1HQ3B

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3B00
5DNMB 1P3AC 4J8VD 2BYMA 2BYKB 4ZUXA 4X23D 3W97C 3UTAD 1P3GA 4LD9A 3AZEA 1S32A 4ZUXD 1ULYA 4HGAB 4JJNA 1M18C 5B24C 4E44A 4H9RA 5B0YA 3B0CW 4JJND 5GT3B 1P3PD 3AN2C 3AZIC 3AZLC 5AV8B 3MGRC 3UTBA 5B0ZA 3WA9A 3AYWB 3MNNB 1P34C 5AVCB 5BT1D 5B33D 3B6GC 2HUEC 4ZBJB 5B0ZD 4H9SC 3O62B 4J8VC 4X23C 2FJ7C 3UTAC 3LELA 4ZUXC 5C3IC 3LELD 1HQ3A 4LD9C 3AZEC 1S32C 1HQ3D 1P3BB 4JJNC 3AZKA 4H9PB 1U35D 3AV2A 1P3PC 3VH6W 5BS7A 3AZHB 3KSYA 1KX3D 3AV2D 5E5AB 5B0ZC 4WU8A 3RELA 5AVBA 1B6WA 5GSUB 4DRAA 5GXQA 1P3MB 3WKJA 4R8PB 5JRGD 3RELD 4WU8D 5AVBD 5AV6A 4XZQA 3WAAD 3WKJD 3MVDD 3LELC 5AV6D 4XZQD 3WTPD 5BO0B 3AZFD 1HQ3C 5AV8A 3KUYB 3VH6A 2AROB 1BH9A 2L5AA 5CPKB 3UT9A 1U35C 2YFVB 4G91B 1KX3C 1Q9CA 5AV5B 3UT9D 3AV2C 3V9RB 5B2ID 3W96A 5CP6A 5BNXB 1EQZB 5JRGC 3RELC 4WU8C 5AVBC 3W96D 5CP6D 3WAAC 5GXQC 3WKJC 3MVDC 3REKA 5B32A 5KDMA 1KX5D 5AV6C 4H9PA 4XZQC 3WTPC 1BH8A 3REKD 5B32D 4J8WA 5G49B 2NZDD 1TZYA 4J8WD 3REID 3UT9C 1TZYD 1P3LB 1KU5A 3KXBB 3A6NB 1AOIB 4UUZB 3W96C 5CP6C 3LJAA 1KX5C 4J8UA 3AZJA 5B1MA 3REKC 5B32C 3LJAD 4J8XA 4J8UD 2F8NA 3AZJD 5B1MD 1F66A 4J8XD 5B31G 4AWLB 4J8WC 2F8ND 3REIC 1P3FB 3X1SA 3AZNB 1F66D 2LY8A 1TZYC 1ID3D 5BNXA 3AV1A 3X1VB 1WWIA 3AFAD 3REHB 5CPIB 3X1TB 4YM6B 3AV1D 3VH6T 1KX4B 3X1UB 4EO5C 3KWQB 5B2JA 1ZLAB 3C1BB 3AZMB 4XUJB 5G49A 5B2JD 3MGSB 3W99B 5CPJB 3LJAC 1M19A 4J8UC 1P3LA 3AZJC 5B1MC 2CV5A 1P3PB 1JFIB 4QLCA 1M19D 4J8XC 2IO5C 5FUGB 2CV5D 4QLCD 1F66C 1ID3C 5B33B 3TU4A 4G92C 4UUZA 3AFAC 5JA4B 2FJ7D 3W98B 1P3KA 2YFWA 3TU4D 3AV1C 1M1AB 2HIOA 5B1LA 2PYOB 1P3KD 1P3GD 4LD9D 3AZED 1S32D 4H9OA 5B1LD 5GT0B 5B2JC 4Z5TA 3NQUB 1P3FA 5B0YD 4E45A 3MGQB 4Z5TD 5B40B 5F99B 1M19C 3X1VA 3B6FA 2CV5C 4YM6A 4QLCC 3UTBD 3WA9D 3B6FD 3NQJB 3LZ1B 3AZGA 5B31A 3REJA 3TU4C 1B67A 3AZGD 3REJD 1P3KC 3MVDB 1P3GC 3WTPB 5AV9B 5B1LC 3AZFB 3C1CB 4KHAB 5B0YC 4Z5TC 3AZKD 5DNMA 4WU9B 2BYKA 4Z66B 5JA4A 5DNMD 3UTBC 3WA9C 1M1AA 3B6FC 3B0DC 4WV4B 5B2IB 5AY8B 1P3IB 4CAYB 3AZGC 5GXQD 5B31C 3REJC 1WWSA 3NQUA 2JSSA 5GT3A 5GT3D 5BNVB 3AYWA 5DNNB 3MNNA 5AVCA 5AV8D 2NZDB 3AYWD 3AZKC 2NQBB 5AVCD 3REIB 3MGPB 3O62A 5BS7C 4KUDB 5DNMC 3O62D 4NFTA 5AV9A 1P3OB 1P3BA 4H9NB 4HGAC 3LZ0B 1P3BD 3AZHA 4KGCB 1BFMA 5GT3C 5E5AA 3AZHD 4YS3B 5AV8C 3AYWC 5E5AD 3MNNC 5AVCC 5AY8A 5GSUA 4ZBJC 4CAYA 1P3MA 4R8PA 1P3AB 3O62C 3B0CT 5GSUD 1P3MD 3W97B 4R8PD 4H9QB 5BO0A 3KUYA 1M18B 1H3OB 1N1JB 2AROA 5B24B 5CPKA 1A7WA 2YFVA 1P3BC 3KUYD 2AROD 5AV5A 5CPKD 3MGPA 3V9RA 3AZHC 4KUDA 3R45B 3AN2B 3AZIB 3AZLB 5AV5D 3MGRB 5E5AC 1P34B 3B6GB 2HUEB 1EQZA 3X1SD 4Z2MG 1TAFB 5GSUC 4J8VB 1P3MC 1EQZD 4R8PC 4X23B 3LZ0A 2FJ7B 3UTAB 4KGCA 4ZUXB 4NE3A 5C3IB 4LD9B 3AZEB 1S32B 3KUYC 2AROC 4JJNB 5CPKC 4G91C 4H9RB 4WNNB 3KXBA 3VH5W 4NE5A 3A6NA 4WZSB 5AV5C 1P3LD 1AOIA 5B0ZB 3X1SC 2CWEA 1AOID 1EQZC 1H3OA 1N1JA 5B24A 1R4VA 2HIOD 3LELB 3R45A 3AZIA 3AZLA 1HQ3B 3B0BA 3VH5A 3AZNA 1U35B 1P3FD 1KX3B 3REHA 3AZND 5CHLB 5CPIA 4H9SA 3AV2B 3X1TA 1TAFA 1P3LC 4X23A 3X1VD 3A6NC 3REHD 5CPID 3X1TD 1KX4A 4YM6D 3X1UA 3KWQA 1AOIC 1ZLAA 3C1BA 3AZMA 4XUJA 5JRGB 4WU8B 3RELB 5B31D 5AVBB 3X1UD 3KWQD 1KX4D 3MGSA 1ZLAD 5GXQB 3W99A 3C1BD 3AZMD 5CPJA 4XUJD 3WKJB 3WAAB 2HIOC 5AV6B 4XZQB 3MGSD 3W99D 1P3PA 1JFIA 4WNNA 5CPJD 4DRBA 5FUGA 4AWLC 5B33A 1P3FC 1BH9B 3AZNC 3UT9B 3W98A 3X1VC 3REHC 5CPIC 5B32G 3X1TC 3W98D 2PYOA 4YM6C 1M1AD 2PYOD 1KX4C 3W96B 3X1UC 5CP6B 3KWQC 5GT0A 1ZLAC 2RVQD 3C1BC 3AZMC 4XUJC 1KX5B 3MGQA 1U35A 5GT0D 3MGSC 3W99C 3REKB 5CPJC 5B32B 5F99A 5KDMB 5B40A 1KX3A 3MGQD 1BH8B 5B40D 5F99D 3MNND 4J8WB 3NQJA 3LZ1A 1TZYB 5BT1C 5B33C 5JRGA 3LZ1D 3W98C 3WAAA 3MVDA 1M1AC 3WTPA 2PYOC 2F8NG 3AZFA 3VH5T 3C1CA 4EO5B 4KHAA 5AV9D 2RVQC 3C1CD 5GT0C 3LJAB 4J8UB 3MGQC 4WU9A 4Z66A 5B1MB 3AZJB 5B40C 5F99C 4J8XB 2IO5B 4WU9D 2F8NB 4Z66D 5B2IA 1P3IA 1F66B 1ID3B 5AY8D 3LZ1C 3X1SB 4G92B 3AFAB 1P3ID 3AV1B 1KX5A 4CSRB 2F8NH 5BNVA 5DNNA 5AV9C 3AZFC 3C1CC 2NZDA 5B2JB 5DNND 2NQBA 3REIA 2NQBD 1M19B 3MGPD 4WU9C 4KUDD 2F8NK 4Z66C 2CV5B 3WTPE 4QLCB 5B2IC 5AY8C 1P3IC 1P3OA 4H9NA 4NE6A 3TU4B 1F1EA 1P3OD 2BYMB 3LZ0D 1P3KB 2YFWB 1P3GB 2HIOB 4KGCD 5B1LB 4YS3A 1HTAA 5DNNC 4H9OB 4YS3D 5B0YB 2NZDC 1ID3A 4M6BA 4Z5TB 2NQBC 3MGPC 1P3AA 3AFAA 3KXBD 4KUDC 3W97A 3A6ND 3UTBB 1P3AD 4H9QA 3B6FB 3WA9B 4Z2MH 3B0DB 4CSRA 3W97D 1M18A 3AZGB 1P3OC 5B31B 1M18D 3LZ0C 5B24D 3REJB 4KGCC 3AN2A 3MGRA 3AN2D 1P34A 3AZID 4YS3C 3AZLD 3B6GA 3MGRD 3AZKB 1P34D 3B6GD 4J8VA 3KXBC 2FJ7A 3UTAA
