1HQ3B

Crystal structure of the histone-core-octamer in kcl/phosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H2A-IV
publication title Structure of the histone-core octamer in KCl/phosphate crystals at 2.15 A resolution.
pubmed doi rcsb
total genus 34
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1hq3B00
4ZUXD 4ZBJB 5CP6A 3LZ1A 5DNMB 1BH9B 4J8XD 3WAAC 5B1LD 2PYOA 2FJ7C 3W99B 5KDMB 1H3OB 5AV8A 1A7WA 3KXBA 4H9RA 3W96A 3RELA 1P34B 3MGQD 3V9RA 5B40D 5B31A 3C1CB 1P3GD 2BYMA 1KX5B 1BH8B 5GT0D 3A6NC 5FUGA 2CV5A 3WAAD 1P3BA 3TU4C 2YFVA 4H9QB 1TZYD 3MGPD 4QLCA 3AZLA 3REKC 3KUYB 4YS3D 2BYKB 3REHB 1AOIA 1P3OA 1P3FA 5AV5D 3LJAC 3UT9A 3TU4B 3WTPA 4YM6B 3VH5T 1P3KC 5B24D 5AY8D 5CP6C 3AZEB 2NQBB 3AFAA 3LZ1C 3WA9D 3R45A 2PYOC 3LJAB 5B33C 3REIB 4J8UA 3W98A 1P3KB 5AV8C 3REJB 5BNXA 3KXBC 1ULYA 4J8WA 1F66A 3W96C 3RELC 3B0DC 5CPIA 1P3AB 1U35B 5B31C 3X1SC 5B33B 5CP6D 5AVCB 5JRGB 4H9OA 1N1JB 3WTPE 1P3IA 5BT1D 1P3BC 2PYOD 1JFIA 4QLCC 3AYWD 3B6FA 4LD9B 5CPJB 1TAFB 5CPKA 1AOIC 3AZIA 1P3FC 1B6WA 3X1SB 3WKJA 3AV1B 3B0CT 3LELA 1KX3A 3UT9C 5B31D 5B2JA 3WTPC 4CAYA 5AVBB 4UUZB 3X1VB 2CV5D 3O62B 5B2IC 3KWQC 3W97B 3UTBA 1M1AD 1KX4A 5B1LA 2YFWA 5B31G 3AZLD 3AFAC 5B0YB 1ID3A 1P3OD 4NE3A 1P3FD 1HQ3D 4H9PA 4Z66D 4J8UC 4JJNB 5BO0A 3W98C 4KHAB 5B2IB 3KWQB 3AZKA 3VH6A 5B0ZA 3MGQA 1P3PA 4R8PB 2HIOB 4J8VD 3AZMD 1F66C 1ZLAA 5B1MC 5CPIC 5GT0A 3X1UB 3LZ0D 5B32A 1TZYA 3MGPA 1P3IC 2HUEB 4Z5TD 4H9NA 4X23C 1EQZA 3B6FC 3W98D 5B1MB 5AV5A 5F99C 5C3IC 4J8WD 5CPKC 3AZIC 3WKJC 2NZDB 3LELC 5B24A 1KX3C 5AV6D 5B2JC 2F8ND 5GT3A 4X23B 2CWEA 5AY8A 4ZUXC 3MNND 3UTBC 2JSSA 5B1LC 5F99B 5C3IB 3AN2B 3B6FD 3B6GA 5CPKD 1ID3C 3UTAA 5BS7A 4ZUXB 1KX3D 1BFMA 3MGQC 4J8XB 4XUJB 1P3PC 5B40C 1P3GC 1S32B 5GT0C 1M19D 3UTBD 1KX4D 2AROA 3AZND 1TZYC 3NQUB 3MGPC 3AYWA 2F8NH 4YS3C 1ID3D 5G49B 3B0CW 5BNVB 4G92B 2F8NK 5B40B 5AV9A 1P3GB 3AZGA 3MGRD 5AV5C 3AZKD 5B0ZD 3AV2D 1P3PD 3WAAB 1ZLAD 2FJ7B 4KGCA 3MVDD 4WU9A 4CSRB 5B24C 5JA4A 4YS3B 