV8A 4H9RB 1AOID 3AZMA 3A6NB 5AVBB 3WA9A 3MGRC 3AV1B 1KX4B 5CPJC 3REHB 5B2ID 3A1KA 3C1CB 5G49A 3LZ1D 4CAYA 5AY8A 3W99A 4KHAA 2XD1A 3WKJB 2RIQA 3AZKB 5BS7A 3MGPC 1M19C 2NQBB 2HIOA 4HGAB 3EPLA 3AZGD 3X1UB 3X1TA 1P3KA 3AZIA 3EPKA 1JFIB 1P3LC 4Z5TD 3MGRB 1B67A 1P3LD 3REJA 5CPJB 3TU4D 2CV5C 2FJ7A 3FDDA 1U35B 1KU5A 3C1BA 5JRGC 3REKC 5JRGD 3REKD 3MGPB 1M19B 1P3BA 3UTAD 5E5AB 1F1EA 1TAFA 4YS3C 5B32C 4UUZB 4YS3D 4XUJC 3F6TA 1WWIA 5B33B 3AZJC 1ZLAC 1M18C 4XUJD 2CV5B 4J8UB 5DNMC 3AZJD 4CSRB 2G5IC 5AVCC 5AV6C 1M18D 5F99C 5DNMD 1P3GA 2F8ND 3A1IA 4UPKA 5AV9A 3W97C 4DQYB 3REID 4KUDD 3WTPD 3W97D 1P3AC 3AZNA 3B6GA 1WWSA 5B32B 4E45A 3AZEC 5GT3B 4Z2MG 2JSSA 1ZLAB 4KUDA 1P3OC 5AVCB 5AV6B 1P3IC 5F99B 1H3OA 3AZLD 4WU9C 5B2JA 3MVDB 3AYWC 3VH6T 5GSUC 5B1LD 3LELA 4J8WC 1P3AB 2HUEC 3AZEB 4H9NB 1ID3B 3WAAA 5B40C 3MGSC 5KDMB 4J8VA 1EQZC 5AV5A 5B0YC 3KXBA 1P3OB 3MGSD 3H0MC 2Y2QA 5GT0C 1P3IB 3KUYD 3W98C 3O62D 3AZFD 1P3FD 4XZQD 4WU9B 5BNVA 3AYWB 4JJND 5GSUB 2NZDC 1KX3A 5B24A 4J8XC 4J8WB 3AV2A 2HUEB 4X23A 3LJAC 3KUYA 3MNNC 2F8NG 4H9OA 3LJAD 4Z66B 5B40B 5GXQA 1EQZB 2Y2HA 5BO0A 5B0YB 5CPKA 5GT0B 4R8PB 2Y2PA 3KWQA 3W98B 3MGQA 2BG1A 5JA4A 1TZYA 2ZM5A 3IP4C 2PYOD 2NZDB 4J8XB 5DNNC 1HQ3D 3RELD 1P34B 1M1AA 3AZHC 4LD9D 1P3PB 3MNNB 1P3MC 4YM6C 3NQUA 3UTBA 5AV8C 3AFAC 3W96A 3X1SC 2YFWB 4QLCC 2Y2NA 4YM6D 3X1VC 5CP6A 5AV8D 3UT9D 4KGCC 3WA9C 3AZMD 5CPIA 2YFVB 3RELA 1F66A 3H0LC 4ZUXA 5AY8C 1Z2CB 1AOIC 2JCHA 3W99D 1BH8B 3VH5W 5DNNB 3R45B 5B2IC 3AZHB 3B6FA 4NFTA 1P3MB 2HIOD 3LZ1C 3AFAB 3X1SB 2F8NH 4QLCB 4NE6A 3X1VB 3X1TD 1P3KD 3AZID 4KGCB 3WA9B 3KFUG 3EG5B 3B0CW 2Y2GA 4H9RA 3AZGC 3REJD 5AY8B 4NE3A 2FJ7D 4DRBA 3A6NA 1AOIB 5AVBA 3LZ0D 3C1BD 1KX4A 4Z5TC 3REHA 1P3BC 5BT1D 3TU4C 3V9RB 3C1CA 5B2IB 3LZ1B 1P3BD 3AZKA 2F2AC 3LZ0A 2NQBA 3UTAC 3X1UA 3AZGB 4G92C 1JFIA 1P3GD 3MGRA 4Z5TB 1S32D 2BYKA 5AV9D 1P3LB 3TU4B 1U35A 3B6GC 3AZND 3B6GD 3MGPA 5JRGB 1M19A 1S32A 3REIC 4KUDC 3REKB 3WTPC 4WNNA 5E5AA 3UTAB 5BNXA 4UUZA 4G92B 4YS3B 5B33A 1KX5D 1HTAA 2CV5A 4J8UA 4XUJB 2ZY2A 4CSRA 2L5AA 5B2JD 3AZJB 2JE5A 1M18B 4H9PB 3KSYA 3LELD 5DNMB 2Y2MA 3AZLC 2F8NB 1KX5A 5B0ZD 3WAAD 3REIB 4KUDB 5B1LC 3WTPB 3W97B 5B32A 4J8VD 5AV5D 5GT3A 3KXBD 1ZLAA 2BYMB 5B0ZA 1KX3C 1BH9B 5AV6A 5AVCA 5F99A 1KX3D 5B24D 3KUYC 3O62C 1N1JB 3AZFC 3AV2D 4M6BA 5B31D 4X23D 3MVDA 3AZLB 1P3FC 4XZQC 5B1MD 4JJNC 5B1LB 1P3AA 5GXQD 5CPKC 3VH5T 4H9NA 1ID3A 5CPKD 3KWQC 5B31A 3KWQD 5B1MA 3MGQD 1T3UA 4Z2MH 3MGSB 3UT9C 1P3IA 1M1AC 1TZYD 5FUGA 3KUYB 5C3IC 3O62B 3AZFB 1M1AD 3W96C 1P3FB 3AYWA 4XZQB 2IO5C 5GSUA 3UTBD 4JJNB 5B32G 4H9SC 2CWEA 4J8WA 2PYOC 3W96D 5CPIC 1HQ3C 5CP6D 3RELC 4LD9C 2XD5A 5CPID 4Z66A 5B40A 4WU8D 1F66D 1ULYA 3LJAB 1EQZA 3AN2D 4ZUXD
chains in the Genus database with same CATH topology
5B0YA 3NQJA 2F8NK 3AZMC 5GT0A 4R8PA 1M1AB 3B6FC 5C3IB 4WU8A 3B6FD 3P5JB 2IO5B 3AN2A 2AROA 2AROD 3W99C 2NZDA 2PYOB 3VH5A 1P34A 1HQ3B 4H9QB 3RELB 3B0BA 5BS7C 2ZY4A 3MNNA 1P3PA 4LD9B 5B31G 1A7WA 2HIOC 3VH6W 2YFWA 3A6NC 4YM6B 3UT9B 5AV8B 5AVBC 3X1TC 1P3KC 2Y2JA 3AZIC 3A6ND 2YFVA 3AZMB 5AVBD 3AV1D 1KX4D 3REHD 3REJC 3C1CD 2FJ7C 3B0DC 5G49B 1BFMA 4CAYB 1BH8A 3W99B 3LZ0C 3WKJD 4KHAB 5DNNA 3C1BC 3R45A 3AZKD 3AZHA 4HGAC 5BT1C 3AV1A 2NQBD 3X1UC 3AFAA 2HIOB 3X1SA 4QLCA 3X1UD 3X1VA 3H0RC 4KGCA 3X1TB 1P3KB 3WKJA 3AZIB 3MGRD 1U35C 5CPJD 4ZBJC 4NE5A 3REJB 1AOIA 1U35D 2FJ7B 3B0DB 3LZ0B 3EPHA 1P3GC 3C1BB 1S32C 3V9RA 5B2IA 5AV9C 5E5AC 3MGPD 1M19D 3LZ1A 5CPJA 1P3BB 5E5AD 2G5HC 2RVQC 3AZNC 1TAFB 5B33C 3AL0C 2RVQD 4WZSB 2BYKB 5B33D 4J8UC 3AZGA 2CV5D 4J8UD 4ZBJB 4Z5TA 