3MNNC

A ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A ruthenium antimetastasis agent forms specific histone protein adducts in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mnnC00
4H9NB 4HGAC 1P3FD 2AROA 3W96C 3REKB 3AN2B 1AOID 1P3PD 3O62C 5E5AB 5B32C 4NE3A 3REKA 3UTAB 3AZFC 5E5AA 5AV5C 5B31B 5AVBD 4LD9D 5AV8B 3VH6W 3W97D 3VH6T 3UTAA 4KUDB 5B31A 1A7WA 3MNNB 5AV8A 3MVDC 3AZLB 4KUDA 5B32D 3AZHC 3MNNA 5CPKC 3AZLA 3KWQB 1P34B 5B2IB 3AZFD 1ZLAC 2RVQC 5B2JC 1N1JB 3KWQA 5B2IA 1P3FB 3A6NC 1AOIB 3MVDD 1N1JA 1BFMA 1HQ3A 1P3FA 5AVCD 3AZHD 1AOIA 5CPKD 2NQBC 4H9PB 3X1TC 4LD9B 3B6FC 2RVQD 5DNMB 2NZDA 3W97B 2BYMB 4H9PA 1ID3C 4LD9A 4HGAB 5DNMA 3W97A 3WTPE 3A6ND 3W96B 2BYMA 3LJAC 3O62B 5B32B 3AZGC 3W96A 4H9OB 3KSYA 2NQBD 3AZFB 1HTAA 3O62A 5B32A 5AV5B 3AZMC 3X1TD 3B6FD 4H9OA 3AZFA 1ID3D 5AV5A 5BNXB 3V9RB 1P3OC 3MVDB 3AZJC 4H9SC 3LJAD 3AZHB 5BNXA 3V9RA 4DRAA 3MVDA 3AZGD 5CPKB 4CAYB 3AZMD 3AZHA 5B2JB 5CPKA 1F66C 4WU9C 4QLCC 2LY8A 1ZLAA 4CAYA 3A6NB 1P3OD 3WKJC 5B2JA 5B1MC 4X23C 3C1CC 1P3MC 5BO0B 3A6NA 3X1VC 4UUZB 2NQBB 3X1TB 1R4VA 3X1UC 3B6FB 5BO0A 4UUZA 1F66D 2NQBA 1ID3B 4QLCD 3X1TA 3B6FA 1S32C 3WKJD 3LJAB 5B1MD 1ID3A 4X23D 3C1CD 3AZGB 1P3MD 3X1VD 3LJAA 3AZMB 4NE6A 3X1UD 3AZGA 3AZMA 1P3OB 3AZJB 3UT9C 4WNNA 3AZNC 1U35C 1P3OA 3AZJA 4H9SA 1WWIA 2FJ7C 4XUJC 1F66B 4WU9B 4QLCB 5KDMB 3WKJB 1F66A 5B1MB 4WU9A 4QLCA 4X23B 3C1CB 1ULYA 3AZND 1P3MB 1TAFB 5KDMA 5B32G 3X1VB 3WKJA 5B1MA 1P3AC 5B24C 4X23A 3C1CA 2CV5A 3X1UB 1P3MA 3NQUB 1TAFA 4XUJD 3X1VA 5E5AD 4YM6C 3X1UA 3NQUA 4J8VC 3UTAD 4E45A 4WU8C 1M18C 3LZ1C 1S32A 5B40C 4J8WC 1P3AD 4NFTA 4G91C 3VH5W 3VH5T 4YM6D 2NZDC 1H3OB 4KHAB 3WAAC 4R8PC 4J8VD 3UT9B 4WU8D 3AZNB 1U35B 3LZ1D 1H3OA 4KHAA 3UT9A 4NE5A 5B40D 1HQ3D 3AZNA 1U35A 2FJ7B 4XUJB 2NZDD 2FJ7A 4XUJA 3WAAD 4R8PD 5CP6C 5DNMD 4G92C 3KXBC 1P3AB 4JJNC 2CWEA 5B24B 3W96D 1TZYC 1P3AA 3O62D 5B24A 4YM6B 5AY8C 3B0CW 4J8VB 5GSUC 4WU8B 4YM6A 5CP6D 3B0DC 5AV5D 3LZ1B 3B6GC 5B0ZC 4J8VA 5B40B 4J8WB 1HQ3B 4WU8A 3KXBD 4JJND 1M18A 3LZ1A 5JRGC 3REHC 4G91B 5B40A 4J8WA 1TZYD 2NZDB 5AY8D 2HIOC 3WAAB 4R8PB 5GSUD 3WTPC 4KGCA 1ZLAD 3B6GD 5B2JD 5B0ZD 3WAAA 4R8PA 5GXQC 5BNVB 3REHD 1M1AC 5BNVA 5CHLB 2HIOD 5CP6B 4Z2MH 3WTPD 3AZEC 4G92B 3KXBB 4JJNB 5CP6A 1TZYB 3KXBA 4JJNA 3UTBC 3R45A 5AY8B 5GSUB 1TZYA 1ZLAB 3B6GB 3B0DB 5AY8A 3AZED 5B0ZB 5GSUA 3B6GA 4Z5TC 4AWLC 5JRGB 1P3KC 5B0ZA 3REHB 3AZJD 2IO5C 2CV5C 2F8NH 3C1BC 5JRGA 5B1LC 3REHA 1KX4C 2HIOB 1F1EA 3WTPB 3NQJB 2HIOA 4WU9D 5GXQB 3WTPA 3NQJA 4Z5TD 2YFVB 1KU5A 1P3KD 3WA9C 5GXQA 1M1AB 1EQZC 2HUEC 2CV5D 4WZSB 2YFVA 3C1BD 1KX4D 3W99C 4J8UC 3LELC 3AV2C 3AZEB 1M1AA 1M19C 4WNNB 3MGQC 3AZEA 5AV6C 1S32D 5C3IC 3WA9D 3MGSC 3W99D 3RELC 3UTBA 3AV2D 1P3GC 3AYWC 4Z5TB 5AV6D 4AWLB 1P3KB 3UT9D 2IO5B 3VH6A 5BT1C 2CV5B 3MGSD 4Z5TA 3C1BB 1U35D 5B1LB 1P3KA 1KX4B 2PYOC 3REJC 5GT0C 3RELD 1P3GD 3C1BA 1KX3C 2FJ7D 5B1LA 4ZBJC 1KX4A 1S32B 3AYWD 3WA9B 1EQZB 2HUEB 5BT1D 3AN2C 4J8UB 2PYOD 5BS7C 3LELB 3WA9A 3W99B 5B24D 3REJD 3AV2B 1M19B 1EQZA 5GT3A 5GT0D 1KX3D 4J8UA 3W99A 4KGCC 3LELA 3MGQB 3AV2A 5AV6B 1M19A 3AZKC 5C3IB 4CSRB 3MGQA 1M18D 3MGSB 5AV6A 2F8ND 4CSRA 4J8WD 4J8XC 3RELB 1P3GB 3MGSA 4KGCD 3RELA 1P3GA 3AYWB 3AZKD 3AYWA 4H9RB 2PYOB 1P3PC 3REJB 3MGRC 3X1SC 4J8XD 5GT0B 4H9RA 1KX3B 4ZBJB 2PYOA 3REJA 5AVBC 5GT0A 1KX3A 3B0CT 1M18B 3B0BA 2F8NB 3X1SD 3MGRD 5CPIC 4H9NA 3AN2A 1JFIB 2F8NA 4KGCB 5BS7A 3AZKB 3AFAC 5F99C 1JFIA 4ZUXC 3LZ0C 3AZKA 4J8XB 5AVCC 5CPID 5JRGD 4Z66C 4J8XA 1BH8B 3AFAD 5F99D 4WV4B 1P34A 1BH8A 2YFWB 4ZUXD 3LZ0D 1P3PB 5GXQD 3X1SB 3R45B 5B0YC 3MGRB 4EO5C 2YFWA 1P3PA 3X1SA 3MGRA 1M1AD 4Z66D 5AVBB 3TU4C 5CPJC 1P3LC 5AVBA 4DRBA 5FUGB 1BH9B 5CPIB 5B0YD 4E44A 3MGPC 5FUGA 1BH9A 4Z2MG 3UTBD 5CPIA 3AFAB 5F99B 3TU4D 5CPJD 1P3LD 4ZUXB 3LZ0B 3AZIC 3AV1C 3AFAA 5F99A 1P3BC 4XZQC 5AVCB 4ZUXA 3LZ0A 3KUYC 3MGPD 4Z66B 5GT3C 5AVCA 5B1LD 4Z66A 2F8NK 3VH5A 3REIC 3AZID 3AV1D 5G49B 1P3BD 4XZQD 5B0YB 4H9QB 4EO5B 2F8NG 3KUYD 5G49A 3UTBB 1KX5C 1EQZD 5B0YA 4H9QA 5GT3D 5B33C 3TU4B 5CPJB 1P3LB 4J8UD 5B31G 3LELD 3W98C 1M19D 3TU4A 3REID 5AV9C 5CPJA 1P3LA 5DNNC 2BYKB 3MGQD 3MGPB 2BYKA 1P3IC 1KX5D 2L5AA 4M6BA 5B33D 3MGPA 1B6WA 3W98D 4YS3C 3AZIB 3AV1B 1P3BB 2JSSA 5AV9D 4XZQB 5DNND 2AROC 3KUYB 3AZIA 3AV1A 1P3BA 4XZQA 5GT3B 1P3ID 5JA4B 3REKC 3KUYA 5E5AC 5JA4A 4YS3D 3REIB 3UTAC 5B31C 5AV8C 2AROD 3REIA 4KUDC 1KX5B 3MNNC 5B33B 3AN2D 3REKD 3AZLC 3W98B 1KX5A 5B33A 5AV9B 3KWQC 1P34C 5DNNB 5B2IC 3W98A 1B67A 5B31D 5AV8D 5AV9A 5DNNA 1HQ3C 1P3IB 4KUDD 1P3FC 1AOIC 3MNND 3AZLD 1P3IA 4YS3B 1Q9CA 3KWQD 1P34D 5B2ID 4LD9C 1WWSA 5DNMC 2AROB 4YS3A 3W97C