5GSUD 5GT3C 1M1AA 5B32D 5AY8C 4WNNA 3WA9C 5DNMD 4EO5C 1HQ3A 5B32G 1EQZD 3A6NB 4Z66A 3B6GC 3W99D 5BS7C 1KU5A 4J8VA 4KUDA 3NQJA 4Z2MG 3AZMA 3VH6W 3C1BA 3REKB 3WA9B 5GT3D 1P34D 3LZ0A 1WWIA 5GXQA 1WWSA 5BT1C 1P3MA 2AROC 4Z5TA 3AYWC 3X1TA 3B6GD 3UTAD 4XZQA 3KUYD 3AZGC 3REHD 5CP6B 4Z2MH 3LZ1B 5CHLB 3AZJA 5AV6A 2PYOB 2F8NA 4WU9C 1HTAA 2CV5C 3MNNA 4YM6D 2AROD 5AV8B 1M1AC 1M18B 3KXBB 3AZLC 4H9RB 3W96B 3RELB 3B0DB 5DNNA 3V9RB 3AZED 1P3OC 2NQBD 5AV9D 5B31B 3AZGD 1HQ3C 2BYMB 1B67A 4Z66C 4DRBA 3AZFA 5FUGB 4NFTA 2CV5B 1P3BB 2YFVB 4J8VC 3AZMC 4KGCD 4WU9D 4QLCB 4WU8A 3AZLB 3AZHA 1M19A 3LZ0C 5GXQC 1P3OB 1AOIB 1Q9CA 3AZNA 1P3FB 1P3AD 1U35D 4Z5TC 3UT9B 4M6BA 3WTPB 3MGRA 4J8WC 3AV2A 3MGSA 4KUDD 1P3LA 4LD9D 5CPJD 3C1BD 5E5AA 3AFAB 3MVDA 3AZJC 3R45B 5AV6C 5GXQD 5GSUA 3AV1D 3VH6T 4J8UB 1P3MD 3MNNC 3W98B 4G91C 5AVBD 3X1VD 5BNXB 4J8WB 5DNMA 3X1TD 1F66B 1BH9A 5CPIB 2L5AA 4XZQD 3W99A 5KDMA 1H3OA 4H9OB 3AZFC 1P3IB 3AZJD 4HGAC 1JFIB 4JJND 1P34A 1M18D 4E44A 1M19C 3B6FB 4R8PD 2HIOD 3C1CA 1KX4C 5CPKB 1BH8A 1KX5A 3AZIB 3X1UD 3AZNC 2F8NG 3WKJB 5DNND 4H9QA 3LELB 1KX3B 4HGAB 5B2JB 4CAYB 3KUYA 2BYKA 3MGRC 3REHA 3AZFD 3AZKC 5B0ZC 3UTBB 3AV2C 3MGSC 5B1LB 4H9SA 2YFWB 1P3LC 1KX4B 4WU8D 1ZLAC 3AZHD 3MVDC 3TU4A 4YM6A 5GSUC 1ID3B 5B32C 2RVQD 4H9PB 5BO0B 3AZKB 5B0ZB 4ZBJC 3MGQB 3AZEA 1P3PB 2NQBA 5DNMC 1EQZC 1ZLAB 5GT0B 3LJAA 3W99C 3AN2D 3MGSD 3REIA 1P3LD 5B32B 5E5AD 1TZYB 3MGPB 1P3KA 1R4VA 3REJA 4H9NB 1P34C 1EQZB 1P3AA 4XUJD 3C1CC 1U35A 5AV5B 1KX5C 5B33A 1S32D 5AVCA 5JRGA 4NE5A 3KSYA 1N1JA 3UTAC 5B24B 5GT3B 3KUYC 4LD9A 5AY8B 3REHC 5CPJA 1TAFA 4H9SC 3X1SA 4EO5B 3AV1A 3C1CD 1F1EA 3B6GB 4YM6C 1KX5D 5AVBA 3UTAB 4UUZA 3X1VA 2FJ7D 3O62A 3W97A 4WV4B 3VH5A 3AZEC 2NQBC 5AV9C 5B0YA 3REIC 2AROB 3A6ND 4KGCC 4JJNA 3AYWB 4KHAA 5B2IA 3KWQA 3REJC 1M18A 3TU4D 4R8PA 2HIOA 5AV9B 3X1UA 3REKD 3AZGB 1P3AC 1U35C 5AVCC 5JRGC 4KGCB 4AWLC 4WU9B 3LJAD 5JA4B 3REID 1M1AB 4KUDC 4LD9C 1P3KD 5B1MA 5CPJC 3C1BC 3REJD 4WNNB 4DRAA 2NZDA 