1KX5C 1P3GB 1S32B 1P3LA 2Y2LA 3TU4A 5AV9B 4WNNB 5B2JC 4WJ3C 5BNXB 5GT3C 2LY8A 3LELC 4E44A 5B32D 3AZNB 3B6GB 3EPJA 5GT3D 5JRGA 2Y2IA 3REKA 3WAAC 5B0ZC 3UTAA 1ZLAD 4J8VC 5AV5C 4YS3A 3KXBC 5AVCD 5AV6D 5F99D 3MVDC 1KX5B 1H3OB 4XUJA 3MVDD 3AZJA 1R4VA 5B2JB 1M18A 4H9PA 1P3AD 5DNMA 1ID3C 5B24C 3LELB 2F8NA 3AZED 3AV2C 5B31C 4X23C 1ID3D 3REIA 3WTPA 5B0ZB 3WAAB 5B1MC 3W97A 2FFFB 5GXQC 4J8VB 1P3OD 5AV5B 3KXBB 1P3ID 3AZEA 2BYMA 2Y2KA 2ZY5A 4WU9D 3MGQC 1BH9A 1PZRA 5KDMA 5GSUD 3AYWD 5BNVB 1P3OA 1TZYC 4J8WD 1KX3B 1B6WA 1N1JA 5B24B 3AZLA 4Z66C 5B31B 4X23B 3AV2B 3B0CT 4H9OB 5B1LA 3UTBC 5B1MB 4Z66D 5B40D 4WU9A 1EQZD 2DQNC 5GXQB 4R8PC 5CP6C 5B0YD 5FUGB 5BO0B 3WTPE 5GT0D 4R8PD 5CPKB 4WU8C 1F66C 3W98D 3AN2C 4G91C 2AROC 4ZUXC 3KWQB 3MGQB 2UWXA 3MGSA 4AWLC 1P34C 5JA4B 2NZDD 1TZYB 4J8XD 1P3PC 4DRAA 1P34D 3O62A 3AZFA 2DF4C 2J8PA 1P3FA 1W2EA 4WV4B 4XZQA 3MNND 1P3PD 3W98A 4JJNA 3NQUB 3UTBB 4EO5C 3NQJB 3W96B 5CP6B 4J8XA 5CHLB 5CPIB 3VH6A 3LJAA 4WU8B 1F66B 1Q9CA 2Y2OA 2W8SA 4G91B 3AN2B 2AROB 4ZUXB 4AWLB 5DNND 3AV1C 1KX4C 3REHC 3AZHD 3C1CC 1P3MD 3B6FB 3AFAD 2PYOA 4H9SA 3X1SD 4EO5B 3WKJC 4QLCD 2ZY3A 1HQ3A 4H9QA 3X1VD 3AZKC 4KGCD 3WA9D 4LD9A 2NQBC 2VQRA 1P3MA 4YM6A 3UT9A 5AY8D 5AV8A 4H9RB 1AOID 3AZMA 3A6NB 5AVBB 3WA9A 3MGRC 3AV1B 1KX4B 5CPJC 3REHB 5B2ID 3A1KA 3C1CB 5G49A 3LZ1D 4CAYA 5AY8A 3W99A 4KHAA 2XD1A 3WKJB 2RIQA 3AZKB 5BS7A 3MGPC 1M19C 2NQBB 2HIOA 4HGAB 3EPLA 3AZGD 3X1UB 3X1TA 1P3KA 3AZIA 3EPKA 1JFIB 1P3LC 4Z5TD 3MGRB 1B67A 1P3LD 3REJA 5CPJB 3TU4D 2CV5C 2FJ7A 3FDDA 1U35B 1KU5A 3C1BA 5JRGC 3REKC 5JRGD 3REKD 3MGPB 1M19B 1P3BA 3UTAD 5E5AB 1F1EA 1TAFA 4YS3C 5B32C 4UUZB 4YS3D 4XUJC 3F6TA 1WWIA 5B33B 3AZJC 1ZLAC 1M18C 4XUJD 2CV5B 4J8UB 5DNMC 3AZJD 4CSRB 2G5IC 5AVCC 5AV6C 1M18D 5F99C 5DNMD 1P3GA 2F8ND 3A1IA 4UPKA 5AV9A 3W97C 4DQYB 3REID 4KUDD 3WTPD 3W97D 1P3AC 3AZNA 3B6GA 1WWSA 5B32B 4E45A 3AZEC 5GT3B 4Z2MG 2JSSA 1ZLAB 4KUDA 1P3OC 5AVCB 5AV6B 1P3IC 5F99B 1H3OA 3AZLD 4WU9C 5B2JA 3MVDB 3AYWC 3VH6T 5GSUC 5B1LD 3LELA 4J8WC 1P3AB 2HUEC 3AZEB 4H9NB 1ID3B 3WAAA 5B40C 3MGSC 5KDMB 4J8VA 1EQZC 5AV5A 5B0YC 3KXBA 1P3OB 3MGSD 3H0MC 2Y2QA 5GT0C 1P3IB 3KUYD 3W98C 3O62D 3AZFD 1P3FD 4XZQD 4WU9B 5BNVA 3AYWB 4JJND 5GSUB 2NZDC 1KX3A 5B24A 4J8XC 4J8WB 3AV2A 2HUEB 4X23A 3LJAC 3KUYA 3MNNC 2F8NG 4H9OA 3LJAD 4Z66B 5B40B 5GXQA 1EQZB 2Y2HA 5BO0A 5B0YB 5CPKA 5GT0B 4R8PB 2Y2PA 3KWQA 3W98B 3MGQA 2BG1A 5JA4A 1TZYA 2ZM5A 3IP4C 2PYOD 2NZDB 4J8XB 5DNNC 1HQ3D 3RELD 1P34B 1M1AA 3AZHC 4LD9D 1P3PB 3MNNB 1P3MC 4YM6C 3NQUA 3UTBA 5AV8C 3AFAC 3W96A 3X1SC 2YFWB 4QLCC 2Y2NA 4YM6D 3X1VC 5CP6A 5AV8D 3UT9D 4KGCC 3WA9C 3AZMD 5CPIA 2YFVB 3RELA 1F66A 3H0LC 4ZUXA 5AY8C 1Z2CB 1AOIC 2JCHA 3W99D 1BH8B 3VH5W 5DNNB 3R45B 5B2IC 3AZHB 3B6FA 4NFTA 1P3MB 2HIOD 3LZ1C 3AFAB 3X1SB 2F8NH 4QLCB 4NE6A 3X1VB 3X1TD 1P3KD 3AZID 4KGCB 3WA9B 3KFUG 3EG5B 3B0CW 2Y2GA 4H9RA 3AZGC 3REJD 5AY8B 4NE3A 2FJ7D 4DRBA 3A6NA 1AOIB 5AVBA 3LZ0D 3C1BD 1KX4A 4Z5TC 3REHA 1P3BC 5BT1D 3TU4C 3V9RB 3C1CA 5B2IB 3LZ1B 1P3BD 3AZKA 2F2AC 3LZ0A 2NQBA 3UTAC 3X1UA 3AZGB 4G92C 1JFIA 1P3GD 3MGRA 4Z5TB 1S32D 2BYKA 5AV9D 1P3LB 3TU4B 1U35A 3B6GC 3AZND 3B6GD 3MGPA 5JRGB 1M19A 1S32A 3REIC 4KUDC 3REKB 3WTPC 4WNNA 5E5AA 3UTAB 5BNXA 4UUZA 4G92B 4YS3B 5B33A 1KX5D 1HTAA 2CV5A 4J8UA 4XUJB 2ZY2A 4CSRA 2L5AA 5B2JD 3AZJB 2JE5A 1M18B 4H9PB 3KSYA 3LELD 5DNMB 2Y2MA 3AZLC 2F8NB 1KX5A 5B0ZD 3WAAD 3REIB 4KUDB 5B1LC 3WTPB 3W97B 5B32A 4J8VD 5AV5D 5GT3A 3KXBD 1ZLAA 2BYMB 5B0ZA 1KX3C 1BH9B 5AV6A 5AVCA 5F99A 1KX3D 5B24D 3KUYC 3O62C 1N1JB 3AZFC 3AV2D 4M6BA 5B31D 4X23D 3MVDA 3AZLB 