1HQ3B

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3B00
3AZKA 3WTPE 1F66D 1P34C 3X1SA 4KUDA 5CPIC 3R45A 4XUJD 4H9NA 4YS3D 2F8NK 4H9SC 4JJNC 1HQ3B 3WAAB 3LJAC 5B40D 5F99A 2CWEA 3NQJA 4HGAC 5B24A 3AZGC 3UTBA 5G49B 3MGSA 1U35A 2CV5C 1KX5C 2RVQC 3W97C 3AYWA 3WTPA 5B31B 1P3MA 4NFTA 1M1AB 2AROD 1ID3B 4J8XD 3A6NA 4XUJC 5AV6A 3AZJA 3MGQA 4YS3C 3W96B 5B0YA 1B6WA 4J8UD 1TZYA 3AZLB 5CP6D 5B40C 3KUYA 3W98D 5B33C 5BNXB 3AZFA 4H9QA 3AFAD 1WWSA 2NQBA 5AV8C 3NQUB 5B2JA 4XZQA 3C1CB 3O62D 4WU8D 2AROC 4ZBJC 5B1LD 4R8PB 5CPJB 1P3GB 1ULYA 1P3BA 3B6GA 3X1VB 1KX4A 4ZUXB 1AOIB 3X1UA 3B6FB 2NZDA 4J8UC 5GXQB 4X23D 5JRGD 2BYKA 1EQZB 5DNMA 3W98C 5BO0B 3AZMA 4H9RB 2BYMA 5B32B 4Z5TB 3AFAC 3MGPA 3AZEA 3AN2A 4J8VD 4KUDB 4WU8C 4Z2MG 2IO5B 1ZLAC 1BH8B 5GT0D 3MNND 3AV1A 4WU9D 3RELB 5E5AD 3LELB 2HIOA 5CHLB 2F8NG 5JRGC 5F99B 5DNNA 5B1MB 3REJA 3B0BA 3X1TB 3WA9B 3REKB 3UTBB 3LZ0A 4Z66B 1P3LB 3AZNB 3AYWB 5AV5A 5AVCB 4AWLB 3LZ1D 5AY8B 3A6NB 1M19A 5AV6B 4H9OB 5GT0C 3MNNC 4WU9C 5E5AC 1TAFA 4EO5B 1P3KA 3UT9B 4H9PA 1P34A 1HQ3D 3WAAD 5CPIA 1WWIA 3AZFB 4H9SA 4CAYA 1P3AB 5AVBB 1P3OB 4G92B 1KX3A 3LJAA 1S32B 4J8WB 5CPKA 3LZ1C 3W99B 3B6GB 3AZHB 5B31D 4JJND 1KX4B 2YFVA 1M1AD 2CV5A 2NZDB 1ID3D 3W97A 4LD9B 5JA4A 5B2IA 1Q9CA 4UUZA 3C1BA 2F8ND 3WKJB 1F66A 1HQ3C 3WAAC 5B0ZB 2RVQD 3AZLD 3AZIB 2FJ7B 2BYMB 4XUJA 4YS3A 3AZEB 3KXBB 3TU4B 1P3IA 5B40A 5BNVA 1N1JA 3UTAB 3REIA 3C1CD 3V9RA 5B31C 1M1AC 4WNNB 1ID3C 4R8PD 5CPJD 1P3GD 3X1VD 5DNNB 4ZUXD 3W96C 5GSUB 3KWQB 3REJB 5B33D 1AOID 3LZ0B 5GXQD 2AROA 5AV9B 3AZLC 4J8XA 5AV8D 3MVDA 4QLCB 2LY8A 5B32D 4Z5TD 4KHAA 5CP6A 5GT3B 3W98A 4NE3A 1P3PB 3C1CC 4KUDD 3REHB 1TAFB 4R8PC 1P3KB 3AFAA 5CPJC 1P3GC 3X1VC 4ZUXC 3RELD 3LELD 1BFMA 1AOIC 3B6FC 3O62A 2HUEB 4WU8A 5GXQC 5B1LA 1EQZC 5B1MD 3X1TD 3WA9D 3REKD 3UTBD 1KX3B 4Z66D 5CPKB 4X23A 1P3LD 1M18B 1ZLAD 5B32C 5JRGA 4Z5TC 3AZND 1P3FB 5FUGA 3B0DB 5AVCD 4KUDC 5AY8D 2IO5C 1A7WA 5B2IB 5AV6D 4YM6B 3C1BB 1F66B 4J8VA 4G91B 4NE5A 3LELC 3RELC 3MGRB 3MNNA 5F99C 3UT9D 5B1MC 3AZKB 3X1TC 3WA9C 4WU9A 3REKC 3UTBC 5E5AA 3X1SB 3R45B 4Z66C 1P3LC 1P3IB 5B31G 4H9NB 5AVBD 3AZNC 3AYWC 1P3AD 1P3OD 3REIB 1S32D 4E44A 4J8WD 5AVCC 4AWLC 5AY8C 3A6NC 3W99D 3B6GD 3NQJB 5AV6C 3AZHD 5B24B 4M6BA 3MGSB 1U35B 4LD9D 4EO5C 4J8XB 3UT9C 3MVDB 3WTPB 3AV2A 3WKJD 1P3MB 5B0ZD 3AZID 2FJ7D 3AZFC 2L5AA 5CP6B 3AZJB 3MGQB 1P3AC 5AVBC 1P3OC 4G92C 5B0YB 3KXBD 3WAAA 3TU4D 1S32C 2PYOA 1TZYB 4J8WC 4KGCA 3UTAD 3W99C 5C3IB 3B6GC 3KUYB 3AZHC 1KX4C 5G49A 4DRBA 2NZDC 3O62B 4LD9C 1B67A 4H9QB 5B1LB 5GSUD 3KWQD 3REJD 2NQBB 3WKJC 5B31A 5B2JB 4JJNA 4XZQB 5B32G 1M1AA 5B0ZC 5AV9D 1ID3A 4X23B 3AZIC 2FJ7C 1JFIA 1P3BB 3AZGA 2F8NA 3AZEC 3KXBC 3VH6A 3X1UB 1KX5A 4QLCD 3TU4C 3AZLA 2BYKB 5GT3D 5DNMB 3UTAC 3W96D 1P3PD 3AZMB 4J8VB 3REHD 1P3KD 5DNNC 3MGPB 5GSUC 3KWQC 3C1CA 3REJC 3AN2B 1HTAA 2YFWA 3LZ0C 5AV9C 4R8PA 5CPJA 1P3GA 3X1VA 5BT1D 4ZUXA 3AV1B 1KX3D 5B33A 1AOIA 4Z2MH 2HIOB 5GXQA 5CPKD 4QLCC 1M18D 4WZSB 1P3FD 5AV8A 5GT3C 1P3PC 3B6FD 2F8NH 3REHC 5BS7C 4Z5TA 5B2ID 4YM6D 1P3KC 1EQZD 3C1BD 3AV2B 4J8UA 3MGRD 5AV5B 2HUEC 4E45A 1BH8A 1M19B 3AZKD 3VH6T 5BT1C 3RELA 3LELA 1KX3C 3X1SD 2PYOB 5CPKC 1M18C 1P3ID 4KGCB 1P3FC 5B1MA 3REID 3X1TA 3WA9A 4H9PB 3REKA 1P34B 5KDMA 3B0DC 5CPIB 4Z66A 1P3LA 1ZLAA 5F99D 3AZNA 5B2IC 4YM6C 5B24D 4CAYB 3C1BC 4JJNB 1F66C 3MGSD 3LJAB 4G91C 1U35D 5AVCA 1F1EA 3MGRC 5AY8A 1JFIB 4WV4B 3AYWD 4H9OA 4HGAB 3MVDD 3WTPD 3AZGB 1P3MD 2F8NB 3AZKC 2YFVB 2CV5B 1KX5B 3X1SC 4DRAA 3VH6W 3A6ND 3W97B 5JA4B 1P3IC 3AZJD 3MGQD 3UT9A 4UUZB 5B0YD 3REIC 2JSSA 1TZYD 1BH9A 4XUJB 5GT0A 1P3AA 5AVBA 3KUYD 4YS3B 1P3OA 5B24C 1S32A 3VH5A 2YFWB 3MGSC 4J8WA 1U35C 3AZFD 4J8XC 5B40B 4NE6A 5BNVB 2NQBD 1N1JB 3AZHA 3W99A 3MVDC 5B2JD 3WTPC 4XZQD 1KU5A 3V9RB 5B33B 1P3MC 4LD9A 5CP6C 1P3BD 5AV8B 3MGQC 3AZJC 1KX4D 1H3OA 3WKJA 4CSRA 5B0YC 3X1UD 2NZDD 5B0ZA 1TZYC 3AZIA 2AROB 4ZBJB 3LZ1A 2FJ7A 5DNMD 5C3IC 3KUYC 3AZMD 3KXBA 3TU4A 4J8UB 3B0CT 3O62C 5B1LC 4KHAB 3UTAA 3MGPD 3AZED 3W98B 2NQBC 3AN2D 5B2JC 1HQ3A 4XZQC 4WNNA 4X23C 3AFAB 1P3BC 5GSUA 3KWQA 3AV1D 5KDMB 2HIOD 3X1UC 5AV9A 4WU8B 1ZLAB 5DNND 5DNMC 3VH5T 3AZMC 3LZ0D 4J8VC 4QLCA 5JRGB 5GT3A 3AV2D 3B0CW 3W96A 3MGPC 1P3PA 5FUGB 3AN2C 5AV5D 3REHA 5BS7A 1M19D 3AV1C 1R4VA 2PYOD 2HIOC 5BNXA 4KGCD 1BH9B 5GT0B 3MNNB 3NQUA 1P34D 4WU9B 5CPID 5E5AB 1M18A 3VH5W 1P3FA 3AV2C 3B6FA 3LJAD 5AV5C 4YM6A 1EQZA 1M19C 3AZGD 3KSYA 5BO0A 1H3OB 4CSRB 2CV5D 1KX5D 4H9RA 3MGRA 2PYOC 3W97D 5B32A 3LZ1B 4KGCC