3LZ1D 3AV1C 1HQ3B 4AWLB 4Z66B 1P3MC 5AVBC 5B33D 5AVCD 4WZSB 5JRGD 3X1VC 4X23A 4J8VB 3O62C 3NQJB 3AZMB 3W97C 3X1TC 4KUDB 5AV8D 3C1BB 5F99A 3KXBD 4XZQC 3AN2A 3W96D 3LZ0B 5GXQB 3RELD 5B0YC 1P3MB 4NE6A 3X1SD 4Z5TB 4JJNC 4ZUXA 1M18C 1P3BD 3X1TB 4J8XA 4XUJA 4R8PC 2HIOC 4E45A 4QLCD 4XZQB 1S32A 2IO5C 3X1UC 3O62D 3W97D 5DNNC 1AOID 3AZJB 3NQUA 5AV6B 2F8NB 2HUEC 5B0YD 5G49A 3UT9D 5BNVA 3MNNB 3WTPD 4G91B 5B40A 1P3GA 4WU8C 2IO5B 5B2ID 3KWQD 3AZHC 3WAAA 5DNNB 2FJ7A 3AFAD 2NZDC 4CSRA 2RVQC 4YS3A 3AZFB 4J8UD 3VH5W 4WU8B 3AZHB 1M19B 3AN2C 1F66D 5B1MD 3A6NA 3AZNB 5CPID 5E5AC 2NZDD 1P3ID 3REKA 3WA9A 3MGRB 4XUJC 4J8XC 3B0BA 4X23D 1S32C 3AV2B 3MGSB 1P3LB 5E5AB 5F99D 3MVDB 2LY8A 3AZID 5GSUB 3WKJD 3LELD 5B2JD 4G92C
chains in the Genus database with same CATH superfamily
2Y2MA 4ZUXD 4ZBJB 5CP6A 3LZ1A 5DNMB 1BH9B 4J8XD 3WAAC 4WJ3C 5B1LD 2PYOA 2FJ7C 3W99B 3P5JB 5KDMB 1H3OB 5AV8A 1A7WA 3KXBA 4H9RA 3W96A 3RELA 1P34B 1Z2CB 3MGQD 3V9RA 5B40D 5B31A 3C1CB 1P3GD 2BYMA 1KX5B 1BH8B 5GT0D 3A6NC 5FUGA 2CV5A 3WAAD 1P3BA 3TU4C 2YFVA 4H9QB 1TZYD 3MGPD 4QLCA 3AZLA 2DF4C 3REKC 3KUYB 4YS3D 2BYKB 3REHB 3EPHA 1AOIA 1P3OA 1P3FA 2ZY3A 5AV5D 3LJAC 3UT9A 3TU4B 3WTPA 4YM6B 3VH5T 2UWXA 2ZM5A 1P3KC 5B24D 4DQYB 5AY8D 5CP6C 3AZEB 2NQBB 3AFAA 3LZ1C 3WA9D 3R45A 2PYOC 3LJAB 5B33C 3REIB 4J8UA 3W98A 1P3KB 5AV8C 3REJB 5BNXA 3KXBC 1ULYA 4J8WA 1F66A 3W96C 3RELC 3B0DC 5CPIA 1P3AB 1U35B 5B31C 3X1SC 5B33B 5CP6D 5AVCB 5JRGB 4H9OA 1N1JB 3WTPE 1P3IA 5BT1D 3A1KA 1P3BC 2PYOD 1JFIA 4QLCC 3AYWD 3B6FA 4LD9B 3IP4C 5CPJB 1TAFB 5CPKA 1AOIC 3AZIA 1P3FC 1B6WA 3X1SB 2ZY5A 3WKJA 3AV1B 3B0CT 3LELA 1KX3A 3UT9C 5B31D 5B2JA 3WTPC 4CAYA 5AVBB 4UUZB 3EPLA 3X1VB 2Y2JA 2CV5D 3O62B 5B2IC 3KWQC 3W97B 3UTBA 2FFFB 1M1AD 1KX4A 5B1LA 2YFWA 5B31G 3AZLD 3AFAC 5B0YB 1ID3A 1P3OD 2VQRA 4NE3A 1P3FD 1HQ3D 1W2EA 4H9PA 4Z66D 4J8UC 4JJNB 2ZY2A 5BO0A 3W98C 4KHAB 5B2IB 3KWQB 3AZKA 3VH6A 5B0ZA 3MGQA 1P3PA 4R8PB 2HIOB 4J8VD 3AZMD 1F66C 1ZLAA 5B1MC 5CPIC 5GT0A 3X1UB 2G5IC 