1P3FC 4XZQC 5B1MD 4JJNC 5B1LB 1P3AA 5GXQD 5CPKC 3VH5T 4H9NA 1ID3A 5CPKD 3KWQC 5B31A 3KWQD 5B1MA 3MGQD 1T3UA 4Z2MH 3MGSB 3UT9C 1P3IA 1M1AC 1TZYD 5FUGA 3KUYB 5C3IC 3O62B 3AZFB 1M1AD 3W96C 1P3FB 3AYWA 4XZQB 2IO5C 5GSUA 3UTBD 4JJNB 5B32G 4H9SC 2CWEA 4J8WA 2PYOC 3W96D 5CPIC 1HQ3C 5CP6D 3RELC 4LD9C 2XD5A 5CPID 4Z66A 5B40A 4WU8D 1F66D 1ULYA 3LJAB 1EQZA 3AN2D 4ZUXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y A;  3NQJ A;  2F8N K;  3AZM C;  5GT0 A;  4R8P A;  1M1A B;  3B6F C;  5C3I B;  4WU8 A;  3B6F D;  2IO5 B;  3AN2 A;  2ARO A;  2ARO D;  3W99 C;  2NZD A;  2PYO B;  3VH5 A;  1P34 A;  1HQ3 B;  4H9Q B;  3REL B;  3B0B A;  5BS7 C;  3MNN A;  1P3P A;  4LD9 B;  5B31 G;  1A7W A;  2HIO C;  3VH6 W;  2YFW A;  3A6N C;  4YM6 B;  3UT9 B;  5AV8 B;  5AVB C;  3X1T C;  1P3K C;  3AZI C;  3A6N D;  2YFV A;  3AZM B;  5AVB D;  3AV1 D;  1KX4 D;  3REH D;  3REJ C;  3C1C D;  2FJ7 C;  3B0D C;  5G49 B;  1BFM A;  4CAY B;  1BH8 A;  3W99 B;  3LZ0 C;  3WKJ D;  4KHA B;  5DNN A;  3C1B C;  3R45 A;  3AZK D;  3AZH A;  4HGA C;  5BT1 C;  3AV1 A;  2NQB D;  3X1U C;  3AFA A;  2HIO B;  3X1S A;  4QLC A;  3X1U D;  3X1V A;  4KGC A;  3X1T B;  1P3K B;  3WKJ A;  3AZI B;  3MGR D;  1U35 C;  5CPJ D;  4ZBJ C;  4NE5 A;  3REJ B;  1AOI A;  1U35 D;  2FJ7 B;  3B0D B;  3LZ0 B;  1P3G C;  3C1B B;  1S32 C;  3V9R A;  5B2I A;  5AV9 C;  5E5A C;  3MGP D;  1M19 D;  3LZ1 A;  5CPJ A;  1P3B B;  5E5A D;  2RVQ C;  3AZN C;  1TAF B;  5B33 C;  2RVQ D;  4WZS B;  2BYK B;  5B33 D;  4J8U C;  3AZG A;  2CV5 D;  4J8U D;  4ZBJ B;  4Z5T A;  1KX5 C;  1P3G B;  1S32 B;  1P3L A;  3TU4 A;  5AV9 B;  4WNN B;  5B2J C;  5BNX B;  5GT3 C;  2LY8 A;  3LEL C;  4E44 A;  5B32 D;  3AZN B;  3B6G B;  5GT3 D;  5JRG A;  3REK A;  3WAA C;  5B0Z C;  3UTA A;  1ZLA D;  4J8V C;  5AV5 C;  4YS3 A;  3KXB C;  5AVC D;  5AV6 D;  5F99 D;  3MVD C;  1KX5 B;  1H3O B;  4XUJ A;  3MVD D;  3AZJ A;  1R4V A;  5B2J B;  1M18 A;  4H9P A;  1P3A D;  5DNM A;  1ID3 C;  5B24 C;  3LEL B;  2F8N A;  3AZE D;  3AV2 C;  5B31 C;  4X23 C;  1ID3 D;  3REI A;  3WTP A;  5B0Z B;  3WAA B;  5B1M C;  3W97 A;  5GXQ C;  4J8V B;  1P3O D;  5AV5 B;  3KXB B;  1P3I D;  3AZE A;  2BYM A;  4WU9 D;  3MGQ C;  1BH9 A;  5KDM A;  3AYW D;  5GSU D;  5BNV B;  1P3O A;  1TZY C;  4J8W D;  1KX3 B;  1B6W A;  1N1J A;  5B24 B;  3AZL A;  4Z66 C;  5B31 B;  4X23 B;  3AV2 B;  3B0C T;  4H9O B;  5B1L A;  3UTB C;  5B1M B;  4Z66 D;  5B40 D;  4WU9 A;  1EQZ D;  5GXQ B;  4R8P C;  5CP6 C;  5B0Y D;  5FUG B;  5BO0 B;  3WTP E;  5GT0 D;  4R8P D;  5CPK B;  4WU8 C;  1F66 C;  3W98 D;  3AN2 C;  4G91 C;  2ARO C;  4ZUX C;  3KWQ B;  3MGQ B;  3MGS A;  4AWL C;  1P34 C;  5JA4 B;  2NZD D;  1TZY B;  4J8X D;  1P3P C;  4DRA A;  1P34 D;  3O62 A;  3AZF A;  1P3F A;  4WV4 B;  4XZQ A;  3MNN D;  1P3P D;  3W98 A;  4JJN A;  3NQU B;  3UTB B;  4EO5 C;  3NQJ B;  3W96 B;  5CP6 B;  4J8X A;  5CHL B;  5CPI B;  3VH6 A;  3LJA A;  4WU8 B;  1F66 B;  1Q9C A;  3AN2 B;  4G91 B;  2ARO B;  4ZUX B;  4AWL B;  5DNN D;  3AV1 C;  1KX4 C;  3REH C;  3AZH D;  3C1C C;  1P3M D;  3B6F B;  3AFA D;  2PYO A;  4H9S A;  3X1S D;  4EO5 B;  3WKJ C;  4QLC D;  1HQ3 A;  4H9Q A;  3X1V D;  3AZK C;  4KGC D;  3WA9 D;  4LD9 A;  2NQB C;  1P3M A;  4YM6 A;  3UT9 A;  5AY8 D;  5AV8 A;  4H9R B;  1AOI D;  3AZM A;  3A6N B;  5AVB B;  3WA9 A;  3MGR C;  3AV1 B;  1KX4 B;  5CPJ C;  3REH B;  5B2I D;  3C1C B;  5G49 A;  3LZ1 D;  4CAY A;  5AY8 A;  3W99 A;  4KHA A;  3WKJ B;  3AZK B;  5BS7 A;  3MGP C;  1M19 C;  2NQB B;  2HIO A;  4HGA B;  3AZG D;  3X1U B;  3X1T A;  1P3K A;  3AZI A;  1JFI B;  1P3L C;  4Z5T