chains in the Genus database with same CATH superfamily
4H9NB 4HGAC 1P3FD 2AROA 3W96C 3REKB 3AN2B 1AOID 1P3PD 3O62C 5E5AB 5B32C 2BG1A 4NE3A 3REKA 3UTAB 3AZFC 5E5AA 5AV5C 5B31B 5AVBD 4LD9D 5AV8B 3VH6W 3W97D 3VH6T 3UTAA 4KUDB 5B31A 1A7WA 3MNNB 5AV8A 3MVDC 3AZLB 4KUDA 5B32D 3AZHC 3MNNA 5CPKC 3AZLA 3KWQB 1P34B 5B2IB 3AZFD 1ZLAC 2RVQC 5B2JC 1N1JB 3KWQA 5B2IA 3AL0C 1P3FB 3A6NC 1AOIB 4WJ3C 2DQNC 3MVDD 1N1JA 1BFMA 1HQ3A 1P3FA 5AVCD 3AZHD 1AOIA 5CPKD 2NQBC 4H9PB 3X1TC 4LD9B 3B6FC 2RVQD 5DNMB 2NZDA 3W97B 2BYMB 4H9PA 1ID3C 4LD9A 4HGAB 5DNMA 3W97A 3WTPE 3A6ND 3W96B 2BYMA 3LJAC 3O62B 5B32B 3AZGC 3W96A 4H9OB 3KSYA 2NQBD 3AZFB 1HTAA 3O62A 5B32A 5AV5B 3AZMC 3X1TD 3B6FD 4H9OA 3AZFA 3EPJA 1ID3D 5AV5A 5BNXB 3V9RB 1P3OC 3MVDB 3AZJC 4H9SC 3LJAD 3AZHB 5BNXA 3V9RA 4DRAA 3MVDA 3AZGD 5CPKB 2Y2PA 4CAYB 3AZMD 3AZHA 5B2JB 5CPKA 1F66C 4WU9C 4QLCC 2LY8A 1ZLAA 3P5JB 4CAYA 3A6NB 1P3OD 3WKJC 5B2JA 2Y2GA 5B1MC 4X23C 3C1CC 1P3MC 5BO0B 3A6NA 3X1VC 4UUZB 2NQBB 3X1TB 1R4VA 2Y2IA 3X1UC 5BO0A 3B6FB 4UUZA 1F66D 2NQBA 1ID3B 4QLCD 1PZRA 3X1TA 3B6FA 1S32C 3WKJD 3LJAB 5B1MD 1ID3A 4X23D 3C1CD 3AZGB 1P3MD 3X1VD 3LJAA 3AZMB 4NE6A 3X1UD 3AZGA 2ZY4A 3AZMA 1P3OB 3AZJB 3UT9C 2UWXA 4WNNA 3AZNC 1U35C 1P3OA 3AZJA 4H9SA 1WWIA 2JCHA 4XUJC 2FJ7C 1F66B 4WU9B 4QLCB 5KDMB 3WKJB 1F66A 5B1MB 3EPKA 4WU9A 4QLCA 4X23B 3C1CB 1ULYA 3AZND 1P3MB 1TAFB 5KDMA 5B32G 3X1VB 3WKJA 5B1MA 1P3AC 5B24C 4X23A 3C1CA 2CV5A 3X1UB 1P3MA 3NQUB 1TAFA 4XUJD 3X1VA 5E5AD 4YM6C 3X1UA 3NQUA 4J8VC 3UTAD 4E45A 4WU8C 1M18C 3LZ1C 1S32A 5B40C 4J8WC 1P3AD 4NFTA 4G91C 3VH5W 3VH5T 4YM6D 2NZDC 1H3OB 4KHAB 3WAAC 4R8PC 4J8VD 3UT9B 4WU8D 3AZNB 1U35B 3LZ1D 1H3OA 4KHAA 3UT9A 4NE5A 5B40D 1HQ3D 2ZM5A 3AZNA 1U35A 2FJ7B 4XUJB 3H0RC 2NZDD 2FJ7A 4XUJA 3WAAD 4R8PD 5CP6C 3KFUG 5DNMD 4G92C 3KXBC 1P3AB 4JJNC 2CWEA 5B24B 3W96D 1TZYC 1P3AA 3O62D 2ZY5A 5B24A 5AY8C 4YM6B 3B0CW 4J8VB 2RIQA 5GSUC 4WU8B 4YM6A 5CP6D 3B0DC 5AV5D 3LZ1B 3B6GC 5B0ZC 4J8VA 5B40B 4J8WB 1HQ3B 4WU8A 3KXBD 4JJND 1M18A 3LZ1A 5JRGC 3REHC 4G91B 3A1IA 5B40A 1TZYD 4J8WA 2NZDB 5AY8D 2HIOC 3WAAB 4R8PB 5GSUD 3WTPC 2JE5A 1ZLAD 4KGCA 3B6GD 5B2JD 5B0ZD 3WAAA 4R8PA 5GXQC 5BNVB 2Y2JA 3REHD 1M1AC 5BNVA 5CHLB 2HIOD 5CP6B 4Z2MH 3WTPD 3AZEC 4G92B 3KXBB 4JJNB 5CP6A 1TZYB 3KXBA 4JJNA 3UTBC 3R45A 5AY8B 2G5HC 5GSUB 1TZYA 1ZLAB 3B6GB 3B0DB 5AY8A 3AZED 5B0ZB 5GSUA 2XD5A 3B6GA 4Z5TC 4AWLC 5JRGB 1P3KC 5B0ZA 3REHB 3AZJD 2IO5C 2CV5C 2F8NH 3C1BC 5JRGA 5B1LC 3REHA 1KX4C 2HIOB 1F1EA 3WTPB 2G5IC 2ZY2A 3NQJB 2HIOA 4WU9D 5GXQB 3WTPA 3NQJA 4Z5TD 2YFVB 1KU5A 1P3KD 3WA9C 5GXQA 1M1AB 1EQZC 2HUEC 2CV5D 4WZSB 3EPLA 2YFVA 3C1BD 1KX4D 3W99C 4J8UC 3LELC 3AV2C 3AZEB 2J8PA 1M19C 1M1AA 4WNNB 3MGQC 3AZEA 5AV6C 1S32D 5C3IC 3WA9D 2Y2QA 3MGSC 3W99D 3RELC 2Y2OA 3UTBA 3AV2D 1P3GC 2Y2MA 3AYWC 4Z5TB 5AV6D 4AWLB 1P3KB 3UT9D 2IO5B 3VH6A 5BT1C 2CV5B 3MGSD 4Z5TA 3C1BB 1W2EA 5B1LB 1U35D 1P3KA 1KX4B 2PYOC 3REJC 2Y2HA 5GT0C 3RELD 1P3GD 3C1BA 1KX3C 2FJ7D 5B1LA 4ZBJC 1KX4A 1S32B 3AYWD 3WA9B 2Y2NA 1EQZB 2HUEB 5BT1D 3AN2C 4J8UB 2PYOD 5BS7C 3LELB 3WA9A 3W99B 5B24D 3REJD 3AV2B 1M19B 1EQZA 5GT3A 5GT0D 1KX3D 4J8UA 3W99A 4KGCC 3LELA 3MGQB 3AV2A 5AV6B 1M19A 3FDDA 3AZKC 5C3IB 4CSRB 3MGQA 1M18D 3MGSB 5AV6A 2F8ND 4CSRA 4J8WD 4J8XC 3RELB 1P3GB 3MGSA 4KGCD 3RELA 2XD1A 1P3GA 3AYWB 3AZKD 3AYWA 4H9RB 2PYOB 1P3PC 3REJB 3H0LC 3MGRC 3X1SC 4J8XD 5GT0B 4H9RA 1KX3B 4ZBJB 2PYOA 3REJA 5AVBC 5GT0A 1KX3A 3B0CT 2DF4C 1M18B 3B0BA 2Y2LA 2F8NB 3X1SD 3MGRD 5CPIC 4H9NA 3AN2A 1JFIB 2F8NA 4KGCB 5BS7A 3AZKB 3AFAC 5F99C 1JFIA 2Y2KA 4ZUXC 3LZ0C 3AZKA 4J8XB 5AVCC 5CPID 5JRGD 4UPKA 4Z66C 4J8XA 1BH8B 2W8SA 3AFAD 5F99D 4WV4B 1P34A 1BH8A 2YFWB 3A1KA 4ZUXD 3LZ0D 1P3PB 2ZY3A 5GXQD 3R45B 5B0YC 3X1SB 4EO5C 2YFWA 3MGRB 1P3PA 3X1SA 3MGRA 1M1AD 4Z66D 5AVBB 3TU4C 5CPJC 1P3LC 1T3UA 5AVBA 2VQRA 4DRBA 5FUGB 1BH9B 5CPIB 5B0YD 4E44A 3MGPC 5FUGA 1BH9A 4Z2MG 3UTBD 5CPIA 3AFAB 5F99B 3TU4D 5CPJD 1P3LD 4ZUXB 3LZ0B 3AZIC 3AV1C 3AFAA 5F99A 1P3BC 4XZQC 5AVCB 4ZUXA 3LZ0A 3KUYC 1Z2CB 3MGPD 4Z66B 5GT3C 5AVCA 5B1LD 4Z66A 2F8NK 3VH5A 3REIC 3AZID 3AV1D 5G49B 1P3BD 4XZQD 5B0YB 4H9QB 4EO5B 2F8NG 3KUYD 5G49A 3UTBB 1KX5C 1EQZD 5B0YA 4H9QA 5GT3D 5B33C 3TU4B 5CPJB 1P3LB 4J8UD 5B31G 3LELD 3W98C 4DQYB 1M19D 3TU4A 3REID 5AV9C 5CPJA 1P3LA 5DNNC 2BYKB 3MGQD 3MGPB 2BYKA 1P3IC 1KX5D 2L5AA 4M6BA 5B33D 3MGPA 1B6WA 3W98D 4YS3C 3AZIB 3AV1B 1P3BB 2JSSA 5AV9D 4XZQB 5DNND 2AROC 3KUYB 3AZIA 3AV1A 1P3BA 4XZQA 5GT3B 1P3ID 3IP4C 5JA4B 3REKC 2FFFB 3KUYA 5E5AC 3EPHA 3EG5B 5JA4A 4YS3D 3REIB 3UTAC 5B31C 5AV8C 3F6TA 2AROD 3REIA 4KUDC 1KX5B 3MNNC 5B33B 3AN2D 3REKD 3AZLC 3W98B 1KX5A 5B33A 5AV9B 3KWQC 1P34C 5DNNB 5B2IC 3W98A 1B67A 5B31D 5AV8D 5AV9A 2F2AC 5DNNA 1HQ3C 1P3IB 4KUDD 1P3FC 1AOIC 3MNND 3AZLD 1P3IA 3H0MC 4YS3B 1Q9CA 3KWQD 1P34D 5B2ID 4LD9C 1WWSA 5DNMC 2AROB 4YS3A 3W97C