3AL0C 3LZ0D 5B32A 1TZYA 3MGPA 1P3IC 2HUEB 4Z5TD 3EPKA 4H9NA 4X23C 1EQZA 3B6FC 3W98D 5B1MB 5AV5A 5F99C 5C3IC 4J8WD 5CPKC 3AZIC 3WKJC 2NZDB 3LELC 5B24A 1KX3C 5AV6D 5B2JC 2F8ND 5GT3A 4X23B 2CWEA 5AY8A 4ZUXC 4UPKA 3MNND 3UTBC 2JSSA 5B1LC 5F99B 5C3IB 3AN2B 3B6FD 3B6GA 5CPKD 1ID3C 3UTAA 5BS7A 4ZUXB 1KX3D 1BFMA 3MGQC 4J8XB 4XUJB 1P3PC 5B40C 1P3GC 1S32B 5GT0C 1M19D 3UTBD 1KX4D 2AROA 3AZND 1TZYC 3NQUB 3MGPC 3AYWA 2F8NH 4YS3C 1ID3D 5G49B 3B0CW 5BNVB 4G92B 2F8NK 5B40B 5AV9A 1P3GB 3AZGA 2BG1A 3MGRD 5AV5C 3AZKD 5B0ZD 3AV2D 1P3PD 3WAAB 1ZLAD 2FJ7B 4KGCA 3MVDD 4WU9A 4CSRB 5B24C 5JA4A 4YS3B 5GSUD 5GT3C 1M1AA 5B32D 5AY8C 4WNNA 3WA9C 5DNMD 4EO5C 1HQ3A 2Y2IA 5B32G 1EQZD 3A6NB 4Z66A 3B6GC 3A1IA 3W99D 5BS7C 1KU5A 2Y2LA 4J8VA 4KUDA 3NQJA 4Z2MG 3AZMA 3VH6W 3C1BA 3REKB 3WA9B 5GT3D 1P34D 3LZ0A 1WWIA 5GXQA 1WWSA 5BT1C 1P3MA 2AROC 3F6TA 4Z5TA 3AYWC 3X1TA 3B6GD 3UTAD 2Y2GA 4XZQA 3KUYD 3AZGC 3REHD 5CP6B 4Z2MH 3LZ1B 5CHLB 3AZJA 5AV6A 3H0LC 2PYOB 2F8NA 3KFUG 4WU9C 1HTAA 2CV5C 3MNNA 4YM6D 2AROD 5AV8B 1M1AC 1M18B 3KXBB 3AZLC 4H9RB 3W96B 3RELB 3B0DB 5DNNA 3V9RB 3AZED 1P3OC 2NQBD 5AV9D 5B31B 3AZGD 1HQ3C 2BYMB 1B67A 4Z66C 4DRBA 3AZFA 5FUGB 4NFTA 2CV5B 3EG5B 1P3BB 2YFVB 4J8VC 3AZMC 4KGCD 4WU8A 4WU9D 4QLCB 3AZLB 3AZHA 1M19A 3LZ0C 5GXQC 1P3OB 1AOIB 1Q9CA 3AZNA 1P3FB 1P3AD 1U35D 4Z5TC 3UT9B 4M6BA 3WTPB 3MGRA 2J8PA 4J8WC 3AV2A 3MGSA 4KUDD 1P3LA 4LD9D 5CPJD 3C1BD 5E5AA 3AFAB 3MVDA 3H0MC 3H0RC 3R45B 5AV6C 3AZJC 5GXQD 5GSUA 3AV1D 3VH6T 4J8UB 1P3MD 3MNNC 3W98B 2Y2KA 4G91C 5AVBD 3X1VD 5BNXB 4J8WB 5DNMA 3X1TD 1F66B 1BH9A 5CPIB 2L5AA 4XZQD 3W99A 5KDMA 1H3OA 4H9OB 3AZFC 1P3IB 3AZJD 4HGAC 1JFIB 4JJND 1P34A 1M18D 4E44A 1M19C 3B6FB 4R8PD 2HIOD 3C1CA 1KX4C 5CPKB 1BH8A 1KX5A 3AZIB 3X1UD 3AZNC 2F8NG 3WKJB 5DNND 4H9QA 3LELB 1KX3B 4HGAB 5B2JB 4CAYB 3KUYA 2BYKA 3MGRC 2ZY4A 3REHA 3AZFD 1PZRA 3AZKC 5B0ZC 3UTBB 3AV2C 3MGSC 5B1LB 4H9SA 2YFWB 1P3LC 1KX4B 4WU8D 1ZLAC 2G5HC 3AZHD 3MVDC 3TU4A 4YM6A 5GSUC 1ID3B 5B32C 2RVQD 4H9PB 