3MNNC

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnC00
3MNNC 1M18B 3AV2A 1KX3D 5BT1C 4J8VB 3LZ0A 1H3OB 3AV1C 2BYKB 5GSUB 3KXBB 1BFMA 4KHAB 3V9RB 1S32D 3MGQD 1KX3C 5B1MB 3AZKA 4WU8B 1P3FA 3X1UA 3C1BB 5B1LA 3RELA 3LZ1B 4XZQA 2FJ7B 4EO5C 1P34D 5AY8B 4H9RB 5AV6D 1S32C 3WA9B 4Z5TD 5CP6D 1F1EA 4H9NA 1P3LA 3KUYA 3VH5W 4R8PD 1P34C 1P3MD 1P3KA 5AV6C 3WTPB 3A6NA 3AYWA 5B33D 5B2JA 3UTBD 3AZGB 4Z5TC 5CP6C 4KUDB 2BYMB 4R8PC 4X23A 3LJAA 4J8XA 3X1TB 5BNXA 1P3MC 1U35D 4LD9D 5GT0D 4ZBJC 2JSSA 5B0ZB 5B33C 1JFIA 3X1SA 3UTBC 5B32A 4ZUXA 1N1JA 3AZLD 3TU4D 3MNNB 1U35C 4LD9C 5GT0C 3O62A 1B67A 1M1AA 4J8WA 3AZLC 3AV1B 3TU4C 5AV9A 3LELA 1KX3B 5GXQD 3NQUA 4EO5B 2F8NG 3REKA 4WU9A 2RVQD 4E45A 5B31A 1S32B 1KX5D 5AV8A 2CV5D 3B6FA 1P34B 5AV6B 2RVQC 5JRGA 1KX5C 4Z5TB 5CP6B 2CV5C 4R8PB 3B6GD 1P3MB 1KU5A 1F66A 4KGCA 3AV2D 5B33B 4Z66D 5BS7A 4YS3A 3B6GC 5AVCC 4CSRA 3REJA 3AZFA 1P3OD 5G49A 2NQBA 5GT0B 4LD9B 3AZND 3AV2C 5B1LD 4Z66C 4XZQD 5CPJA 4WNNA 3TU4B 4Z2MH 4UUZA 1P3OC 4QLCB 3AZNC 3REHA 3X1UC 5B1LC 1P3AA 1P3LD 5F99A 4XZQC 5B40A 4G91C 3WA9D 1AOIA 5KDMA 1ULYA 5B0YA 5JA4A 3MGRA 3WKJB 3AYWD 5B2JD 4H9SC 2F8NB 1P3LC 4XUJA 3UT9D 3X1VA 3AZHA 5DNND 3AYWC 1KX5B 5B2JC 4AWLC 2CV5B 4H9QA 5B32D 3VH5A 5B32G 3KWQB 5CPIA 5FUGA 4G92C 1KX4A 3O62D 3UT9C 1BH8B 5DNNC 3REIA 1M1AD 2AROD 5B32C 5AVCB 4NE3A 5AV9D 3AZIA 3O62C 3AV2B 1M1AC 4Z66B 2AROC 3LZ0B 3REKD 5C3IC 5GT3A 5AV9C 5B24A 4WU9D 1P3OB 5AVBD 3AZNB 4WV4B 3W99A 5B31G 3X1UB 5B1LB 3RELB 3C1CA 4XZQB 3B6FD 4G91B 3UTAA 1M19A 3MVDD 3REKC 4H9OA 4WU9C 5AVBC 1P3GD 5B31C 2YFVB 4J8UA 2HIOA 1EQZA 4H9NB 1P3LB 3B6FC 1HQ3A 3MVDC 4YM6A 3A6NB 1P3GC 3AYWB 5B2JB 4AWLB 1M18A 4J8VA 5BNXB 4G92B 5BO0A 3AZFD 2BYKA 3UT9B 5DNNB 2YFWA 3WTPE 3AN2A 5B32B 4ZUXB 1N1JB 2LY8A 3LZ1A 4WZSB 2FJ7A 1ID3A 3REJC 3AZFC 3AFAD 3O62B 1M1AB 4QLCD 3R45A 5CPKA 2AROB 1P3AD 5F99D 1TZYA 5B40D 1AOID 5C3IB 5AV9B 5B0YD 3AFAC 5BNVA 3MGRD 3W96D 3WTPA 4QLCC 3WKJD 3AZGA 3AZMA 1P3AC 5F99C 5B40C 1AOIC 4KUDA 2NZDD 2BYMA 3REKB 2F8ND 4WU9B 5B0YC 4XUJD 5AVBB 3X1VD 5B31B 3W96C 3MGRC 1P3BD 3B6FB 3MGPA 3WKJC 1WWSA 3MVDB 2NZDC 4XUJC 3X1VC 3KWQD 3B0BA 1P3GB 3REID 4H9PA 1P3BC 3W97D 3AZID 5AVCD 1F66B 3KWQC 3REIC 2HUEC 3W97C 4NFTA 4CSRB 4DRAA 3LZ0D 3REJB 3AZFB 3AZIC 4CAYA 3MGQA 5CPJB 4WNNB 3UTAD 3AZKD 1P3FD 3X1UD 3RELD 4UUZB 1P34A 3LZ0C 3AFAB 5AV6A 2HIOD 1P3AB 4Z5TA 5F99B 5B40B 1AOIB 3UTAC 3AZKC 1P3FC 5KDMB 3RELC 3KUYD 5B0YB 3VH6T 3NQJB 3MGRB 3W96B 1P3KD 2PYOA 4J8UC 2HIOC 3A6ND 5B33A 3UTBA 2L5AA 2NZDB 5DNMA 3KUYC 4X23D 4XUJB 3LJAD 4J8XD 3X1VB 3W98A 1U35A 4LD9A 1P3KC 1P3BB 4H9QB 3A6NC 4JJNA 3X1SD 3AZLA 4ZUXD 1ID3D 4X23C 5B2IA 3LJAC 4J8XC 1P3PA 3REIB 1BH9B 5CPKD 3AZEA 5AV5A 2HUEB 3W97B 4J8WD 3X1SC 3WAAA 4ZUXC 3AZIB 1ID3C 1P3IA 3LELD 5GXQA 5CPKC 3MGSA 3VH6W 1TZYC 2IO5C 4J8WC 2F8NH 3B0DB 5E5AA 4M6BA 3LELC 5B31D 3C1CB 3MGPD 4DRBA 3UTAB 5AV8D 3AZKB 1P3FB 3B0CT 3AZJA 4J8UB 2HIOB 1EQZB 1B6WA 5JRGD 3MGPC 5AV8C 3KUYB 3B6GA 1ZLAA 4YM6B 1P3KB 1F66D 4KGCD 1TAFA 5JRGC 4Z66A 5BO0B 4YS3D 4X23B 3LJAB 4J8XB 1P3OA 1H3OA 3REJD 2NQBD 2YFWB 3AZNA 5GSUA 3KXBA 3AN2B 1F66C 4KHAA 3V9RA 4KGCC 1JFIB 3X1SB 5B1MA 4WU8A 5BS7C 5CPJD 3C1BA 4YS3C 1ID3B 4Z2MG 5AY8A 4H9RA 2NQBC 3R45B 3MGQC 5CPKB 2YFVA 3B0CW 4H9SA 3REHD 1TZYB 2IO5B 4J8WB 3WA9A 5CPJC 4NE6A 5BNVB 1HTAA 3LELB 2PYOD 3AZMB 3NQUB 3REHC 5DNMD 3W98D 3UT9A 3X1TA 2PYOC 5DNNA 3AZHD 4JJND 1Q9CA 3MGPB 5AV8B 5B0ZA 5DNMC 5B2ID 5CPID 1P3PD 3W98C 4H9PB 1KX4D 3AZED 5AV5D 3MNNA 5JRGB 4JJNC 3AZHC 2AROA 2CWEA 3WAAD 5B2IC 1P3ID 5CPIC 3AV1A 1P3PC 1KX4C 4KGCB 3AZEC 5AV5C 3MGSD 1KX3A 3WAAC 4YS3B 5E5AD 4CAYB 1P3IC 2NQBB 5GT3D 5AVBA 5B24D 5G49B 3MGQB 5GXQC 5CHLB 3MGSC 1S32A 3W99D 3C1CD 3MVDA 1M19D 5E5AC 3AZJD 5GT3C 5B24C 1P3GA 3B0DC 3REHB 3VH6A 4J8UD 3W99C 1EQZD 3C1CC 1ZLAD 5CP6A 1HQ3D 4R8PA 1M19C 4ZBJB 3AZJC 4YM6D 2PYOB 1P3MA 5JA4B 3UTBB 4NE5A 1M18D 1EQZC 5DNMB 1ZLAC 4J8VD 4E44A 1HQ3C 3W98B 1U35B 4HGAC 4YM6C 5GSUD 3KXBD 3AZHB 4JJNB 5GT0A 1R4VA 1M18C 3AZLB 3AN2D 5B1MD 4WU8D 3C1BD 5B2IB 3LZ1D 4J8VC 2FJ7D 5CPIB 1P3PB 5FUGB 3AFAA 3TU4A 5AY8D 1KX4B 3AZEB 5GSUC 3KXBC 5AV5B 4QLCA 3AN2C 3WAAB 5B1MC 4WU8C 1TZYD 3C1BC 3LZ1C 1P3IB 2FJ7C 5AY8C 3NQJA 1WWIA 5GXQB 3W96A 2F8NK 3MGSB 3WTPD 3WKJA 3AZGD 3KSYA 3AZMD 3WA9C 2NZDA 2F8NA 4KUDD 5E5AB 5B24B 3X1TD 5GT3B 1P3BA 3WTPC 3W99B 5B0ZD 1KX5A 3AZGC 3AZMC 2CV5A 1M19B 4KUDC 3AZJB 4H9OB 3KWQA 3X1TC 3VH5T 3MNND 1BH9A 1BH8A 5B0ZC 3W97A 3B6GB 5BT1D 1ZLAB 1HQ3B 1A7WA 4HGAB 5AVCA 3AV1D 1TAFB