chains in the Genus database with same CATH topology
4H9NB 4HGAC 1P3FD 2AROA 3W96C 3REKB 3AN2B 1AOID 1P3PD 3O62C 5E5AB 5B32C 2BG1A 4NE3A 3REKA 3UTAB 3AZFC 5E5AA 5AV5C 5B31B 5AVBD 4LD9D 5AV8B 3VH6W 3W97D 3VH6T 3UTAA 4KUDB 5B31A 1A7WA 3MNNB 5AV8A 3MVDC 3AZLB 4KUDA 5B32D 3AZHC 3MNNA 5CPKC 3AZLA 3KWQB 1P34B 5B2IB 3AZFD 1ZLAC 2RVQC 5B2JC 1N1JB 3KWQA 5B2IA 3AL0C 1P3FB 3A6NC 1AOIB 4WJ3C 2DQNC 3MVDD 1N1JA 1BFMA 1HQ3A 1P3FA 5AVCD 3AZHD 1AOIA 5CPKD 2NQBC 4H9PB 3X1TC 4LD9B 3B6FC 2RVQD 5DNMB 2NZDA 3W97B 2BYMB 4H9PA 1ID3C 4LD9A 4HGAB 5DNMA 3W97A 3WTPE 3A6ND 3W96B 2BYMA 3LJAC 3O62B 5B32B 3AZGC 3W96A 4H9OB 3KSYA 2NQBD 3AZFB 1HTAA 3O62A 5B32A 5AV5B 3AZMC 3X1TD 3B6FD 4H9OA 3AZFA 3EPJA 1ID3D 5AV5A 5BNXB 3V9RB 1P3OC 3MVDB 3AZJC 4H9SC 3LJAD 3AZHB 5BNXA 3V9RA 4DRAA 3MVDA 3AZGD 5CPKB 2Y2PA 4CAYB 3AZMD 3AZHA 5B2JB 5CPKA 1F66C 4WU9C 4QLCC 2LY8A 1ZLAA 3P5JB 4CAYA 3A6NB 1P3OD 3WKJC 5B2JA 2Y2GA 5B1MC 4X23C 3C1CC 1P3MC 5BO0B 3A6NA 3X1VC 4UUZB 2NQBB 3X1TB 1R4VA 2Y2IA 3X1UC 5BO0A 3B6FB 4UUZA 1F66D 2NQBA 1ID3B 4QLCD 1PZRA 3X1TA 3B6FA 1S32C 3WKJD 3LJAB 5B1MD 1ID3A 4X23D 3C1CD 3AZGB 1P3MD 3X1VD 3LJAA 3AZMB 4NE6A 3X1UD 3AZGA 2ZY4A 3AZMA 1P3OB 3AZJB 3UT9C 2UWXA 4WNNA 3AZNC 1U35C 1P3OA 3AZJA 4H9SA 1WWIA 2JCHA 4XUJC 2FJ7C 1F66B 4WU9B 4QLCB 5KDMB 3WKJB 1F66A 5B1MB 3EPKA 4WU9A 4QLCA 4X23B 3C1CB 1ULYA 3AZND 1P3MB 1TAFB 5KDMA 5B32G 3X1VB 3WKJA 5B1MA 1P3AC 5B24C 4X23A 3C1CA 2CV5A 3X1UB 1P3MA 3NQUB 1TAFA 4XUJD 3X1VA 5E5AD 4YM6C 3X1UA 3NQUA 4J8VC 3UTAD 4E45A 4WU8C 1M18C 3LZ1C 1S32A 5B40C 4J8WC 1P3AD 4NFTA 4G91C 3VH5W 3VH5T 4YM6D 2NZDC 1H3OB 4KHAB 3WAAC 4R8PC 4J8VD 3UT9B 4WU8D 3AZNB 1U35B 3LZ1D 1H3OA 4KHAA 3UT9A 4NE5A 5B40D 1HQ3D 2ZM5A 3AZNA 1U35A 2FJ7B 4XUJB 3H0RC 2NZDD 2FJ7A 4XUJA 3WAAD 4R8PD 5CP6C 3KFUG 5DNMD 4G92C 3KXBC 1P3AB 4JJNC 2CWEA 5B24B 3W96D 1TZYC 1P3AA 3O62D 2ZY5A 5B24A 5AY8C 4YM6B 3B0CW 4J8VB 2RIQA 5GSUC 4WU8B 4YM6A 5CP6D 3B0DC 5AV5D 3LZ1B 3B6GC 5B0ZC 4J8VA 5B40B 4J8WB 1HQ3B 4WU8A 3KXBD 4JJND 1M18A 3LZ1A 5JRGC 3REHC 4G91B 3A1IA 5B40A 1TZYD 4J8WA 2NZDB 5AY8D 2HIOC 3WAAB 4R8PB 5GSUD 3WTPC 2JE5A 1ZLAD 4KGCA 3B6GD 5B2JD 5B0ZD 3WAAA 4R8PA 5GXQC 5BNVB 2Y2JA 3REHD 1M1AC 5BNVA 5CHLB 2HIOD 5CP6B 4Z2MH 3WTPD 3AZEC 4G92B 3KXBB 4JJNB 5CP6A 1TZYB 3KXBA 4JJNA 3UTBC 3R45A 5AY8B 2G5HC 5GSUB 1TZYA 1ZLAB 3B6GB 3B0DB 5AY8A 3AZED 5B0ZB 5GSUA 2XD5A 3B6GA 4Z5TC 4AWLC 5JRGB 1P3KC 5B0ZA 3REHB 3AZJD 2IO5C 2CV5C 2F8NH 3C1BC 5JRGA 5B1LC 3REHA 1KX4C 2HIOB 1F1EA 3WTPB 2G5IC 2ZY2A 3NQJB 2HIOA 4WU9D 5GXQB 3WTPA 3NQJA 4Z5TD 2YFVB 1KU5A 1P3KD 3WA9C 5GXQA 1M1AB 1EQZC 2HUEC 2CV5D 4WZSB 3EPLA 2YFVA 3C1BD 1KX4D 3W99C 4J8UC 3LELC 3AV2C 3AZEB 2J8PA 1M19C 1M1AA 4WNNB 3MGQC 3AZEA 5AV6C 1S32D 5C3IC 3WA9D 2Y2QA 3MGSC 3W99D 3RELC 2Y2OA 3UTBA 3AV2D 1P3GC 2Y2MA 3AYWC 4Z5TB 5AV6D 4AWLB 1P3KB 3UT9D 2IO5B 3VH6A 5BT1C 2CV5B 3MGSD 4Z5TA 3C1BB 1W2EA 5B1LB 1U35D 1P3KA 1KX4B 2PYOC 3REJC 2Y2HA 5GT0C 3RELD 1P3GD 3C1BA 1KX3C 2FJ7D 5B1LA 4ZBJC 1KX4A 1S32B 3AYWD 3WA9B 2Y2NA 1EQZB 2HUEB 5BT1D 3AN2C 4J8UB 2PYOD 5BS7C 3LELB 3WA9A 3W99B 5B24D 3REJD 3AV2B 1M19B 1EQZA 5GT3A 5GT0D 1KX3D 4J8UA 3W99A 4KGCC 3LELA 3MGQB 3AV2A 5AV6B 1M19A 3FDDA 3AZKC 5C3IB 4CSRB 3MGQA 1M18D 3MGSB 5AV6A 2F8ND 4CSRA 4J8WD 4J8XC 3RELB 1P3GB 3MGSA 4KGCD 3RELA 2XD1A 1P3GA 3AYWB 3AZKD 3AYWA 4H9RB 2PYOB 1P3PC 3REJB 3H0LC 3MGRC 3X1SC 4J8XD 5GT0B 4H9RA 1KX3B 4ZBJB 2PYOA 3REJA 5AVBC 5GT0A 1KX3A 3B0CT 2DF4C 1M18B 3B0BA 2Y2LA 2F8NB 3X1SD 3MGRD 5CPIC 4H9NA 3AN2A 1JFIB 2F8NA 4KGCB 5BS7A 3AZKB 3AFAC 5F99C 1JFIA 2Y2KA 4ZUXC 3LZ0C 3AZKA 4J8XB 5AVCC 5CPID 5JRGD 4UPKA 4Z66C 4J8XA 1BH8B 2W8SA 3AFAD 5F99D 4WV4B 1P34A 1BH8A 2YFWB 3A1KA 4ZUXD 3LZ0D 1P3PB 2ZY3A 5GXQD 3R45B 5B0YC 3X1SB 4EO5C 2YFWA 3MGRB 1P3PA 3X1SA 3MGRA 1M1AD 4Z66D 5AVBB 3TU4C 5CPJC 1P3LC 1T3UA 5AVBA 2VQRA 4DRBA 5FUGB 1BH9B 