5BO0B 3AZKB 5B0ZB 4ZBJC 3MGQB 3AZEA 1P3PB 2NQBA 5DNMC 1EQZC 1ZLAB 5GT0B 2W8SA 3LJAA 3W99C 3AN2D 3MGSD 3REIA 1P3LD 5B32B 5E5AD 1TZYB 3MGPB 1P3KA 1R4VA 3REJA 4H9NB 1P34C 1EQZB 1P3AA 4XUJD 3C1CC 1U35A 5AV5B 2JE5A 1KX5C 5B33A 1S32D 5AVCA 5JRGA 4NE5A 3KSYA 1N1JA 3UTAC 5B24B 5GT3B 2Y2QA 3KUYC 4LD9A 5AY8B 3REHC 5CPJA 1TAFA 2F2AC 4H9SC 3X1SA 4EO5B 3AV1A 3C1CD 1F1EA 3B6GB 4YM6C 1KX5D 5AVBA 3UTAB 4UUZA 3X1VA 2FJ7D 3O62A 3W97A 4WV4B 3VH5A 3AZEC 2NQBC 5AV9C 5B0YA 2Y2PA 2XD1A 3REIC 2AROB 3A6ND 4KGCC 4JJNA 3AYWB 4KHAA 5B2IA 3KWQA 3REJC 1M18A 3TU4D 4R8PA 2HIOA 5AV9B 3X1UA 3REKD 3AZGB 1P3AC 1U35C 5AVCC 5JRGC 4KGCB 4AWLC 4WU9B 3LJAD 5JA4B 3REID 3EPJA 1M1AB 4KUDC 4LD9C 1P3KD 5B1MA 5CPJC 3C1BC 3REJD 4WNNB 4DRAA 2NZDA 3LZ1D 3AV1C 1HQ3B 4AWLB 4Z66B 1P3MC 5AVBC 5B33D 5AVCD 4WZSB 5JRGD 3X1VC 4X23A 4J8VB 3O62C 3NQJB 3AZMB 3W97C 3X1TC 4KUDB 5AV8D 3C1BB 5F99A 3KXBD 4XZQC 1T3UA 3AN2A 3W96D 3LZ0B 5GXQB 3RELD 5B0YC 2Y2OA 1P3MB 4NE6A 3X1SD 4Z5TB 4JJNC 4ZUXA 2RIQA 1M18C 1P3BD 3X1TB 4J8XA 4XUJA 4R8PC 2HIOC 4E45A 4QLCD 4XZQB 1S32A 2IO5C 3X1UC 3O62D 3W97D 5DNNC 1AOID 3AZJB 3NQUA 5AV6B 2F8NB 2HUEC 5B0YD 5G49A 3UT9D 5BNVA 2XD5A 2Y2HA 3WTPD 4G91B 5B40A 3MNNB 1P3GA 4WU8C 2IO5B 5B2ID 3KWQD 3AZHC 2JCHA 3WAAA 5DNNB 2FJ7A 3AFAD 2NZDC 4CSRA 2RVQC 4YS3A 3AZFB 4J8UD 3VH5W 4WU8B 3AZHB 1M19B 3AN2C 1F66D 5B1MD 3A6NA 3AZNB 5CPID 5E5AC 2NZDD 1P3ID 3REKA 3WA9A 3MGRB 4XUJC 4J8XC 3B0BA 4X23D 1S32C 3AV2B 3MGSB 2DQNC 1P3LB 5E5AB 5F99D 3MVDB 2LY8A 3AZID 5GSUB 3WKJD 3FDDA 3LELD 2Y2NA 5B2JD 4G92C
chains in the Genus database with same CATH topology
2Y2MA 4ZUXD 4ZBJB 5CP6A 3LZ1A 5DNMB 1BH9B 4J8XD 3WAAC 4WJ3C 5B1LD 2PYOA 2FJ7C 3W99B 3P5JB 5KDMB 1H3OB 5AV8A 1A7WA 3KXBA 4H9RA 3W96A 3RELA 1P34B 1Z2CB 3MGQD 3V9RA 5B40D 5B31A 3C1CB 1P3GD 2BYMA 1KX5B 1BH8B 5GT0D 3A6NC 5FUGA 2CV5A 3WAAD 1P3BA 3TU4C 2YFVA 4H9QB 1TZYD 3MGPD 4QLCA 3AZLA 2DF4C 3REKC 3KUYB 4YS3D 2BYKB 3REHB 3EPHA 1AOIA 1P3OA 1P3FA 2ZY3A 5AV5D 3LJAC 3UT9A 3TU4B 3WTPA 