chains in the Genus database with same CATH superfamily
5DNMB 1P3AC 4J8VD 2BYMA 2BYKB 4ZUXA 4X23D 3W97C 3UTAD 1P3GA 4LD9A 3AZEA 1S32A 3AL0C 4ZUXD 2ZY2A 1ULYA 4HGAB 4JJNA 1M18C 5B24C 4E44A 4H9RA 5B0YA 3B0CW 4JJND 5GT3B 1P3PD 3AN2C 3AZIC 3AZLC 5AV8B 3MGRC 3UTBA 5B0ZA 3WA9A 3AYWB 3KFUG 3MNNB 1P34C 2JE5A 5AVCB 5BT1D 5B33D 3B6GC 2HUEC 4ZBJB 5B0ZD 4H9SC 3O62B 4J8VC 4X23C 2FJ7C 3UTAC 3LELA 2DF4C 4ZUXC 5C3IC 3LELD 1HQ3A 2ZY4A 4LD9C 3AZEC 1S32C 1HQ3D 1P3BB 4JJNC 3AZKA 4H9PB 1U35D 3AV2A 1P3PC 3VH6W 5BS7A 3AZHB 3KSYA 1KX3D 3AV2D 5E5AB 2Y2NA 5B0ZC 4WU8A 3RELA 5AVBA 1B6WA 5GSUB 4DRAA 5GXQA 1P3MB 3WKJA 4R8PB 5JRGD 3RELD 4WU8D 5AVBD 5AV6A 4XZQA 3WAAD 3WKJD 3MVDD 3LELC 5AV6D 4XZQD 3WTPD 5BO0B 3AZFD 1HQ3C 5AV8A 3KUYB 3VH6A 2AROB 1BH9A 2L5AA 5CPKB 3UT9A 1U35C 2YFVB 2BG1A 4G91B 1KX3C 1Q9CA 5AV5B 3UT9D 3AV2C 3V9RB 5B2ID 3W96A 5CP6A 5BNXB 1EQZB 5JRGC 3RELC 4WU8C 5AVBC 3W96D 5CP6D 3WAAC 5GXQC 3WKJC 3MVDC 3REKA 5B32A 5KDMA 1KX5D 3EPHA 5AV6C 2W8SA 4H9PA 4XZQC 3WTPC 1BH8A 3REKD 5B32D 4J8WA 5G49B 2NZDD 1TZYA 4J8WD 3REID 3UT9C 1TZYD 1P3LB 1KU5A 3KXBB 3A6NB 3EPJA 1AOIB 4UUZB 3W96C 5CP6C 3LJAA 1KX5C 4J8UA 2Y2PA 3AZJA 5B1MA 3REKC 5B32C 3LJAD 4J8XA 4J8UD 2F8NA 3AZJD 5B1MD 1F66A 4J8XD 5B31G 2ZY3A 4AWLB 4J8WC 2F8ND 3REIC 1P3FB 3X1SA 3AZNB 1F66D 2LY8A 1TZYC 1ID3D 5BNXA 3AV1A 3X1VB 1WWIA 3AFAD 3REHB 5CPIB 3X1TB 4YM6B 3AV1D 2FFFB 3VH6T 1KX4B 3X1UB 4EO5C 3KWQB 5B2JA 1ZLAB 3C1BB 3AZMB 4XUJB 5G49A 2ZM5A 5B2JD 3MGSB 3W99B 5CPJB 3LJAC 1PZRA 1M19A 4J8UC 1P3LA 3AZJC 5B1MC 2CV5A 1P3PB 1JFIB 4QLCA 2J8PA 1M19D 4J8XC 2IO5C 5FUGB 2CV5D 4QLCD 1F66C 1ID3C 5B33B 3TU4A 2RIQA 4G92C 4UUZA 3AFAC 5JA4B 2FJ7D 3W98B 1P3KA 2YFWA 3TU4D 3AV1C 1M1AB 2HIOA 5B1LA 2PYOB 1P3KD 1P3GD 4LD9D 3AZED 1S32D 4H9OA 5B1LD 5GT0B 5B2JC 4Z5TA 3NQUB 1P3FA 5B0YD 4E45A 3MGQB 4Z5TD 5B40B 5F99B 1M19C 3X1VA 3B6FA 2CV5C 4YM6A 4QLCC 3UTBD 3WA9D 3B6FD 2ZY5A 1W2EA 3NQJB 3LZ1B 3AZGA 5B31A 3REJA 3TU4C 1B67A 3AZGD 3REJD 1P3KC 3MVDB 1P3GC 3WTPB 5AV9B 5B1LC 3AZFB 3C1CB 4KHAB 3EPLA 5B0YC 4Z5TC 3AZKD 4WJ3C 5DNMA 4WU9B 2BYKA 4Z66B 5JA4A 5DNMD 3UTBC 3WA9C 2Y2IA 1M1AA 3B6FC 3B0DC 4WV4B 5B2IB 5AY8B 1P3IB 4CAYB 3AZGC 2JCHA 5GXQD 5B31C 3REJC 1WWSA 3NQUA 2JSSA 5GT3A 5GT3D 5BNVB 3AYWA 5DNNB 3MNNA 5AVCA 5AV8D 2NZDB 3AYWD 3AZKC 2NQBB 3P5JB 5AVCD 3REIB 3MGPB 3O62A 5BS7C 4KUDB 5DNMC 3O62D 4NFTA 5AV9A 1P3OB 1P3BA 4H9NB 4HGAC 3LZ0B 2UWXA 2XD1A 1P3BD 3AZHA 4KGCB 2Y2KA 1BFMA 5GT3C 5E5AA 3AZHD 4YS3B 5AV8C 3AYWC 5E5AD 3MNNC 5AVCC 5AY8A 5GSUA 4ZBJC 4CAYA 1P3MA 4R8PA 1P3AB 3O62C 3B0CT 5GSUD 1P3MD 3W97B 4R8PD 4H9QB 5BO0A 2G5HC 3IP4C 3KUYA 1M18B 1H3OB 1N1JB 2AROA 5B24B 2Y2OA 5CPKA 1A7WA 2YFVA 1P3BC 3KUYD 2AROD 5AV5A 5CPKD 3MGPA 3V9RA 3AZHC 4KUDA 3R45B 3AN2B 3AZIB 4UPKA 5AV5D 3AZLB 3MGRB 5E5AC 1P34B 3B6GB 2HUEB 1EQZA 3X1SD 4Z2MG 1TAFB 5GSUC 4J8VB 1P3MC 1EQZD 4R8PC 4X23B 3LZ0A 2FJ7B 3UTAB 4KGCA 4ZUXB 4NE3A 5C3IB 4LD9B 3AZEB 1S32B 3KUYC 2AROC 4JJNB 5CPKC 4G91C 4H9RB 4WNNB 3KXBA 3VH5W 4NE5A 3A6NA 4WZSB 5AV5C 1P3LD 1AOIA 5B0ZB 2XD5A 3X1SC 2CWEA 1AOID 1EQZC 2F2AC 1H3OA 1N1JA 5B24A 1R4VA 2HIOD 3LELB 3R45A 3AZIA 3AZLA 1HQ3B 3B0BA 3VH5A 3AZNA 1U35B 2Y2HA 2Y2JA 1P3FD 1KX3B 3REHA 3AZND 5CHLB 5CPIA 4H9SA 3AV2B 3X1TA 1TAFA 1P3LC 4X23A 3X1VD 3A6NC 3REHD 5CPID 3X1TD 1KX4A 4YM6D 3X1UA 3KWQA 1T3UA 1AOIC 1ZLAA 3C1BA 3AZMA 4XUJA 5JRGB 4WU8B 3RELB 5B31D 5AVBB 3X1UD 3KWQD 1KX4D 3MGSA 1ZLAD 5GXQB 3W99A 3C1BD 3AZMD 5CPJA 4XUJD 3WKJB 3WAAB 2G5IC 2HIOC 5AV6B 4XZQB 3MGSD 3FDDA 3H0MC 3W99D 2DQNC 4WNNA 5CPJD 1P3PA 1JFIA 4DRBA 5FUGA 4AWLC 5B33A 1P3FC 1BH9B 3AZNC 3UT9B 3W98A 2Y2LA 3X1VC 3REHC 5CPIC 5B32G 3X1TC 3W98D 2PYOA 4YM6C 1M1AD 2PYOD 1KX4C 3W96B 3X1UC 5CP6B 3KWQC 5GT0A 1ZLAC 2RVQD 3C1BC 3AZMC 4XUJC 1KX5B 4DQYB 3MGQA 1U35A 5GT0D 3MGSC 3W99C 3REKB 3H0LC 5B32B 5F99A 5KDMB 2Y2GA 5B40A 5CPJC 3MGQD 1KX3A 1BH8B 5B40D 5F99D 3MNND 4J8WB 3NQJA 3LZ1A 1TZYB 5BT1C 5B33C 1Z2CB 5JRGA 3LZ1D 3W98C 3WAAA 3MVDA 1M1AC 3WTPA 2PYOC 2F8NG 3AZFA 3VH5T 3C1CA 4EO5B 4KHAA 5AV9D 2RVQC 3C1CD 5GT0C 3LJAB 4J8UB 3MGQC 4WU9A 4Z66A 5B1MB 3AZJB 5B40C 5F99C 4J8XB 2IO5B 4WU9D 2F8NB 3A1KA 5B2IA 4Z66D 1P3IA 3A1IA 1F66B 1ID3B 5AY8D 3LZ1C 3X1SB 4G92B 3AFAB 1P3ID 3EPKA 3AV1B 1KX5A 4CSRB 2F8NH 5BNVA 5DNNA 5AV9C 3AZFC 3C1CC 2NZDA 5B2JB 5DNND 2NQBA 3REIA 2NQBD 1M19B 3MGPD 4WU9C 4KUDD 2F8NK 4Z66C 2CV5B 3WTPE 4QLCB 3F6TA 5B2IC 5AY8C 1P3IC 1P3OA 4H9NA 4NE6A 3TU4B 1F1EA 1P3OD 2BYMB 3LZ0D 1P3KB 2YFWB 1P3GB 2HIOB 4KGCD 5B1LB 4YS3A 1HTAA 5DNNC 4H9OB 4YS3D 5B0YB 2NZDC 1ID3A 4M6BA 4Z5TB 2NQBC 2VQRA 3MGPC 1P3AA 3AFAA 3KXBD 4KUDC 3W97A 3A6ND 3UTBB 1P3AD 2Y2MA 4H9QA 3B6FB 4Z2MH 3B0DB 3WA9B 4CSRA 3W97D 1M18A 3AZGB 1P3OC 5B31B 1M18D 3LZ0C 3H0RC 5B24D 3REJB 3EG5B 4KGCC 3AN2A 3MGRA 3AN2D 1P34A 3AZID 4YS3C 3AZLD 3B6GA 3MGRD 2Y2QA 3AZKB 1P34D 3B6GD 4J8VA 3KXBC 2FJ7A 3UTAA