chains in the Genus database with same CATH superfamily
3MNNC 1M18B 3AV2A 1KX3D 2DF4C 5BT1C 4J8VB 3LZ0A 2ZM5A 1H3OB 3AV1C 2BYKB 5GSUB 3KXBB 1BFMA 4KHAB 3V9RB 1S32D 3MGQD 1KX3C 5B1MB 3AZKA 4WU8B 1P3FA 3X1UA 3C1BB 5B1LA 3RELA 3LZ1B 4XZQA 2FJ7B 4EO5C 1P34D 5AY8B 4H9RB 5AV6D 2XD5A 1S32C 2ZY2A 3WA9B 4Z5TD 5CP6D 1F1EA 4H9NA 1P3LA 3KUYA 3VH5W 4R8PD 1P34C 1P3MD 1P3KA 5AV6C 3WTPB 3A6NA 3AYWA 5B33D 5B2JA 3UTBD 3AZGB 4Z5TC 5CP6C 4KUDB 2BYMB 4R8PC 4X23A 3LJAA 4J8XA 3X1TB 5BNXA 1P3MC 1U35D 4LD9D 5GT0D 4ZBJC 2JSSA 5B0ZB 2BG1A 2J8PA 2UWXA 3X1SA 3UTBC 5B33C 1JFIA 5B32A 2F2AC 1N1JA 4ZUXA 3AZLD 4WJ3C 3FDDA 3EPKA 3TU4D 3MNNB 1U35C 4LD9C 5GT0C 3O62A 1B67A 1M1AA 4J8WA 3AZLC 3AV1B 3TU4C 5AV9A 3LELA 2Y2IA 1KX3B 5GXQD 3NQUA 1W2EA 2Y2LA 4EO5B 2F8NG 3REKA 4WU9A 2RVQD 3F6TA 4E45A 5B31A 1S32B 1KX5D 5AV8A 2CV5D 4DQYB 3B6FA 2RIQA 1P34B 5AV6B 2RVQC 5JRGA 1KX5C 4Z5TB 5CP6B 2CV5C 4R8PB 3B6GD 1P3MB 1KU5A 2Y2HA 1F66A 4KGCA 3AV2D 2ZY3A 5B33B 4Z66D 5BS7A 4YS3A 3B6GC 5AVCC 4CSRA 3REJA 3AZFA 1P3OD 5G49A 2NQBA 5GT0B 4LD9B 3AZND 3AV2C 2ZY4A 5B1LD 4Z66C 4XZQD 5CPJA 4WNNA 3TU4B 4Z2MH 4UUZA 1P3OC 4QLCB 3AZNC 3REHA 3X1UC 5B1LC 1P3AA 1P3LD 5F99A 4XZQC 5B40A 4G91C 3WA9D 1AOIA 5KDMA 1ULYA 5B0YA 5JA4A 3MGRA 3WKJB 3AYWD 2ZY5A 5B2JD 4H9SC 2G5HC 2F8NB 1P3LC 3H0LC 4XUJA 3UT9D 3X1VA 3AZHA 5DNND 3AYWC 2FFFB 1KX5B 5B2JC 4AWLC 2CV5B 4H9QA 5B32D 3VH5A 5B32G 3KWQB 5CPIA 5FUGA 4G92C 1KX4A 3O62D 3UT9C 2Y2MA 1BH8B 5DNNC 3REIA 1M1AD 2AROD 5B32C 3EPHA 5AVCB 4NE3A 5AV9D 3AZIA 3O62C 3AV2B 1M1AC 4Z66B 2AROC 2Y2GA 3LZ0B 2VQRA 3REKD 5C3IC 5AV9C 5GT3A 5B24A 4WU9D 1P3OB 5AVBD 3AZNB 4WV4B 3W99A 5B31G 3X1UB 5B1LB 3RELB 3C1CA 4XZQB 3B6FD 4G91B 3UTAA 1M19A 3MVDD 3REKC 4H9OA 4WU9C 5AVBC 1P3GD 5B31C 2YFVB 4J8UA 2HIOA 1EQZA 4H9NB 1P3LB 3B6FC 1HQ3A 3MVDC 4YM6A 3A6NB 3EPLA 1P3GC 3AYWB 5B2JB 4AWLB 1M18A 4J8VA 5BNXB 4G92B 5BO0A 3AZFD 2Y2JA 2BYKA 3UT9B 5DNNB 2YFWA 3WTPE 3AN2A 5B32B 4ZUXB 1N1JB 2LY8A 3LZ1A 4WZSB 2FJ7A 1ID3A 3REJC 3AZFC 3AFAD 3O62B 1M1AB 4QLCD 3R45A 5CPKA 2AROB 1P3AD 5F99D 1TZYA 5B40D 1AOID 5C3IB 5AV9B 5B0YD 2JE5A 3AFAC 5BNVA 3MGRD 3W96D 3WTPA 4QLCC 3WKJD 3AZGA 3AZMA 1P3AC 5F99C 5B40C 1AOIC 4KUDA 2NZDD 2BYMA 3REKB 2F8ND 4WU9B 5B0YC 4XUJD 5AVBB 3X1VD 5B31B 3W96C 3MGRC 1P3BD 3B6FB 3MGPA 3WKJC 1WWSA 3MVDB 2NZDC 4XUJC 3X1VC 3KWQD 3B0BA 1P3GB 3REID 4H9PA 1P3BC 3W97D 2DQNC 3AZID 5AVCD 1F66B 3KWQC 3A1IA 3REIC 2W8SA 2HUEC 3W97C 4NFTA 4CSRB 4DRAA 3LZ0D 3REJB 3AZFB 3AZIC 4CAYA 3MGQA 5CPJB 4WNNB 3UTAD 3AZKD 1P3FD 3X1UD 3RELD 4UUZB 1P34A 3LZ0C 3AFAB 5AV6A 2HIOD 1P3AB 4Z5TA 5F99B 5B40B 1AOIB 3UTAC 3AZKC 1P3FC 5KDMB 3RELC 3KUYD 5B0YB 3VH6T 3NQJB 3MGRB 3W96B 1P3KD 2PYOA 4J8UC 2HIOC 3A6ND 5B33A 3UTBA 2L5AA 2JCHA 2NZDB 5DNMA 3KUYC 4X23D 4XUJB 3LJAD 4J8XD 3X1VB 3EG5B 3W98A 1U35A 4LD9A 1P3KC 1P3BB 4H9QB 3A6NC 4JJNA 2G5IC 3X1SD 3AZLA 4ZUXD 1ID3D 4X23C 5B2IA 3LJAC 4J8XC 1P3PA 3REIB 1BH9B 5CPKD 3AZEA 5AV5A 2HUEB 3W97B 4J8WD 3X1SC 3WAAA 4ZUXC 3AZIB 1ID3C 1P3IA 3LELD 5GXQA 3IP4C 5CPKC 3MGSA 3VH6W 1TZYC 2IO5C 4J8WC 2F8NH 3B0DB 5E5AA 4M6BA 3LELC 5B31D 3C1CB 2Y2PA 4DRBA 4UPKA 3MGPD 3UTAB 5AV8D 3AZKB 1P3FB 3B0CT 1PZRA 3AZJA 4J8UB 2HIOB 1EQZB 1B6WA 5JRGD 3MGPC 5AV8C 3KUYB 3B6GA 3H0MC 1ZLAA 4YM6B 2Y2KA 1T3UA 1P3KB 1F66D 4KGCD 1TAFA 5JRGC 4Z66A 5BO0B 4YS3D 4X23B 3LJAB 4J8XB 1P3OA 1H3OA 3REJD 2NQBD 2YFWB 3AZNA 5GSUA 3KXBA 3AN2B 1F66C 4KHAA 3V9RA 4KGCC 1JFIB 3KFUG 3X1SB 5B1MA 4WU8A 5BS7C 5CPJD 3C1BA 4YS3C 1ID3B 4Z2MG 5AY8A 4H9RA 2NQBC 3R45B 3MGQC 5CPKB 2YFVA 3B0CW 4H9SA 3REHD 1TZYB 3A1KA 2IO5B 4J8WB 3WA9A 5CPJC 4NE6A 5BNVB 3AL0C 2Y2OA 1HTAA 3LELB 2PYOD 3AZMB 2XD1A 3NQUB 3REHC 5DNMD 3W98D 3UT9A 3X1TA 2PYOC 5DNNA 3AZHD 4JJND 1Q9CA 3MGPB 1Z2CB 5AV8B 5B0ZA 5DNMC 5B2ID 5CPID 1P3PD 3W98C 4H9PB 1KX4D 3AZED 5AV5D 3MNNA 5JRGB 4JJNC 3AZHC 2AROA 2CWEA 2Y2NA 3WAAD 5B2IC 1P3ID 5CPIC 3AV1A 1P3PC 1KX4C 4KGCB 3EPJA 3AZEC 5AV5C 3MGSD 1KX3A 3WAAC 4YS3B 5E5AD 4CAYB 1P3IC 2NQBB 5GT3D 5AVBA 5B24D 5G49B 3MGQB 5GXQC 5CHLB 3MGSC 1S32A 3W99D 3C1CD 3MVDA 1M19D 5E5AC 2Y2QA 3AZJD 5GT3C 5B24C 1P3GA 3B0DC 3REHB 3VH6A 4J8UD 3W99C 1EQZD 3C1CC 1ZLAD 5CP6A 1HQ3D 4R8PA 1M19C 4ZBJB 3AZJC 4YM6D 2PYOB 1P3MA 5JA4B 3UTBB 4NE5A 1M18D 1EQZC 5DNMB 1ZLAC 4J8VD 4E44A 1HQ3C 3W98B 1U35B 4HGAC 4YM6C 5GSUD 3KXBD 3AZHB 4JJNB 5GT0A 1R4VA 1M18C 3AZLB 3AN2D 5B1MD 4WU8D 3C1BD 3P5JB 5B2IB 3LZ1D 4J8VC 2FJ7D 5CPIB 1P3PB 5FUGB 3AFAA 3TU4A 5AY8D 1KX4B 3AZEB 5GSUC 3KXBC 5AV5B 4QLCA 3AN2C 3WAAB 5B1MC 4WU8C 1TZYD 3C1BC 3LZ1C 1P3IB 2FJ7C 5AY8C 1WWIA 3NQJA 5GXQB 3W96A 2F8NK 3MGSB 3WTPD 3WKJA 3AZGD 3KSYA 3AZMD 3WA9C 2NZDA 2F8NA 4KUDD 5E5AB 5GT3B 5B24B 3X1TD 1P3BA 3H0RC 3WTPC 3W99B 5B0ZD 1KX5A 3AZGC 3AZMC 2CV5A 1M19B 4KUDC 3AZJB 4H9OB 3KWQA 3X1TC 3VH5T 3MNND 1BH9A 1BH8A 5B0ZC 3W97A 3B6GB 5BT1D 1ZLAB 1HQ3B 1A7WA 4HGAB 5AVCA 3AV1D 1TAFB