5CPIB 5B0YD 4E44A 3MGPC 5FUGA 1BH9A 4Z2MG 3UTBD 5CPIA 3AFAB 5F99B 3TU4D 5CPJD 1P3LD 4ZUXB 3LZ0B 3AZIC 3AV1C 3AFAA 5F99A 1P3BC 4XZQC 5AVCB 4ZUXA 3LZ0A 3KUYC 1Z2CB 3MGPD 4Z66B 5GT3C 5AVCA 5B1LD 4Z66A 2F8NK 3VH5A 3REIC 3AZID 3AV1D 5G49B 1P3BD 4XZQD 5B0YB 4H9QB 4EO5B 2F8NG 3KUYD 5G49A 3UTBB 1KX5C 1EQZD 5B0YA 4H9QA 5GT3D 5B33C 3TU4B 5CPJB 1P3LB 4J8UD 5B31G 3LELD 3W98C 4DQYB 1M19D 3TU4A 3REID 5AV9C 5CPJA 1P3LA 5DNNC 2BYKB 3MGQD 3MGPB 2BYKA 1P3IC 1KX5D 2L5AA 4M6BA 5B33D 3MGPA 1B6WA 3W98D 4YS3C 3AZIB 3AV1B 1P3BB 2JSSA 5AV9D 4XZQB 5DNND 2AROC 3KUYB 3AZIA 3AV1A 1P3BA 4XZQA 5GT3B 1P3ID 3IP4C 5JA4B 3REKC 2FFFB 3KUYA 5E5AC 3EPHA 3EG5B 5JA4A 4YS3D 3REIB 3UTAC 5B31C 5AV8C 3F6TA 2AROD 3REIA 4KUDC 1KX5B 3MNNC 5B33B 3AN2D 3REKD 3AZLC 3W98B 1KX5A 5B33A 5AV9B 3KWQC 1P34C 5DNNB 5B2IC 3W98A 1B67A 5B31D 5AV8D 5AV9A 2F2AC 5DNNA 1HQ3C 1P3IB 4KUDD 1P3FC 1AOIC 3MNND 3AZLD 1P3IA 3H0MC 4YS3B 1Q9CA 3KWQD 1P34D 5B2ID 4LD9C 1WWSA 5DNMC 2AROB 4YS3A 3W97C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N B;  4HGA C;  1P3F D;  2ARO A;  3W96 C;  3REK B;  3AN2 B;  1AOI D;  1P3P D;  3O62 C;  5E5A B;  5B32 C;  4NE3 A;  3REK A;  3UTA B;  3AZF C;  5E5A A;  5AV5 C;  5B31 B;  5AVB D;  4LD9 D;  5AV8 B;  3VH6 W;  3W97 D;  3VH6 T;  3UTA A;  4KUD B;  5B31 A;  1A7W A;  3MNN B;  5AV8 A;  3MVD C;  3AZL B;  4KUD A;  5B32 D;  3AZH C;  3MNN A;  5CPK C;  3AZL A;  3KWQ B;  1P34 B;  5B2I B;  3AZF D;  1ZLA C;  2RVQ C;  5B2J C;  1N1J B;  3KWQ A;  5B2I A;  1P3F B;  3A6N C;  1AOI B;  3MVD D;  1N1J A;  1BFM A;  1HQ3 A;  1P3F A;  5AVC D;  3AZH D;  1AOI A;  5CPK D;  2NQB C;  4H9P B;  3X1T C;  4LD9 B;  3B6F C;  2RVQ D;  5DNM B;  2NZD A;  3W97 B;  2BYM B;  4H9P A;  1ID3 C;  4LD9 A;  4HGA B;  5DNM A;  3W97 A;  3WTP E;  3A6N D;  3W96 B;  2BYM A;  3LJA C;  3O62 B;  5B32 B;  3AZG C;  3W96 A;  4H9O B;  3KSY A;  2NQB D;  3AZF B;  1HTA A;  3O62 A;  5B32 A;  5AV5 B;  3AZM C;  3X1T D;  3B6F D;  4H9O A;  3AZF A;  1ID3 D;  5AV5 A;  5BNX B;  3V9R B;  1P3O C;  3MVD B;  3AZJ C;  4H9S C;  3LJA D;  3AZH B;  5BNX A;  3V9R A;  4DRA A;  3MVD A;  3AZG D;  5CPK B;  4CAY B;  3AZM D;  3AZH A;  5B2J B;  5CPK A;  1F66 C;  4WU9 C;  4QLC C;  2LY8 A;  1ZLA A;  4CAY A;  3A6N B;  1P3O D;  3WKJ C;  5B2J A;  5B1M C;  4X23 C;  3C1C C;  1P3M C;  5BO0 B;  3A6N A;  3X1V C;  4UUZ B;  2NQB B;  3X1T B;  1R4V A;  3X1U C;  3B6F B;  5BO0 A;  4UUZ A;  1F66 D;  2NQB A;  1ID3 B;  4QLC D;  3X1T A;  3B6F A;  1S32 C;  3WKJ D;  3LJA B;  5B1M D;  1ID3 A;  4X23 D;  3C1C D;  3AZG B;  1P3M D;  3X1V D;  3LJA A;  3AZM B;  4NE6 A;  3X1U D;  3AZG A;  3AZM A;  1P3O B;  3AZJ B;  3UT9 C;  4WNN A;  3AZN C;  1U35 C;  1P3O A;  3AZJ A;  4H9S A;  1WWI A;  2FJ7 C;  4XUJ C;  1F66 B;  4WU9 B;  4QLC B;  5KDM B;  3WKJ B;  1F66 A;  5B1M B;  4WU9 A;  4QLC A;  4X23 B;  3C1C B;  1ULY A;  3AZN D;  1P3M B;  1TAF B;  5KDM A;  5B32 G;  3X1V B;  3WKJ A;  5B1M A;  1P3A C;  5B24 C;  4X23 A;  3C1C A;  2CV5 A;  3X1U B;  1P3M A;  3NQU B;  1TAF A;  4XUJ D;  3X1V A;  5E5A D;  4YM6 C;  3X1U A;  3NQU A;  4J8V C;  3UTA D;  4E45 A;  4WU8 C;  1M18 C;  3LZ1 C;  1S32 A;  5B40 C;  4J8W C;  1P3A D;  4NFT A;  4G91 C;  3VH5 W;  3VH5 T;  4YM6 D;  2NZD C;  1H3O B;  4KHA B;  3WAA C;  4R8P C;  4J8V D;  3UT9 B;  4WU8 D;  3AZN B;  1U35 B;  3LZ1 D;  1H3O A;  4KHA A;  3UT9 A;  4NE5 A;  5B40 D;  1HQ3 D;  3AZN A;  1U35 A;  2FJ7 B;  4XUJ B;  2NZD D;  2FJ7 A;  4XUJ A;  3WAA D;  4R8P D;  5CP6 C;  5DNM D;  4G92 C;  3KXB C;  1P3A B;  4JJN C;  2CWE A;  5B24 B;  3W96 D;  1TZY C;  1P3A A;  3O62 D;  5B24 A;  4YM6 B;  5AY8 C;  3B0C W;  4J8V B;  5GSU C;  4WU8 B;  4YM6 A;  5CP6 D;  3B0D C;  5AV5 D;  3LZ1 B;  3B6G C;  5B0Z C;  4J8V A;  5B40 B;  4J8W B;  1HQ3 B;  4WU8 A;  3KXB D;  4JJN D;  1M18 A;  3LZ1 A;  5JRG C;  3REH C;  4G91 B;  5B40 A;  4J8W A;  1TZY D;  2NZD B;  5AY8 D;  2HIO C;  3WAA B;  4R8P B;  5GSU D;  3WTP C;  4KGC A;  1ZLA D;  3B6G D;  5B2J D;  5B0Z D;  3WAA A;  4R8P A;  5GXQ C;  5BNV B;  3REH D;  1M1A C;  5BNV A;  5CHL B;  2HIO D;  5CP6 B;  4Z2M H;  3WTP D;  3AZE C;  4G92 B;  3KXB B;  4JJN B;  5CP6 A;  1TZY B;  3KXB A;  4JJN A;  3UTB C;  3R45 A;  5AY8 B;  5GSU B;  1TZY A;  1ZLA B;  3B6G B;  3B0D B;  5AY8 A;  3AZE D;  5B0Z B;  5GSU A;  3B6G A;  4Z5T C;  4AWL C;  5JRG B;  1P3K C;  5B0Z A;  3REH B;  3AZJ D;  2IO5 C;  2CV5 C;  2F8N H;  3C1B C;  5JRG A;  5B1L C;  3REH A;  