D;  3MGR B;  1B67 A;  1P3L D;  3REJ A;  5CPJ B;  3TU4 D;  2CV5 C;  2FJ7 A;  1U35 B;  1KU5 A;  3C1B A;  5JRG C;  3REK C;  5JRG D;  3REK D;  3MGP B;  1M19 B;  1P3B A;  3UTA D;  5E5A B;  1F1E A;  1TAF A;  4YS3 C;  5B32 C;  4UUZ B;  4YS3 D;  4XUJ C;  5B33 B;  1WWI A;  3AZJ C;  1ZLA C;  1M18 C;  4XUJ D;  2CV5 B;  4J8U B;  5DNM C;  3AZJ D;  4CSR B;  1M18 D;  5AVC C;  5AV6 C;  5F99 C;  5DNM D;  1P3G A;  2F8N D;  5AV9 A;  3W97 C;  3REI D;  4KUD D;  3WTP D;  3W97 D;  1P3A C;  3AZN A;  3B6G A;  1WWS A;  5B32 B;  4E45 A;  3AZE C;  5GT3 B;  4Z2M G;  2JSS A;  1ZLA B;  4KUD A;  1P3O C;  5AVC B;  5AV6 B;  1P3I C;  5F99 B;  1H3O A;  3AZL D;  4WU9 C;  5B2J A;  3MVD B;  3AYW C;  3VH6 T;  5GSU C;  5B1L D;  3LEL A;  4J8W C;  1P3A B;  2HUE C;  3AZE B;  4H9N B;  1ID3 B;  3WAA A;  5B40 C;  3MGS C;  5KDM B;  4J8V A;  1EQZ C;  5AV5 A;  5B0Y C;  3KXB A;  1P3O B;  3MGS D;  5GT0 C;  1P3I B;  3KUY D;  3W98 C;  3O62 D;  3AZF D;  1P3F D;  4XZQ D;  4WU9 B;  5BNV A;  3AYW B;  4JJN D;  5GSU B;  2NZD C;  1KX3 A;  5B24 A;  4J8X C;  4J8W B;  3AV2 A;  2HUE B;  4X23 A;  3LJA C;  3KUY A;  3MNN C;  2F8N G;  4H9O A;  3LJA D;  4Z66 B;  5B40 B;  5GXQ A;  1EQZ B;  5BO0 A;  5B0Y B;  5CPK A;  5GT0 B;  4R8P B;  3W98 B;  3KWQ A;  3MGQ A;  5JA4 A;  1TZY A;  2PYO D;  2NZD B;  4J8X B;  5DNN C;  1HQ3 D;  3REL D;  1P34 B;  1M1A A;  3AZH C;  4LD9 D;  1P3P B;  3MNN B;  1P3M C;  4YM6 C;  3NQU A;  3UTB A;  5AV8 C;  3AFA C;  3W96 A;  3X1S C;  2YFW B;  4QLC C;  4YM6 D;  3UT9 D;  3X1V C;  5CP6 A;  5AV8 D;  4KGC C;  3WA9 C;  3AZM D;  5CPI A;  2YFV B;  3REL A;  1F66 A;  4ZUX A;  5AY8 C;  1AOI C;  3W99 D;  1BH8 B;  3VH5 W;  5DNN B;  3R45 B;  5B2I C;  3AZH B;  3B6F A;  4NFT A;  1P3M B;  2HIO D;  3LZ1 C;  3AFA B;  3X1S B;  2F8N H;  4QLC B;  4NE6 A;  3X1V B;  3X1T D;  1P3K D;  3AZI D;  4KGC B;  3WA9 B;  3B0C W;  4H9R A;  3AZG C;  3REJ D;  5AY8 B;  4NE3 A;  2FJ7 D;  4DRB A;  3A6N A;  1AOI B;  5AVB A;  3LZ0 D;  3C1B D;  1KX4 A;  4Z5T C;  3REH A;  1P3B C;  5BT1 D;  3TU4 C;  3V9R B;  3C1C A;  5B2I B;  3LZ1 B;  1P3B D;  3AZK A;  3LZ0 A;  2NQB A;  3UTA C;  3X1U A;  3AZG B;  4G92 C;  1JFI A;  1P3G D;  3MGR A;  4Z5T B;  1S32 D;  2BYK A;  5AV9 D;  1P3L B;  3TU4 B;  1U35 A;  3B6G C;  3AZN D;  3B6G D;  3MGP A;  5JRG B;  1M19 A;  1S32 A;  3REI C;  4KUD C;  3REK B;  3WTP C;  4WNN A;  5E5A A;  3UTA B;  5BNX A;  4UUZ A;  4G92 B;  4YS3 B;  5B33 A;  1KX5 D;  1HTA A;  2CV5 A;  4J8U A;  4XUJ B;  4CSR A;  2L5A A;  5B2J D;  3AZJ B;  1M18 B;  4H9P B;  3KSY A;  3LEL D;  5DNM B;  3AZL C;  2F8N B;  1KX5 A;  5B0Z D;  3WAA D;  3REI B;  4KUD B;  5B1L C;  3WTP B;  3W97 B;  5B32 A;  4J8V D;  5AV5 D;  5GT3 A;  3KXB D;  1ZLA A;  2BYM B;  5B0Z A;  1KX3 C;  1BH9 B;  5AV6 A;  5AVC A;  5F99 A;  1KX3 D;  5B24 D;  3KUY C;  3O62 C;  1N1J B;  3AZF C;  3AV2 D;  4M6B A;  5B31 D;  4X23 D;  3MVD A;  3AZL B;  1P3F C;  4XZQ C;  5B1M D;  4JJN C;  5B1L B;  1P3A A;  5GXQ D;  5CPK C;  3VH5 T;  4H9N A;  1ID3 A;  5CPK D;  3KWQ C;  5B31 A;  3KWQ D;  5B1M A;  3MGQ D;  4Z2M H;  3MGS B;  3UT9 C;  1P3I A;  1M1A C;  1TZY D;  5FUG A;  3KUY B;  5C3I C;  3O62 B;  3AZF B;  1M1A D;  3W96 C;  1P3F B;  3AYW A;  4XZQ B;  2IO5 C;  5GSU A;  3UTB D;  4JJN B;  5B32 G;  4H9S C;  2CWE A;  4J8W A;  2PYO C;  3W96 D;  5CPI C;  1HQ3 C;  5CP6 D;  3REL C;  4LD9 C;  5CPI D;  4Z66 A;  5B40 A;  4WU8 D;  1F66 D;  1ULY A;  3LJA B;  1EQZ A;  3AN2 D;  4ZUX D; 
#chains in the Genus database with same CATH topology