chains in the Genus database with same CATH superfamily
2FFFB 3AZKA 3WTPE 1F66D 1P34C 3X1SA 4KUDA 2Y2GA 5CPIC 3R45A 4XUJD 4H9NA 4YS3D 2F8NK 4H9SC 4JJNC 1HQ3B 2Y2HA 3WAAB 3LJAC 5B40D 2RIQA 5F99A 2CWEA 3NQJA 4HGAC 5B24A 3AZGC 3UTBA 5G49B 3MGSA 2J8PA 1U35A 2CV5C 1KX5C 2RVQC 3H0LC 3W97C 3AYWA 3WTPA 5B31B 1P3MA 4NFTA 3KFUG 1M1AB 2AROD 1ID3B 4J8XD 3A6NA 3EG5B 2Y2NA 3H0RC 4XUJC 5AV6A 3MGQA 4YS3C 3AZJA 3W96B 5B0YA 1B6WA 4J8UD 1TZYA 2ZY5A 3AZLB 5CP6D 3A1KA 5B40C 3KUYA 3W98D 2XD5A 5B33C 5BNXB 3AZFA 4H9QA 3AFAD 1WWSA 2NQBA 5AV8C 3NQUB 5B2JA 4XZQA 3C1CB 3O62D 4WU8D 2AROC 4ZBJC 5B1LD 4R8PB 5CPJB 1P3GB 1ULYA 1P3BA 3B6GA 3X1VB 1KX4A 3FDDA 4ZUXB 1AOIB 3X1UA 3B6FB 2NZDA 4J8UC 5GXQB 4X23D 5JRGD 2BYKA 1EQZB 5DNMA 3W98C 5BO0B 3AZMA 4H9RB 2BYMA 5B32B 4Z5TB 3AFAC 3F6TA 3MGPA 3AZEA 3AN2A 4J8VD 4KUDB 4WU8C 4Z2MG 2IO5B 3P5JB 1ZLAC 1BH8B 5GT0D 3MNND 3AV1A 3A1IA 4WU9D 3RELB 5E5AD 2DQNC 3LELB 2HIOA 5CHLB 2F8NG 5JRGC 5F99B 5DNNA 5B1MB 3REJA 3B0BA 3X1TB 3WA9B 3REKB 3UTBB 3LZ0A 2G5IC 4Z66B 1PZRA 1P3LB 3AZNB 3AYWB 5AV5A 5AVCB 4AWLB 3LZ1D 5AY8B 3A6NB 3EPKA 1M19A 5AV6B 4H9OB 5GT0C 3MNNC 2ZY3A 2ZM5A 4WU9C 5E5AC 1TAFA 3EPHA 4EO5B 1P3KA 3UT9B 4H9PA 1P34A 1HQ3D 3WAAD 5CPIA 1WWIA 3AZFB 2Y2KA 4H9SA 2JE5A 4CAYA 1P3AB 5AVBB 1P3OB 4G92B 1KX3A 3LJAA 1S32B 4J8WB 5CPKA 3LZ1C 3W99B 3B6GB 3AZHB 2Y2QA 5B31D 4JJND 1KX4B 2YFVA 1M1AD 2CV5A 2NZDB 1ID3D 3W97A 4LD9B 5JA4A 5B2IA 1Q9CA 4UUZA 3C1BA 2F8ND 3WKJB 1F66A 1HQ3C 3WAAC 5B0ZB 2RVQD 3AZLD 3AZIB 2FJ7B 2BYMB 4XUJA 4YS3A 1W2EA 3AZEB 3KXBB 3TU4B 3IP4C 1P3IA 5B40A 5BNVA 1N1JA 3UTAB 3REIA 3C1CD 3V9RA 5B31C 1M1AC 4WNNB 1ID3C 4R8PD 5CPJD 1P3GD 3X1VD 5DNNB 4ZUXD 3W96C 5GSUB 3KWQB 3REJB 5B33D 1AOID 3LZ0B 5GXQD 2AROA 2G5HC 5AV9B 3AZLC 4J8XA 5AV8D 2Y2MA 3MVDA 4QLCB 2LY8A 5B32D 4Z5TD 4KHAA 5CP6A 5GT3B 3W98A 4NE3A 1P3PB 3C1CC 4KUDD 3REHB 1TAFB 4R8PC 1P3KB 3AFAA 5CPJC 1P3GC 3X1VC 4ZUXC 3RELD 3LELD 1BFMA 1AOIC 3B6FC 3O62A 2HUEB 4WU8A 5GXQC 5B1LA 1EQZC 4UPKA 5B1MD 3X1TD 3WA9D 3REKD 3UTBD 1KX3B 4Z66D 5CPKB 4X23A 1P3LD 1M18B 2Y2IA 1ZLAD 5B32C 5JRGA 4Z5TC 3AZND 1P3FB 5FUGA 3B0DB 5AVCD 2ZY2A 4KUDC 5AY8D 2IO5C 1A7WA 5B2IB 5AV6D 4YM6B 3C1BB 2W8SA 1F66B 4J8VA 4G91B 4NE5A 3LELC 3RELC 3MGRB 3MNNA 5F99C 3UT9D 2Y2JA 5B1MC 3AZKB 3X1TC 3WA9C 4WU9A 3REKC 3UTBC 5E5AA 3X1SB 3R45B 4Z66C 1P3LC 1P3IB 5B31G 4H9NB 5AVBD 3AZNC 3AYWC 1P3AD 1P3OD 3REIB 1S32D 4E44A 4J8WD 5AVCC 4AWLC 5AY8C 3A6NC 3EPJA 3W99D 3B6GD 3NQJB 5AV6C 3AZHD 5B24B 4M6BA 3MGSB 1U35B 4LD9D 4EO5C 4J8XB 3UT9C 3MVDB 3WTPB 3AV2A 3WKJD 1P3MB 5B0ZD 3AZID 2FJ7D 3AZFC 2L5AA 5CP6B 3AZJB 3MGQB 1P3AC 5AVBC 1P3OC 4G92C 5B0YB 3KXBD 3WAAA 3TU4D 1S32C 2PYOA 1TZYB 4J8WC 4KGCA 3UTAD 3W99C 5C3IB 3B6GC 3KUYB 3AZHC 2XD1A 1KX4C 5G49A 4DRBA 2NZDC 3O62B 2VQRA 4LD9C 1B67A 4H9QB 5B1LB 5GSUD 3KWQD 3REJD 2NQBB 3WKJC 5B31A 5B2JB 4JJNA 4XZQB 5B32G 1M1AA 5B0ZC 5AV9D 1ID3A 4X23B 3AZIC 2FJ7C 1JFIA 1P3BB 3AZGA 2F8NA 3AZEC 3KXBC 3VH6A 3X1UB 1KX5A 4QLCD 3TU4C 1Z2CB 3AZLA 2BYKB 5GT3D 3H0MC 5DNMB 3UTAC 3W96D 1P3PD 3AZMB 4J8VB 3REHD 1P3KD 5DNNC 3MGPB 5GSUC 3KWQC 3C1CA 3REJC 3AN2B 1HTAA 2YFWA 3LZ0C 5AV9C 4R8PA 5CPJA 1P3GA 3X1VA 5BT1D 4ZUXA 3AV1B 1KX3D 2ZY4A 5B33A 1AOIA 4Z2MH 2HIOB 5GXQA 5CPKD 4QLCC 1M18D 4WZSB 1P3FD 5AV8A 5GT3C 1P3PC 3B6FD 2F8NH 3REHC 5BS7C 4Z5TA 5B2ID 4YM6D 1P3KC 1EQZD 3C1BD 3AV2B 4J8UA 3MGRD 5AV5B 2HUEC 4E45A 1BH8A 1M19B 3AZKD 3VH6T 5BT1C 3RELA 3LELA 1KX3C 3X1SD 2PYOB 5CPKC 1M18C 1P3ID 4KGCB 1P3FC 5B1MA 3REID 3X1TA 3WA9A 4H9PB 3REKA 1P34B 5KDMA 2JCHA 3B0DC 5CPIB 4Z66A 1P3LA 1ZLAA 5F99D 3AZNA 5B2IC 4YM6C 5B24D 4CAYB 2Y2LA 3C1BC 4JJNB 1F66C 3MGSD 3LJAB 4G91C 1U35D 5AVCA 1F1EA 3MGRC 5AY8A 3EPLA 1JFIB 4WV4B 3AYWD 4H9OA 4HGAB 3MVDD 3WTPD 3AZGB 1P3MD 2F8NB 3AZKC 2BG1A 2YFVB 4DQYB 2CV5B 1KX5B 3X1SC 4DRAA 3VH6W 3A6ND 3W97B 5JA4B 1P3IC 3AZJD 3MGQD 3UT9A 4UUZB 5B0YD 3REIC 2JSSA 1TZYD 1BH9A 2Y2OA 4XUJB 5GT0A 2Y2PA 1P3AA 5AVBA 3KUYD 4YS3B 1P3OA 5B24C 1S32A 3VH5A 2YFWB 3MGSC 4J8WA 1U35C 3AZFD 4J8XC 5B40B 1T3UA 4NE6A 5BNVB 1N1JB 3AZHA 2NQBD 3MVDC 5B2JD 3WTPC 4XZQD 1KU5A 3V9RB 5B33B 1P3MC 4LD9A 5CP6C 1P3BD 5AV8B 3MGQC 3AZJC 1KX4D 1H3OA 3WKJA 4CSRA 5B0YC 3X1UD 2NZDD 5B0ZA 1TZYC 3AZIA 2AROB 4ZBJB 3LZ1A 2FJ7A 5DNMD 5C3IC 3KUYC 3AZMD 3KXBA 3TU4A 4J8UB 3B0CT 3O62C 5B1LC 4KHAB 3UTAA 3MGPD 3AZED 3W98B 2NQBC 3AN2D 5B2JC 1HQ3A 4XZQC 4WNNA 4X23C 3AFAB 1P3BC 5GSUA 3KWQA 3AV1D 5KDMB 2HIOD 3X1UC 5AV9A 4WU8B 2UWXA 1ZLAB 5DNND 5DNMC 3W99A 3VH5T 2F2AC 3AZMC 3LZ0D 4J8VC 4QLCA 3AL0C 5JRGB 5GT3A 3AV2D 3B0CW 3W96A 3MGPC 1P3PA 5FUGB 3AN2C 5AV5D 4WJ3C 3REHA 5BS7A 1M19D 3AV1C 1R4VA 2PYOD 2HIOC 5BNXA 4KGCD 1BH9B 5GT0B 3MNNB 3NQUA 1P34D 4WU9B 5CPID 5E5AB 1M18A 3VH5W 1P3FA 3AV2C 3B6FA 3LJAD 5AV5C 4YM6A 1EQZA 1M19C 3AZGD 3KSYA 5BO0A 1H3OB 4CSRB 2CV5D 2DF4C 1KX5D 4H9RA 3MGRA 2PYOC 3W97D 5B32A 3LZ1B 4KGCC