1KX4 C;  2HIO B;  1F1E A;  3WTP B;  3NQJ B;  2HIO A;  4WU9 D;  5GXQ B;  3WTP A;  3NQJ A;  4Z5T D;  2YFV B;  1KU5 A;  1P3K D;  3WA9 C;  5GXQ A;  1M1A B;  1EQZ C;  2HUE C;  2CV5 D;  4WZS B;  2YFV A;  3C1B D;  1KX4 D;  3W99 C;  4J8U C;  3LEL C;  3AV2 C;  3AZE B;  1M1A A;  1M19 C;  4WNN B;  3MGQ C;  3AZE A;  5AV6 C;  1S32 D;  5C3I C;  3WA9 D;  3MGS C;  3W99 D;  3REL C;  3UTB A;  3AV2 D;  1P3G C;  3AYW C;  4Z5T B;  5AV6 D;  4AWL B;  1P3K B;  3UT9 D;  2IO5 B;  3VH6 A;  5BT1 C;  2CV5 B;  3MGS D;  4Z5T A;  3C1B B;  1U35 D;  5B1L B;  1P3K A;  1KX4 B;  2PYO C;  3REJ C;  5GT0 C;  3REL D;  1P3G D;  3C1B A;  1KX3 C;  2FJ7 D;  5B1L A;  4ZBJ C;  1KX4 A;  1S32 B;  3AYW D;  3WA9 B;  1EQZ B;  2HUE B;  5BT1 D;  3AN2 C;  4J8U B;  2PYO D;  5BS7 C;  3LEL B;  3WA9 A;  3W99 B;  5B24 D;  3REJ D;  3AV2 B;  1M19 B;  1EQZ A;  5GT3 A;  5GT0 D;  1KX3 D;  4J8U A;  3W99 A;  4KGC C;  3LEL A;  3MGQ B;  3AV2 A;  5AV6 B;  1M19 A;  3AZK C;  5C3I B;  4CSR B;  3MGQ A;  1M18 D;  3MGS B;  5AV6 A;  2F8N D;  4CSR A;  4J8W D;  4J8X C;  3REL B;  1P3G B;  3MGS A;  4KGC D;  3REL A;  1P3G A;  3AYW B;  3AZK D;  3AYW A;  4H9R B;  2PYO B;  1P3P C;  3REJ B;  3MGR C;  3X1S C;  4J8X D;  5GT0 B;  4H9R A;  1KX3 B;  4ZBJ B;  2PYO A;  3REJ A;  5AVB C;  5GT0 A;  1KX3 A;  3B0C T;  1M18 B;  3B0B A;  2F8N B;  3X1S D;  3MGR D;  5CPI C;  4H9N A;  3AN2 A;  1JFI B;  2F8N A;  4KGC B;  5BS7 A;  3AZK B;  3AFA C;  5F99 C;  1JFI A;  4ZUX C;  3LZ0 C;  3AZK A;  4J8X B;  5AVC C;  5CPI D;  5JRG D;  4Z66 C;  4J8X A;  1BH8 B;  3AFA D;  5F99 D;  4WV4 B;  1P34 A;  1BH8 A;  2YFW B;  4ZUX D;  3LZ0 D;  1P3P B;  5GXQ D;  3X1S B;  3R45 B;  5B0Y C;  3MGR B;  4EO5 C;  2YFW A;  1P3P A;  3X1S A;  3MGR A;  1M1A D;  4Z66 D;  5AVB B;  3TU4 C;  5CPJ C;  1P3L C;  5AVB A;  4DRB A;  5FUG B;  1BH9 B;  5CPI B;  5B0Y D;  4E44 A;  3MGP C;  5FUG A;  1BH9 A;  4Z2M G;  3UTB D;  5CPI A;  3AFA B;  5F99 B;  3TU4 D;  5CPJ D;  1P3L D;  4ZUX B;  3LZ0 B;  3AZI C;  3AV1 C;  3AFA A;  5F99 A;  1P3B C;  4XZQ C;  5AVC B;  4ZUX A;  3LZ0 A;  3KUY C;  3MGP D;  4Z66 B;  5GT3 C;  5AVC A;  5B1L D;  4Z66 A;  2F8N K;  3VH5 A;  3REI C;  3AZI D;  3AV1 D;  5G49 B;  1P3B D;  4XZQ D;  5B0Y B;  4H9Q B;  4EO5 B;  2F8N G;  3KUY D;  5G49 A;  3UTB B;  1KX5 C;  1EQZ D;  5B0Y A;  4H9Q A;  5GT3 D;  5B33 C;  3TU4 B;  5CPJ B;  1P3L B;  4J8U D;  5B31 G;  3LEL D;  3W98 C;  1M19 D;  3TU4 A;  3REI D;  5AV9 C;  5CPJ A;  1P3L A;  5DNN C;  2BYK B;  3MGQ D;  3MGP B;  2BYK A;  1P3I C;  1KX5 D;  2L5A A;  4M6B A;  5B33 D;  3MGP A;  1B6W A;  3W98 D;  4YS3 C;  3AZI B;  3AV1 B;  1P3B B;  2JSS A;  5AV9 D;  4XZQ B;  5DNN D;  2ARO C;  3KUY B;  3AZI A;  3AV1 A;  1P3B A;  4XZQ A;  5GT3 B;  1P3I D;  5JA4 B;  3REK C;  3KUY A;  5E5A C;  5JA4 A;  4YS3 D;  3REI B;  3UTA C;  5B31 C;  5AV8 C;  2ARO D;  3REI A;  4KUD C;  1KX5 B;  3MNN C;  5B33 B;  3AN2 D;  3REK D;  3AZL C;  3W98 B;  1KX5 A;  5B33 A;  5AV9 B;  3KWQ C;  1P34 C;  5DNN B;  5B2I C;  3W98 A;  1B67 A;  5B31 D;  5AV8 D;  5AV9 A;  5DNN A;  1HQ3 C;  1P3I B;  4KUD D;  1P3F C;  1AOI C;  3MNN D;  3AZL D;  1P3I A;  4YS3 B;  1Q9C A;  3KWQ D;  1P34 D;  5B2I D;  4LD9 C;  1WWS A;  5DNM C;  2ARO B;  4YS3 A;  3W97 C; 
#chains in the Genus database with same CATH topology
 4H9N B;  4HGA C;  1P3F D;  2ARO A;  3W96 C;  3REK B;  3AN2 B;  1AOI D;  1P3P D;  3O62 C;  5E5A B;  5B32 C;  2BG1 A;  4NE3 A;  3REK A;  3UTA B;  3AZF C;  5E5A A;  5AV5 C;  5B31 B;  5AVB D;  4LD9 D;  5AV8 B;  3VH6 W;  3W97 D;  3VH6 T;  3UTA A;  4KUD B;  5B31 A;  1A7W A;  3MNN B;  5AV8 A;  3MVD C;  3AZL B;  4KUD A;  5B32 D;  3AZH C;  3MNN A;  5CPK C;  3AZL A;  3KWQ B;  1P34 B;  5B2I B;  3AZF D;  1ZLA C;  2RVQ C;  5B2J C;  1N1J B;  3KWQ A;  5B2I A;  3AL0 C;  1P3F B;  3A6N C;  1AOI B;  4WJ3 C;  2DQN C;  3MVD D;  1N1J A;  1BFM A;  1HQ3 A;  1P3F A;  5AVC D;  3AZH D;  1AOI A;  5CPK D;  2NQB C;  4H9P B;  3X1T C;  4LD9 B;  3B6F C;  2RVQ D;  5DNM B;  2NZD A;  3W97 B;  2BYM B;  4H9P A;  1ID3 C;  4LD9 A;  4HGA B;  5DNM A;  3W97 A;  3WTP E;  3A6N D;  3W96 B;  2BYM A;  3LJA C;  3O62 B;  5B32 B;  3AZG C;  3W96 A;  4H9O B;  3KSY A;  2NQB D;  3AZF B;  1HTA A;  3O62 A;  5B32 A;  5AV5 B;  3AZM C;  3X1T D;  3B6F D;  4H9O A;  3AZF A;  3EPJ A;  1ID3 D;  5AV5 A;  5BNX B;  3V9R B;  1P3O C;  3MVD B;  3AZJ C;  4H9S C;  3LJA D;  3AZH B;  5BNX A;  3V9R A;  4DRA A;  3MVD A;  3AZG