chains in the Genus database with same CATH topology
5DNMB 1P3AC 4J8VD 2BYMA 2BYKB 4ZUXA 4X23D 3W97C 3UTAD 1P3GA 4LD9A 3AZEA 1S32A 3AL0C 4ZUXD 2ZY2A 1ULYA 4HGAB 4JJNA 1M18C 5B24C 4E44A 4H9RA 5B0YA 3B0CW 4JJND 5GT3B 1P3PD 3AN2C 3AZIC 3AZLC 5AV8B 3MGRC 3UTBA 5B0ZA 3WA9A 3AYWB 3KFUG 3MNNB 1P34C 2JE5A 5AVCB 5BT1D 5B33D 3B6GC 2HUEC 4ZBJB 5B0ZD 4H9SC 3O62B 4J8VC 4X23C 2FJ7C 3UTAC 3LELA 2DF4C 4ZUXC 5C3IC 3LELD 1HQ3A 2ZY4A 4LD9C 3AZEC 1S32C 1HQ3D 1P3BB 4JJNC 3AZKA 4H9PB 1U35D 3AV2A 1P3PC 3VH6W 5BS7A 3AZHB 3KSYA 1KX3D 3AV2D 5E5AB 2Y2NA 5B0ZC 4WU8A 3RELA 5AVBA 1B6WA 5GSUB 4DRAA 5GXQA 1P3MB 3WKJA 4R8PB 5JRGD 3RELD 4WU8D 5AVBD 5AV6A 4XZQA 3WAAD 3WKJD 3MVDD 3LELC 5AV6D 4XZQD 3WTPD 5BO0B 3AZFD 1HQ3C 5AV8A 3KUYB 3VH6A 2AROB 1BH9A 2L5AA 5CPKB 3UT9A 1U35C 2YFVB 2BG1A 4G91B 1KX3C 1Q9CA 5AV5B 3UT9D 3AV2C 3V9RB 5B2ID 3W96A 5CP6A 5BNXB 1EQZB 5JRGC 3RELC 4WU8C 5AVBC 3W96D 5CP6D 3WAAC 5GXQC 3WKJC 3MVDC 3REKA 5B32A 5KDMA 1KX5D 3EPHA 5AV6C 2W8SA 4H9PA 4XZQC 3WTPC 1BH8A 3REKD 5B32D 4J8WA 5G49B 2NZDD 1TZYA 4J8WD 3REID 3UT9C 1TZYD 1P3LB 1KU5A 3KXBB 3A6NB 3EPJA 1AOIB 4UUZB 3W96C 5CP6C 3LJAA 1KX5C 4J8UA 2Y2PA 3AZJA 5B1MA 3REKC 5B32C 3LJAD 4J8XA 4J8UD 2F8NA 3AZJD 5B1MD 1F66A 4J8XD 5B31G 2ZY3A 4AWLB 4J8WC 2F8ND 3REIC 1P3FB 3X1SA 3AZNB 1F66D 2LY8A 1TZYC 1ID3D 5BNXA 3AV1A 3X1VB 1WWIA 3AFAD 3REHB 5CPIB 3X1TB 4YM6B 3AV1D 2FFFB 3VH6T 1KX4B 3X1UB 4EO5C 3KWQB 5B2JA 1ZLAB 3C1BB 3AZMB 4XUJB 5G49A 2ZM5A 5B2JD 3MGSB 3W99B 5CPJB 3LJAC 1PZRA 1M19A 4J8UC 1P3LA 3AZJC 5B1MC 2CV5A 1P3PB 1JFIB 4QLCA 2J8PA 1M19D 4J8XC 2IO5C 5FUGB 2CV5D 4QLCD 1F66C 1ID3C 5B33B 3TU4A 2RIQA 4G92C 4UUZA 3AFAC 5JA4B 2FJ7D 3W98B 1P3KA 2YFWA 3TU4D 3AV1C 1M1AB 2HIOA 5B1LA 2PYOB 1P3KD 1P3GD 4LD9D 3AZED 1S32D 4H9OA 5B1LD 5GT0B 5B2JC 4Z5TA 3NQUB 1P3FA 5B0YD 4E45A 3MGQB 4Z5TD 5B40B 5F99B 1M19C 3X1VA 3B6FA 2CV5C 4YM6A 4QLCC 3UTBD 3WA9D 3B6FD 2ZY5A 1W2EA 3NQJB 3LZ1B 3AZGA 5B31A 3REJA 3TU4C 1B67A 3AZGD 3REJD 1P3KC 3MVDB 1P3GC 3WTPB 5AV9B 5B1LC 3AZFB 3C1CB 4KHAB 3EPLA 5B0YC 4Z5TC 3AZKD 4WJ3C 5DNMA 4WU9B 2BYKA 4Z66B 5JA4A 5DNMD 3UTBC 3WA9C 2Y2IA 1M1AA 3B6FC 3B0DC 4WV4B 5B2IB 5AY8B 1P3IB 4CAYB 3AZGC 2JCHA 5GXQD 5B31C 3REJC 1WWSA 3NQUA 2JSSA 5GT3A 5GT3D 5BNVB 3AYWA 5DNNB 3MNNA 5AVCA 5AV8D 2NZDB 3AYWD 3AZKC 2NQBB 3P5JB 5AVCD 3REIB 3MGPB 3O62A 5BS7C 4KUDB 5DNMC 3O62D 4NFTA 5AV9A 1P3OB 1P3BA 4H9NB 4HGAC 3LZ0B 2UWXA 2XD1A 1P3BD 3AZHA 4KGCB 2Y2KA 1BFMA 5GT3C 5E5AA 3AZHD 4YS3B 5AV8C 3AYWC 5E5AD 3MNNC 5AVCC 5AY8A 5GSUA 4ZBJC 4CAYA 1P3MA 4R8PA 1P3AB 3O62C 3B0CT 5GSUD 1P3MD 3W97B 4R8PD 4H9QB 5BO0A 2G5HC 3IP4C 3KUYA 1M18B 1H3OB 1N1JB 2AROA 5B24B 2Y2OA 5CPKA 1A7WA 2YFVA 1P3BC 3KUYD 2AROD 5AV5A 5CPKD 3MGPA 3V9RA 3AZHC 4KUDA 3R45B 3AN2B 3AZIB 4UPKA 5AV5D 3AZLB 3MGRB 5E5AC 1P34B 3B6GB 2HUEB 1EQZA 3X1SD 4Z2MG 1TAFB 5GSUC 4J8VB 1P3MC 1EQZD 4R8PC 4X23B 3LZ0A 2FJ7B 3UTAB 4KGCA 4ZUXB 4NE3A 5C3IB 4LD9B 3AZEB 1S32B 3KUYC 2AROC 4JJNB 5CPKC 4G91C 4H9RB 4WNNB 3KXBA 3VH5W 4NE5A 3A6NA 4WZSB 5AV5C 1P3LD 1AOIA 5B0ZB 2XD5A 3X1SC 2CWEA 1AOID 1EQZC 2F2AC 1H3OA 1N1JA 5B24A 1R4VA 2HIOD 3LELB 3R45A 3AZIA 3AZLA 1HQ3B 3B0BA 3VH5A 3AZNA 1U35B 2Y2HA 2Y2JA 1P3FD 1KX3B 3REHA 3AZND 5CHLB 5CPIA 4H9SA 3AV2B 3X1TA 1TAFA 1P3LC 4X23A 3X1VD 3A6NC 3REHD 5CPID 3X1TD 1KX4A 4YM6D 3X1UA 3KWQA 1T3UA 1AOIC 1ZLAA 3C1BA 3AZMA 4XUJA 5JRGB 4WU8B 3RELB 5B31D 5AVBB 3X1UD 3KWQD 1KX4D 3MGSA 1ZLAD 5GXQB 3W99A 3C1BD 3AZMD 5CPJA 4XUJD 3WKJB 3WAAB 2G5IC 2HIOC 5AV6B 4XZQB 3MGSD 3FDDA 3H0MC 3W99D 2DQNC 4WNNA 5CPJD 1P3PA 1JFIA 4DRBA 5FUGA 4AWLC 5B33A 1P3FC 1BH9B 3AZNC 3UT9B 3W98A 2Y2LA 3X1VC 3REHC 5CPIC 5B32G 3X1TC 3W98D 2PYOA 4YM6C 1M1AD 2PYOD 1KX4C 3W96B 3X1UC 5CP6B 3KWQC 5GT0A 1ZLAC 2RVQD 3C1BC 3AZMC 4XUJC 1KX5B 4DQYB 3MGQA 1U35A 5GT0D 3MGSC 3W99C 3REKB 3H0LC 5B32B 5F99A 5KDMB 2Y2GA 5B40A 5CPJC 3MGQD 1KX3A 1BH8B 5B40D 5F99D 3MNND 4J8WB 3NQJA 3LZ1A 1TZYB 5BT1C 5B33C 1Z2CB 5JRGA 3LZ1D 