chains in the Genus database with same CATH topology
2FFFB 3AZKA 3WTPE 1F66D 1P34C 3X1SA 4KUDA 2Y2GA 5CPIC 3R45A 4XUJD 4H9NA 4YS3D 2F8NK 4H9SC 4JJNC 1HQ3B 2Y2HA 3WAAB 3LJAC 5B40D 2RIQA 5F99A 2CWEA 3NQJA 4HGAC 5B24A 3AZGC 3UTBA 5G49B 3MGSA 2J8PA 1U35A 2CV5C 1KX5C 2RVQC 3H0LC 3W97C 3AYWA 3WTPA 5B31B 1P3MA 4NFTA 3KFUG 1M1AB 2AROD 1ID3B 4J8XD 3A6NA 3EG5B 2Y2NA 3H0RC 4XUJC 5AV6A 3MGQA 4YS3C 3AZJA 3W96B 5B0YA 1B6WA 4J8UD 1TZYA 2ZY5A 3AZLB 5CP6D 3A1KA 5B40C 3KUYA 3W98D 2XD5A 5B33C 5BNXB 3AZFA 4H9QA 3AFAD 1WWSA 2NQBA 5AV8C 3NQUB 5B2JA 4XZQA 3C1CB 3O62D 4WU8D 2AROC 4ZBJC 5B1LD 4R8PB 5CPJB 1P3GB 1ULYA 1P3BA 3B6GA 3X1VB 1KX4A 3FDDA 4ZUXB 1AOIB 3X1UA 3B6FB 2NZDA 4J8UC 5GXQB 4X23D 5JRGD 2BYKA 1EQZB 5DNMA 3W98C 5BO0B 3AZMA 4H9RB 2BYMA 5B32B 4Z5TB 3AFAC 3F6TA 3MGPA 3AZEA 3AN2A 4J8VD 4KUDB 4WU8C 4Z2MG 2IO5B 3P5JB 1ZLAC 1BH8B 5GT0D 3MNND 3AV1A 3A1IA 4WU9D 3RELB 5E5AD 2DQNC 3LELB 2HIOA 5CHLB 2F8NG 5JRGC 5F99B 5DNNA 5B1MB 3REJA 3B0BA 3X1TB 3WA9B 3REKB 3UTBB 3LZ0A 2G5IC 4Z66B 1PZRA 1P3LB 3AZNB 3AYWB 5AV5A 5AVCB 4AWLB 3LZ1D 5AY8B 3A6NB 3EPKA 1M19A 5AV6B 4H9OB 5GT0C 3MNNC 2ZY3A 2ZM5A 4WU9C 5E5AC 1TAFA 3EPHA 4EO5B 1P3KA 3UT9B 4H9PA 1P34A 1HQ3D 3WAAD 5CPIA 1WWIA 3AZFB 2Y2KA 4H9SA 2JE5A 4CAYA 1P3AB 5AVBB 1P3OB 4G92B 1KX3A 3LJAA 1S32B 4J8WB 5CPKA 3LZ1C 3W99B 3B6GB 3AZHB 2Y2QA 5B31D 4JJND 1KX4B 2YFVA 1M1AD 2CV5A 2NZDB 1ID3D 3W97A 4LD9B 5JA4A 5B2IA 1Q9CA 4UUZA 3C1BA 2F8ND 3WKJB 1F66A 1HQ3C 3WAAC 5B0ZB 2RVQD 3AZLD 3AZIB 2FJ7B 2BYMB 4XUJA 4YS3A 1W2EA 3AZEB 3KXBB 3TU4B 3IP4C 1P3IA 5B40A 5BNVA 1N1JA 3UTAB 3REIA 3C1CD 3V9RA 5B31C 1M1AC 4WNNB 1ID3C 4R8PD 5CPJD 1P3GD 3X1VD 5DNNB 4ZUXD 3W96C 5GSUB 3KWQB 3REJB 5B33D 1AOID 3LZ0B 5GXQD 2AROA 2G5HC 5AV9B 3AZLC 4J8XA 5AV8D 2Y2MA 3MVDA 4QLCB 2LY8A 5B32D 4Z5TD 4KHAA 5CP6A 5GT3B 3W98A 4NE3A 1P3PB 3C1CC 4KUDD 3REHB 1TAFB 4R8PC 1P3KB 3AFAA 5CPJC 1P3GC 3X1VC 4ZUXC 3RELD 3LELD 1BFMA 1AOIC 3B6FC 3O62A 2HUEB 4WU8A 5GXQC 5B1LA 1EQZC 4UPKA 5B1MD 3X1TD 3WA9D 3REKD 3UTBD 1KX3B 4Z66D 5CPKB 4X23A 1P3LD 1M18B 2Y2IA 1ZLAD 5B32C 5JRGA 4Z5TC 3AZND 1P3FB 5FUGA 3B0DB 5AVCD 2ZY2A 4KUDC 5AY8D 2IO5C 1A7WA 5B2IB 5AV6D 4YM6B 3C1BB 2W8SA 1F66B 4J8VA 4G91B 4NE5A 3LELC 3RELC 3MGRB 3MNNA 5F99C 3UT9D 2Y2JA 5B1MC 3AZKB 3X1TC 3WA9C 4WU9A 3REKC 3UTBC 5E5AA 3X1SB 3R45B 4Z66C 1P3LC 1P3IB 5B31G 4H9NB 5AVBD 3AZNC 3AYWC 1P3AD 1P3OD 3REIB 1S32D 4E44A 4J8WD 5AVCC 4AWLC 5AY8C 3A6NC 3EPJA 3W99D 3B6GD 3NQJB 5AV6C 3AZHD 5B24B 4M6BA 3MGSB 1U35B 4LD9D 4EO5C 4J8XB 3UT9C 3MVDB 3WTPB 3AV2A 3WKJD 1P3MB 5B0ZD 3AZID 2FJ7D 3AZFC 2L5AA 5CP6B 3AZJB 3MGQB 1P3AC 5AVBC 1P3OC 4G92C 5B0YB 3KXBD 3WAAA 3TU4D 1S32C 2PYOA 1TZYB 4J8WC 4KGCA 3UTAD 3W99C 5C3IB 3B6GC 3KUYB 3AZHC 2XD1A 1KX4C 5G49A 4DRBA 2NZDC 3O62B 2VQRA 4LD9C 1B67A 4H9QB 5B1LB 5GSUD 3KWQD 3REJD 2NQBB 3WKJC 5B31A 5B2JB 4JJNA 4XZQB 5B32G 1M1AA 5B0ZC 5AV9D 1ID3A 4X23B 3AZIC 2FJ7C 1JFIA 1P3BB 3AZGA 2F8NA 3AZEC 3KXBC 3VH6A 3X1UB 1KX5A 4QLCD 3TU4C 1Z2CB 3AZLA 2BYKB 5GT3D 3H0MC 5DNMB 3UTAC 3W96D 1P3PD 3AZMB 4J8VB 3REHD 1P3KD 5DNNC 3MGPB 5GSUC 3KWQC 3C1CA 3REJC 3AN2B 1HTAA 2YFWA 3LZ0C 5AV9C 4R8PA 5CPJA 1P3GA 3X1VA 5BT1D 4ZUXA 3AV1B 1KX3D 2ZY4A 5B33A 1AOIA 4Z2MH 2HIOB 5GXQA 5CPKD 4QLCC 1M18D 4WZSB 1P3FD 5AV8A 5GT3C 1P3PC 3B6FD 2F8NH 3REHC 5BS7C 4Z5TA 5B2ID 4YM6D 1P3KC 1EQZD 3C1BD 3AV2B 4J8UA 3MGRD 5AV5B 2HUEC 4E45A 1BH8A 1M19B 3AZKD 3VH6T 5BT1C 3RELA 3LELA 1KX3C 3X1SD 2PYOB 5CPKC 1M18C 1P3ID 4KGCB 1P3FC 5B1MA 3REID 3X1TA 3WA9A 4H9PB 3REKA 1P34B 5KDMA 2JCHA 3B0DC 5CPIB 4Z66A 1P3LA 1ZLAA 5F99D 3AZNA 5B2IC 4YM6C 5B24D 4CAYB 2Y2LA 3C1BC 4JJNB 1F66C 3MGSD 3LJAB 4G91C 1U35D 5AVCA 1F1EA 3MGRC 5AY8A 3EPLA 1JFIB 4WV4B 3AYWD 4H9OA 4HGAB 3MVDD 3WTPD 3AZGB 1P3MD 2F8NB 3AZKC 2BG1A 2YFVB 4DQYB 2CV5B 1KX5B 3X1SC 4DRAA 3VH6W 3A6ND 3W97B 5JA4B 1P3IC 3AZJD 3MGQD 3UT9A 4UUZB 5B0YD 3REIC 2JSSA 1TZYD 1BH9A 2Y2OA 4XUJB 5GT0A 2Y2PA 1P3AA 5AVBA 3KUYD 4YS3B 