 5B0Y A;  3NQJ A;  2F8N K;  3AZM C;  5GT0 A;  4R8P A;  1M1A B;  3B6F C;  5C3I B;  4WU8 A;  3B6F D;  3P5J B;  2IO5 B;  3AN2 A;  2ARO A;  2ARO D;  3W99 C;  2NZD A;  2PYO B;  3VH5 A;  1P34 A;  1HQ3 B;  4H9Q B;  3REL B;  3B0B A;  5BS7 C;  2ZY4 A;  3MNN A;  1P3P A;  4LD9 B;  5B31 G;  1A7W A;  2HIO C;  3VH6 W;  2YFW A;  3A6N C;  4YM6 B;  3UT9 B;  5AV8 B;  5AVB C;  3X1T C;  1P3K C;  2Y2J A;  3AZI C;  3A6N D;  2YFV A;  3AZM B;  5AVB D;  3AV1 D;  1KX4 D;  3REH D;  3REJ C;  3C1C D;  2FJ7 C;  3B0D C;  5G49 B;  1BFM A;  4CAY B;  1BH8 A;  3W99 B;  3LZ0 C;  3WKJ D;  4KHA B;  5DNN A;  3C1B C;  3R45 A;  3AZK D;  3AZH A;  4HGA C;  5BT1 C;  3AV1 A;  2NQB D;  3X1U C;  3AFA A;  2HIO B;  3X1S A;  4QLC A;  3X1U D;  3X1V A;  3H0R C;  4KGC A;  3X1T B;  1P3K B;  3WKJ A;  3AZI B;  3MGR D;  1U35 C;  5CPJ D;  4ZBJ C;  4NE5 A;  3REJ B;  1AOI A;  1U35 D;  2FJ7 B;  3B0D B;  3LZ0 B;  3EPH A;  1P3G C;  3C1B B;  1S32 C;  3V9R A;  5B2I A;  5AV9 C;  5E5A C;  3MGP D;  1M19 D;  3LZ1 A;  5CPJ A;  1P3B B;  5E5A D;  2G5H C;  2RVQ C;  3AZN C;  1TAF B;  5B33 C;  3AL0 C;  2RVQ D;  4WZS B;  2BYK B;  5B33 D;  4J8U C;  3AZG A;  2CV5 D;  4J8U D;  4ZBJ B;  4Z5T A;  1KX5 C;  1P3G B;  1S32 B;  1P3L A;  2Y2L A;  3TU4 A;  5AV9 B;  4WNN B;  5B2J C;  4WJ3 C;  5BNX B;  5GT3 C;  2LY8 A;  3LEL C;  4E44 A;  5B32 D;  3AZN B;  3B6G B;  3EPJ A;  5GT3 D;  5JRG A;  2Y2I A;  3REK A;  3WAA C;  5B0Z C;  3UTA A;  1ZLA D;  4J8V C;  5AV5 C;  4YS3 A;  3KXB C;  5AVC D;  5AV6 D;  5F99 D;  3MVD C;  1KX5 B;  1H3O B;  4XUJ A;  3MVD D;  3AZJ A;  1R4V A;  5B2J B;  1M18 A;  4H9P A;  1P3A D;  5DNM A;  1ID3 C;  5B24 C;  3LEL B;  2F8N A;  3AZE D;  3AV2 C;  5B31 C;  4X23 C;  1ID3 D;  3REI A;  3WTP A;  5B0Z B;  3WAA B;  5B1M C;  3W97 A;  2FFF B;  5GXQ C;  4J8V B;  1P3O D;  5AV5 B;  3KXB B;  1P3I D;  3AZE A;  2BYM A;  2Y2K A;  2ZY5 A;  4WU9 D;  3MGQ C;  1BH9 A;  1PZR A;  5KDM A;  5GSU D;  3AYW D;  5BNV B;  1P3O A;  1TZY C;  4J8W D;  1KX3 B;  1B6W A;  1N1J A;  5B24 B;  3AZL A;  4Z66 C;  5B31 B;  4X23 B;  3AV2 B;  3B0C T;  4H9O B;  5B1L A;  3UTB C;  5B1M B;  4Z66 D;  5B40 D;  4WU9 A;  1EQZ D;  2DQN C;  5GXQ B;  4R8P C;  5CP6 C;  5B0Y D;  5FUG B;  5BO0 B;  3WTP E;  5GT0 D;  4R8P D;  5CPK B;  4WU8 C;  1F66 C;  3W98 D;  3AN2 C;  4G91 C;  2ARO C;  4ZUX C;  3KWQ B;  3MGQ B;  2UWX A;  3MGS A;  4AWL C;  1P34 C;  5JA4 B;  2NZD D;  1TZY B;  4J8X D;  1P3P C;  4DRA A;  1P34 D;  3O62 A;  3AZF A;  2DF4 C;  2J8P A;  1P3F A;  1W2E A;  4WV4 B;  4XZQ A;  3MNN D;  1P3P D;  3W98 A;  4JJN A;  3NQU B;  3UTB B;  4EO5 C;  3NQJ B;  3W96 B;  5CP6 B;  4J8X A;  5CHL B;  5CPI B;  3VH6 A;  3LJA A;  4WU8 B;  1F66 B;  1Q9C A;  2Y2O A;  2W8S A;  4G91 B;  3AN2 B;  2ARO B;  4ZUX B;  4AWL B;  5DNN D;  3AV1 C;  1KX4 C;  3REH C;  3AZH D;  3C1C C;  1P3M D;  3B6F B;  3AFA D;  2PYO A;  4H9S A;  3X1S D;  4EO5 B;  3WKJ C;  4QLC D;  2ZY3 A;  1HQ3 A;  4H9Q A;  3X1V D;  3AZK C;  4KGC D;  3WA9 D;  4LD9 A;  2NQB C;  2VQR A;  1P3M A;  4YM6 A;  3UT9 A;  5AY8 D;  5AV8 A;  4H9R B;  1AOI D;  3AZM A;  3A6N B;  5AVB B;  3WA9 A;  3MGR C;  3AV1 B;  1KX4 B;  5CPJ C;  3REH B;  5B2I D;  3A1K A;  3C1C B;  5G49 A;  3LZ1 D;  4CAY A;  5AY8 A;  3W99 A;  4KHA A;  2XD1 A;  3WKJ B;  2RIQ A;  3AZK B;  5BS7 A;  3MGP C;  1M19 C;  2NQB B;  2HIO A;  4HGA B;  3EPL A;  3AZG D;  3X1U B;  3X1T A;  1P3K A;  3AZI A;  3EPK A;  1JFI B;  1P3L C;  4Z5T D;  3MGR B;  1B67 A;  1P3L D;  3REJ A;  5CPJ B;  3TU4 D;  2CV5 C;  2FJ7 A;  3FDD A;  1U35 B;  1KU5 A;  3C1B A;  5JRG C;  3REK C;  5JRG D;  3REK D;  3MGP B;  1M19 B;  1P3B A;  3UTA D;  5E5A B;  1F1E A;  