3W98C 3WAAA 3MVDA 1M1AC 3WTPA 2PYOC 2F8NG 3AZFA 3VH5T 3C1CA 4EO5B 4KHAA 5AV9D 2RVQC 3C1CD 5GT0C 3LJAB 4J8UB 3MGQC 4WU9A 4Z66A 5B1MB 3AZJB 5B40C 5F99C 4J8XB 2IO5B 4WU9D 2F8NB 3A1KA 5B2IA 4Z66D 1P3IA 3A1IA 1F66B 1ID3B 5AY8D 3LZ1C 3X1SB 4G92B 3AFAB 1P3ID 3EPKA 3AV1B 1KX5A 4CSRB 2F8NH 5BNVA 5DNNA 5AV9C 3AZFC 3C1CC 2NZDA 5B2JB 5DNND 2NQBA 3REIA 2NQBD 1M19B 3MGPD 4WU9C 4KUDD 2F8NK 4Z66C 2CV5B 3WTPE 4QLCB 3F6TA 5B2IC 5AY8C 1P3IC 1P3OA 4H9NA 4NE6A 3TU4B 1F1EA 1P3OD 2BYMB 3LZ0D 1P3KB 2YFWB 1P3GB 2HIOB 4KGCD 5B1LB 4YS3A 1HTAA 5DNNC 4H9OB 4YS3D 5B0YB 2NZDC 1ID3A 4M6BA 4Z5TB 2NQBC 2VQRA 3MGPC 1P3AA 3AFAA 3KXBD 4KUDC 3W97A 3A6ND 3UTBB 1P3AD 2Y2MA 4H9QA 3B6FB 4Z2MH 3B0DB 3WA9B 4CSRA 3W97D 1M18A 3AZGB 1P3OC 5B31B 1M18D 3LZ0C 3H0RC 5B24D 3REJB 3EG5B 4KGCC 3AN2A 3MGRA 3AN2D 1P34A 3AZID 4YS3C 3AZLD 3B6GA 3MGRD 2Y2QA 3AZKB 1P34D 3B6GD 4J8VA 3KXBC 2FJ7A 3UTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM B;  1P3A C;  4J8V D;  2BYM A;  2BYK B;  4ZUX A;  4X23 D;  3W97 C;  3UTA D;  1P3G A;  4LD9 A;  3AZE A;  1S32 A;  4ZUX D;  1ULY A;  4HGA B;  4JJN A;  1M18 C;  5B24 C;  4E44 A;  4H9R A;  5B0Y A;  3B0C W;  4JJN D;  5GT3 B;  1P3P D;  3AN2 C;  3AZI C;  3AZL C;  5AV8 B;  3MGR C;  3UTB A;  5B0Z A;  3WA9 A;  3AYW B;  3MNN B;  1P34 C;  5AVC B;  5BT1 D;  5B33 D;  3B6G C;  2HUE C;  4ZBJ B;  5B0Z D;  4H9S C;  3O62 B;  4J8V C;  4X23 C;  2FJ7 C;  3UTA C;  3LEL A;  4ZUX C;  5C3I C;  3LEL D;  1HQ3 A;  4LD9 C;  3AZE C;  1S32 C;  1HQ3 D;  1P3B B;  4JJN C;  3AZK A;  4H9P B;  1U35 D;  3AV2 A;  1P3P C;  3VH6 W;  5BS7 A;  3AZH B;  3KSY A;  1KX3 D;  3AV2 D;  5E5A B;  5B0Z C;  4WU8 A;  3REL A;  5AVB A;  1B6W A;  5GSU B;  4DRA A;  5GXQ A;  1P3M B;  3WKJ A;  4R8P B;  5JRG D;  3REL D;  4WU8 D;  5AVB D;  5AV6 A;  4XZQ A;  3WAA D;  3WKJ D;  3MVD D;  3LEL C;  5AV6 D;  4XZQ D;  3WTP D;  5BO0 B;  3AZF D;  1HQ3 C;  5AV8 A;  3KUY B;  3VH6 A;  2ARO B;  1BH9 A;  2L5A A;  5CPK B;  3UT9 A;  1U35 C;  2YFV B;  4G91 B;  1KX3 C;  1Q9C A;  5AV5 B;  3UT9 D;  3AV2 C;  3V9R B;  5B2I D;  3W96 A;  5CP6 A;  5BNX B;  1EQZ B;  5JRG C;  3REL C;  4WU8 C;  5AVB C;  3W96 D;  5CP6 D;  3WAA C;  5GXQ C;  3WKJ C;  3MVD C;  3REK A;  5B32 A;  5KDM A;  1KX5 D;  5AV6 C;  4H9P A;  4XZQ C;  3WTP C;  1BH8 A;  3REK D;  5B32 D;  4J8W A;  5G49 B;  2NZD D;  1TZY A;  4J8W D;  3REI D;  3UT9 C;  1TZY D;  1P3L B;  1KU5 A;  3KXB B;  3A6N B;  1AOI B;  4UUZ B;  3W96 C;  5CP6 C;  3LJA A;  1KX5 C;  4J8U A;  3AZJ A;  5B1M A;  3REK C;  5B32 C;  3LJA D;  4J8X A;  4J8U D;  2F8N A;  3AZJ D;  5B1M D;  1F66 A;  4J8X D;  5B31 G;  4AWL B;  4J8W C;  2F8N D;  3REI C;  1P3F B;  3X1S A;  3AZN B;  1F66 D;  2LY8 A;  1TZY C;  1ID3 D;  5BNX A;  3AV1 A;  3X1V B;  1WWI A;  3AFA D;  3REH B;  5CPI B;  3X1T B;  4YM6 B;  3AV1 D;  3VH6 T;  1KX4 B;  3X1U B;  4EO5 C;  3KWQ B;  5B2J A;  1ZLA B;  3C1B B;  3AZM B;  4XUJ B;  5G49 A;  5B2J D;  3MGS B;  3W99 B;  5CPJ B;  3LJA C;  1M19 A;  4J8U C;  1P3L A;  3AZJ C;  5B1M C;  2CV5 A;  1P3P B;  1JFI B;  4QLC A;  1M19 D;  4J8X C;  2IO5 C;  5FUG B;  2CV5 D;  4QLC D;  1F66 C;  1ID3 C;  5B33 B;  3TU4 A;  4G92 C;  4UUZ A;  3AFA C;  5JA4 B;  2FJ7 D;  3W98 B;  1P3K A;  2YFW A;  3TU4 D;  3AV1 C;  1M1A B;  2HIO A;  5B1L A;  2PYO B;  1P3K D;  1P3G D;  4LD9 D;  3AZE D;  1S32 D;  4H9O A;  5B1L D;  5GT0 B;  5B2J C;  4Z5T A;  3NQU B;  1P3F A;  5B0Y D;  4E45 A;  3MGQ B;  4Z5T D;  5B40 B;  5F99 B;  1M19 C;  3X1V A;  3B6F A;  2CV5 C;  4YM6 A;  4QLC C;  3UTB D;  3WA9 D;  3B6F D;  3NQJ B;  3LZ1 B;  3AZG A;  5B31 A;  3REJ A;  3TU4 C;  1B67 A;  3AZG D;  3REJ D;  1P3K C;  3MVD B;  1P3G C;  3WTP B;  5AV9 B;  5B1L C;  3AZF B;  3C1C B;  4KHA B;  5B0Y C;  4Z5T C;  3AZK D;  5DNM A;  4WU9 B;  2BYK A;  4Z66 B;  5JA4 A;  5DNM D;  3UTB C;  3WA9 C;  1M1A A;  3B6F C;  3B0D C;  4WV4 B;  5B2I B;  5AY8 B;  1P3I B;  4CAY B;  3AZG C;  5GXQ D;  5B31 C;  3REJ C;  1WWS A;  3NQU A;  2JSS A;  5GT3 A;  5GT3 D;  5BNV B;  3AYW A;  5DNN B;  3MNN A;  5AVC A;  5AV8 D;  2NZD B;  3AYW D;  3AZK C;  2NQB B;  5AVC D;  3REI B;  3MGP B;  3O62 A;  5BS7 C;  4KUD B;  5DNM C;  3O62 D;  4NFT A;  5AV9 A;  1P3O B;  1P3B A;  4H9N B;  4HGA C;  3LZ0 B;  1P3B D;  3AZH A;  4KGC B;  1BFM A;  5GT3 C;  5E5A A;  3AZH D;  4YS3 B;  5AV8 C;  3AYW C;  5E5A D;  3MNN C;  5AVC C;  5AY8 A;  5GSU A;  4ZBJ C;  4CAY A;  1P3M A;  4R8P A;  1P3A