1P3OA 5B24C 1S32A 3VH5A 2YFWB 3MGSC 4J8WA 1U35C 3AZFD 4J8XC 5B40B 1T3UA 4NE6A 5BNVB 1N1JB 3AZHA 2NQBD 3MVDC 5B2JD 3WTPC 4XZQD 1KU5A 3V9RB 5B33B 1P3MC 4LD9A 5CP6C 1P3BD 5AV8B 3MGQC 3AZJC 1KX4D 1H3OA 3WKJA 4CSRA 5B0YC 3X1UD 2NZDD 5B0ZA 1TZYC 3AZIA 2AROB 4ZBJB 3LZ1A 2FJ7A 5DNMD 5C3IC 3KUYC 3AZMD 3KXBA 3TU4A 4J8UB 3B0CT 3O62C 5B1LC 4KHAB 3UTAA 3MGPD 3AZED 3W98B 2NQBC 3AN2D 5B2JC 1HQ3A 4XZQC 4WNNA 4X23C 3AFAB 1P3BC 5GSUA 3KWQA 3AV1D 5KDMB 2HIOD 3X1UC 5AV9A 4WU8B 2UWXA 1ZLAB 5DNND 5DNMC 3W99A 3VH5T 2F2AC 3AZMC 3LZ0D 4J8VC 4QLCA 3AL0C 5JRGB 5GT3A 3AV2D 3B0CW 3W96A 3MGPC 1P3PA 5FUGB 3AN2C 5AV5D 4WJ3C 3REHA 5BS7A 1M19D 3AV1C 1R4VA 2PYOD 2HIOC 5BNXA 4KGCD 1BH9B 5GT0B 3MNNB 3NQUA 1P34D 4WU9B 5CPID 5E5AB 1M18A 3VH5W 1P3FA 3AV2C 3B6FA 3LJAD 5AV5C 4YM6A 1EQZA 1M19C 3AZGD 3KSYA 5BO0A 1H3OB 4CSRB 2CV5D 2DF4C 1KX5D 4H9RA 3MGRA 2PYOC 3W97D 5B32A 3LZ1B 4KGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK A;  3WTP E;  1F66 D;  1P34 C;  3X1S A;  4KUD A;  5CPI C;  3R45 A;  4XUJ D;  4H9N A;  4YS3 D;  2F8N K;  4H9S C;  4JJN C;  1HQ3 B;  3WAA B;  3LJA C;  5B40 D;  5F99 A;  2CWE A;  3NQJ A;  4HGA C;  5B24 A;  3AZG C;  3UTB A;  5G49 B;  3MGS A;  1U35 A;  2CV5 C;  1KX5 C;  2RVQ C;  3W97 C;  3AYW A;  3WTP A;  5B31 B;  1P3M A;  4NFT A;  1M1A B;  2ARO D;  1ID3 B;  4J8X D;  3A6N A;  4XUJ C;  5AV6 A;  3AZJ A;  3MGQ A;  4YS3 C;  3W96 B;  5B0Y A;  1B6W A;  4J8U D;  1TZY A;  3AZL B;  5CP6 D;  5B40 C;  3KUY A;  3W98 D;  5B33 C;  5BNX B;  3AZF A;  4H9Q A;  3AFA D;  1WWS A;  2NQB A;  5AV8 C;  3NQU B;  5B2J A;  4XZQ A;  3C1C B;  3O62 D;  4WU8 D;  2ARO C;  4ZBJ C;  5B1L D;  4R8P B;  5CPJ B;  1P3G B;  1ULY A;  1P3B A;  3B6G A;  3X1V B;  1KX4 A;  4ZUX B;  1AOI B;  3X1U A;  3B6F B;  2NZD A;  4J8U C;  5GXQ B;  4X23 D;  5JRG D;  2BYK A;  1EQZ B;  5DNM A;  3W98 C;  5BO0 B;  3AZM A;  4H9R B;  2BYM A;  5B32 B;  4Z5T B;  3AFA C;  3MGP A;  3AZE A;  3AN2 A;  4J8V D;  4KUD B;  4WU8 C;  4Z2M G;  2IO5 B;  1ZLA C;  1BH8 B;  5GT0 D;  3MNN D;  3AV1 A;  4WU9 D;  3REL B;  5E5A D;  3LEL B;  2HIO A;  5CHL B;  2F8N G;  5JRG C;  5F99 B;  5DNN A;  5B1M B;  3REJ A;  3B0B A;  3X1T B;  3WA9 B;  3REK B;  3UTB B;  3LZ0 A;  4Z66 B;  1P3L B;  3AZN B;  3AYW B;  5AV5 A;  5AVC B;  4AWL B;  3LZ1 D;  5AY8 B;  3A6N B;  1M19 A;  5AV6 B;  4H9O B;  5GT0 C;  3MNN C;  4WU9 C;  5E5A C;  1TAF A;  4EO5 B;  1P3K A;  3UT9 B;  4H9P A;  1P34 A;  1HQ3 D;  3WAA D;  5CPI A;  1WWI A;  3AZF B;  4H9S A;  4CAY A;  1P3A B;  5AVB B;  1P3O B;  4G92 B;  1KX3 A;  3LJA A;  1S32 B;  4J8W B;  5CPK A;  3LZ1 C;  3W99 B;  3B6G B;  3AZH B;  5B31 D;  4JJN D;  1KX4 B;  2YFV A;  1M1A D;  2CV5 A;  2NZD B;  1ID3 D;  3W97 A;  4LD9 B;  5JA4 A;  5B2I A;  1Q9C A;  4UUZ A;  3C1B A;  2F8N D;  3WKJ B;  1F66 A;  1HQ3 C;  3WAA C;  5B0Z B;  2RVQ D;  3AZL D;  3AZI B;  2FJ7 B;  2BYM B;  4XUJ A;  4YS3 A;  3AZE B;  3KXB B;  3TU4 B;  1P3I A;  5B40 A;  5BNV A;  1N1J A;  3UTA B;  3REI A;  3C1C D;  3V9R A;  5B31 C;  1M1A C;  4WNN B;  1ID3 C;  4R8P D;  5CPJ D;  1P3G D;  3X1V D;  5DNN B;  4ZUX D;  3W96 C;  5GSU B;  3KWQ B;  3REJ B;  5B33 D;  1AOI D;  3LZ0 B;  5GXQ D;  2ARO A;  5AV9 B;  3AZL C;  4J8X A;  5AV8 D;  3MVD A;  4QLC B;  2LY8 A;  5B32 D;  4Z5T D;  4KHA A;  5CP6 A;  5GT3 B;  3W98 A;  4NE3 A;  1P3P B;  3C1C C;  4KUD D;  3REH B;  1TAF B;  4R8P C;  1P3K B;  3AFA A;  5CPJ C;  1P3G C;  3X1V C;  4ZUX C;  3REL D;  3LEL D;  1BFM A;  1AOI C;  3B6F C;  3O62 A;  2HUE B;  4WU8 A;  5GXQ C;  5B1L A;  1EQZ C;  5B1M D;  3X1T D;  3WA9 D;  3REK D;  3UTB D;  1KX3 B;  4Z66 D;  5CPK B;  4X23 A;  1P3L D;  1M18 B;  1ZLA D;  5B32 C;  5JRG A;  4Z5T C;  3AZN D;  1P3F B;  5FUG A;  3B0D B;  5AVC D;  4KUD C;  5AY8 D;  2IO5 C;  1A7W A;  5B2I B;  5AV6 D;  4YM6 B;  3C1B B;  1F66 B;  4J8V A;  4G91 B;  4NE5 A;  3LEL C;  3REL C;  3MGR B;  3MNN A;  5F99 C;  3UT9 D;  5B1M C;  3AZK B;  3X1T C;  3WA9 C;  4WU9 A;  3REK C;  3UTB C;  5E5A A;  3X1S B;  3R45 B;  4Z66 C;  1P3L C;  1P3I B;  5B31 G;  4H9N B;  5AVB D;  3AZN C;  3AYW C;  1P3A D;  1P3O D;  3REI B;  1S32 D;  4E44 A;  4J8W D;  5AVC C;  4AWL C;  5AY8 C;  3A6N C;  3W99 D;  3B6G D;  3NQJ B;  5AV6 C;  3AZH D;  5B24 B;  4M6B A;  3MGS B;  1U35 B;  4LD9 D;  4EO5 C;  4J8X B;  3UT9 C;  3MVD B;  3WTP B;  3AV2 A;  3WKJ D;  1P3M B;  5B0Z D;  3AZI D;  2FJ7 D;  3AZF C;  2L5A A;  5CP6 B;  3AZJ B;  3MGQ B;  1P3A C;  5AVB C;  1P3O C;  4G92 C;  5B0Y B;  3KXB D;  3WAA A;  3TU4 D;  1S32 C;  2PYO A;  1TZY B;  4J8W C;  4KGC A;  3UTA D;  3W99 C;  5C3I B;  3B6G C;  3KUY B;  3AZH C;  1KX4 C;  5G49 A;  4DRB A;  2NZD C;  3O62 B;  4LD9 C;  1B67 A;  4H9Q B;  5B1L B;  5GSU D;  3KWQ D;  3REJ D;  2NQB B;  3WKJ C;  5B31 A;  5B2J B;  4JJN A;  4XZQ B;  5B32 G;  1M1A A;  5B0Z C;  5AV9 D;  1ID3 A;  4X23 B;  3AZI C;  2FJ7 C;  1JFI A;  1P3B B;  3AZG A;  2F8N A;  3AZE C;  3KXB C;  3VH6 A;  3X1U B;  1KX5 A;  4QLC D;  3TU4 C;  3AZL A;  2BYK B;  5GT3 D;  5DNM B;  3UTA C;  3W96 D;  1P3P D;  3AZM B;  4J8V B;  3REH D;  1P3K D;  5DNN C;  3MGP B;  5GSU C;  3KWQ C;  3C1C A;  3REJ C;  3AN2 B;  1HTA A;  2YFW A;  3LZ0 C;  5AV9 C;  4R8P A;  5CPJ A;  1P3G A;  3X1V A;  5BT1 D;  4ZUX A;  3AV1 B;  1KX3 D;  5B33 A;  1AOI A;  4Z2M H;  2HIO B;  5GXQ A;  5CPK D;  4QLC C;  1M18 D;  4WZS B;  1P3F D;  5AV8 A;  5GT3 C;  1P3P C;  3B6F D;  2F8N H;  3REH C;  5BS7 C;  4Z5T A;  5B2I D;  4YM6 D;  1P3K C;  1EQZ D;  3C1B D;  3AV2 B;  4J8U A;  3MGR D;  5AV5 B;  2HUE C;  4E45 A;  1BH8 A;  1M19 B;  3AZK D;  3VH6 T;  5BT1 C;  3REL A;  3LEL A;  1KX3 C;  3X1S D;  2PYO B;  5CPK C;  1M18 C;  1P3I D;  4KGC B;  1P3F C;  5B1M A;  3REI D;  3X1T A;  3WA9 A;  4H9P B;  3REK A;  1P34 B;  5KDM A;  3B0D C;  5CPI B;  4Z66 A;  1P3L A;  1ZLA A;  5F99 D;  3AZN A;  5B2I C;  4YM6 C;  5B24 D;  4CAY B;  3C1B C;  4JJN B;  1F66 C;  3MGS D;  3LJA B;  4G91 C;  1U35 D;  5AVC A;  1F1E A;  3MGR C;  5AY8 A;  1JFI B;  4WV4 B;  3AYW D;  4H9O A;  4HGA B;  3MVD D;  3WTP D;  3AZG B;  1P3M D;  2F8N B;  3AZK C;  2YFV B;  2CV5 B;  1KX5 B;  3X1S C;  4DRA A;  3VH6 W;  3A6N D;  3W97 B;  5JA4 B;  1P3I C;  3AZJ D;  3MGQ D;  3UT9 A;  4UUZ B;  5B0Y D;  3REI C;  2JSS A;  1TZY D;  1BH9 A;  4XUJ B;  5GT0 A;  1P3A A;  5AVB A;  3KUY D;  4YS3 B;  1P3O A;  5B24 C;  1S32 A;  3VH5 A;  2YFW B;  3MGS C;  4J8W A;  1U35 C;  3AZF D;  4J8X C;  5B40 B;  4NE6 A;  5BNV B;  2NQB D;  1N1J B;  3AZH A;  3W99 A;  3MVD C;  5B2J D;  3WTP C;  4XZQ D;  1KU5 A;  3V9R B;  5B33 B;  1P3M C;  4LD9 A;  5CP6 C;  1P3B D;  5AV8 B;  3MGQ C;  3AZJ C;  1KX4 D;  1H3O A;  3WKJ A;  4CSR A;  5B0Y C;  3X1U D;  2NZD D;  5B0Z A;  1TZY C;  3AZI A;  2ARO B;  4ZBJ B;  3LZ1 A;  2FJ7 A;  5DNM D;  5C3I C;  3KUY C;  3AZM D;  3KXB A;  3TU4 A;  4J8U B;  3B0C T;  3O62 C;  5B1L C;  4KHA B;  3UTA A;  3MGP D;  3AZE D;  3W98 B;  2NQB C;  3AN2 D;  5B2J C;  1HQ3 A;  4XZQ C;  4WNN A;  4X23 C;  3AFA B;  1P3B C;  5GSU A;  3KWQ A;  3AV1 D;  5KDM B;  2HIO D;  3X1U C;  5AV9 A;  4WU8 B;  1ZLA B;  5DNN D;  5DNM C;  3VH5 T;  3AZM C;  3LZ0 D;  4J8V C;  4QLC A;  5JRG B;  5GT3 A;  3AV2 D;  3B0C W;  3W96 A;  3MGP C;  1P3P A;  5FUG B;  3AN2 C;  5AV5 D;  3REH A;  5BS7 A;  1M19 D;  3AV1 C;  1R4V A;  2PYO D;  2HIO C;  5BNX A;  4KGC D;  1BH9 B;  5GT0 B;  3MNN B;  3NQU A;  1P34 D;  4WU9 B;  5CPI D;  5E5A B;  1M18 A;  3VH5 W;  1P3F A;  3AV2 C;  3B6F A;  3LJA D;  5AV5 C;  4YM6 A;  1EQZ A;  1M19 C;  3AZG D;  3KSY A;  5BO0 A;  1H3O B;  4CSR B;  2CV5 D;  1KX5 D;  4H9R A;  3MGR A;  2PYO C;  3W97 D;  5B32 A;  3LZ1 B;  4KGC C; 
#chains in the Genus database with same CATH topology
 2FFF B;  3AZK A;  3WTP E;  1F66 D;  1P34 C;  3X1S A;  4KUD A;  2Y2G A;  5CPI C;  3R45 A;  4XUJ D;  4H9N A;  4YS3 D;  2F8N K;  4H9S C;  4JJN C;  1HQ3 B;  2Y2H A;  3WAA B;  3LJA C;  5B40 D;  2RIQ A;  5F99 A;  2CWE A;  3NQJ A;  4HGA C;  5B24 A;  3AZG C;  3UTB A;  5G49 B;  3MGS A;  2J8P A;  1U35 A;  2CV5 C;  1KX5 C;  2RVQ C;  3H0L C;  3W97 C;  3AYW A;  3WTP A;  5B31 B;  1P3M A;  4NFT A;  3KFU G;  1M1A B;  2ARO D;  1ID3 B;  4J8X D;  3A6N A;  3EG5 B;  2Y2N A;  3H0R C;  4XUJ C;  5AV6 A;  3MGQ A;  4YS3 C;  3AZJ A;  3W96 B;  5B0Y A;  1B6W A;  4J8U D;  1TZY A;  2ZY5 A;  3AZL B;  5CP6 D;  3A1K A;  5B40 C;  3KUY A;  3W98 D;  2XD5 A;  5B33 C;  5BNX B;  3AZF A;  4H9Q A;  3AFA D;  1WWS A;  2NQB A;  5AV8 C;  3NQU B;  5B2J A;  4XZQ A;  3C1C B;  3O62 D;  4WU8 D;  2ARO C;  4ZBJ C;  5B1L D;  4R8P B;  5CPJ B;  1P3G B;  1ULY A;  1P3B A;  3B6G A;  3X1V B;  1KX4 A;  3FDD A;  4ZUX B;  1AOI B;  3X1U A;  3B6F B;  2NZD A;  4J8U C;  5GXQ B;  4X23 D;  5JRG D;  2BYK A;  1EQZ B;  5DNM A;  3W98 C;  5BO0 B;  3AZM A;  4H9R B;  2BYM A;  5B32 B;  4Z5T B;  3AFA C;  3F6T A;  3MGP A;  3AZE A;  3AN2 A;  4J8V D;  4KUD B;  4WU8 C;  4Z2M G;  