1TAF A;  4YS3 C;  5B32 C;  4UUZ B;  4YS3 D;  4XUJ C;  3F6T A;  1WWI A;  5B33 B;  3AZJ C;  1ZLA C;  1M18 C;  4XUJ D;  2CV5 B;  4J8U B;  5DNM C;  3AZJ D;  4CSR B;  2G5I C;  5AVC C;  5AV6 C;  1M18 D;  5F99 C;  5DNM D;  1P3G A;  2F8N D;  3A1I A;  4UPK A;  5AV9 A;  3W97 C;  4DQY B;  3REI D;  4KUD D;  3WTP D;  3W97 D;  1P3A C;  3AZN A;  3B6G A;  1WWS A;  5B32 B;  4E45 A;  3AZE C;  5GT3 B;  4Z2M G;  2JSS A;  1ZLA B;  4KUD A;  1P3O C;  5AVC B;  5AV6 B;  1P3I C;  5F99 B;  1H3O A;  3AZL D;  4WU9 C;  5B2J A;  3MVD B;  3AYW C;  3VH6 T;  5GSU C;  5B1L D;  3LEL A;  4J8W C;  1P3A B;  2HUE C;  3AZE B;  4H9N B;  1ID3 B;  3WAA A;  5B40 C;  3MGS C;  5KDM B;  4J8V A;  1EQZ C;  5AV5 A;  5B0Y C;  3KXB A;  1P3O B;  3MGS D;  3H0M C;  2Y2Q A;  5GT0 C;  1P3I B;  3KUY D;  3W98 C;  3O62 D;  3AZF D;  1P3F D;  4XZQ D;  4WU9 B;  5BNV A;  3AYW B;  4JJN D;  5GSU B;  2NZD C;  1KX3 A;  5B24 A;  4J8X C;  4J8W B;  3AV2 A;  2HUE B;  4X23 A;  3LJA C;  3KUY A;  3MNN C;  2F8N G;  4H9O A;  3LJA D;  4Z66 B;  5B40 B;  5GXQ A;  1EQZ B;  2Y2H A;  5BO0 A;  5B0Y B;  5CPK A;  5GT0 B;  4R8P B;  2Y2P A;  3KWQ A;  3W98 B;  3MGQ A;  2BG1 A;  5JA4 A;  1TZY A;  2ZM5 A;  3IP4 C;  2PYO D;  2NZD B;  4J8X B;  5DNN C;  1HQ3 D;  3REL D;  1P34 B;  1M1A A;  3AZH C;  4LD9 D;  1P3P B;  3MNN B;  1P3M C;  4YM6 C;  3NQU A;  3UTB A;  5AV8 C;  3AFA C;  3W96 A;  3X1S C;  2YFW B;  4QLC C;  2Y2N A;  4YM6 D;  3X1V C;  5CP6 A;  5AV8 D;  3UT9 D;  4KGC C;  3WA9 C;  3AZM D;  5CPI A;  2YFV B;  3REL A;  1F66 A;  3H0L C;  4ZUX A;  5AY8 C;  1Z2C B;  1AOI C;  2JCH A;  3W99 D;  1BH8 B;  3VH5 W;  5DNN B;  3R45 B;  5B2I C;  3AZH B;  3B6F A;  4NFT A;  1P3M B;  2HIO D;  3LZ1 C;  3AFA B;  3X1S B;  2F8N H;  4QLC B;  4NE6 A;  3X1V B;  3X1T D;  1P3K D;  3AZI D;  4KGC B;  3WA9 B;  3KFU G;  3EG5 B;  3B0C W;  2Y2G A;  4H9R A;  3AZG C;  3REJ D;  5AY8 B;  4NE3 A;  2FJ7 D;  4DRB A;  3A6N A;  1AOI B;  5AVB A;  3LZ0 D;  3C1B D;  1KX4 A;  4Z5T C;  3REH A;  1P3B C;  5BT1 D;  3TU4 C;  3V9R B;  3C1C A;  5B2I B;  3LZ1 B;  1P3B D;  3AZK A;  2F2A C;  3LZ0 A;  2NQB A;  3UTA C;  3X1U A;  3AZG B;  4G92 C;  1JFI A;  1P3G D;  3MGR A;  4Z5T B;  1S32 D;  2BYK A;  5AV9 D;  1P3L B;  3TU4 B;  1U35 A;  3B6G C;  3AZN D;  3B6G D;  3MGP A;  5JRG B;  1M19 A;  1S32 A;  3REI C;  4KUD C;  3REK B;  3WTP C;  4WNN A;  5E5A A;  3UTA B;  5BNX A;  4UUZ A;  4G92 B;  4YS3 B;  5B33 A;  1KX5 D;  1HTA A;  2CV5 A;  4J8U A;  4XUJ B;  2ZY2 A;  4CSR A;  2L5A A;  5B2J D;  3AZJ B;  2JE5 A;  1M18 B;  4H9P B;  3KSY A;  3LEL D;  5DNM B;  2Y2M A;  3AZL C;  2F8N B;  1KX5 A;  5B0Z D;  3WAA D;  3REI B;  4KUD B;  5B1L C;  3WTP B;  3W97 B;  5B32 A;  4J8V D;  5AV5 D;  5GT3 A;  3KXB D;  1ZLA A;  2BYM B;  5B0Z A;  1KX3 C;  1BH9 B;  5AV6 A;  5AVC A;  5F99 A;  1KX3 D;  5B24 D;  3KUY C;  3O62 C;  1N1J B;  3AZF C;  3AV2 D;  4M6B A;  5B31 D;  4X23 D;  3MVD A;  3AZL B;  1P3F C;  4XZQ C;  5B1M D;  4JJN C;  5B1L B;  1P3A A;  5GXQ D;  5CPK C;  3VH5 T;  4H9N A;  1ID3 A;  5CPK D;  3KWQ C;  5B31 A;  3KWQ D;  5B1M A;  3MGQ D;  1T3U A;  4Z2M H;  3MGS B;  3UT9 C;  1P3I A;  1M1A C;  1TZY D;  5FUG A;  3KUY B;  5C3I C;  3O62 B;  3AZF B;  1M1A D;  3W96 C;  1P3F B;  3AYW A;  4XZQ B;  2IO5 C;  5GSU A;  3UTB D;  4JJN B;  5B32 G;  4H9S C;  2CWE A;  4J8W A;  2PYO C;  3W96 D;  5CPI C;  1HQ3 C;  5CP6 D;  3REL C;  4LD9 C;  2XD5 A;  5CPI D;  4Z66 A;  5B40 A;  4WU8 D;  1F66 D;  1ULY A;  3LJA B;  1EQZ A;  3AN2 D;  4ZUX D; 
#chains in the Genus database with same CATH homology