chains in the Genus database with same CATH topology
3MNNC 1M18B 3AV2A 1KX3D 2DF4C 5BT1C 4J8VB 3LZ0A 2ZM5A 1H3OB 3AV1C 2BYKB 5GSUB 3KXBB 1BFMA 4KHAB 3V9RB 1S32D 3MGQD 1KX3C 5B1MB 3AZKA 4WU8B 1P3FA 3X1UA 3C1BB 5B1LA 3RELA 3LZ1B 4XZQA 2FJ7B 4EO5C 1P34D 5AY8B 4H9RB 5AV6D 2XD5A 1S32C 2ZY2A 3WA9B 4Z5TD 5CP6D 1F1EA 4H9NA 1P3LA 3KUYA 3VH5W 4R8PD 1P34C 1P3MD 1P3KA 5AV6C 3WTPB 3A6NA 3AYWA 5B33D 5B2JA 3UTBD 3AZGB 4Z5TC 5CP6C 4KUDB 2BYMB 4R8PC 4X23A 3LJAA 4J8XA 3X1TB 5BNXA 1P3MC 1U35D 4LD9D 5GT0D 4ZBJC 2JSSA 5B0ZB 2BG1A 2J8PA 2UWXA 3X1SA 3UTBC 5B33C 1JFIA 5B32A 2F2AC 1N1JA 4ZUXA 3AZLD 4WJ3C 3FDDA 3EPKA 3TU4D 3MNNB 1U35C 4LD9C 5GT0C 3O62A 1B67A 1M1AA 4J8WA 3AZLC 3AV1B 3TU4C 5AV9A 3LELA 2Y2IA 1KX3B 5GXQD 3NQUA 1W2EA 2Y2LA 4EO5B 2F8NG 3REKA 4WU9A 2RVQD 3F6TA 4E45A 5B31A 1S32B 1KX5D 5AV8A 2CV5D 4DQYB 3B6FA 2RIQA 1P34B 5AV6B 2RVQC 5JRGA 1KX5C 4Z5TB 5CP6B 2CV5C 4R8PB 3B6GD 1P3MB 1KU5A 2Y2HA 1F66A 4KGCA 3AV2D 2ZY3A 5B33B 4Z66D 5BS7A 4YS3A 3B6GC 5AVCC 4CSRA 3REJA 3AZFA 1P3OD 5G49A 2NQBA 5GT0B 4LD9B 3AZND 3AV2C 2ZY4A 5B1LD 4Z66C 4XZQD 5CPJA 4WNNA 3TU4B 4Z2MH 4UUZA 1P3OC 4QLCB 3AZNC 3REHA 3X1UC 5B1LC 1P3AA 1P3LD 5F99A 4XZQC 5B40A 4G91C 3WA9D 1AOIA 5KDMA 1ULYA 5B0YA 5JA4A 3MGRA 3WKJB 3AYWD 2ZY5A 5B2JD 4H9SC 2G5HC 2F8NB 1P3LC 3H0LC 4XUJA 3UT9D 3X1VA 3AZHA 5DNND 3AYWC 2FFFB 1KX5B 5B2JC 4AWLC 2CV5B 4H9QA 5B32D 3VH5A 5B32G 3KWQB 5CPIA 5FUGA 4G92C 1KX4A 3O62D 3UT9C 2Y2MA 1BH8B 5DNNC 3REIA 1M1AD 2AROD 5B32C 3EPHA 5AVCB 4NE3A 5AV9D 3AZIA 3O62C 3AV2B 1M1AC 4Z66B 2AROC 2Y2GA 3LZ0B 2VQRA 3REKD 5C3IC 5AV9C 5GT3A 5B24A 4WU9D 1P3OB 5AVBD 3AZNB 4WV4B 3W99A 5B31G 3X1UB 5B1LB 3RELB 3C1CA 4XZQB 3B6FD 4G91B 3UTAA 1M19A 3MVDD 3REKC 4H9OA 4WU9C 5AVBC 1P3GD 5B31C 2YFVB 4J8UA 2HIOA 1EQZA 4H9NB 1P3LB 3B6FC 1HQ3A 3MVDC 4YM6A 3A6NB 3EPLA 1P3GC 3AYWB 5B2JB 4AWLB 1M18A 4J8VA 5BNXB 4G92B 5BO0A 3AZFD 2Y2JA 2BYKA 3UT9B 5DNNB 2YFWA 3WTPE 3AN2A 5B32B 4ZUXB 1N1JB 2LY8A 3LZ1A 4WZSB 2FJ7A 1ID3A 3REJC 3AZFC 3AFAD 3O62B 1M1AB 4QLCD 3R45A 5CPKA 2AROB 1P3AD 5F99D 1TZYA 5B40D 1AOID 5C3IB 5AV9B 5B0YD 2JE5A 3AFAC 5BNVA 3MGRD 3W96D 3WTPA 4QLCC 3WKJD 3AZGA 3AZMA 1P3AC 5F99C 5B40C 1AOIC 4KUDA 2NZDD 2BYMA 3REKB 2F8ND 4WU9B 5B0YC 4XUJD 5AVBB 3X1VD 5B31B 3W96C 3MGRC 1P3BD 3B6FB 3MGPA 3WKJC 1WWSA 3MVDB 2NZDC 4XUJC 3X1VC 3KWQD 3B0BA 1P3GB 3REID 4H9PA 1P3BC 3W97D 2DQNC 3AZID 5AVCD 1F66B 3KWQC 3A1IA 3REIC 2W8SA 2HUEC 3W97C 4NFTA 4CSRB 4DRAA 3LZ0D 3REJB 3AZFB 3AZIC 4CAYA 3MGQA 5CPJB 4WNNB 3UTAD 3AZKD 1P3FD 3X1UD 3RELD 4UUZB 1P34A 3LZ0C 3AFAB 5AV6A 2HIOD 1P3AB 4Z5TA 5F99B 5B40B 1AOIB 3UTAC 3AZKC 1P3FC 5KDMB 3RELC 3KUYD 5B0YB 3VH6T 3NQJB 3MGRB 3W96B 1P3KD 2PYOA 4J8UC 2HIOC 3A6ND 5B33A 3UTBA 2L5AA 2JCHA 2NZDB 5DNMA 3KUYC 4X23D 4XUJB 3LJAD 4J8XD 3X1VB 3EG5B 3W98A 1U35A 4LD9A 1P3KC 1P3BB 4H9QB 3A6NC 4JJNA 2G5IC 3X1SD 3AZLA 4ZUXD 1ID3D 4X23C 5B2IA 3LJAC 4J8XC 1P3PA 3REIB 1BH9B 5CPKD 3AZEA 5AV5A 2HUEB 3W97B 4J8WD 3X1SC 3WAAA 4ZUXC 3AZIB 1ID3C 1P3IA 3LELD 5GXQA 3IP4C 5CPKC 3MGSA 3VH6W 1TZYC 2IO5C 4J8WC 2F8NH 3B0DB 5E5AA 4M6BA 3LELC 5B31D 3C1CB 2Y2PA 4DRBA 4UPKA 3MGPD 3UTAB 5AV8D 3AZKB 1P3FB 3B0CT 1PZRA 3AZJA 4J8UB 2HIOB 1EQZB 1B6WA 5JRGD 3MGPC 5AV8C 3KUYB 3B6GA 3H0MC 1ZLAA 4YM6B 2Y2KA 1T3UA 1P3KB 1F66D 4KGCD 1TAFA 5JRGC 4Z66A 5BO0B 4YS3D 4X23B 3LJAB 4J8XB 1P3OA 1H3OA 3REJD 2NQBD 2YFWB 3AZNA 5GSUA 3KXBA 3AN2B 1F66C 4KHAA 3V9RA 4KGCC 1JFIB 3KFUG 3X1SB 5B1MA 4WU8A 5BS7C 5CPJD 3C1BA 4YS3C 1ID3B 4Z2MG 5AY8A 4H9RA 2NQBC 3R45B 3MGQC 5CPKB 2YFVA 3B0CW 4H9SA 3REHD 1TZYB 3A1KA 2IO5B 4J8WB 3WA9A 5CPJC 4NE6A 5BNVB 3AL0C 2Y2OA 1HTAA 3LELB 2PYOD 3AZMB 2XD1A 3NQUB 3REHC 5DNMD 3W98D 3UT9A 3X1TA 2PYOC 5DNNA 3AZHD 4JJND 1Q9CA 3MGPB 1Z2CB 5AV8B 5B0ZA 5DNMC 5B2ID 5CPID 1P3PD 3W98C 4H9PB 1KX4D 3AZED 5AV5D 3MNNA 5JRGB 4JJNC 3AZHC 2AROA 2CWEA 2Y2NA 3WAAD 5B2IC 1P3ID 5CPIC 3AV1A 1P3PC 1KX4C 4KGCB 3EPJA 3AZEC 5AV5C 3MGSD 1KX3A 3WAAC 4YS3B 