D;  5CPK B;  2Y2P A;  4CAY B;  3AZM D;  3AZH A;  5B2J B;  5CPK A;  1F66 C;  4WU9 C;  4QLC C;  2LY8 A;  1ZLA A;  3P5J B;  4CAY A;  3A6N B;  1P3O D;  3WKJ C;  5B2J A;  2Y2G A;  5B1M C;  4X23 C;  3C1C C;  1P3M C;  5BO0 B;  3A6N A;  3X1V C;  4UUZ B;  2NQB B;  3X1T B;  1R4V A;  2Y2I A;  3X1U C;  5BO0 A;  3B6F B;  4UUZ A;  1F66 D;  2NQB A;  1ID3 B;  4QLC D;  1PZR A;  3X1T A;  3B6F A;  1S32 C;  3WKJ D;  3LJA B;  5B1M D;  1ID3 A;  4X23 D;  3C1C D;  3AZG B;  1P3M D;  3X1V D;  3LJA A;  3AZM B;  4NE6 A;  3X1U D;  3AZG A;  2ZY4 A;  3AZM A;  1P3O B;  3AZJ B;  3UT9 C;  2UWX A;  4WNN A;  3AZN C;  1U35 C;  1P3O A;  3AZJ A;  4H9S A;  1WWI A;  2JCH A;  4XUJ C;  2FJ7 C;  1F66 B;  4WU9 B;  4QLC B;  5KDM B;  3WKJ B;  1F66 A;  5B1M B;  3EPK A;  4WU9 A;  4QLC A;  4X23 B;  3C1C B;  1ULY A;  3AZN D;  1P3M B;  1TAF B;  5KDM A;  5B32 G;  3X1V B;  3WKJ A;  5B1M A;  1P3A C;  5B24 C;  4X23 A;  3C1C A;  2CV5 A;  3X1U B;  1P3M A;  3NQU B;  1TAF A;  4XUJ D;  3X1V A;  5E5A D;  4YM6 C;  3X1U A;  3NQU A;  4J8V C;  3UTA D;  4E45 A;  4WU8 C;  1M18 C;  3LZ1 C;  1S32 A;  5B40 C;  4J8W C;  1P3A D;  4NFT A;  4G91 C;  3VH5 W;  3VH5 T;  4YM6 D;  2NZD C;  1H3O B;  4KHA B;  3WAA C;  4R8P C;  4J8V D;  3UT9 B;  4WU8 D;  3AZN B;  1U35 B;  3LZ1 D;  1H3O A;  4KHA A;  3UT9 A;  4NE5 A;  5B40 D;  1HQ3 D;  2ZM5 A;  3AZN A;  1U35 A;  2FJ7 B;  4XUJ B;  3H0R C;  2NZD D;  2FJ7 A;  4XUJ A;  3WAA D;  4R8P D;  5CP6 C;  3KFU G;  5DNM D;  4G92 C;  3KXB C;  1P3A B;  4JJN C;  2CWE A;  5B24 B;  3W96 D;  1TZY C;  1P3A A;  3O62 D;  2ZY5 A;  5B24 A;  5AY8 C;  4YM6 B;  3B0C W;  4J8V B;  2RIQ A;  5GSU C;  4WU8 B;  4YM6 A;  5CP6 D;  3B0D C;  5AV5 D;  3LZ1 B;  3B6G C;  5B0Z C;  4J8V A;  5B40 B;  4J8W B;  1HQ3 B;  4WU8 A;  3KXB D;  4JJN D;  1M18 A;  3LZ1 A;  5JRG C;  3REH C;  4G91 B;  3A1I A;  5B40 A;  1TZY D;  4J8W A;  2NZD B;  5AY8 D;  2HIO C;  3WAA B;  4R8P B;  5GSU D;  3WTP C;  2JE5 A;  1ZLA D;  4KGC A;  3B6G D;  5B2J D;  5B0Z D;  3WAA A;  4R8P A;  5GXQ C;  5BNV B;  2Y2J A;  3REH D;  1M1A C;  5BNV A;  5CHL B;  2HIO D;  5CP6 B;  4Z2M H;  3WTP D;  3AZE C;  4G92 B;  3KXB B;  4JJN B;  5CP6 A;  1TZY B;  3KXB A;  4JJN A;  3UTB C;  3R45 A;  5AY8 B;  2G5H C;  5GSU B;  1TZY A;  1ZLA B;  3B6G B;  3B0D B;  5AY8 A;  3AZE D;  5B0Z B;  5GSU A;  2XD5 A;  3B6G A;  4Z5T C;  4AWL C;  5JRG B;  1P3K C;  5B0Z A;  3REH B;  3AZJ D;  2IO5 C;  2CV5 C;  2F8N H;  3C1B C;  5JRG A;  5B1L C;  3REH A;  1KX4 C;  2HIO B;  1F1E A;  3WTP B;  2G5I C;  2ZY2 A;  3NQJ B;  2HIO A;  4WU9 D;  5GXQ B;  3WTP A;  3NQJ A;  4Z5T D;  2YFV B;  1KU5 A;  1P3K D;  3WA9 C;  5GXQ A;  1M1A B;  1EQZ C;  2HUE C;  2CV5 D;  4WZS B;  3EPL A;  2YFV A;  3C1B D;  1KX4 D;  3W99 C;  4J8U C;  3LEL C;  3AV2 C;  3AZE B;  2J8P A;  1M19 C;  1M1A A;  4WNN B;  3MGQ C;  3AZE A;  5AV6 C;  1S32 D;  5C3I C;  3WA9 D;  2Y2Q A;  3MGS C;  3W99 D;  3REL C;  2Y2O A;  3UTB A;  3AV2 D;  1P3G C;  2Y2M A;  3AYW C;  4Z5T B;  5AV6 D;  4AWL B;  1P3K B;  3UT9 D;  2IO5 B;  3VH6 A;  5BT1 C;  2CV5 B;  3MGS D;  4Z5T A;  3C1B B;  1W2E A;  5B1L B;  1U35 D;  1P3K A;  1KX4 B;  2PYO C;  3REJ C;  2Y2H A;  5GT0 C;  3REL D;  1P3G D;  3C1B A;  1KX3 C;  2FJ7 D;  5B1L A;  4ZBJ C;  1KX4 A;  1S32 B;  3AYW D;  3WA9 B;  2Y2N A;  1EQZ B;  2HUE B;  5BT1 D;  3AN2 C;  4J8U B;  2PYO D;  5BS7 C;  3LEL B;  3WA9 A;  3W99 B;  5B24 D;  3REJ D;  3AV2 B;  1M19 B;  1EQZ A;  5GT3 A;  5GT0 D;  1KX3 D;  4J8U A;  3W99 A;  4KGC C;  3LEL A;  3MGQ B;  3AV2 A;  5AV6 B;  1M19 A;  3FDD A;  3AZK C;  5C3I B;  4CSR B;  3MGQ A;  1M18 D;  3MGS B;  5AV6 A;  2F8N D;  4CSR A;  4J8W D;  4J8X C;  3REL B;  1P3G B;  3MGS A;  4KGC D;  3REL A;  2XD1 A;  1P3G A;  3AYW B;  3AZK D;  3AYW A;  4H9R B;  2PYO B;  1P3P C;  3REJ B;  3H0L C;  3MGR C;  3X1S C;  4J8X D;  5GT0 B;  4H9R A;  1KX3 B;  4ZBJ B;  2PYO A;  3REJ A;  5AVB C;  5GT0 A;  1KX3 A;  3B0C T;  2DF4 C;  1M18 B;  3B0B A;  2Y2L A;  2F8N B;  3X1S D;  3MGR D;  5CPI C;  4H9N A;  3AN2 A;  1JFI B;  2F8N A;  4KGC B;  5BS7 A;  3AZK B;  3AFA C;  5F99 C;  1JFI A;  2Y2K A;  4ZUX C;  3LZ0 C;  3AZK A;  4J8X B;  5AVC C;  5CPI D;  5JRG D;  4UPK A;  4Z66 C;  4J8X A;  1BH8 B;  2W8S A;  3AFA D;  5F99 D;  4WV4 B;  1P34 A;  1BH8 A;  2YFW B;  3A1K A;  4ZUX D;  3LZ0 D;  1P3P B;  2ZY3 A;  5GXQ D;  3R45 B;  5B0Y C;  3X1S B;  4EO5 C;  2YFW A;  3MGR B;  1P3P A;  3X1S A;  3MGR A;  1M1A D;  