 5B0Y A;  3NQJ A;  2F8N K;  3AZM C;  5GT0 A;  4R8P A;  1M1A B;  3B6F C;  5C3I B;  4WU8 A;  3B6F D;  3P5J B;  2IO5 B;  3AN2 A;  2ARO A;  2ARO D;  3W99 C;  2NZD A;  2PYO B;  3VH5 A;  1P34 A;  1HQ3 B;  4H9Q B;  3REL B;  3B0B A;  5BS7 C;  2ZY4 A;  3MNN A;  1P3P A;  4LD9 B;  5B31 G;  1A7W A;  2HIO C;  3VH6 W;  2YFW A;  3A6N C;  4YM6 B;  3UT9 B;  5AV8 B;  5AVB C;  3X1T C;  1P3K C;  2Y2J A;  3AZI C;  3A6N D;  2YFV A;  3AZM B;  5AVB D;  3AV1 D;  1KX4 D;  3REH D;  3REJ C;  3C1C D;  2FJ7 C;  3B0D C;  5G49 B;  1BFM A;  4CAY B;  1BH8 A;  3W99 B;  3LZ0 C;  3WKJ D;  4KHA B;  5DNN A;  3C1B C;  3R45 A;  3AZK D;  3AZH A;  4HGA C;  5BT1 C;  3AV1 A;  2NQB D;  3X1U C;  3AFA A;  2HIO B;  3X1S A;  4QLC A;  3X1U D;  3X1V A;  3H0R C;  4KGC A;  3X1T B;  1P3K B;  3WKJ A;  3AZI B;  3MGR D;  1U35 C;  5CPJ D;  4ZBJ C;  4NE5 A;  3REJ B;  1AOI A;  1U35 D;  2FJ7 B;  3B0D B;  3LZ0 B;  3EPH A;  1P3G C;  3C1B B;  1S32 C;  3V9R A;  5B2I A;  5AV9 C;  5E5A C;  3MGP D;  1M19 D;  3LZ1 A;  5CPJ A;  1P3B B;  5E5A D;  2G5H C;  2RVQ C;  3AZN C;  1TAF B;  5B33 C;  3AL0 C;  2RVQ D;  4WZS B;  2BYK B;  5B33 D;  4J8U C;  3AZG A;  2CV5 D;  4J8U D;  4ZBJ B;  4Z5T A;  1KX5 C;  1P3G B;  1S32 B;  1P3L A;  2Y2L A;  3TU4 A;  5AV9 B;  4WNN B;  5B2J C;  4WJ3 C;  5BNX B;  5GT3 C;  2LY8 A;  3LEL C;  4E44 A;  5B32 D;  3AZN B;  3B6G B;  3EPJ A;  5GT3 D;  5JRG A;  2Y2I A;  3REK A;  3WAA C;  5B0Z C;  3UTA A;  1ZLA D;  4J8V C;  5AV5 C;  4YS3 A;  3KXB C;  5AVC D;  5AV6 D;  5F99 D;  3MVD C;  1KX5 B;  1H3O B;  4XUJ A;  3MVD D;  3AZJ A;  1R4V A;  5B2J B;  1M18 A;  4H9P A;  1P3A D;  5DNM A;  1ID3 C;  5B24 C;  3LEL B;  2F8N A;  3AZE D;  3AV2 C;  5B31 C;  4X23 C;  1ID3 D;  3REI A;  3WTP A;  5B0Z B;  3WAA B;  5B1M C;  3W97 A;  2FFF B;  5GXQ C;  4J8V B;  1P3O D;  5AV5 B;  3KXB B;  1P3I D;  3AZE A;  2BYM A;  2Y2K A;  2ZY5 A;  4WU9 D;  3MGQ C;  1BH9 A;  1PZR A;  5KDM A;  5GSU D;  3AYW D;  5BNV B;  1P3O A;  1TZY C;  4J8W D;  1KX3 B;  1B6W A;  1N1J A;  5B24 B;  3AZL A;  4Z66 C;  5B31 B;  4X23 B;  3AV2 B;  3B0C T;  4H9O B;  5B1L A;  3UTB C;  5B1M B;  4Z66 D;  5B40 D;  4WU9 A;  1EQZ D;  2DQN C;  5GXQ B;  4R8P C;  5CP6 C;  5B0Y D;  5FUG B;  5BO0 B;  3WTP E;  5GT0 D;  4R8P D;  5CPK B;  4WU8 C;  1F66 C;  3W98 D;  3AN2 C;  4G91 C;  2ARO C;  4ZUX C;  3KWQ B;  3MGQ B;  2UWX A;  3MGS A;  4AWL C;  1P34 C;  5JA4 B;  2NZD D;  1TZY B;  4J8X D;  1P3P C;  4DRA A;  1P34 D;  3O62 A;  3AZF A;  2DF4 C;  2J8P A;  1P3F A;  1W2E A;  4WV4 B;  4XZQ A;  3MNN D;  1P3P D;  3W98 A;  4JJN A;  3NQU B;  3UTB B;  4EO5 C;  3NQJ B;  3W96 B;  5CP6 B;  4J8X A;  5CHL B;  5CPI B;  3VH6 A;  3LJA A;  4WU8 B;  1F66 B;  1Q9C A;  2Y2O A;  2W8S A;  4G91 B;  3AN2 B;  2ARO B;  4ZUX B;  4AWL B;  5DNN D;  3AV1 C;  1KX4 C;  3REH C;  3AZH D;  3C1C C;  1P3M D;  3B6F B;  3AFA D;  2PYO A;  4H9S A;  3X1S D;  4EO5 B;  3WKJ C;  4QLC D;  2ZY3 A;  1HQ3 A;  4H9Q A;  3X1V D;  3AZK C;  4KGC D;  3WA9 D;  4LD9 A;  2NQB C;  2VQR A;  1P3M A;  4YM6 A;  3UT9 A;  5AY8 D;  5AV8 A;  4H9R B;  1AOI D;  3AZM A;  3A6N B;  5AVB B;  3WA9 A;  3MGR C;  3AV1 B;  1KX4 B;  5CPJ C;  3REH B;  5B2I D;  3A1K A;  3C1C B;  5G49 A;  3LZ1 D;  4CAY A;  5AY8 A;  3W99 A;  4KHA A;  2XD1 A;  3WKJ B;  2RIQ A;  3AZK B;  5BS7 A;  3MGP C;  1M19 C;  2NQB B;  2HIO A;  4HGA B;  3EPL A;  3AZG D;  3X1U B;  3X1T A;  1P3K A;  3AZI A;  3EPK A;  1JFI B;  1P3L C;  4Z5T D;  3MGR B;  1B67 A;  1P3L D;  3REJ A;  5CPJ B;  3TU4 D;  2CV5 C;  2FJ7 A;  3FDD A;  1U35 B;  1KU5 A;  3C1B A;  5JRG C;  3REK C;  5JRG D;  3REK D;  3MGP B;  1M19 B;  1P3B