5E5AD 4CAYB 1P3IC 2NQBB 5GT3D 5AVBA 5B24D 5G49B 3MGQB 5GXQC 5CHLB 3MGSC 1S32A 3W99D 3C1CD 3MVDA 1M19D 5E5AC 2Y2QA 3AZJD 5GT3C 5B24C 1P3GA 3B0DC 3REHB 3VH6A 4J8UD 3W99C 1EQZD 3C1CC 1ZLAD 5CP6A 1HQ3D 4R8PA 1M19C 4ZBJB 3AZJC 4YM6D 2PYOB 1P3MA 5JA4B 3UTBB 4NE5A 1M18D 1EQZC 5DNMB 1ZLAC 4J8VD 4E44A 1HQ3C 3W98B 1U35B 4HGAC 4YM6C 5GSUD 3KXBD 3AZHB 4JJNB 5GT0A 1R4VA 1M18C 3AZLB 3AN2D 5B1MD 4WU8D 3C1BD 3P5JB 5B2IB 3LZ1D 4J8VC 2FJ7D 5CPIB 1P3PB 5FUGB 3AFAA 3TU4A 5AY8D 1KX4B 3AZEB 5GSUC 3KXBC 5AV5B 4QLCA 3AN2C 3WAAB 5B1MC 4WU8C 1TZYD 3C1BC 3LZ1C 1P3IB 2FJ7C 5AY8C 1WWIA 3NQJA 5GXQB 3W96A 2F8NK 3MGSB 3WTPD 3WKJA 3AZGD 3KSYA 3AZMD 3WA9C 2NZDA 2F8NA 4KUDD 5E5AB 5GT3B 5B24B 3X1TD 1P3BA 3H0RC 3WTPC 3W99B 5B0ZD 1KX5A 3AZGC 3AZMC 2CV5A 1M19B 4KUDC 3AZJB 4H9OB 3KWQA 3X1TC 3VH5T 3MNND 1BH9A 1BH8A 5B0ZC 3W97A 3B6GB 5BT1D 1ZLAB 1HQ3B 1A7WA 4HGAB 5AVCA 3AV1D 1TAFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN C;  1M18 B;  3AV2 A;  1KX3 D;  5BT1 C;  4J8V B;  3LZ0 A;  1H3O B;  3AV1 C;  2BYK B;  5GSU B;  3KXB B;  1BFM A;  4KHA B;  3V9R B;  1S32 D;  3MGQ D;  1KX3 C;  5B1M B;  3AZK A;  4WU8 B;  1P3F A;  3X1U A;  3C1B B;  5B1L A;  3REL A;  3LZ1 B;  4XZQ A;  2FJ7 B;  4EO5 C;  1P34 D;  5AY8 B;  4H9R B;  5AV6 D;  1S32 C;  3WA9 B;  4Z5T D;  5CP6 D;  1F1E A;  4H9N A;  1P3L A;  3KUY A;  3VH5 W;  4R8P D;  1P34 C;  1P3M D;  1P3K A;  5AV6 C;  3WTP B;  3A6N A;  3AYW A;  5B33 D;  5B2J A;  3UTB D;  3AZG B;  4Z5T C;  5CP6 C;  4KUD B;  2BYM B;  4R8P C;  4X23 A;  3LJA A;  4J8X A;  3X1T B;  5BNX A;  1P3M C;  1U35 D;  4LD9 D;  5GT0 D;  4ZBJ C;  2JSS A;  5B0Z B;  5B33 C;  1JFI A;  3X1S A;  3UTB C;  5B32 A;  4ZUX A;  1N1J A;  3AZL D;  3TU4 D;  3MNN B;  1U35 C;  4LD9 C;  5GT0 C;  3O62 A;  1B67 A;  1M1A A;  4J8W A;  3AZL C;  3AV1 B;  3TU4 C;  5AV9 A;  3LEL A;  1KX3 B;  5GXQ D;  3NQU A;  4EO5 B;  2F8N G;  3REK A;  4WU9 A;  2RVQ D;  4E45 A;  5B31 A;  1S32 B;  1KX5 D;  5AV8 A;  2CV5 D;  3B6F A;  1P34 B;  5AV6 B;  2RVQ C;  5JRG A;  1KX5 C;  4Z5T B;  5CP6 B;  2CV5 C;  4R8P B;  3B6G D;  1P3M B;  1KU5 A;  1F66 A;  4KGC A;  3AV2 D;  5B33 B;  4Z66 D;  5BS7 A;  4YS3 A;  3B6G C;  5AVC C;  4CSR A;  3REJ A;  3AZF A;  1P3O D;  5G49 A;  2NQB A;  5GT0 B;  4LD9 B;  3AZN D;  3AV2 C;  5B1L D;  4Z66 C;  4XZQ D;  5CPJ A;  4WNN A;  3TU4 B;  4Z2M H;  4UUZ A;  1P3O C;  4QLC B;  3AZN C;  3REH A;  3X1U C;  5B1L C;  1P3A A;  1P3L D;  5F99 A;  4XZQ C;  5B40 A;  4G91 C;  3WA9 D;  1AOI A;  5KDM A;  1ULY A;  5B0Y A;  5JA4 A;  3MGR A;  3WKJ B;  3AYW D;  5B2J D;  4H9S C;  2F8N B;  1P3L C;  4XUJ A;  3UT9 D;  3X1V A;  3AZH A;  5DNN D;  3AYW C;  1KX5 B;  5B2J C;  4AWL C;  2CV5 B;  4H9Q A;  5B32 D;  3VH5 A;  5B32 G;  3KWQ B;  5CPI A;  5FUG A;  4G92 C;  1KX4 A;  3O62 D;  3UT9 C;  1BH8 B;  5DNN C;  3REI A;  1M1A D;  2ARO D;  5B32 C;  5AVC B;  4NE3 A;  5AV9 D;  3AZI A;  3O62 C;  3AV2 B;  1M1A C;  4Z66 B;  2ARO C;  3LZ0 B;  3REK D;  5C3I C;  5GT3 A;  5AV9 C;  5B24 A;  4WU9 D;  1P3O B;  5AVB D;  3AZN B;  4WV4 B;  3W99 A;  5B31 G;  3X1U B;  5B1L B;  3REL B;  3C1C A;  4XZQ B;  3B6F D;  4G91 B;  3UTA A;  1M19 A;  3MVD D;  3REK C;  4H9O A;  4WU9 C;  5AVB C;  1P3G D;  5B31 C;  2YFV B;  4J8U A;  2HIO A;  1EQZ A;  4H9N B;  1P3L B;  3B6F C;  1HQ3 A;  3MVD C;  4YM6 A;  3A6N B;  1P3G C;  3AYW B;  5B2J B;  4AWL B;  1M18 A;  4J8V A;  5BNX B;  4G92 B;  5BO0 A;  3AZF D;  2BYK A;  3UT9 B;  5DNN B;  2YFW A;  3WTP E;  3AN2 A;  5B32 B;  4ZUX B;  1N1J B;  2LY8 A;  3LZ1 A;  4WZS B;  2FJ7 A;  1ID3 A;  3REJ C;  3AZF C;  3AFA D;  3O62 B;  1M1A B;  4QLC D;  3R45 A;  5CPK A;  2ARO B;  1P3A D;  5F99 D;  1TZY A;  5B40 D;  1AOI D;  5C3I B;  5AV9 B;  5B0Y D;  3AFA C;  5BNV A;  3MGR D;  3W96 D;  3WTP A;  4QLC C;  3WKJ D;  3AZG A;  3AZM A;  1P3A C;  5F99 C;  5B40 C;  1AOI C;  4KUD A;  2NZD D;  2BYM A;  3REK B;  2F8N D;  4WU9 B;  5B0Y C;  4XUJ D;  5AVB B;  3X1V D;  5B31 B;  3W96 C;  3MGR C;  1P3B D;  3B6F B;  3MGP A;  3WKJ C;  1WWS A;  3MVD B;  2NZD C;  4XUJ C;  3X1V C;  3KWQ D;  3B0B A;  1P3G B;  3REI D;  4H9P A;  1P3B C;  3W97 D;  3AZI D;  5AVC D;  1F66 B;  3KWQ C;  3REI C;  2HUE C;  3W97 C;  4NFT A;  4CSR B;  4DRA A;  3LZ0 D;  3REJ B;  3AZF B;  3AZI C;  4CAY A;  3MGQ A;  5CPJ B;  4WNN B;  3UTA D;  3AZK D;  1P3F D;  3X1U D;  3REL D;  4UUZ B;  1P34 A;  3LZ0 C;  3AFA B;  5AV6 A;  2HIO D;  1P3A B;  4Z5T