4Z66 D;  5AVB B;  3TU4 C;  5CPJ C;  1P3L C;  1T3U A;  5AVB A;  2VQR A;  4DRB A;  5FUG B;  1BH9 B;  5CPI B;  5B0Y D;  4E44 A;  3MGP C;  5FUG A;  1BH9 A;  4Z2M G;  3UTB D;  5CPI A;  3AFA B;  5F99 B;  3TU4 D;  5CPJ D;  1P3L D;  4ZUX B;  3LZ0 B;  3AZI C;  3AV1 C;  3AFA A;  5F99 A;  1P3B C;  4XZQ C;  5AVC B;  4ZUX A;  3LZ0 A;  3KUY C;  1Z2C B;  3MGP D;  4Z66 B;  5GT3 C;  5AVC A;  5B1L D;  4Z66 A;  2F8N K;  3VH5 A;  3REI C;  3AZI D;  3AV1 D;  5G49 B;  1P3B D;  4XZQ D;  5B0Y B;  4H9Q B;  4EO5 B;  2F8N G;  3KUY D;  5G49 A;  3UTB B;  1KX5 C;  1EQZ D;  5B0Y A;  4H9Q A;  5GT3 D;  5B33 C;  3TU4 B;  5CPJ B;  1P3L B;  4J8U D;  5B31 G;  3LEL D;  3W98 C;  4DQY B;  1M19 D;  3TU4 A;  3REI D;  5AV9 C;  5CPJ A;  1P3L A;  5DNN C;  2BYK B;  3MGQ D;  3MGP B;  2BYK A;  1P3I C;  1KX5 D;  2L5A A;  4M6B A;  5B33 D;  3MGP A;  1B6W A;  3W98 D;  4YS3 C;  3AZI B;  3AV1 B;  1P3B B;  2JSS A;  5AV9 D;  4XZQ B;  5DNN D;  2ARO C;  3KUY B;  3AZI A;  3AV1 A;  1P3B A;  4XZQ A;  5GT3 B;  1P3I D;  3IP4 C;  5JA4 B;  3REK C;  2FFF B;  3KUY A;  5E5A C;  3EPH A;  3EG5 B;  5JA4 A;  4YS3 D;  3REI B;  3UTA C;  5B31 C;  5AV8 C;  3F6T A;  2ARO D;  3REI A;  4KUD C;  1KX5 B;  3MNN C;  5B33 B;  3AN2 D;  3REK D;  3AZL C;  3W98 B;  1KX5 A;  5B33 A;  5AV9 B;  3KWQ C;  1P34 C;  5DNN B;  5B2I C;  3W98 A;  1B67 A;  5B31 D;  5AV8 D;  5AV9 A;  2F2A C;  5DNN A;  1HQ3 C;  1P3I B;  4KUD D;  1P3F C;  1AOI C;  3MNN D;  3AZL D;  1P3I A;  3H0M C;  4YS3 B;  1Q9C A;  3KWQ D;  1P34 D;  5B2I D;  4LD9 C;  1WWS A;  5DNM C;  2ARO B;  4YS3 A;  3W97 C; 
#chains in the Genus database with same CATH homology
 4H9N B;  4HGA C;  1P3F D;  2ARO A;  3W96 C;  3REK B;  3AN2 B;  1AOI D;  1P3P D;  3O62 C;  5E5A B;  5B32 C;  2BG1 A;  4NE3 A;  3REK A;  3UTA B;  3AZF C;  5E5A A;  5AV5 C;  5B31 B;  5AVB D;  4LD9 D;  5AV8 B;  3VH6 W;  3W97 D;  3VH6 T;  3UTA A;  4KUD B;  5B31 A;  1A7W A;  3MNN B;  5AV8 A;  3MVD C;  3AZL B;  4KUD A;  5B32 D;  3AZH C;  3MNN A;  5CPK C;  3AZL A;  3KWQ B;  1P34 B;  5B2I B;  3AZF D;  1ZLA C;  2RVQ C;  5B2J C;  1N1J B;  3KWQ A;  5B2I A;  3AL0 C;  1P3F B;  3A6N C;  1AOI B;  4WJ3 C;  2DQN C;  3MVD D;  1N1J A;  1BFM A;  1HQ3 A;  1P3F A;  5AVC D;  3AZH D;  1AOI A;  5CPK D;  2NQB C;  4H9P B;  3X1T C;  4LD9 B;  3B6F C;  2RVQ D;  5DNM B;  2NZD A;  3W97 B;  2BYM B;  4H9P A;  1ID3 C;  4LD9 A;  4HGA B;  5DNM A;  3W97 A;  3WTP E;  3A6N D;  3W96 B;  2BYM A;  3LJA C;  3O62 B;  5B32 B;  3AZG C;  3W96 A;  4H9O B;  3KSY A;  2NQB D;  3AZF B;  1HTA A;  3O62 A;  5B32 A;  5AV5 B;  3AZM C;  3X1T D;  3B6F D;  4H9O A;  3AZF A;  3EPJ A;  1ID3 D;  5AV5 A;  5BNX B;  3V9R B;  1P3O C;  3MVD B;  3AZJ C;  4H9S C;  3LJA D;  3AZH B;  5BNX A;  3V9R A;  4DRA A;  3MVD A;  3AZG D;  5CPK B;  2Y2P A;  4CAY B;  3AZM D;  3AZH A;  5B2J B;  5CPK A;  1F66 C;  4WU9 C;  4QLC C;  2LY8 A;  1ZLA A;  3P5J B;  4CAY A;  3A6N B;  1P3O D;  3WKJ C;  5B2J A;  2Y2G A;  5B1M C;  4X23 C;  3C1C C;  1P3M C;  5BO0 B;  3A6N A;  3X1V C;  4UUZ B;  2NQB B;  3X1T B;  1R4V A;  2Y2I A;  3X1U C;  5BO0 A;  3B6F B;  4UUZ A;  1F66 D;  2NQB A;  1ID3 B;  4QLC D;  1PZR A;  3X1T A;  3B6F A;  1S32 C;  3WKJ D;  3LJA B;  5B1M D;  1ID3 A;  4X23 D;  3C1C D;  3AZG B;  1P3M D;  3X1V D;  3LJA A;  3AZM B;  4NE6 A;  3X1U D;  3AZG A;  2ZY4 A;  3AZM A;  1P3O B;  3AZJ B;  3UT9 C;  2UWX A;  4WNN A;  3AZN C;  1U35 C;  1P3O A;  3AZJ A;  4H9S A;  1WWI A;  2JCH A;  4XUJ C;  2FJ7 C;  1F66 B;  4WU9 B;  4QLC B;  5KDM B;  3WKJ B;  1F66 A;  5B1M B;  3EPK A;  4WU9 A;  4QLC A;  4X23 B;  3C1C B;  1ULY A;  3AZN D;  1P3M B;  1TAF B;  5KDM A;  5B32 G;  3X1V B;  3WKJ A;  5B1M A;  1P3A C;  5B24 C;  4X23 A;  3C1C A;  2CV5 A;  3X1U B;  1P3M A;  3NQU B;  1TAF A;  4XUJ D;  3X1V A;  5E5A D;  4YM6 C;  3X1U A;  3NQU A;  4J8V C;  3UTA D;  4E45 A;  4WU8 C;  1M18 C;  3LZ1 C;  1S32 A;  5B40 C;  4J8W C;  1P3A D;  4NFT A;  4G91 C;  3VH5 W;  3VH5 T;  4YM6 D;  2NZD C;  1H3O B;  4KHA B;  3WAA C;  4R8P C;  4J8V D;  3UT9 B;  4WU8 D;  3AZN B;  1U35 B;  3LZ1 D;  1H3O A;  4KHA A;  3UT9 A;  4NE5 A;  5B40 D;  1HQ3 D;  2ZM5 A;  3AZN A;  1U35 A;  2FJ7 B;  4XUJ B;  3H0R C;  2NZD D;  2FJ7 A;  4XUJ A;  3WAA D;  4R8P D;  5CP6 C;  3KFU G;  5DNM D;  4G92 C;  3KXB C;  1P3A B;  4JJN C;  2CWE A;  5B24 B;  3W96 D;  1TZY C;  1P3A A;  3O62 D;  2ZY5 A;  5B24 A;  5AY8 C;  4YM6 B;  3B0C W;  4J8V B;  2RIQ A;  5GSU