4YM6B 3VH5T 2UWXA 2ZM5A 1P3KC 5B24D 4DQYB 5AY8D 5CP6C 3AZEB 2NQBB 3AFAA 3LZ1C 3WA9D 3R45A 2PYOC 3LJAB 5B33C 3REIB 4J8UA 3W98A 1P3KB 5AV8C 3REJB 5BNXA 3KXBC 1ULYA 4J8WA 1F66A 3W96C 3RELC 3B0DC 5CPIA 1P3AB 1U35B 5B31C 3X1SC 5B33B 5CP6D 5AVCB 5JRGB 4H9OA 1N1JB 3WTPE 1P3IA 5BT1D 3A1KA 1P3BC 2PYOD 1JFIA 4QLCC 3AYWD 3B6FA 4LD9B 3IP4C 5CPJB 1TAFB 5CPKA 1AOIC 3AZIA 1P3FC 1B6WA 3X1SB 2ZY5A 3WKJA 3AV1B 3B0CT 3LELA 1KX3A 3UT9C 5B31D 5B2JA 3WTPC 4CAYA 5AVBB 4UUZB 3EPLA 3X1VB 2Y2JA 2CV5D 3O62B 5B2IC 3KWQC 3W97B 3UTBA 2FFFB 1M1AD 1KX4A 5B1LA 2YFWA 5B31G 3AZLD 3AFAC 5B0YB 1ID3A 1P3OD 2VQRA 4NE3A 1P3FD 1HQ3D 1W2EA 4H9PA 4Z66D 4J8UC 4JJNB 2ZY2A 5BO0A 3W98C 4KHAB 5B2IB 3KWQB 3AZKA 3VH6A 5B0ZA 3MGQA 1P3PA 4R8PB 2HIOB 4J8VD 3AZMD 1F66C 1ZLAA 5B1MC 5CPIC 5GT0A 3X1UB 2G5IC 3AL0C 3LZ0D 5B32A 1TZYA 3MGPA 1P3IC 2HUEB 4Z5TD 3EPKA 4H9NA 4X23C 1EQZA 3B6FC 3W98D 5B1MB 5AV5A 5F99C 5C3IC 4J8WD 5CPKC 3AZIC 3WKJC 2NZDB 3LELC 5B24A 1KX3C 5AV6D 5B2JC 2F8ND 5GT3A 4X23B 2CWEA 5AY8A 4ZUXC 4UPKA 3MNND 3UTBC 2JSSA 5B1LC 5F99B 5C3IB 3AN2B 3B6FD 3B6GA 5CPKD 1ID3C 3UTAA 5BS7A 4ZUXB 1KX3D 1BFMA 3MGQC 4J8XB 4XUJB 1P3PC 5B40C 1P3GC 1S32B 5GT0C 1M19D 3UTBD 1KX4D 2AROA 3AZND 1TZYC 3NQUB 3MGPC 3AYWA 2F8NH 4YS3C 1ID3D 5G49B 3B0CW 5BNVB 4G92B 2F8NK 5B40B 5AV9A 1P3GB 3AZGA 2BG1A 3MGRD 5AV5C 3AZKD 5B0ZD 3AV2D 1P3PD 3WAAB 1ZLAD 2FJ7B 4KGCA 3MVDD 4WU9A 4CSRB 5B24C 5JA4A 4YS3B 5GSUD 5GT3C 1M1AA 5B32D 5AY8C 4WNNA 3WA9C 5DNMD 4EO5C 1HQ3A 2Y2IA 5B32G 1EQZD 3A6NB 4Z66A 3B6GC 3A1IA 3W99D 5BS7C 1KU5A 2Y2LA 4J8VA 4KUDA 3NQJA 4Z2MG 3AZMA 3VH6W 3C1BA 3REKB 3WA9B 5GT3D 1P34D 3LZ0A 1WWIA 5GXQA 1WWSA 5BT1C 1P3MA 2AROC 3F6TA 4Z5TA 3AYWC 3X1TA 3B6GD 3UTAD 2Y2GA 4XZQA 3KUYD 3AZGC 3REHD 5CP6B 4Z2MH 3LZ1B 5CHLB 3AZJA 5AV6A 3H0LC 2PYOB 2F8NA 3KFUG 4WU9C 1HTAA 2CV5C 3MNNA 4YM6D 2AROD 5AV8B 1M1AC 1M18B 3KXBB 3AZLC 4H9RB 3W96B 3RELB 3B0DB 5DNNA 3V9RB 3AZED 1P3OC 2NQBD 5AV9D 5B31B 3AZGD 1HQ3C 2BYMB 1B67A 4Z66C 4DRBA 3AZFA 5FUGB 4NFTA 2CV5B 