B;  3O62 C;  3B0C T;  5GSU D;  1P3M D;  3W97 B;  4R8P D;  4H9Q B;  5BO0 A;  3KUY A;  1M18 B;  1H3O B;  1N1J B;  2ARO A;  5B24 B;  5CPK A;  1A7W A;  2YFV A;  1P3B C;  3KUY D;  2ARO D;  5AV5 A;  5CPK D;  3MGP A;  3V9R A;  3AZH C;  4KUD A;  3R45 B;  3AN2 B;  3AZI B;  3AZL B;  5AV5 D;  3MGR B;  5E5A C;  1P34 B;  3B6G B;  2HUE B;  1EQZ A;  3X1S D;  4Z2M G;  1TAF B;  5GSU C;  4J8V B;  1P3M C;  1EQZ D;  4R8P C;  4X23 B;  3LZ0 A;  2FJ7 B;  3UTA B;  4KGC A;  4ZUX B;  4NE3 A;  5C3I B;  4LD9 B;  3AZE B;  1S32 B;  3KUY C;  2ARO C;  4JJN B;  5CPK C;  4G91 C;  4H9R B;  4WNN B;  3KXB A;  3VH5 W;  4NE5 A;  3A6N A;  4WZS B;  5AV5 C;  1P3L D;  1AOI A;  5B0Z B;  3X1S C;  2CWE A;  1AOI D;  1EQZ C;  1H3O A;  1N1J A;  5B24 A;  1R4V A;  2HIO D;  3LEL B;  3R45 A;  3AZI A;  3AZL A;  1HQ3 B;  3B0B A;  3VH5 A;  3AZN A;  1U35 B;  1P3F D;  1KX3 B;  3REH A;  3AZN D;  5CHL B;  5CPI A;  4H9S A;  3AV2 B;  3X1T A;  1TAF A;  1P3L C;  4X23 A;  3X1V D;  3A6N C;  3REH D;  5CPI D;  3X1T D;  1KX4 A;  4YM6 D;  3X1U A;  3KWQ A;  1AOI C;  1ZLA A;  3C1B A;  3AZM A;  4XUJ A;  5JRG B;  4WU8 B;  3REL B;  5B31 D;  5AVB B;  3X1U D;  3KWQ D;  1KX4 D;  3MGS A;  1ZLA D;  5GXQ B;  3W99 A;  3C1B D;  3AZM D;  5CPJ A;  4XUJ D;  3WKJ B;  3WAA B;  2HIO C;  5AV6 B;  4XZQ B;  3MGS D;  3W99 D;  1P3P A;  1JFI A;  4WNN A;  5CPJ D;  4DRB A;  5FUG A;  4AWL C;  5B33 A;  1P3F C;  1BH9 B;  3AZN C;  3UT9 B;  3W98 A;  3X1V C;  3REH C;  5CPI C;  5B32 G;  3X1T C;  3W98 D;  2PYO A;  4YM6 C;  1M1A D;  2PYO D;  1KX4 C;  3W96 B;  3X1U C;  5CP6 B;  3KWQ C;  5GT0 A;  1ZLA C;  2RVQ D;  3C1B C;  3AZM C;  4XUJ C;  1KX5 B;  3MGQ A;  1U35 A;  5GT0 D;  3MGS C;  3W99 C;  3REK B;  5CPJ C;  5B32 B;  5F99 A;  5KDM B;  5B40 A;  1KX3 A;  3MGQ D;  1BH8 B;  5B40 D;  5F99 D;  3MNN D;  4J8W B;  3NQJ A;  3LZ1 A;  1TZY B;  5BT1 C;  5B33 C;  5JRG A;  3LZ1 D;  3W98 C;  3WAA A;  3MVD A;  1M1A C;  3WTP A;  2PYO C;  2F8N G;  3AZF A;  3VH5 T;  3C1C A;  4EO5 B;  4KHA A;  5AV9 D;  2RVQ C;  3C1C D;  5GT0 C;  3LJA B;  4J8U B;  3MGQ C;  4WU9 A;  4Z66 A;  5B1M B;  3AZJ B;  5B40 C;  5F99 C;  4J8X B;  2IO5 B;  4WU9 D;  2F8N B;  4Z66 D;  5B2I A;  1P3I A;  1F66 B;  1ID3 B;  5AY8 D;  3LZ1 C;  3X1S B;  4G92 B;  3AFA B;  1P3I D;  3AV1 B;  1KX5 A;  4CSR B;  2F8N H;  5BNV A;  5DNN A;  5AV9 C;  3AZF C;  3C1C C;  2NZD A;  5B2J B;  5DNN D;  2NQB A;  3REI A;  2NQB D;  1M19 B;  3MGP D;  4WU9 C;  4KUD D;  2F8N K;  4Z66 C;  2CV5 B;  3WTP E;  4QLC B;  5B2I C;  5AY8 C;  1P3I C;  1P3O A;  4H9N A;  4NE6 A;  3TU4 B;  1F1E A;  1P3O D;  2BYM B;  3LZ0 D;  1P3K B;  2YFW B;  1P3G B;  2HIO B;  4KGC D;  5B1L B;  4YS3 A;  1HTA A;  5DNN C;  4H9O B;  4YS3 D;  5B0Y B;  2NZD C;  1ID3 A;  4M6B A;  4Z5T B;  2NQB C;  3MGP C;  1P3A A;  3AFA A;  3KXB D;  4KUD C;  3W97 A;  3A6N D;  3UTB B;  1P3A D;  4H9Q A;  3B6F B;  3WA9 B;  4Z2M H;  3B0D B;  4CSR A;  3W97 D;  1M18 A;  3AZG B;  1P3O C;  5B31 B;  1M18 D;  3LZ0 C;  5B24 D;  3REJ B;  4KGC C;  3AN2 A;  3MGR A;  3AN2 D;  1P34 A;  3AZI D;  4YS3 C;  3AZL D;  3B6G A;  3MGR D;  3AZK B;  1P34 D;  3B6G D;  4J8V A;  3KXB C;  2FJ7 A;  3UTA A; 
#chains in the Genus database with same CATH topology
 5DNM B;  1P3A C;  4J8V D;  2BYM A;  2BYK B;  4ZUX A;  4X23 D;  3W97 C;  3UTA D;  1P3G A;  4LD9 A;  3AZE A;  1S32 A;  3AL0 C;  4ZUX D;  2ZY2 A;  1ULY A;  4HGA B;  4JJN A;  1M18 C;  5B24 C;  4E44 A;  4H9R A;  5B0Y A;  3B0C W;  4JJN D;  5GT3 B;  1P3P D;  3AN2 C;  3AZI C;  3AZL C;  5AV8 B;  3MGR C;  3UTB A;  5B0Z A;  3WA9 A;  3AYW B;  3KFU G;  3MNN B;  1P34 C;  2JE5 A;  5AVC B;  5BT1 D;  5B33 D;  3B6G C;  2HUE C;  4ZBJ B;  5B0Z D;  4H9S C;  3O62 B;  4J8V C;  4X23 C;  2FJ7 C;  3UTA C;  3LEL A;  2DF4 C;  4ZUX C;  5C3I C;  3LEL D;  1HQ3 A;  2ZY4 A;  4LD9 C;  3AZE C;  1S32 C;  1HQ3 D;  1P3B B;  4JJN C;  3AZK A;  4H9P B;  1U35 D;  3AV2 A;  1P3P C;  3VH6 W;  5BS7 A;  3AZH B;  3KSY A;  1KX3 D;  3AV2 D;  5E5A B;  2Y2N A;  5B0Z C;  4WU8 A;  3REL A;  5AVB A;  1B6W A;  5GSU B;  4DRA A;  5GXQ A;  1P3M B;  3WKJ A;  4R8P B;  5JRG D;  3REL D;  4WU8 D;  5AVB D;  5AV6 A;  4XZQ A;  3WAA D;  3WKJ D;  3MVD D;  3LEL C;  5AV6 D;  4XZQ D;  3WTP D;  5BO0 B;  3AZF D;  1HQ3 C;  5AV8 A;  3KUY B;  3VH6 A;  2ARO B;  1BH9 A;  2L5A A;  5CPK B;  3UT9 A;  1U35 C;  2YFV B;  2BG1 A;  4G91 B;  1KX3 C;  1Q9C A;  5AV5 B;  3UT9 D;  3AV2 C;  