C;  4WU8 B;  4YM6 A;  5CP6 D;  3B0D C;  5AV5 D;  3LZ1 B;  3B6G C;  5B0Z C;  4J8V A;  5B40 B;  4J8W B;  1HQ3 B;  4WU8 A;  3KXB D;  4JJN D;  1M18 A;  3LZ1 A;  5JRG C;  3REH C;  4G91 B;  3A1I A;  5B40 A;  1TZY D;  4J8W A;  2NZD B;  5AY8 D;  2HIO C;  3WAA B;  4R8P B;  5GSU D;  3WTP C;  2JE5 A;  1ZLA D;  4KGC A;  3B6G D;  5B2J D;  5B0Z D;  3WAA A;  4R8P A;  5GXQ C;  5BNV B;  2Y2J A;  3REH D;  1M1A C;  5BNV A;  5CHL B;  2HIO D;  5CP6 B;  4Z2M H;  3WTP D;  3AZE C;  4G92 B;  3KXB B;  4JJN B;  5CP6 A;  1TZY B;  3KXB A;  4JJN A;  3UTB C;  3R45 A;  5AY8 B;  2G5H C;  5GSU B;  1TZY A;  1ZLA B;  3B6G B;  3B0D B;  5AY8 A;  3AZE D;  5B0Z B;  5GSU A;  2XD5 A;  3B6G A;  4Z5T C;  4AWL C;  5JRG B;  1P3K C;  5B0Z A;  3REH B;  3AZJ D;  2IO5 C;  2CV5 C;  2F8N H;  3C1B C;  5JRG A;  5B1L C;  3REH A;  1KX4 C;  2HIO B;  1F1E A;  3WTP B;  2G5I C;  2ZY2 A;  3NQJ B;  2HIO A;  4WU9 D;  5GXQ B;  3WTP A;  3NQJ A;  4Z5T D;  2YFV B;  1KU5 A;  1P3K D;  3WA9 C;  5GXQ A;  1M1A B;  1EQZ C;  2HUE C;  2CV5 D;  4WZS B;  3EPL A;  2YFV A;  3C1B D;  1KX4 D;  3W99 C;  4J8U C;  3LEL C;  3AV2 C;  3AZE B;  2J8P A;  1M19 C;  1M1A A;  4WNN B;  3MGQ C;  3AZE A;  5AV6 C;  1S32 D;  5C3I C;  3WA9 D;  2Y2Q A;  3MGS C;  3W99 D;  3REL C;  2Y2O A;  3UTB A;  3AV2 D;  1P3G C;  2Y2M A;  3AYW C;  4Z5T B;  5AV6 D;  4AWL B;  1P3K B;  3UT9 D;  2IO5 B;  3VH6 A;  5BT1 C;  2CV5 B;  3MGS D;  4Z5T A;  3C1B B;  1W2E A;  5B1L B;  1U35 D;  1P3K A;  1KX4 B;  2PYO C;  3REJ C;  2Y2H A;  5GT0 C;  3REL D;  1P3G D;  3C1B A;  1KX3 C;  2FJ7 D;  5B1L A;  4ZBJ C;  1KX4 A;  1S32 B;  3AYW D;  3WA9 B;  2Y2N A;  1EQZ B;  2HUE B;  5BT1 D;  3AN2 C;  4J8U B;  2PYO D;  5BS7 C;  3LEL B;  3WA9 A;  3W99 B;  5B24 D;  3REJ D;  3AV2 B;  1M19 B;  1EQZ A;  5GT3 A;  5GT0 D;  1KX3 D;  4J8U A;  3W99 A;  4KGC C;  3LEL A;  3MGQ B;  3AV2 A;  5AV6 B;  1M19 A;  3FDD A;  3AZK C;  5C3I B;  4CSR B;  3MGQ A;  1M18 D;  3MGS B;  5AV6 A;  2F8N D;  4CSR A;  4J8W D;  4J8X C;  3REL B;  1P3G B;  3MGS A;  4KGC D;  3REL A;  2XD1 A;  1P3G A;  3AYW B;  3AZK D;  3AYW A;  4H9R B;  2PYO B;  1P3P C;  3REJ B;  3H0L C;  3MGR C;  3X1S C;  4J8X D;  5GT0 B;  4H9R A;  1KX3 B;  4ZBJ B;  2PYO A;  3REJ A;  5AVB C;  5GT0 A;  1KX3 A;  3B0C T;  2DF4 C;  1M18 B;  3B0B A;  2Y2L A;  2F8N B;  3X1S D;  3MGR D;  5CPI C;  4H9N A;  3AN2 A;  1JFI B;  2F8N A;  4KGC B;  5BS7 A;  3AZK B;  3AFA C;  5F99 C;  1JFI A;  2Y2K A;  4ZUX C;  3LZ0 C;  3AZK A;  4J8X B;  5AVC C;  5CPI D;  5JRG D;  4UPK A;  4Z66 C;  4J8X A;  1BH8 B;  2W8S A;  3AFA D;  5F99 D;  4WV4 B;  1P34 A;  1BH8 A;  2YFW B;  3A1K A;  4ZUX D;  3LZ0 D;  1P3P B;  2ZY3 A;  5GXQ D;  3R45 B;  5B0Y C;  3X1S B;  4EO5 C;  2YFW A;  3MGR B;  1P3P A;  3X1S A;  3MGR A;  1M1A D;  4Z66 D;  5AVB B;  3TU4 C;  5CPJ C;  1P3L C;  1T3U A;  5AVB A;  2VQR A;  4DRB A;  5FUG B;  1BH9 B;  5CPI B;  5B0Y D;  4E44 A;  3MGP C;  5FUG A;  1BH9 A;  4Z2M G;  3UTB D;  5CPI A;  3AFA B;  5F99 B;  3TU4 D;  5CPJ D;  1P3L D;  4ZUX B;  3LZ0 B;  3AZI C;  3AV1 C;  3AFA A;  5F99 A;  1P3B C;  4XZQ C;  5AVC B;  4ZUX A;  3LZ0 A;  3KUY C;  1Z2C B;  3MGP D;  4Z66 B;  5GT3 C;  5AVC A;  5B1L D;  4Z66 A;  2F8N K;  3VH5 A;  3REI C;  3AZI D;  3AV1 D;  5G49 B;  1P3B D;  4XZQ D;  5B0Y B;  4H9Q B;  4EO5 B;  2F8N G;  3KUY D;  5G49 A;  3UTB B;  1KX5 C;  1EQZ D;  5B0Y A;  4H9Q A;  5GT3 D;  5B33 C;  3TU4 B;  5CPJ B;  1P3L B;  4J8U D;  5B31 G;  3LEL D;  3W98 C;  4DQY B;  1M19 D;  3TU4 A;  3REI D;  5AV9 C;  5CPJ A;  1P3L A;  5DNN C;  2BYK B;  3MGQ D;  3MGP B;  2BYK A;  1P3I C;  1KX5 D;  2L5A A;  4M6B A;  5B33 D;  3MGP A;  1B6W A;  3W98 D;  4YS3 C;  3AZI B;  3AV1 B;  1P3B B;  2JSS A;  5AV9 D;  4XZQ B;  5DNN D;  2ARO C;  3KUY B;  3AZI A;  3AV1 A;  1P3B A;  4XZQ A;  5GT3 B;  1P3I D;  3IP4 C;  5JA4 B;  3REK C;  2FFF B;  3KUY A;  5E5A C;  3EPH A;  3EG5 B;  5JA4 A;  4YS3 D;  3REI B;  3UTA C;  5B31 C;  5AV8 C;  3F6T A;  2ARO D;  3REI A;  4KUD C;  1KX5 B;  3MNN C;  5B33 B;  3AN2 D;  3REK D;  3AZL C;  3W98 B;  1KX5 A;  5B33 A;  5AV9 B;  3KWQ C;  1P34 C;  5DNN B;  5B2I C;  3W98 A;  1B67 A;  5B31 D;  5AV8 D;  5AV9 A;  2F2A C;  5DNN A;  1HQ3 C;  1P3I B;  4KUD D;  1P3F C;  1AOI C;  3MNN D;  3AZL D;  1P3I A;  3H0M C;  4YS3 B;  1Q9C A;  3KWQ D;  1P34 D;  5B2I D;  4LD9 C;  1WWS A;  5DNM C;  2ARO B;  4YS3 A;  3W97 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...