2IO5 B;  3P5J B;  1ZLA C;  1BH8 B;  5GT0 D;  3MNN D;  3AV1 A;  3A1I A;  4WU9 D;  3REL B;  5E5A D;  2DQN C;  3LEL B;  2HIO A;  5CHL B;  2F8N G;  5JRG C;  5F99 B;  5DNN A;  5B1M B;  3REJ A;  3B0B A;  3X1T B;  3WA9 B;  3REK B;  3UTB B;  3LZ0 A;  2G5I C;  4Z66 B;  1PZR A;  1P3L B;  3AZN B;  3AYW B;  5AV5 A;  5AVC B;  4AWL B;  3LZ1 D;  5AY8 B;  3A6N B;  3EPK A;  1M19 A;  5AV6 B;  4H9O B;  5GT0 C;  3MNN C;  2ZY3 A;  2ZM5 A;  4WU9 C;  5E5A C;  1TAF A;  3EPH A;  4EO5 B;  1P3K A;  3UT9 B;  4H9P A;  1P34 A;  1HQ3 D;  3WAA D;  5CPI A;  1WWI A;  3AZF B;  2Y2K A;  4H9S A;  2JE5 A;  4CAY A;  1P3A B;  5AVB B;  1P3O B;  4G92 B;  1KX3 A;  3LJA A;  1S32 B;  4J8W B;  5CPK A;  3LZ1 C;  3W99 B;  3B6G B;  3AZH B;  2Y2Q A;  5B31 D;  4JJN D;  1KX4 B;  2YFV A;  1M1A D;  2CV5 A;  2NZD B;  1ID3 D;  3W97 A;  4LD9 B;  5JA4 A;  5B2I A;  1Q9C A;  4UUZ A;  3C1B A;  2F8N D;  3WKJ B;  1F66 A;  1HQ3 C;  3WAA C;  5B0Z B;  2RVQ D;  3AZL D;  3AZI B;  2FJ7 B;  2BYM B;  4XUJ A;  4YS3 A;  1W2E A;  3AZE B;  3KXB B;  3TU4 B;  3IP4 C;  1P3I A;  5B40 A;  5BNV A;  1N1J A;  3UTA B;  3REI A;  3C1C D;  3V9R A;  5B31 C;  1M1A C;  4WNN B;  1ID3 C;  4R8P D;  5CPJ D;  1P3G D;  3X1V D;  5DNN B;  4ZUX D;  3W96 C;  5GSU B;  3KWQ B;  3REJ B;  5B33 D;  1AOI D;  3LZ0 B;  5GXQ D;  2ARO A;  2G5H C;  5AV9 B;  3AZL C;  4J8X A;  5AV8 D;  2Y2M A;  3MVD A;  4QLC B;  2LY8 A;  5B32 D;  4Z5T D;  4KHA A;  5CP6 A;  5GT3 B;  3W98 A;  4NE3 A;  1P3P B;  3C1C C;  4KUD D;  3REH B;  1TAF B;  4R8P C;  1P3K B;  3AFA A;  5CPJ C;  1P3G C;  3X1V C;  4ZUX C;  3REL D;  3LEL D;  1BFM A;  1AOI C;  3B6F C;  3O62 A;  2HUE B;  4WU8 A;  5GXQ C;  5B1L A;  1EQZ C;  4UPK A;  5B1M D;  3X1T D;  3WA9 D;  3REK D;  3UTB D;  1KX3 B;  4Z66 D;  5CPK B;  4X23 A;  1P3L D;  1M18 B;  2Y2I A;  1ZLA D;  5B32 C;  5JRG A;  4Z5T C;  3AZN D;  1P3F B;  5FUG A;  3B0D B;  5AVC D;  2ZY2 A;  4KUD C;  5AY8 D;  2IO5 C;  1A7W A;  5B2I B;  5AV6 D;  4YM6 B;  3C1B B;  2W8S A;  1F66 B;  4J8V A;  4G91 B;  4NE5 A;  3LEL C;  3REL C;  3MGR B;  3MNN A;  5F99 C;  3UT9 D;  2Y2J A;  5B1M C;  3AZK B;  3X1T C;  3WA9 C;  4WU9 A;  3REK C;  3UTB C;  5E5A A;  3X1S B;  3R45 B;  4Z66 C;  1P3L C;  1P3I B;  5B31 G;  4H9N B;  5AVB D;  3AZN C;  3AYW C;  1P3A D;  1P3O D;  3REI B;  1S32 D;  4E44 A;  4J8W D;  5AVC C;  4AWL C;  5AY8 C;  3A6N C;  3EPJ A;  3W99 D;  3B6G D;  3NQJ B;  5AV6 C;  3AZH D;  5B24 B;  4M6B A;  3MGS B;  1U35 B;  4LD9 D;  4EO5 C;  4J8X B;  3UT9 C;  3MVD B;  3WTP B;  3AV2 A;  3WKJ D;  1P3M B;  5B0Z D;  3AZI D;  2FJ7 D;  3AZF C;  2L5A A;  5CP6 B;  3AZJ B;  3MGQ B;  1P3A C;  5AVB C;  1P3O C;  4G92 C;  5B0Y B;  3KXB D;  3WAA A;  3TU4 D;  1S32 C;  2PYO A;  1TZY B;  4J8W C;  4KGC A;  3UTA D;  3W99 C;  5C3I B;  3B6G C;  3KUY B;  3AZH C;  2XD1 A;  1KX4 C;  5G49 A;  4DRB A;  2NZD C;  3O62 B;  2VQR A;  4LD9 C;  1B67 A;  4H9Q B;  5B1L B;  5GSU D;  3KWQ D;  3REJ D;  2NQB B;  3WKJ C;  5B31 A;  5B2J B;  4JJN A;  4XZQ B;  5B32 G;  1M1A A;  5B0Z C;  5AV9 D;  1ID3 A;  4X23 B;  3AZI C;  2FJ7 C;  1JFI A;  1P3B B;  3AZG A;  2F8N A;  3AZE C;  3KXB C;  3VH6 A;  3X1U B;  1KX5 A;  4QLC D;  3TU4 C;  1Z2C B;  3AZL A;  2BYK B;  5GT3 D;  3H0M C;  5DNM B;  3UTA C;  3W96 D;  1P3P D;  3AZM B;  4J8V B;  3REH D;  1P3K D;  5DNN C;  3MGP B;  5GSU C;  3KWQ C;  3C1C A;  3REJ C;  3AN2 B;  1HTA A;  2YFW A;  3LZ0 C;  5AV9 C;  4R8P A;  5CPJ A;  1P3G A;  3X1V A;  5BT1 D;  4ZUX A;  3AV1 B;  1KX3 D;  2ZY4 A;  5B33 A;  1AOI A;  4Z2M H;  2HIO B;  5GXQ A;  5CPK D;  4QLC C;  1M18 D;  4WZS B;  1P3F D;  5AV8 A;  5GT3 C;  1P3P C;  3B6F D;  2F8N H;  3REH C;  5BS7 C;  4Z5T A;  5B2I D;  4YM6 D;  1P3K C;  1EQZ D;  3C1B D;  3AV2 B;  4J8U A;  3MGR D;  5AV5 B;  2HUE C;  4E45 A;  1BH8 A;  1M19 B;  3AZK D;  3VH6 T;  5BT1 C;  3REL A;  3LEL A;  1KX3 C;  3X1S D;  2PYO B;  5CPK C;  1M18 C;  1P3I D;  4KGC B;  1P3F C;  5B1M A;  3REI D;  3X1T A;  3WA9 A;  4H9P B;  3REK A;  1P34 B;  5KDM A;  2JCH A;  3B0D C;  5CPI B;  4Z66 A;  1P3L A;  1ZLA A;  5F99 D;  3AZN A;  5B2I C;  4YM6 C;  5B24 D;  4CAY B;  2Y2L A;  3C1B C;  4JJN B;  1F66 C;  3MGS D;  3LJA B;  4G91 C;  1U35 D;  5AVC A;  1F1E A;  3MGR C;  5AY8 A;  3EPL A;  1JFI B;  4WV4 B;  3AYW D;  4H9O A;  4HGA B;  3MVD D;  3WTP D;  3AZG B;  1P3M D;  2F8N B;  3AZK C;  2BG1 A;  2YFV B;  4DQY B;  2CV5 B;  1KX5 B;  3X1S C;  4DRA A;  3VH6 