A;  5F99 B;  5B40 B;  1AOI B;  3UTA C;  3AZK C;  1P3F C;  5KDM B;  3REL C;  3KUY D;  5B0Y B;  3VH6 T;  3NQJ B;  3MGR B;  3W96 B;  1P3K D;  2PYO A;  4J8U C;  2HIO C;  3A6N D;  5B33 A;  3UTB A;  2L5A A;  2NZD B;  5DNM A;  3KUY C;  4X23 D;  4XUJ B;  3LJA D;  4J8X D;  3X1V B;  3W98 A;  1U35 A;  4LD9 A;  1P3K C;  1P3B B;  4H9Q B;  3A6N C;  4JJN A;  3X1S D;  3AZL A;  4ZUX D;  1ID3 D;  4X23 C;  5B2I A;  3LJA C;  4J8X C;  1P3P A;  3REI B;  1BH9 B;  5CPK D;  3AZE A;  5AV5 A;  2HUE B;  3W97 B;  4J8W D;  3X1S C;  3WAA A;  4ZUX C;  3AZI B;  1ID3 C;  1P3I A;  3LEL D;  5GXQ A;  5CPK C;  3MGS A;  3VH6 W;  1TZY C;  2IO5 C;  4J8W C;  2F8N H;  3B0D B;  5E5A A;  4M6B A;  3LEL C;  5B31 D;  3C1C B;  3MGP D;  4DRB A;  3UTA B;  5AV8 D;  3AZK B;  1P3F B;  3B0C T;  3AZJ A;  4J8U B;  2HIO B;  1EQZ B;  1B6W A;  5JRG D;  3MGP C;  5AV8 C;  3KUY B;  3B6G A;  1ZLA A;  4YM6 B;  1P3K B;  1F66 D;  4KGC D;  1TAF A;  5JRG C;  4Z66 A;  5BO0 B;  4YS3 D;  4X23 B;  3LJA B;  4J8X B;  1P3O A;  1H3O A;  3REJ D;  2NQB D;  2YFW B;  3AZN A;  5GSU A;  3KXB A;  3AN2 B;  1F66 C;  4KHA A;  3V9R A;  4KGC C;  1JFI B;  3X1S B;  5B1M A;  4WU8 A;  5BS7 C;  5CPJ D;  3C1B A;  4YS3 C;  1ID3 B;  4Z2M G;  5AY8 A;  4H9R A;  2NQB C;  3R45 B;  3MGQ C;  5CPK B;  2YFV A;  3B0C W;  4H9S A;  3REH D;  1TZY B;  2IO5 B;  4J8W B;  3WA9 A;  5CPJ C;  4NE6 A;  5BNV B;  1HTA A;  3LEL B;  2PYO D;  3AZM B;  3NQU B;  3REH C;  5DNM D;  3W98 D;  3UT9 A;  3X1T A;  2PYO C;  5DNN A;  3AZH D;  4JJN D;  1Q9C A;  3MGP B;  5AV8 B;  5B0Z A;  5DNM C;  5B2I D;  5CPI D;  1P3P D;  3W98 C;  4H9P B;  1KX4 D;  3AZE D;  5AV5 D;  3MNN A;  5JRG B;  4JJN C;  3AZH C;  2ARO A;  2CWE A;  3WAA D;  5B2I C;  1P3I D;  5CPI C;  3AV1 A;  1P3P C;  1KX4 C;  4KGC B;  3AZE C;  5AV5 C;  3MGS D;  1KX3 A;  3WAA C;  4YS3 B;  5E5A D;  4CAY B;  1P3I C;  2NQB B;  5GT3 D;  5AVB A;  5B24 D;  5G49 B;  3MGQ B;  5GXQ C;  5CHL B;  3MGS C;  1S32 A;  3W99 D;  3C1C D;  3MVD A;  1M19 D;  5E5A C;  3AZJ D;  5GT3 C;  5B24 C;  1P3G A;  3B0D C;  3REH B;  3VH6 A;  4J8U D;  3W99 C;  1EQZ D;  3C1C C;  1ZLA D;  5CP6 A;  1HQ3 D;  4R8P A;  1M19 C;  4ZBJ B;  3AZJ C;  4YM6 D;  2PYO B;  1P3M A;  5JA4 B;  3UTB B;  4NE5 A;  1M18 D;  1EQZ C;  5DNM B;  1ZLA C;  4J8V D;  4E44 A;  1HQ3 C;  3W98 B;  1U35 B;  4HGA C;  4YM6 C;  5GSU D;  3KXB D;  3AZH B;  4JJN B;  5GT0 A;  1R4V A;  1M18 C;  3AZL B;  3AN2 D;  5B1M D;  4WU8 D;  3C1B D;  5B2I B;  3LZ1 D;  4J8V C;  2FJ7 D;  5CPI B;  1P3P B;  5FUG B;  3AFA A;  3TU4 A;  5AY8 D;  1KX4 B;  3AZE B;  5GSU C;  3KXB C;  5AV5 B;  4QLC A;  3AN2 C;  3WAA B;  5B1M C;  4WU8 C;  1TZY D;  3C1B C;  3LZ1 C;  1P3I B;  2FJ7 C;  5AY8 C;  3NQJ A;  1WWI A;  5GXQ B;  3W96 A;  2F8N K;  3MGS B;  3WTP D;  3WKJ A;  3AZG D;  3KSY A;  3AZM D;  3WA9 C;  2NZD A;  2F8N A;  4KUD D;  5E5A B;  5B24 B;  3X1T D;  5GT3 B;  1P3B A;  3WTP C;  3W99 B;  5B0Z D;  1KX5 A;  3AZG C;  3AZM C;  2CV5 A;  1M19 B;  4KUD C;  3AZJ B;  4H9O B;  3KWQ A;  3X1T C;  3VH5 T;  3MNN D;  1BH9 A;  1BH8 A;  5B0Z C;  3W97 A;  3B6G B;  5BT1 D;  1ZLA B;  1HQ3 B;  1A7W A;  4HGA B;  5AVC A;  3AV1 D;  1TAF B; 
#chains in the Genus database with same CATH topology
 3MNN C;  1M18 B;  3AV2 A;  1KX3 D;  2DF4 C;  5BT1 C;  4J8V B;  3LZ0 A;  2ZM5 A;  1H3O B;  3AV1 C;  2BYK B;  5GSU B;  3KXB B;  1BFM A;  4KHA B;  3V9R B;  1S32 D;  3MGQ D;  1KX3 C;  5B1M B;  3AZK A;  4WU8 B;  1P3F A;  3X1U A;  3C1B B;  5B1L A;  3REL A;  3LZ1 B;  4XZQ A;  2FJ7 B;  4EO5 C;  1P34 D;  5AY8 B;  4H9R B;  5AV6 D;  2XD5 A;  1S32 C;  2ZY2 A;  3WA9 B;  4Z5T D;  5CP6 D;  1F1E A;  4H9N A;  1P3L A;  3KUY A;  3VH5 W;  4R8P D;  1P34 C;  1P3M D;  1P3K A;  5AV6 C;  3WTP B;  3A6N A;  3AYW A;  5B33 D;  5B2J A;  3UTB D;  3AZG B;  4Z5T C;  5CP6 C;  4KUD B;  2BYM B;  4R8P C;  4X23 A;  3LJA A;  4J8X A;  3X1T B;  5BNX A;  1P3M C;  1U35 D;  4LD9 D;  5GT0 D;  4ZBJ C;  2JSS A;  5B0Z B;  2BG1 A;  2J8P A;  2UWX A;  3X1S A;  3UTB C;  5B33 C;  1JFI A;  5B32 A;  2F2A C;  1N1J A;  4ZUX A;  3AZL D;  4WJ3 C;  3FDD A;  3EPK A;  3TU4 D;  3MNN B;  1U35 C;  4LD9 C;  5GT0 C;  3O62 A;  1B67 A;  1M1A A;  4J8W A;  3AZL C;  3AV1 B;  3TU4 C;  5AV9 A;  3LEL A;  2Y2I A;  1KX3 B;  5GXQ D;  3NQU A;  1W2E A;  2Y2L A;  4EO5 B;  2F8N G;  3REK A;  4WU9 A;  2RVQ D;  3F6T A;  4E45 A;  5B31 A;  1S32 B;  1KX5 D;  5AV8 A;  2CV5 D;  4DQY B;  3B6F A;  2RIQ A;  1P34 B;  5AV6 B;  2RVQ C;  5JRG A;  1KX5 C;  4Z5T B;  5CP6 B;  2CV5 C;  4R8P B;  3B6G D;  1P3M B;  1KU5 A;  2Y2H A;  1F66 A;  4KGC A;  3AV2 D;  2ZY3 A;  5B33 B;  4Z66 D;  5BS7 A;  4YS3 A;  3B6G C;  5AVC C;  4CSR A;  3REJ A;  3AZF A;  1P3O D;  5G49 A;  2NQB A;  5GT0 B;  4LD9 B;  3AZN D;  3AV2 C;  2ZY4 A;  5B1L D;  4Z66 C;  4XZQ D;  5CPJ A;  4WNN A;  3TU4 B;  4Z2M H;  4UUZ A;  1P3O C;  4QLC B;  3AZN C;  3REH A;  3X1U C;  5B1L C;  1P3A A;  1P3L D;  5F99 A;  4XZQ C;  5B40 A;  4G91 C;  3WA9 D;  1AOI A;  5KDM A;  1ULY A;  5B0Y A;  5JA4 A;  3MGR A;  3WKJ B;  3AYW D;  2ZY5 A;  5B2J D;  4H9S C;  2G5H C;  2F8N B;  1P3L C;  3H0L C;  4XUJ A;  3UT9 D;  3X1V A;  3AZH A;  5DNN D;  3AYW C;  2FFF B;  1KX5 B;  5B2J C;  4AWL C;  2CV5 B;  4H9Q A;  5B32 D;  3VH5 A;  5B32 G;  3KWQ B;  5CPI A;  5FUG A;  4G92 C;  1KX4 A;  3O62 D;  3UT9 C;  2Y2M A;  1BH8 B;  5DNN C;  3REI A;  1M1A D;  2ARO D;  5B32 C;  3EPH A;  5AVC B;  4NE3 A;  5AV9 D;  3AZI A;  3O62 C;  3AV2 B;  1M1A C;  4Z66 B;  2ARO C;  2Y2G A;  3LZ0 B;  2VQR A;  3REK D;  5C3I C;  5AV9 C;  5GT3 A;  5B24 A;  4WU9 D;  1P3O B;  5AVB D;  3AZN B;  4WV4 B;  3W99 A;  5B31 G;  3X1U B;  5B1L B;  3REL B;  3C1C A;  4XZQ B;  3B6F D;  4G91 B;  3UTA A;  1M19 A;  3MVD D;  3REK C;  4H9O A;  4WU9 C;  5AVB C;  1P3G D;  5B31 C;  2YFV B;  4J8U A;  2HIO A;  1EQZ A;  4H9N B;  1P3L B;  3B6F C;  1HQ3 A;  3MVD C;  4YM6 A;  3A6N B;  3EPL A;  1P3G C;  3AYW B;  5B2J B;  4AWL B;  1M18 A;  4J8V A;  5BNX B;  4G92 B;  5BO0 A;  3AZF D;  2Y2J A;  2BYK A;  3UT9 B;  5DNN B;  2YFW A;  3WTP E;  3AN2 A;  5B32 B;  4ZUX B;  1N1J B;  2LY8 A;  3LZ1 A;  4WZS B;  2FJ7 A;  1ID3 A;  3REJ C;  3AZF C;  3AFA D;  3O62 B;  1M1A B;  4QLC D;  3R45 A;  5CPK A;  2ARO B;  1P3A D;  5F99 D;  1TZY A;  5B40 D;  1AOI D;  5C3I B;  5AV9 B;  5B0Y D;  2JE5 A;  3AFA C;  5BNV A;  3MGR D;  3W96 D;  3WTP A;  4QLC C;  3WKJ D;  3AZG A;  3AZM A;  1P3A C;  5F99 C;  5B40 C;  1AOI C;  4KUD A;  2NZD D;  2BYM A;  3REK B;  2F8N D;  4WU9 B;  5B0Y C;  4XUJ D;  5AVB B;  3X1V D;  5B31 B;  3W96 C;  3MGR C;  1P3B D;  3B6F B;  3MGP A;  3WKJ C;  1WWS A;  3MVD B;  2NZD C;  4XUJ C;  3X1V C;  3KWQ D;  3B0B A;  1P3G B;  3REI D;  4H9P A;  1P3B C;  3W97 D;  2DQN C;  3AZI D;  5AVC D;  1F66 B;  3KWQ C;  3A1I A;  3REI C;  2W8S A;  2HUE C;  3W97 C;  4NFT A;  4CSR B;  4DRA A;  3LZ0 D;  3REJ B;  3AZF B;  3AZI C;  4CAY A;  3MGQ A;  5CPJ B;  4WNN B;  3UTA D;  3AZK D;  1P3F D;  3X1U D;  3REL D;  4UUZ B;  1P34 A;  3LZ0 C;  3AFA B;  5AV6 A;  2HIO D;  1P3A B;  4Z5T A;  5F99 B;  5B40 B;  1AOI B;  3UTA C;  3AZK C;  1P3F C;  5KDM B;  3REL C;  3KUY D;  5B0Y B;  3VH6 T;  3NQJ B;  3MGR B;  3W96 B;  1P3K D;  2PYO A;  4J8U C;  2HIO C;  3A6N D;  5B33 A;  3UTB A;  2L5A A;  2JCH A;  2NZD B;  5DNM A;  3KUY C;  4X23 D;  4XUJ B;  3LJA D;  4J8X D;  3X1V B;  3EG5 B;  3W98 A;  1U35 A;  4LD9 A;  1P3K C;  1P3B B;  4H9Q B;  3A6N C;  4JJN A;  2G5I C;  3X1S D;  3AZL A;  4ZUX D;  1ID3 D;  4X23 C;  5B2I A;  3LJA C;  4J8X C;  1P3P A;  3REI B;  1BH9 B;  5CPK D;  3AZE A;  5AV5 A;  2HUE B;  3W97 B;  4J8W D;  3X1S C;  3WAA A;  4ZUX C;  3AZI B;  1ID3 C;  1P3I A;  3LEL D;  5GXQ A;  3IP4 C;  5CPK C;  3MGS A;  3VH6 W;  1TZY C;  2IO5 C;  4J8W C;  2F8N H;  3B0D B;  5E5A A;  4M6B A;  3LEL C;  5B31 D;  3C1C B;  2Y2P A;  4DRB A;  4UPK A;  3MGP D;  3UTA B;  5AV8 D;  3AZK B;  1P3F B;  3B0C T;  1PZR A;  3AZJ A;  4J8U B;  2HIO B;  1EQZ B;  1B6W A;  5JRG D;  3MGP C;  5AV8 C;  3KUY B;  3B6G A;  3H0M C;  1ZLA A;  4YM6 B;  2Y2K A;  1T3U A;  1P3K B;  1F66 D;  4KGC D;  1TAF A;  5JRG C;  4Z66 A;  5BO0 B;  4YS3 D;  4X23 B;  3LJA B;  4J8X B;  1P3O A;  1H3O A;  3REJ D;  2NQB D;  2YFW B;  3AZN A;  5GSU A;  3KXB A;  3AN2 B;  1F66 C;  4KHA A;  3V9R A;  4KGC C;  1JFI B;  3KFU G;  3X1S B;  5B1M A;  4WU8 A;  5BS7 C;  5CPJ D;  3C1B A;  4YS3 C;  1ID3 B;  4Z2M G;  5AY8 A;  4H9R A;  2NQB C;  3R45 B;  3MGQ C;  5CPK B;  2YFV A;  3B0C W;  4H9S A;  3REH D;  1TZY B;  3A1K A;  2IO5 B;  4J8W B;  3WA9 A;  5CPJ C;  4NE6 A;  5BNV B;  3AL0 C;  2Y2O A;  1HTA A;  3LEL B;  2PYO D;  3AZM B;  2XD1 A;  3NQU B;  3REH C;  5DNM D;  3W98 D;  3UT9 A;  3X1T A;  2PYO C;  5DNN A;  3AZH D;  4JJN D;  1Q9C A;  3MGP B;  1Z2C B;  5AV8 B;  5B0Z A;  5DNM C;  5B2I D;  5CPI D;  1P3P D;  3W98 C;  4H9P B;  1KX4 D;  3AZE D;  5AV5 D;  3MNN