A;  3UTA D;  5E5A B;  1F1E A;  1TAF A;  4YS3 C;  5B32 C;  4UUZ B;  4YS3 D;  4XUJ C;  3F6T A;  1WWI A;  5B33 B;  3AZJ C;  1ZLA C;  1M18 C;  4XUJ D;  2CV5 B;  4J8U B;  5DNM C;  3AZJ D;  4CSR B;  2G5I C;  5AVC C;  5AV6 C;  1M18 D;  5F99 C;  5DNM D;  1P3G A;  2F8N D;  3A1I A;  4UPK A;  5AV9 A;  3W97 C;  4DQY B;  3REI D;  4KUD D;  3WTP D;  3W97 D;  1P3A C;  3AZN A;  3B6G A;  1WWS A;  5B32 B;  4E45 A;  3AZE C;  5GT3 B;  4Z2M G;  2JSS A;  1ZLA B;  4KUD A;  1P3O C;  5AVC B;  5AV6 B;  1P3I C;  5F99 B;  1H3O A;  3AZL D;  4WU9 C;  5B2J A;  3MVD B;  3AYW C;  3VH6 T;  5GSU C;  5B1L D;  3LEL A;  4J8W C;  1P3A B;  2HUE C;  3AZE B;  4H9N B;  1ID3 B;  3WAA A;  5B40 C;  3MGS C;  5KDM B;  4J8V A;  1EQZ C;  5AV5 A;  5B0Y C;  3KXB A;  1P3O B;  3MGS D;  3H0M C;  2Y2Q A;  5GT0 C;  1P3I B;  3KUY D;  3W98 C;  3O62 D;  3AZF D;  1P3F D;  4XZQ D;  4WU9 B;  5BNV A;  3AYW B;  4JJN D;  5GSU B;  2NZD C;  1KX3 A;  5B24 A;  4J8X C;  4J8W B;  3AV2 A;  2HUE B;  4X23 A;  3LJA C;  3KUY A;  3MNN C;  2F8N G;  4H9O A;  3LJA D;  4Z66 B;  5B40 B;  5GXQ A;  1EQZ B;  2Y2H A;  5BO0 A;  5B0Y B;  5CPK A;  5GT0 B;  4R8P B;  2Y2P A;  3KWQ A;  3W98 B;  3MGQ A;  2BG1 A;  5JA4 A;  1TZY A;  2ZM5 A;  3IP4 C;  2PYO D;  2NZD B;  4J8X B;  5DNN C;  1HQ3 D;  3REL D;  1P34 B;  1M1A A;  3AZH C;  4LD9 D;  1P3P B;  3MNN B;  1P3M C;  4YM6 C;  3NQU A;  3UTB A;  5AV8 C;  3AFA C;  3W96 A;  3X1S C;  2YFW B;  4QLC C;  2Y2N A;  4YM6 D;  3X1V C;  5CP6 A;  5AV8 D;  3UT9 D;  4KGC C;  3WA9 C;  3AZM D;  5CPI A;  2YFV B;  3REL A;  1F66 A;  3H0L C;  4ZUX A;  5AY8 C;  1Z2C B;  1AOI C;  2JCH A;  3W99 D;  1BH8 B;  3VH5 W;  5DNN B;  3R45 B;  5B2I C;  3AZH B;  3B6F A;  4NFT A;  1P3M B;  2HIO D;  3LZ1 C;  3AFA B;  3X1S B;  2F8N H;  4QLC B;  4NE6 A;  3X1V B;  3X1T D;  1P3K D;  3AZI D;  4KGC B;  3WA9 B;  3KFU G;  3EG5 B;  3B0C W;  2Y2G A;  4H9R A;  3AZG C;  3REJ D;  5AY8 B;  4NE3 A;  2FJ7 D;  4DRB A;  3A6N A;  1AOI B;  5AVB A;  3LZ0 D;  3C1B D;  1KX4 A;  4Z5T C;  3REH A;  1P3B C;  5BT1 D;  3TU4 C;  3V9R B;  3C1C A;  5B2I B;  3LZ1 B;  1P3B D;  3AZK A;  2F2A C;  3LZ0 A;  2NQB A;  3UTA C;  3X1U A;  3AZG B;  4G92 C;  1JFI A;  1P3G D;  3MGR A;  4Z5T B;  1S32 D;  2BYK A;  5AV9 D;  1P3L B;  3TU4 B;  1U35 A;  3B6G C;  3AZN D;  3B6G D;  3MGP A;  5JRG B;  1M19 A;  1S32 A;  3REI C;  4KUD C;  3REK B;  3WTP C;  4WNN A;  5E5A A;  3UTA B;  5BNX A;  4UUZ A;  4G92 B;  4YS3 B;  5B33 A;  1KX5 D;  1HTA A;  2CV5 A;  4J8U A;  4XUJ B;  2ZY2 A;  4CSR A;  2L5A A;  5B2J D;  3AZJ B;  2JE5 A;  1M18 B;  4H9P B;  3KSY A;  3LEL D;  5DNM B;  2Y2M A;  3AZL C;  2F8N B;  1KX5 A;  5B0Z D;  3WAA D;  3REI B;  4KUD B;  5B1L C;  3WTP B;  3W97 B;  5B32 A;  4J8V D;  5AV5 D;  5GT3 A;  3KXB D;  1ZLA A;  2BYM B;  5B0Z A;  1KX3 C;  1BH9 B;  5AV6 A;  5AVC A;  5F99 A;  1KX3 D;  5B24 D;  3KUY C;  3O62 C;  1N1J B;  3AZF C;  3AV2 D;  4M6B A;  5B31 D;  4X23 D;  3MVD A;  3AZL B;  1P3F C;  4XZQ C;  5B1M D;  4JJN C;  5B1L B;  1P3A A;  5GXQ D;  5CPK C;  3VH5 T;  4H9N A;  1ID3 A;  5CPK D;  3KWQ C;  5B31 A;  3KWQ D;  5B1M A;  3MGQ D;  1T3U A;  4Z2M H;  3MGS B;  3UT9 C;  1P3I A;  1M1A C;  1TZY D;  5FUG A;  3KUY B;  5C3I C;  3O62 B;  3AZF B;  1M1A D;  3W96 C;  1P3F B;  3AYW A;  4XZQ B;  2IO5 C;  5GSU A;  3UTB D;  4JJN B;  5B32 G;  4H9S C;  2CWE A;  4J8W A;  2PYO C;  3W96 D;  5CPI C;  1HQ3 C;  5CP6 D;  3REL C;  4LD9 C;  2XD5 A;  5CPI D;  4Z66 A;  5B40 A;  4WU8 D;  1F66 D;  1ULY A;  3LJA B;  1EQZ A;  3AN2 D;  4ZUX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...