W;  3A6N D;  3W97 B;  5JA4 B;  1P3I C;  3AZJ D;  3MGQ D;  3UT9 A;  4UUZ B;  5B0Y D;  3REI C;  2JSS A;  1TZY D;  1BH9 A;  2Y2O A;  4XUJ B;  5GT0 A;  2Y2P A;  1P3A A;  5AVB A;  3KUY D;  4YS3 B;  1P3O A;  5B24 C;  1S32 A;  3VH5 A;  2YFW B;  3MGS C;  4J8W A;  1U35 C;  3AZF D;  4J8X C;  5B40 B;  1T3U A;  4NE6 A;  5BNV B;  1N1J B;  3AZH A;  2NQB D;  3MVD C;  5B2J D;  3WTP C;  4XZQ D;  1KU5 A;  3V9R B;  5B33 B;  1P3M C;  4LD9 A;  5CP6 C;  1P3B D;  5AV8 B;  3MGQ C;  3AZJ C;  1KX4 D;  1H3O A;  3WKJ A;  4CSR A;  5B0Y C;  3X1U D;  2NZD D;  5B0Z A;  1TZY C;  3AZI A;  2ARO B;  4ZBJ B;  3LZ1 A;  2FJ7 A;  5DNM D;  5C3I C;  3KUY C;  3AZM D;  3KXB A;  3TU4 A;  4J8U B;  3B0C T;  3O62 C;  5B1L C;  4KHA B;  3UTA A;  3MGP D;  3AZE D;  3W98 B;  2NQB C;  3AN2 D;  5B2J C;  1HQ3 A;  4XZQ C;  4WNN A;  4X23 C;  3AFA B;  1P3B C;  5GSU A;  3KWQ A;  3AV1 D;  5KDM B;  2HIO D;  3X1U C;  5AV9 A;  4WU8 B;  2UWX A;  1ZLA B;  5DNN D;  5DNM C;  3W99 A;  3VH5 T;  2F2A C;  3AZM C;  3LZ0 D;  4J8V C;  4QLC A;  3AL0 C;  5JRG B;  5GT3 A;  3AV2 D;  3B0C W;  3W96 A;  3MGP C;  1P3P A;  5FUG B;  3AN2 C;  5AV5 D;  4WJ3 C;  3REH A;  5BS7 A;  1M19 D;  3AV1 C;  1R4V A;  2PYO D;  2HIO C;  5BNX A;  4KGC D;  1BH9 B;  5GT0 B;  3MNN B;  3NQU A;  1P34 D;  4WU9 B;  5CPI D;  5E5A B;  1M18 A;  3VH5 W;  1P3F A;  3AV2 C;  3B6F A;  3LJA D;  5AV5 C;  4YM6 A;  1EQZ A;  1M19 C;  3AZG D;  3KSY A;  5BO0 A;  1H3O B;  4CSR B;  2CV5 D;  2DF4 C;  1KX5 D;  4H9R A;  3MGR A;  2PYO C;  3W97 D;  5B32 A;  3LZ1 B;  4KGC C; 
#chains in the Genus database with same CATH homology
 2FFF B;  3AZK A;  3WTP E;  1F66 D;  1P34 C;  3X1S A;  4KUD A;  2Y2G A;  5CPI C;  3R45 A;  4XUJ D;  4H9N A;  4YS3 D;  2F8N K;  4H9S C;  4JJN C;  1HQ3 B;  2Y2H A;  3WAA B;  3LJA C;  5B40 D;  2RIQ A;  5F99 A;  2CWE A;  3NQJ A;  4HGA C;  5B24 A;  3AZG C;  3UTB A;  5G49 B;  3MGS A;  2J8P A;  1U35 A;  2CV5 C;  1KX5 C;  2RVQ C;  3H0L C;  3W97 C;  3AYW A;  3WTP A;  5B31 B;  1P3M A;  4NFT A;  3KFU G;  1M1A B;  2ARO D;  1ID3 B;  4J8X D;  3A6N A;  3EG5 B;  2Y2N A;  3H0R C;  4XUJ C;  5AV6 A;  3MGQ A;  4YS3 C;  3AZJ A;  3W96 B;  5B0Y A;  1B6W A;  4J8U D;  1TZY A;  2ZY5 A;  3AZL B;  5CP6 D;  3A1K A;  5B40 C;  3KUY A;  3W98 D;  2XD5 A;  5B33 C;  5BNX B;  3AZF A;  4H9Q A;  3AFA D;  1WWS A;  2NQB A;  5AV8 C;  3NQU B;  5B2J A;  4XZQ A;  3C1C B;  3O62 D;  4WU8 D;  2ARO C;  4ZBJ C;  5B1L D;  4R8P B;  5CPJ B;  1P3G B;  1ULY A;  1P3B A;  3B6G A;  3X1V B;  1KX4 A;  3FDD A;  4ZUX B;  1AOI B;  3X1U A;  3B6F B;  2NZD A;  4J8U C;  5GXQ B;  4X23 D;  5JRG D;  2BYK A;  1EQZ B;  5DNM A;  3W98 C;  5BO0 B;  3AZM A;  4H9R B;  2BYM A;  5B32 B;  4Z5T B;  3AFA C;  3F6T A;  3MGP A;  3AZE A;  3AN2 A;  4J8V D;  4KUD B;  4WU8 C;  4Z2M G;  2IO5 B;  3P5J B;  1ZLA C;  1BH8 B;  5GT0 D;  3MNN D;  3AV1 A;  3A1I A;  4WU9 D;  3REL B;  5E5A D;  2DQN C;  3LEL B;  2HIO A;  5CHL B;  2F8N G;  5JRG C;  5F99 B;  5DNN A;  5B1M B;  3REJ A;  3B0B A;  3X1T B;  3WA9 B;  3REK B;  3UTB B;  3LZ0 A;  2G5I C;  4Z66 B;  1PZR A;  1P3L B;  3AZN B;  3AYW B;  5AV5 A;  5AVC B;  4AWL B;  3LZ1 D;  5AY8 B;  3A6N B;  3EPK A;  1M19 A;  5AV6 B;  4H9O B;  5GT0 C;  3MNN C;  2ZY3 A;  2ZM5 A;  4WU9 C;  5E5A C;  1TAF A;  3EPH A;  4EO5 B;  1P3K A;  3UT9 B;  4H9P A;  1P34 A;  1HQ3 D;  3WAA D;  5CPI A;  1WWI A;  3AZF B;  2Y2K A;  4H9S A;  2JE5 A;  4CAY A;  1P3A B;  5AVB B;  1P3O B;  4G92 B;  1KX3 A;  3LJA A;  1S32 B;  4J8W B;  5CPK A;  3LZ1 C;  3W99 B;  3B6G B;  3AZH B;  2Y2Q A;  5B31 D;  4JJN D;  1KX4 B;  2YFV A;  1M1A D;  2CV5 A;  2NZD B;  1ID3 D;  3W97 A;  4LD9 B;  5JA4 A;  5B2I A;  1Q9C A;  4UUZ A;  3C1B A;  2F8N D;  3WKJ B;  1F66 A;  1HQ3 C;  3WAA C;  5B0Z B;  2RVQ D;  3AZL D;  3AZI B;  2FJ7 B;  2BYM B;  4XUJ A;  4YS3 A;  1W2E A;  3AZE B;  3KXB B;  3TU4 B;  3IP4 C;  1P3I A;  5B40 A;  5BNV A;  1N1J A;  3UTA B;  3REI A;  3C1C D;  3V9R A;  5B31 C;  1M1A C;  4WNN B;  1ID3 C;  4R8P D;  5CPJ D;  1P3G D;  3X1V D;  5DNN B;  4ZUX D;  3W96 C;  5GSU B;  3KWQ B;  3REJ B;  5B33 D;  1AOI D;  3LZ0 B;  5GXQ D;  2ARO A;  2G5H C;  5AV9 B;  3AZL C;  4J8X A;  5AV8 D;  2Y2M A;  3MVD A;  4QLC B;  2LY8 A;  5B32 D;  4Z5T D;  4KHA A;  5CP6 A;  5GT3 B;  3W98 A;  4NE3 A;  1P3P B;  3C1C C;  4KUD D;  3REH B;  1TAF B;  4R8P C;  1P3K B;  3AFA A;  5CPJ C;  1P3G C;  3X1V C;  4ZUX C;  3REL D;  3LEL D;  