3EG5B 1P3BB 2YFVB 4J8VC 3AZMC 4KGCD 4WU8A 4WU9D 4QLCB 3AZLB 3AZHA 1M19A 3LZ0C 5GXQC 1P3OB 1AOIB 1Q9CA 3AZNA 1P3FB 1P3AD 1U35D 4Z5TC 3UT9B 4M6BA 3WTPB 3MGRA 2J8PA 4J8WC 3AV2A 3MGSA 4KUDD 1P3LA 4LD9D 5CPJD 3C1BD 5E5AA 3AFAB 3MVDA 3H0MC 3H0RC 3R45B 5AV6C 3AZJC 5GXQD 5GSUA 3AV1D 3VH6T 4J8UB 1P3MD 3MNNC 3W98B 2Y2KA 4G91C 5AVBD 3X1VD 5BNXB 4J8WB 5DNMA 3X1TD 1F66B 1BH9A 5CPIB 2L5AA 4XZQD 3W99A 5KDMA 1H3OA 4H9OB 3AZFC 1P3IB 3AZJD 4HGAC 1JFIB 4JJND 1P34A 1M18D 4E44A 1M19C 3B6FB 4R8PD 2HIOD 3C1CA 1KX4C 5CPKB 1BH8A 1KX5A 3AZIB 3X1UD 3AZNC 2F8NG 3WKJB 5DNND 4H9QA 3LELB 1KX3B 4HGAB 5B2JB 4CAYB 3KUYA 2BYKA 3MGRC 2ZY4A 3REHA 3AZFD 1PZRA 3AZKC 5B0ZC 3UTBB 3AV2C 3MGSC 5B1LB 4H9SA 2YFWB 1P3LC 1KX4B 4WU8D 1ZLAC 2G5HC 3AZHD 3MVDC 3TU4A 4YM6A 5GSUC 1ID3B 5B32C 2RVQD 4H9PB 5BO0B 3AZKB 5B0ZB 4ZBJC 3MGQB 3AZEA 1P3PB 2NQBA 5DNMC 1EQZC 1ZLAB 5GT0B 2W8SA 3LJAA 3W99C 3AN2D 3MGSD 3REIA 1P3LD 5B32B 5E5AD 1TZYB 3MGPB 1P3KA 1R4VA 3REJA 4H9NB 1P34C 1EQZB 1P3AA 4XUJD 3C1CC 1U35A 5AV5B 2JE5A 1KX5C 5B33A 1S32D 5AVCA 5JRGA 4NE5A 3KSYA 1N1JA 3UTAC 5B24B 5GT3B 2Y2QA 3KUYC 4LD9A 5AY8B 3REHC 5CPJA 1TAFA 2F2AC 4H9SC 3X1SA 4EO5B 3AV1A 3C1CD 1F1EA 3B6GB 4YM6C 1KX5D 5AVBA 3UTAB 4UUZA 3X1VA 2FJ7D 3O62A 3W97A 4WV4B 3VH5A 3AZEC 2NQBC 5AV9C 5B0YA 2Y2PA 2XD1A 3REIC 2AROB 3A6ND 4KGCC 4JJNA 3AYWB 4KHAA 5B2IA 3KWQA 3REJC 1M18A 3TU4D 4R8PA 2HIOA 5AV9B 3X1UA 3REKD 3AZGB 1P3AC 1U35C 5AVCC 5JRGC 4KGCB 4AWLC 4WU9B 3LJAD 5JA4B 3REID 3EPJA 1M1AB 4KUDC 4LD9C 1P3KD 5B1MA 5CPJC 3C1BC 3REJD 4WNNB 4DRAA 2NZDA 3LZ1D 3AV1C 1HQ3B 4AWLB 4Z66B 1P3MC 5AVBC 5B33D 5AVCD 4WZSB 5JRGD 3X1VC 4X23A 4J8VB 3O62C 3NQJB 3AZMB 3W97C 3X1TC 4KUDB 5AV8D 3C1BB 5F99A 3KXBD 4XZQC 1T3UA 3AN2A 3W96D 3LZ0B 5GXQB 3RELD 5B0YC 2Y2OA 1P3MB 4NE6A 3X1SD 4Z5TB 4JJNC 4ZUXA 2RIQA 1M18C 1P3BD 3X1TB 4J8XA 4XUJA 4R8PC 2HIOC 4E45A 4QLCD 4XZQB 1S32A 2IO5C 3X1UC 3O62D 3W97D 5DNNC 1AOID 3AZJB 3NQUA 5AV6B 2F8NB 2HUEC 5B0YD 5G49A 3UT9D 5BNVA 2XD5A 2Y2HA 3WTPD 4G91B 5B40A 