A;  5JRG B;  4JJN C;  3AZH C;  2ARO A;  2CWE A;  2Y2N A;  3WAA D;  5B2I C;  1P3I D;  5CPI C;  3AV1 A;  1P3P C;  1KX4 C;  4KGC B;  3EPJ A;  3AZE C;  5AV5 C;  3MGS D;  1KX3 A;  3WAA C;  4YS3 B;  5E5A D;  4CAY B;  1P3I C;  2NQB B;  5GT3 D;  5AVB A;  5B24 D;  5G49 B;  3MGQ B;  5GXQ C;  5CHL B;  3MGS C;  1S32 A;  3W99 D;  3C1C D;  3MVD A;  1M19 D;  5E5A C;  2Y2Q A;  3AZJ D;  5GT3 C;  5B24 C;  1P3G A;  3B0D C;  3REH B;  3VH6 A;  4J8U D;  3W99 C;  1EQZ D;  3C1C C;  1ZLA D;  5CP6 A;  1HQ3 D;  4R8P A;  1M19 C;  4ZBJ B;  3AZJ C;  4YM6 D;  2PYO B;  1P3M A;  5JA4 B;  3UTB B;  4NE5 A;  1M18 D;  1EQZ C;  5DNM B;  1ZLA C;  4J8V D;  4E44 A;  1HQ3 C;  3W98 B;  1U35 B;  4HGA C;  4YM6 C;  5GSU D;  3KXB D;  3AZH B;  4JJN B;  5GT0 A;  1R4V A;  1M18 C;  3AZL B;  3AN2 D;  5B1M D;  4WU8 D;  3C1B D;  3P5J B;  5B2I B;  3LZ1 D;  4J8V C;  2FJ7 D;  5CPI B;  1P3P B;  5FUG B;  3AFA A;  3TU4 A;  5AY8 D;  1KX4 B;  3AZE B;  5GSU C;  3KXB C;  5AV5 B;  4QLC A;  3AN2 C;  3WAA B;  5B1M C;  4WU8 C;  1TZY D;  3C1B C;  3LZ1 C;  1P3I B;  2FJ7 C;  5AY8 C;  1WWI A;  3NQJ A;  5GXQ B;  3W96 A;  2F8N K;  3MGS B;  3WTP D;  3WKJ A;  3AZG D;  3KSY A;  3AZM D;  3WA9 C;  2NZD A;  2F8N A;  4KUD D;  5E5A B;  5GT3 B;  5B24 B;  3X1T D;  1P3B A;  3H0R C;  3WTP C;  3W99 B;  5B0Z D;  1KX5 A;  3AZG C;  3AZM C;  2CV5 A;  1M19 B;  4KUD C;  3AZJ B;  4H9O B;  3KWQ A;  3X1T C;  3VH5 T;  3MNN D;  1BH9 A;  1BH8 A;  5B0Z C;  3W97 A;  3B6G B;  5BT1 D;  1ZLA B;  1HQ3 B;  1A7W A;  4HGA B;  5AVC A;  3AV1 D;  1TAF B; 
#chains in the Genus database with same CATH homology
 3MNN C;  1M18 B;  3AV2 A;  1KX3 D;  2DF4 C;  5BT1 C;  4J8V B;  3LZ0 A;  2ZM5 A;  1H3O B;  3AV1 C;  2BYK B;  5GSU B;  3KXB B;  1BFM A;  4KHA B;  3V9R B;  1S32 D;  3MGQ D;  1KX3 C;  5B1M B;  3AZK A;  4WU8 B;  1P3F A;  3X1U A;  3C1B B;  5B1L A;  3REL A;  3LZ1 B;  4XZQ A;  2FJ7 B;  4EO5 C;  1P34 D;  5AY8 B;  4H9R B;  5AV6 D;  2XD5 A;  1S32 C;  2ZY2 A;  3WA9 B;  4Z5T D;  5CP6 D;  1F1E A;  4H9N A;  1P3L A;  3KUY A;  3VH5 W;  4R8P D;  1P34 C;  1P3M D;  1P3K A;  5AV6 C;  3WTP B;  3A6N A;  3AYW A;  5B33 D;  5B2J A;  3UTB D;  3AZG B;  4Z5T C;  5CP6 C;  4KUD B;  2BYM B;  4R8P C;  4X23 A;  3LJA A;  4J8X A;  3X1T B;  5BNX A;  1P3M C;  1U35 D;  4LD9 D;  5GT0 D;  4ZBJ C;  2JSS A;  5B0Z B;  2BG1 A;  2J8P A;  2UWX A;  3X1S A;  3UTB C;  5B33 C;  1JFI A;  5B32 A;  2F2A C;  1N1J A;  4ZUX A;  3AZL D;  4WJ3 C;  3FDD A;  3EPK A;  3TU4 D;  3MNN B;  1U35 C;  4LD9 C;  5GT0 C;  3O62 A;  1B67 A;  1M1A A;  4J8W A;  3AZL C;  3AV1 B;  3TU4 C;  5AV9 A;  3LEL A;  2Y2I A;  1KX3 B;  5GXQ D;  3NQU A;  1W2E A;  2Y2L A;  4EO5 B;  2F8N G;  3REK A;  4WU9 A;  2RVQ D;  3F6T A;  4E45 A;  5B31 A;  1S32 B;  1KX5 D;  5AV8 A;  2CV5 D;  4DQY B;  3B6F A;  2RIQ A;  1P34 B;  5AV6 B;  2RVQ C;  5JRG A;  1KX5 C;  4Z5T B;  5CP6 B;  2CV5 C;  4R8P B;  3B6G D;  1P3M B;  1KU5 A;  2Y2H A;  1F66 A;  4KGC A;  3AV2 D;  2ZY3 A;  5B33 B;  4Z66 D;  5BS7 A;  4YS3 A;  3B6G C;  5AVC C;  4CSR A;  3REJ A;  3AZF A;  1P3O D;  5G49 A;  2NQB A;  5GT0 B;  4LD9 B;  3AZN D;  3AV2 C;  2ZY4 A;  5B1L D;  4Z66 C;  4XZQ D;  5CPJ A;  4WNN A;  3TU4 B;  4Z2M H;  4UUZ A;  1P3O C;  4QLC B;  3AZN C;  3REH A;  3X1U C;  5B1L C;  1P3A A;  1P3L D;  5F99 A;  4XZQ C;  5B40 A;  4G91 C;  3WA9 D;  1AOI A;  5KDM A;  1ULY A;  5B0Y A;  5JA4 A;  3MGR A;  3WKJ B;  3AYW D;  2ZY5 A;  5B2J D;  4H9S C;  2G5H C;  2F8N B;  1P3L C;  3H0L C;  4XUJ A;  3UT9 D;  3X1V A;  3AZH A;  5DNN D;  3AYW C;  2FFF B;  1KX5 B;  5B2J C;  4AWL C;  2CV5 B;  4H9Q A;  5B32 D;  3VH5 A;  5B32 G;  3KWQ B;  5CPI A;  5FUG A;  4G92 C;  1KX4 A;  3O62 D;  3UT9 C;  2Y2M A;  1BH8 B;  5DNN C;  3REI A;  1M1A D;  2ARO D;  5B32 C;  3EPH A;  5AVC B;  4NE3 A;  5AV9 D;  3AZI A;  3O62 C;  3AV2 B;  1M1A C;  4Z66 B;  2ARO C;  2Y2G A;  3LZ0 B;  2VQR A;  3REK D;  5C3I C;  5AV9 C;  5GT3 A;  5B24 A;  4WU9 D;  1P3O B;  5AVB D;  3AZN B;  4WV4 B;  3W99 A;  5B31 G;  3X1U B;  5B1L B;  3REL B;  3C1C A;  4XZQ B;  3B6F D;  4G91 B;  3UTA A;  1M19 A;  3MVD D;  3REK C;  4H9O A;  4WU9 C;  5AVB C;  1P3G D;  5B31 C;  2YFV B;  4J8U A;  2HIO A;  1EQZ A;  4H9N B;  1P3L B;  3B6F C;  1HQ3 A;  3MVD C;  4YM6 A;  3A6N B;  3EPL A;  1P3G C;  3AYW B;  5B2J B;  4AWL B;  1M18 A;  4J8V A;  5BNX B;  4G92 B;  5BO0 A;  3AZF D;  2Y2J A;  2BYK A;  3UT9 B;  5DNN B;  2YFW A;  