3V9R B;  5B2I D;  3W96 A;  5CP6 A;  5BNX B;  1EQZ B;  5JRG C;  3REL C;  4WU8 C;  5AVB C;  3W96 D;  5CP6 D;  3WAA C;  5GXQ C;  3WKJ C;  3MVD C;  3REK A;  5B32 A;  5KDM A;  1KX5 D;  3EPH A;  5AV6 C;  2W8S A;  4H9P A;  4XZQ C;  3WTP C;  1BH8 A;  3REK D;  5B32 D;  4J8W A;  5G49 B;  2NZD D;  1TZY A;  4J8W D;  3REI D;  3UT9 C;  1TZY D;  1P3L B;  1KU5 A;  3KXB B;  3A6N B;  3EPJ A;  1AOI B;  4UUZ B;  3W96 C;  5CP6 C;  3LJA A;  1KX5 C;  4J8U A;  2Y2P A;  3AZJ A;  5B1M A;  3REK C;  5B32 C;  3LJA D;  4J8X A;  4J8U D;  2F8N A;  3AZJ D;  5B1M D;  1F66 A;  4J8X D;  5B31 G;  2ZY3 A;  4AWL B;  4J8W C;  2F8N D;  3REI C;  1P3F B;  3X1S A;  3AZN B;  1F66 D;  2LY8 A;  1TZY C;  1ID3 D;  5BNX A;  3AV1 A;  3X1V B;  1WWI A;  3AFA D;  3REH B;  5CPI B;  3X1T B;  4YM6 B;  3AV1 D;  2FFF B;  3VH6 T;  1KX4 B;  3X1U B;  4EO5 C;  3KWQ B;  5B2J A;  1ZLA B;  3C1B B;  3AZM B;  4XUJ B;  5G49 A;  2ZM5 A;  5B2J D;  3MGS B;  3W99 B;  5CPJ B;  3LJA C;  1PZR A;  1M19 A;  4J8U C;  1P3L A;  3AZJ C;  5B1M C;  2CV5 A;  1P3P B;  1JFI B;  4QLC A;  2J8P A;  1M19 D;  4J8X C;  2IO5 C;  5FUG B;  2CV5 D;  4QLC D;  1F66 C;  1ID3 C;  5B33 B;  3TU4 A;  2RIQ A;  4G92 C;  4UUZ A;  3AFA C;  5JA4 B;  2FJ7 D;  3W98 B;  1P3K A;  2YFW A;  3TU4 D;  3AV1 C;  1M1A B;  2HIO A;  5B1L A;  2PYO B;  1P3K D;  1P3G D;  4LD9 D;  3AZE D;  1S32 D;  4H9O A;  5B1L D;  5GT0 B;  5B2J C;  4Z5T A;  3NQU B;  1P3F A;  5B0Y D;  4E45 A;  3MGQ B;  4Z5T D;  5B40 B;  5F99 B;  1M19 C;  3X1V A;  3B6F A;  2CV5 C;  4YM6 A;  4QLC C;  3UTB D;  3WA9 D;  3B6F D;  2ZY5 A;  1W2E A;  3NQJ B;  3LZ1 B;  3AZG A;  5B31 A;  3REJ A;  3TU4 C;  1B67 A;  3AZG D;  3REJ D;  1P3K C;  3MVD B;  1P3G C;  3WTP B;  5AV9 B;  5B1L C;  3AZF B;  3C1C B;  4KHA B;  3EPL A;  5B0Y C;  4Z5T C;  3AZK D;  4WJ3 C;  5DNM A;  4WU9 B;  2BYK A;  4Z66 B;  5JA4 A;  5DNM D;  3UTB C;  3WA9 C;  2Y2I A;  1M1A A;  3B6F C;  3B0D C;  4WV4 B;  5B2I B;  5AY8 B;  1P3I B;  4CAY B;  3AZG C;  2JCH A;  5GXQ D;  5B31 C;  3REJ C;  1WWS A;  3NQU A;  2JSS A;  5GT3 A;  5GT3 D;  5BNV B;  3AYW A;  5DNN B;  3MNN A;  5AVC A;  5AV8 D;  2NZD B;  3AYW D;  3AZK C;  2NQB B;  3P5J B;  5AVC D;  3REI B;  3MGP B;  3O62 A;  5BS7 C;  4KUD B;  5DNM C;  3O62 D;  4NFT A;  5AV9 A;  1P3O B;  1P3B A;  4H9N B;  4HGA C;  3LZ0 B;  2UWX A;  2XD1 A;  1P3B D;  3AZH A;  4KGC B;  2Y2K A;  1BFM A;  5GT3 C;  5E5A A;  3AZH D;  4YS3 B;  5AV8 C;  3AYW C;  5E5A D;  3MNN C;  5AVC C;  5AY8 A;  5GSU A;  4ZBJ C;  4CAY A;  1P3M A;  4R8P A;  1P3A B;  3O62 C;  3B0C T;  5GSU D;  1P3M D;  3W97 B;  4R8P D;  4H9Q B;  5BO0 A;  2G5H C;  3IP4 C;  3KUY A;  1M18 B;  1H3O B;  1N1J B;  2ARO A;  5B24 B;  2Y2O A;  5CPK A;  1A7W A;  2YFV A;  1P3B C;  3KUY D;  2ARO D;  5AV5 A;  5CPK D;  3MGP A;  3V9R A;  3AZH C;  4KUD A;  3R45 B;  3AN2 B;  3AZI B;  4UPK A;  5AV5 D;  3AZL B;  3MGR B;  5E5A C;  1P34 B;  3B6G B;  2HUE B;  1EQZ A;  3X1S D;  4Z2M G;  1TAF B;  5GSU C;  4J8V B;  1P3M C;  1EQZ D;  4R8P C;  4X23 B;  3LZ0 A;  2FJ7 B;  3UTA B;  4KGC A;  4ZUX B;  4NE3 A;  5C3I B;  4LD9 B;  3AZE B;  1S32 B;  3KUY C;  2ARO C;  4JJN B;  5CPK C;  4G91 C;  4H9R B;  4WNN B;  3KXB A;  3VH5 W;  4NE5 A;  3A6N A;  4WZS B;  5AV5 C;  1P3L D;  1AOI A;  5B0Z B;  2XD5 A;  3X1S C;  2CWE A;  1AOI D;  1EQZ C;  2F2A C;  1H3O A;  1N1J A;  5B24 A;  1R4V A;  2HIO D;  3LEL B;  3R45 A;  3AZI A;  3AZL A;  1HQ3 B;  3B0B A;  3VH5 A;  3AZN A;  1U35 B;  2Y2H A;  2Y2J A;  1P3F D;  1KX3 B;  3REH A;  3AZN D;  5CHL B;  5CPI A;  4H9S A;  3AV2 B;  3X1T A;  1TAF A;  1P3L C;  4X23 A;  3X1V D;  3A6N C;  3REH D;  5CPI D;  3X1T D;  1KX4 A;  4YM6 D;  3X1U A;  3KWQ A;  1T3U A;  1AOI C;  1ZLA A;  3C1B A;  3AZM A;  4XUJ A;  5JRG B;  4WU8 B;  3REL B;  5B31 D;  5AVB B;  3X1U D;  3KWQ D;  1KX4 D;  3MGS A;  1ZLA D;  5GXQ B;  3W99 A;  3C1B D;  3AZM D;  5CPJ A;  4XUJ D;  3WKJ B;  3WAA B;  2G5I C;  2HIO C;  5AV6 B;  4XZQ B;  3MGS D;  3FDD A;  3H0M C;  3W99 D;  2DQN C;  4WNN A;  5CPJ D;  1P3P A;  1JFI A;  4DRB A;  5FUG A;  4AWL C;  5B33 A;  1P3F C;  1BH9 B;  3AZN C;  3UT9 B;  3W98 A;  2Y2L A;  3X1V C;  3REH C;  5CPI C;  5B32 G;  3X1T C;  3W98 D;  2PYO A;  4YM6 C;  1M1A D;  2PYO D;  1KX4 C;  3W96 B;  3X1U C;  5CP6 B;  3KWQ C;  5GT0 A;  1ZLA C;  2RVQ D;  3C1B C;  3AZM C;  4XUJ C;  1KX5 B;  4DQY B;  3MGQ A;  1U35 A;  5GT0 D;  3MGS C;  3W99 C;  3REK B;  3H0L