1BFM A;  1AOI C;  3B6F C;  3O62 A;  2HUE B;  4WU8 A;  5GXQ C;  5B1L A;  1EQZ C;  4UPK A;  5B1M D;  3X1T D;  3WA9 D;  3REK D;  3UTB D;  1KX3 B;  4Z66 D;  5CPK B;  4X23 A;  1P3L D;  1M18 B;  2Y2I A;  1ZLA D;  5B32 C;  5JRG A;  4Z5T C;  3AZN D;  1P3F B;  5FUG A;  3B0D B;  5AVC D;  2ZY2 A;  4KUD C;  5AY8 D;  2IO5 C;  1A7W A;  5B2I B;  5AV6 D;  4YM6 B;  3C1B B;  2W8S A;  1F66 B;  4J8V A;  4G91 B;  4NE5 A;  3LEL C;  3REL C;  3MGR B;  3MNN A;  5F99 C;  3UT9 D;  2Y2J A;  5B1M C;  3AZK B;  3X1T C;  3WA9 C;  4WU9 A;  3REK C;  3UTB C;  5E5A A;  3X1S B;  3R45 B;  4Z66 C;  1P3L C;  1P3I B;  5B31 G;  4H9N B;  5AVB D;  3AZN C;  3AYW C;  1P3A D;  1P3O D;  3REI B;  1S32 D;  4E44 A;  4J8W D;  5AVC C;  4AWL C;  5AY8 C;  3A6N C;  3EPJ A;  3W99 D;  3B6G D;  3NQJ B;  5AV6 C;  3AZH D;  5B24 B;  4M6B A;  3MGS B;  1U35 B;  4LD9 D;  4EO5 C;  4J8X B;  3UT9 C;  3MVD B;  3WTP B;  3AV2 A;  3WKJ D;  1P3M B;  5B0Z D;  3AZI D;  2FJ7 D;  3AZF C;  2L5A A;  5CP6 B;  3AZJ B;  3MGQ B;  1P3A C;  5AVB C;  1P3O C;  4G92 C;  5B0Y B;  3KXB D;  3WAA A;  3TU4 D;  1S32 C;  2PYO A;  1TZY B;  4J8W C;  4KGC A;  3UTA D;  3W99 C;  5C3I B;  3B6G C;  3KUY B;  3AZH C;  2XD1 A;  1KX4 C;  5G49 A;  4DRB A;  2NZD C;  3O62 B;  2VQR A;  4LD9 C;  1B67 A;  4H9Q B;  5B1L B;  5GSU D;  3KWQ D;  3REJ D;  2NQB B;  3WKJ C;  5B31 A;  5B2J B;  4JJN A;  4XZQ B;  5B32 G;  1M1A A;  5B0Z C;  5AV9 D;  1ID3 A;  4X23 B;  3AZI C;  2FJ7 C;  1JFI A;  1P3B B;  3AZG A;  2F8N A;  3AZE C;  3KXB C;  3VH6 A;  3X1U B;  1KX5 A;  4QLC D;  3TU4 C;  1Z2C B;  3AZL A;  2BYK B;  5GT3 D;  3H0M C;  5DNM B;  3UTA C;  3W96 D;  1P3P D;  3AZM B;  4J8V B;  3REH D;  1P3K D;  5DNN C;  3MGP B;  5GSU C;  3KWQ C;  3C1C A;  3REJ C;  3AN2 B;  1HTA A;  2YFW A;  3LZ0 C;  5AV9 C;  4R8P A;  5CPJ A;  1P3G A;  3X1V A;  5BT1 D;  4ZUX A;  3AV1 B;  1KX3 D;  2ZY4 A;  5B33 A;  1AOI A;  4Z2M H;  2HIO B;  5GXQ A;  5CPK D;  4QLC C;  1M18 D;  4WZS B;  1P3F D;  5AV8 A;  5GT3 C;  1P3P C;  3B6F D;  2F8N H;  3REH C;  5BS7 C;  4Z5T A;  5B2I D;  4YM6 D;  1P3K C;  1EQZ D;  3C1B D;  3AV2 B;  4J8U A;  3MGR D;  5AV5 B;  2HUE C;  4E45 A;  1BH8 A;  1M19 B;  3AZK D;  3VH6 T;  5BT1 C;  3REL A;  3LEL A;  1KX3 C;  3X1S D;  2PYO B;  5CPK C;  1M18 C;  1P3I D;  4KGC B;  1P3F C;  5B1M A;  3REI D;  3X1T A;  3WA9 A;  4H9P B;  3REK A;  1P34 B;  5KDM A;  2JCH A;  3B0D C;  5CPI B;  4Z66 A;  1P3L A;  1ZLA A;  5F99 D;  3AZN A;  5B2I C;  4YM6 C;  5B24 D;  4CAY B;  2Y2L A;  3C1B C;  4JJN B;  1F66 C;  3MGS D;  3LJA B;  4G91 C;  1U35 D;  5AVC A;  1F1E A;  3MGR C;  5AY8 A;  3EPL A;  1JFI B;  4WV4 B;  3AYW D;  4H9O A;  4HGA B;  3MVD D;  3WTP D;  3AZG B;  1P3M D;  2F8N B;  3AZK C;  2BG1 A;  2YFV B;  4DQY B;  2CV5 B;  1KX5 B;  3X1S C;  4DRA A;  3VH6 W;  3A6N D;  3W97 B;  5JA4 B;  1P3I C;  3AZJ D;  3MGQ D;  3UT9 A;  4UUZ B;  5B0Y D;  3REI C;  2JSS A;  1TZY D;  1BH9 A;  2Y2O A;  4XUJ B;  5GT0 A;  2Y2P A;  1P3A A;  5AVB A;  3KUY D;  4YS3 B;  1P3O A;  5B24 C;  1S32 A;  3VH5 A;  2YFW B;  3MGS C;  4J8W A;  1U35 C;  3AZF D;  4J8X C;  5B40 B;  1T3U A;  4NE6 A;  5BNV B;  1N1J B;  3AZH A;  2NQB D;  3MVD C;  5B2J D;  3WTP C;  4XZQ D;  1KU5 A;  3V9R B;  5B33 B;  1P3M C;  4LD9 A;  5CP6 C;  1P3B D;  5AV8 B;  3MGQ C;  3AZJ C;  1KX4 D;  1H3O A;  3WKJ A;  4CSR A;  5B0Y C;  3X1U D;  2NZD D;  5B0Z A;  1TZY C;  3AZI A;  2ARO B;  4ZBJ B;  3LZ1 A;  2FJ7 A;  5DNM D;  5C3I C;  3KUY C;  3AZM D;  3KXB A;  3TU4 A;  4J8U B;  3B0C T;  3O62 C;  5B1L C;  4KHA B;  3UTA A;  3MGP D;  3AZE D;  3W98 B;  2NQB C;  3AN2 D;  5B2J C;  1HQ3 A;  4XZQ C;  4WNN A;  4X23 C;  3AFA B;  1P3B C;  5GSU A;  3KWQ A;  3AV1 D;  5KDM B;  2HIO D;  3X1U C;  5AV9 A;  4WU8 B;  2UWX A;  1ZLA B;  5DNN D;  5DNM C;  3W99 A;  3VH5 T;  2F2A C;  3AZM C;  3LZ0 D;  4J8V C;  4QLC A;  3AL0 C;  5JRG B;  5GT3 A;  3AV2 D;  3B0C W;  3W96 A;  3MGP C;  1P3P A;  5FUG B;  3AN2 C;  5AV5 D;  4WJ3 C;  3REH A;  5BS7 A;  1M19 D;  3AV1 C;  1R4V A;  2PYO D;  2HIO C;  5BNX A;  4KGC D;  1BH9 B;  5GT0 B;  3MNN B;  3NQU A;  1P34 D;  4WU9 B;  5CPI D;  5E5A B;  1M18 A;  3VH5 W;  1P3F A;  3AV2 C;  3B6F A;  3LJA D;  5AV5 C;  4YM6 A;  1EQZ A;  1M19 C;  3AZG D;  3KSY A;  5BO0 A;  1H3O B;  4CSR B;  2CV5 D;  2DF4 C;  1KX5 D;  4H9R A;  3MGR A;  2PYO C;  3W97 D;  5B32 A;  3LZ1 B;  4KGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...