3WTP E;  3AN2 A;  5B32 B;  4ZUX B;  1N1J B;  2LY8 A;  3LZ1 A;  4WZS B;  2FJ7 A;  1ID3 A;  3REJ C;  3AZF C;  3AFA D;  3O62 B;  1M1A B;  4QLC D;  3R45 A;  5CPK A;  2ARO B;  1P3A D;  5F99 D;  1TZY A;  5B40 D;  1AOI D;  5C3I B;  5AV9 B;  5B0Y D;  2JE5 A;  3AFA C;  5BNV A;  3MGR D;  3W96 D;  3WTP A;  4QLC C;  3WKJ D;  3AZG A;  3AZM A;  1P3A C;  5F99 C;  5B40 C;  1AOI C;  4KUD A;  2NZD D;  2BYM A;  3REK B;  2F8N D;  4WU9 B;  5B0Y C;  4XUJ D;  5AVB B;  3X1V D;  5B31 B;  3W96 C;  3MGR C;  1P3B D;  3B6F B;  3MGP A;  3WKJ C;  1WWS A;  3MVD B;  2NZD C;  4XUJ C;  3X1V C;  3KWQ D;  3B0B A;  1P3G B;  3REI D;  4H9P A;  1P3B C;  3W97 D;  2DQN C;  3AZI D;  5AVC D;  1F66 B;  3KWQ C;  3A1I A;  3REI C;  2W8S A;  2HUE C;  3W97 C;  4NFT A;  4CSR B;  4DRA A;  3LZ0 D;  3REJ B;  3AZF B;  3AZI C;  4CAY A;  3MGQ A;  5CPJ B;  4WNN B;  3UTA D;  3AZK D;  1P3F D;  3X1U D;  3REL D;  4UUZ B;  1P34 A;  3LZ0 C;  3AFA B;  5AV6 A;  2HIO D;  1P3A B;  4Z5T A;  5F99 B;  5B40 B;  1AOI B;  3UTA C;  3AZK C;  1P3F C;  5KDM B;  3REL C;  3KUY D;  5B0Y B;  3VH6 T;  3NQJ B;  3MGR B;  3W96 B;  1P3K D;  2PYO A;  4J8U C;  2HIO C;  3A6N D;  5B33 A;  3UTB A;  2L5A A;  2JCH A;  2NZD B;  5DNM A;  3KUY C;  4X23 D;  4XUJ B;  3LJA D;  4J8X D;  3X1V B;  3EG5 B;  3W98 A;  1U35 A;  4LD9 A;  1P3K C;  1P3B B;  4H9Q B;  3A6N C;  4JJN A;  2G5I C;  3X1S D;  3AZL A;  4ZUX D;  1ID3 D;  4X23 C;  5B2I A;  3LJA C;  4J8X C;  1P3P A;  3REI B;  1BH9 B;  5CPK D;  3AZE A;  5AV5 A;  2HUE B;  3W97 B;  4J8W D;  3X1S C;  3WAA A;  4ZUX C;  3AZI B;  1ID3 C;  1P3I A;  3LEL D;  5GXQ A;  3IP4 C;  5CPK C;  3MGS A;  3VH6 W;  1TZY C;  2IO5 C;  4J8W C;  2F8N H;  3B0D B;  5E5A A;  4M6B A;  3LEL C;  5B31 D;  3C1C B;  2Y2P A;  4DRB A;  4UPK A;  3MGP D;  3UTA B;  5AV8 D;  3AZK B;  1P3F B;  3B0C T;  1PZR A;  3AZJ A;  4J8U B;  2HIO B;  1EQZ B;  1B6W A;  5JRG D;  3MGP C;  5AV8 C;  3KUY B;  3B6G A;  3H0M C;  1ZLA A;  4YM6 B;  2Y2K A;  1T3U A;  1P3K B;  1F66 D;  4KGC D;  1TAF A;  5JRG C;  4Z66 A;  5BO0 B;  4YS3 D;  4X23 B;  3LJA B;  4J8X B;  1P3O A;  1H3O A;  3REJ D;  2NQB D;  2YFW B;  3AZN A;  5GSU A;  3KXB A;  3AN2 B;  1F66 C;  4KHA A;  3V9R A;  4KGC C;  1JFI B;  3KFU G;  3X1S B;  5B1M A;  4WU8 A;  5BS7 C;  5CPJ D;  3C1B A;  4YS3 C;  1ID3 B;  4Z2M G;  5AY8 A;  4H9R A;  2NQB C;  3R45 B;  3MGQ C;  5CPK B;  2YFV A;  3B0C W;  4H9S A;  3REH D;  1TZY B;  3A1K A;  2IO5 B;  4J8W B;  3WA9 A;  5CPJ C;  4NE6 A;  5BNV B;  3AL0 C;  2Y2O A;  1HTA A;  3LEL B;  2PYO D;  3AZM B;  2XD1 A;  3NQU B;  3REH C;  5DNM D;  3W98 D;  3UT9 A;  3X1T A;  2PYO C;  5DNN A;  3AZH D;  4JJN D;  1Q9C A;  3MGP B;  1Z2C B;  5AV8 B;  5B0Z A;  5DNM C;  5B2I D;  5CPI D;  1P3P D;  3W98 C;  4H9P B;  1KX4 D;  3AZE D;  5AV5 D;  3MNN A;  5JRG B;  4JJN C;  3AZH C;  2ARO A;  2CWE A;  2Y2N A;  3WAA D;  5B2I C;  1P3I D;  5CPI C;  3AV1 A;  1P3P C;  1KX4 C;  4KGC B;  3EPJ A;  3AZE C;  5AV5 C;  3MGS D;  1KX3 A;  3WAA C;  4YS3 B;  5E5A D;  4CAY B;  1P3I C;  2NQB B;  5GT3 D;  5AVB A;  5B24 D;  5G49 B;  3MGQ B;  5GXQ C;  5CHL B;  3MGS C;  1S32 A;  3W99 D;  3C1C D;  3MVD A;  1M19 D;  5E5A C;  2Y2Q A;  3AZJ D;  5GT3 C;  5B24 C;  1P3G A;  3B0D C;  3REH B;  3VH6 A;  4J8U D;  3W99 C;  1EQZ D;  3C1C C;  1ZLA D;  5CP6 A;  1HQ3 D;  4R8P A;  1M19 C;  4ZBJ B;  3AZJ C;  4YM6 D;  2PYO B;  1P3M A;  5JA4 B;  3UTB B;  4NE5 A;  1M18 D;  1EQZ C;  5DNM B;  1ZLA C;  4J8V D;  4E44 A;  1HQ3 C;  3W98 B;  1U35 B;  4HGA C;  4YM6 C;  5GSU D;  3KXB D;  3AZH B;  4JJN B;  5GT0 A;  1R4V A;  1M18 C;  3AZL B;  3AN2 D;  5B1M D;  4WU8 D;  3C1B D;  3P5J B;  5B2I B;  3LZ1 D;  4J8V C;  2FJ7 D;  5CPI B;  1P3P B;  5FUG B;  3AFA A;  3TU4 A;  5AY8 D;  1KX4 B;  3AZE B;  5GSU C;  3KXB C;  5AV5 B;  4QLC A;  3AN2 C;  3WAA B;  5B1M C;  4WU8 C;  1TZY D;  3C1B C;  3LZ1 C;  1P3I B;  2FJ7 C;  5AY8 C;  1WWI A;  3NQJ A;  5GXQ B;  3W96 A;  2F8N K;  3MGS B;  3WTP D;  3WKJ A;  3AZG D;  3KSY A;  3AZM D;  3WA9 C;  2NZD A;  2F8N A;  4KUD D;  5E5A B;  5GT3 B;  5B24 B;  3X1T D;  1P3B A;  3H0R C;  3WTP C;  3W99 B;  5B0Z D;  1KX5 A;  3AZG C;  3AZM C;  2CV5 A;  1M19 B;  4KUD C;  3AZJ B;  4H9O B;  3KWQ A;  3X1T C;  3VH5 T;  3MNN D;  1BH9 A;  1BH8 A;  5B0Z C;  3W97 A;  3B6G B;  5BT1 D;  1ZLA B;  1HQ3 B;  1A7W A;  4HGA B;  5AVC A;  3AV1 D;  1TAF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...