C;  5B32 B;  5F99 A;  5KDM B;  2Y2G A;  5B40 A;  5CPJ C;  3MGQ D;  1KX3 A;  1BH8 B;  5B40 D;  5F99 D;  3MNN D;  4J8W B;  3NQJ A;  3LZ1 A;  1TZY B;  5BT1 C;  5B33 C;  1Z2C B;  5JRG A;  3LZ1 D;  3W98 C;  3WAA A;  3MVD A;  1M1A C;  3WTP A;  2PYO C;  2F8N G;  3AZF A;  3VH5 T;  3C1C A;  4EO5 B;  4KHA A;  5AV9 D;  2RVQ C;  3C1C D;  5GT0 C;  3LJA B;  4J8U B;  3MGQ C;  4WU9 A;  4Z66 A;  5B1M B;  3AZJ B;  5B40 C;  5F99 C;  4J8X B;  2IO5 B;  4WU9 D;  2F8N B;  3A1K A;  5B2I A;  4Z66 D;  1P3I A;  3A1I A;  1F66 B;  1ID3 B;  5AY8 D;  3LZ1 C;  3X1S B;  4G92 B;  3AFA B;  1P3I D;  3EPK A;  3AV1 B;  1KX5 A;  4CSR B;  2F8N H;  5BNV A;  5DNN A;  5AV9 C;  3AZF C;  3C1C C;  2NZD A;  5B2J B;  5DNN D;  2NQB A;  3REI A;  2NQB D;  1M19 B;  3MGP D;  4WU9 C;  4KUD D;  2F8N K;  4Z66 C;  2CV5 B;  3WTP E;  4QLC B;  3F6T A;  5B2I C;  5AY8 C;  1P3I C;  1P3O A;  4H9N A;  4NE6 A;  3TU4 B;  1F1E A;  1P3O D;  2BYM B;  3LZ0 D;  1P3K B;  2YFW B;  1P3G B;  2HIO B;  4KGC D;  5B1L B;  4YS3 A;  1HTA A;  5DNN C;  4H9O B;  4YS3 D;  5B0Y B;  2NZD C;  1ID3 A;  4M6B A;  4Z5T B;  2NQB C;  2VQR A;  3MGP C;  1P3A A;  3AFA A;  3KXB D;  4KUD C;  3W97 A;  3A6N D;  3UTB B;  1P3A D;  2Y2M A;  4H9Q A;  3B6F B;  4Z2M H;  3B0D B;  3WA9 B;  4CSR A;  3W97 D;  1M18 A;  3AZG B;  1P3O C;  5B31 B;  1M18 D;  3LZ0 C;  3H0R C;  5B24 D;  3REJ B;  3EG5 B;  4KGC C;  3AN2 A;  3MGR A;  3AN2 D;  1P34 A;  3AZI D;  4YS3 C;  3AZL D;  3B6G A;  3MGR D;  2Y2Q A;  3AZK B;  1P34 D;  3B6G D;  4J8V A;  3KXB C;  2FJ7 A;  3UTA A; 
#chains in the Genus database with same CATH homology
 5DNM B;  1P3A C;  4J8V D;  2BYM A;  2BYK B;  4ZUX A;  4X23 D;  3W97 C;  3UTA D;  1P3G A;  4LD9 A;  3AZE A;  1S32 A;  3AL0 C;  4ZUX D;  2ZY2 A;  1ULY A;  4HGA B;  4JJN A;  1M18 C;  5B24 C;  4E44 A;  4H9R A;  5B0Y A;  3B0C W;  4JJN D;  5GT3 B;  1P3P D;  3AN2 C;  3AZI C;  3AZL C;  5AV8 B;  3MGR C;  3UTB A;  5B0Z A;  3WA9 A;  3AYW B;  3KFU G;  3MNN B;  1P34 C;  2JE5 A;  5AVC B;  5BT1 D;  5B33 D;  3B6G C;  2HUE C;  4ZBJ B;  5B0Z D;  4H9S C;  3O62 B;  4J8V C;  4X23 C;  2FJ7 C;  3UTA C;  3LEL A;  2DF4 C;  4ZUX C;  5C3I C;  3LEL D;  1HQ3 A;  2ZY4 A;  4LD9 C;  3AZE C;  1S32 C;  1HQ3 D;  1P3B B;  4JJN C;  3AZK A;  4H9P B;  1U35 D;  3AV2 A;  1P3P C;  3VH6 W;  5BS7 A;  3AZH B;  3KSY A;  1KX3 D;  3AV2 D;  5E5A B;  2Y2N A;  5B0Z C;  4WU8 A;  3REL A;  5AVB A;  1B6W A;  5GSU B;  4DRA A;  5GXQ A;  1P3M B;  3WKJ A;  4R8P B;  5JRG D;  3REL D;  4WU8 D;  5AVB D;  5AV6 A;  4XZQ A;  3WAA D;  3WKJ D;  3MVD D;  3LEL C;  5AV6 D;  4XZQ D;  3WTP D;  5BO0 B;  3AZF D;  1HQ3 C;  5AV8 A;  3KUY B;  3VH6 A;  2ARO B;  1BH9 A;  2L5A A;  5CPK B;  3UT9 A;  1U35 C;  2YFV B;  2BG1 A;  4G91 B;  1KX3 C;  1Q9C A;  5AV5 B;  3UT9 D;  3AV2 C;  3V9R B;  5B2I D;  3W96 A;  5CP6 A;  5BNX B;  1EQZ B;  5JRG C;  3REL C;  4WU8 C;  5AVB C;  3W96 D;  5CP6 D;  3WAA C;  5GXQ C;  3WKJ C;  3MVD C;  3REK A;  5B32 A;  5KDM A;  1KX5 D;  3EPH A;  5AV6 C;  2W8S A;  4H9P A;  4XZQ C;  3WTP C;  1BH8 A;  3REK D;  5B32 D;  4J8W A;  5G49 B;  2NZD D;  1TZY A;  4J8W D;  3REI D;  3UT9 C;  1TZY D;  1P3L B;  1KU5 A;  3KXB B;  3A6N B;  3EPJ A;  1AOI B;  4UUZ B;  3W96 C;  5CP6 C;  3LJA A;  1KX5 C;  4J8U A;  2Y2P A;  3AZJ A;  5B1M A;  3REK C;  5B32 C;  3LJA D;  4J8X A;  4J8U D;  2F8N A;  3AZJ D;  5B1M D;  1F66 A;  4J8X D;  5B31 G;  2ZY3 A;  4AWL B;  4J8W C;  2F8N D;  3REI C;  1P3F B;  3X1S A;  3AZN B;  1F66 D;  2LY8 A;  1TZY C;  1ID3 D;  5BNX A;  3AV1 A;  3X1V B;  1WWI A;  3AFA D;  3REH B;  5CPI B;  3X1T B;  4YM6 B;  3AV1 D;  2FFF B;  3VH6 T;  1KX4 B;  3X1U B;  4EO5 C;  3KWQ B;  5B2J A;  1ZLA B;  3C1B B;  3AZM B;  4XUJ B;  5G49 A;  2ZM5 A;  5B2J D;  3MGS B;  3W99 B;  5CPJ B;  3LJA C;  1PZR A;  1M19 A;  4J8U C;  1P3L A;  3AZJ C;  5B1M C;  2CV5 A;  1P3P B;  1JFI B;  4QLC A;  2J8P A;  1M19 D;  4J8X C;  2IO5 C;  5FUG B;  2CV5 D;  4QLC D;  1F66 C;  1ID3 C;  5B33 B;  3TU4 A;  2RIQ A;  4G92 C;  4UUZ A;  3AFA C;  5JA4 B;  2FJ7 D;  3W98 B;  1P3K A;  2YFW A;  3TU4 D;  3AV1 C;  1M1A B;  2HIO A;  5B1L A;  2PYO B;  1P3K D;  1P3G D;  4LD9 D;  3AZE D;  1S32 D;  4H9O A;  5B1L D;  5GT0 B;  5B2J C;  4Z5T A;  3NQU B;  1P3F A;  5B0Y D;  4E45 A;  3MGQ B;  4Z5T D;  5B40 B;  5F99 B;  1M19 C;  3X1V A;  3B6F A;  2CV5 C;  4YM6 A;  4QLC C;  3UTB D;  3WA9 D;  3B6F D;  2ZY5 A;  1W2E A;  3NQJ B;  3LZ1 B;  3AZG A;  5B31 A;  3REJ A;  3TU4 C;  1B67 A;  3AZG D;  3REJ D;  1P3K C;  3MVD B;  1P3G C;  3WTP B;  5AV9 B;  5B1L C;  3AZF B;  3C1C B;  4KHA B;  3EPL A;  5B0Y C;  4Z5T C;  3AZK D;  4WJ3 C;  5DNM A;  4WU9 B;  2BYK A;  4Z66 B;  5JA4 A;  5DNM D;  3UTB C;  3WA9 C;  2Y2I A;  1M1A A;  3B6F C;  3B0D C;  4WV4 B;  5B2I B;  5AY8 B;  1P3I B;  4CAY B;  3AZG C;  2JCH A;  5GXQ D;  5B31 C;  3REJ C;  1WWS A;  3NQU A;  2JSS A;  5GT3 A;  5GT3 D;  5BNV B;  3AYW A;  5DNN B;  3MNN A;  5AVC A;  5AV8 D;  2NZD B;  3AYW D;  3AZK C;  2NQB B;  3P5J B;  5AVC D;  3REI B;  3MGP B;  3O62 A;  5BS7 C;  4KUD B;  5DNM C;  3O62 D;  4NFT A;  5AV9 A;  1P3O B;  1P3B A;  4H9N B;  4HGA C;  3LZ0 B;  2UWX A;  2XD1 A;  1P3B D;  3AZH A;  4KGC B;  2Y2K A;  1BFM A;  5GT3 C;  5E5A A;  3AZH D;  4YS3 B;  5AV8 C;  3AYW C;  5E5A D;  3MNN C;  5AVC C;  5AY8 A;  5GSU A;  4ZBJ C;  4CAY A;  1P3M A;  4R8P A;  1P3A B;  3O62 C;  3B0C T;  5GSU D;  1P3M D;  3W97 B;  4R8P D;  4H9Q B;  5BO0 A;  2G5H C;  3IP4 C;  3KUY A;  1M18 B;  1H3O B;  1N1J B;  2ARO A;  5B24 B;  2Y2O A;  5CPK A;  1A7W A;  2YFV A;  1P3B C;  3KUY D;  2ARO D;  5AV5 A;  5CPK D;  3MGP A;  3V9R A;  3AZH C;  4KUD A;  3R45 B;  3AN2 B;  3AZI B;  4UPK A;  5AV5 D;  3AZL B;  3MGR B;  5E5A C;  1P34 B;  3B6G B;  2HUE B;  1EQZ A;  3X1S D;  4Z2M G;  1TAF B;  5GSU C;  4J8V B;  1P3M C;  1EQZ D;  4R8P C;  4X23 B;  3LZ0 A;  2FJ7 B;  3UTA B;  4KGC A;  4ZUX B;  4NE3 A;  5C3I B;  4LD9 B;  3AZE B;  1S32 B;  3KUY C;  2ARO C;  4JJN B;  5CPK C;  4G91 C;  4H9R B;  4WNN B;  3KXB A;  3VH5 W;  4NE5 A;  3A6N A;  4WZS B;  5AV5 C;  1P3L D;  1AOI A;  5B0Z B;  2XD5 A;  3X1S C;  2CWE A;  1AOI D;  1EQZ C;  2F2A C;  1H3O A;  1N1J A;  5B24 A;  1R4V A;  2HIO D;  3LEL B;  3R45 A;  3AZI A;  3AZL A;  1HQ3 B;  3B0B A;  3VH5 A;  3AZN A;  1U35 B;  2Y2H A;  2Y2J A;  1P3F D;  1KX3 B;  3REH A;  3AZN D;  5CHL B;  5CPI A;  4H9S A;  3AV2 B;  3X1T A;  1TAF A;  1P3L C;  4X23 A;  3X1V D;  3A6N C;  3REH D;  5CPI D;  3X1T D;  1KX4 A;  4YM6 D;  3X1U A;  3KWQ A;  1T3U A;  1AOI C;  1ZLA A;  3C1B A;  3AZM A;  4XUJ A;  5JRG B;  4WU8 B;  3REL B;  5B31 D;  5AVB B;  3X1U D;  3KWQ D;  1KX4 D;  3MGS A;  1ZLA D;  5GXQ B;  3W99 A;  3C1B D;  3AZM D;  5CPJ A;  4XUJ D;  3WKJ B;  3WAA B;  2G5I C;  2HIO C;  5AV6 B;  4XZQ B;  3MGS D;  3FDD A;  3H0M C;  3W99 D;  2DQN C;  4WNN A;  5CPJ D;  1P3P A;  1JFI A;  4DRB A;  5FUG A;  4AWL C;  5B33 A;  1P3F C;  1BH9 B;  3AZN C;  3UT9 B;  3W98 A;  2Y2L A;  3X1V C;  3REH C;  5CPI C;  5B32 G;  3X1T C;  3W98 D;  2PYO A;  4YM6 C;  1M1A D;  2PYO D;  1KX4 C;  3W96 B;  3X1U C;  5CP6 B;  3KWQ C;  5GT0 A;  1ZLA C;  2RVQ D;  3C1B C;  3AZM C;  4XUJ C;  1KX5 B;  4DQY B;  3MGQ A;  1U35 A;  5GT0 D;  3MGS C;  3W99 C;  3REK B;  3H0L C;  5B32 B;  5F99 A;  5KDM B;  2Y2G A;  5B40 A;  5CPJ C;  3MGQ D;  1KX3 A;  1BH8 B;  5B40 D;  5F99 D;  3MNN D;  4J8W B;  3NQJ A;  3LZ1 A;  1TZY B;  5BT1 C;  5B33 C;  1Z2C B;  5JRG A;  3LZ1 D;  3W98 C;  3WAA A;  3MVD A;  1M1A C;  3WTP A;  2PYO C;  2F8N G;  3AZF A;  3VH5 T;  3C1C A;  4EO5 B;  4KHA A;  5AV9 D;  2RVQ C;  3C1C D;  5GT0 C;  3LJA B;  4J8U B;  3MGQ C;  4WU9 A;  4Z66 A;  5B1M B;  3AZJ B;  5B40 C;  5F99 C;  4J8X B;  2IO5 B;  4WU9 D;  2F8N B;  3A1K A;  5B2I A;  4Z66 D;  1P3I A;  3A1I A;  1F66 B;  1ID3 B;  5AY8 D;  3LZ1 C;  3X1S B;  4G92 B;  3AFA B;  1P3I D;  3EPK A;  3AV1 B;  1KX5 A;  4CSR B;  2F8N H;  5BNV A;  5DNN A;  5AV9 C;  3AZF C;  3C1C C;  2NZD A;  5B2J B;  5DNN D;  2NQB A;  3REI A;  2NQB D;  1M19 B;  3MGP D;  4WU9 C;  4KUD D;  2F8N K;  4Z66 C;  2CV5 B;  3WTP E;  4QLC B;  3F6T A;  5B2I C;  5AY8 C;  1P3I C;  1P3O A;  4H9N A;  4NE6 A;  3TU4 B;  1F1E A;  1P3O D;  2BYM B;  3LZ0 D;  1P3K B;  2YFW B;  1P3G B;  2HIO B;  4KGC D;  5B1L B;  4YS3 A;  1HTA A;  5DNN C;  4H9O B;  4YS3 D;  5B0Y B;  2NZD C;  1ID3 A;  4M6B A;  4Z5T B;  2NQB C;  2VQR A;  3MGP C;  1P3A A;  3AFA A;  3KXB D;  4KUD C;  3W97 A;  3A6N D;  3UTB B;  1P3A D;  2Y2M A;  4H9Q A;  3B6F B;  4Z2M H;  3B0D B;  3WA9 B;  4CSR A;  3W97 D;  1M18 A;  3AZG B;  1P3O C;  5B31 B;  1M18 D;  3LZ0 C;  3H0R C;  5B24 D;  3REJ B;  3EG5 B;  4KGC C;  3AN2 A;  3MGR A;  3AN2 D;  1P34 A;  3AZI D;  4YS3 C;  3AZL D;  3B6G A;  3MGR D;  2Y2Q A;  3AZK B;  1P34 D;  3B6G D;  4J8V A;  3KXB C;  2FJ7 A;  3UTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...