3MNNB 1P3GA 4WU8C 2IO5B 5B2ID 3KWQD 3AZHC 2JCHA 3WAAA 5DNNB 2FJ7A 3AFAD 2NZDC 4CSRA 2RVQC 4YS3A 3AZFB 4J8UD 3VH5W 4WU8B 3AZHB 1M19B 3AN2C 1F66D 5B1MD 3A6NA 3AZNB 5CPID 5E5AC 2NZDD 1P3ID 3REKA 3WA9A 3MGRB 4XUJC 4J8XC 3B0BA 4X23D 1S32C 3AV2B 3MGSB 2DQNC 1P3LB 5E5AB 5F99D 3MVDB 2LY8A 3AZID 5GSUB 3WKJD 3FDDA 3LELD 2Y2NA 5B2JD 4G92C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX D;  4ZBJ B;  5CP6 A;  3LZ1 A;  5DNM B;  1BH9 B;  4J8X D;  3WAA C;  5B1L D;  2PYO A;  2FJ7 C;  3W99 B;  5KDM B;  1H3O B;  5AV8 A;  1A7W A;  3KXB A;  4H9R A;  3W96 A;  3REL A;  1P34 B;  3MGQ D;  3V9R A;  5B40 D;  5B31 A;  3C1C B;  1P3G D;  2BYM A;  1KX5 B;  1BH8 B;  5GT0 D;  3A6N C;  5FUG A;  2CV5 A;  3WAA D;  1P3B A;  3TU4 C;  2YFV A;  4H9Q B;  1TZY D;  3MGP D;  4QLC A;  3AZL A;  3REK C;  3KUY B;  4YS3 D;  2BYK B;  3REH B;  1AOI A;  1P3O A;  1P3F A;  5AV5 D;  3LJA C;  3UT9 A;  3TU4 B;  3WTP A;  4YM6 B;  3VH5 T;  1P3K C;  5B24 D;  5AY8 D;  5CP6 C;  3AZE B;  2NQB B;  3AFA A;  3LZ1 C;  3WA9 D;  3R45 A;  2PYO C;  3LJA B;  5B33 C;  3REI B;  4J8U A;  3W98 A;  1P3K B;  5AV8 C;  3REJ B;  5BNX A;  3KXB C;  1ULY A;  4J8W A;  1F66 A;  3W96 C;  3REL C;  3B0D C;  5CPI A;  1P3A B;  1U35 B;  5B31 C;  3X1S C;  5B33 B;  5CP6 D;  5AVC B;  5JRG B;  4H9O A;  1N1J B;  3WTP E;  1P3I A;  5BT1 D;  1P3B C;  2PYO D;  1JFI A;  4QLC C;  3AYW D;  3B6F A;  4LD9 B;  5CPJ B;  1TAF B;  5CPK A;  1AOI C;  3AZI A;  1P3F C;  1B6W A;  3X1S B;  3WKJ A;  3AV1 B;  3B0C T;  3LEL A;  1KX3 A;  3UT9 C;  5B31 D;  5B2J A;  3WTP C;  4CAY A;  5AVB B;  4UUZ B;  3X1V B;  2CV5 D;  3O62 B;  5B2I C;  3KWQ C;  3W97 B;  3UTB A;  1M1A D;  1KX4 A;  5B1L A;  2YFW A;  5B31 G;  3AZL D;  3AFA C;  5B0Y B;  1ID3 A;  1P3O D;  4NE3 A;  1P3F D;  1HQ3 D;  4H9P A;  4Z66 D;  4J8U C;  4JJN B;  5BO0 A;  3W98 C;  4KHA B;  5B2I B;  3KWQ B;  3AZK A;  3VH6 A;  5B0Z A;  3MGQ A;  1P3P A;  4R8P B;  2HIO B;  4J8V D;  3AZM D;  1F66 C;  1ZLA A;  5B1M C;  5CPI C;  5GT0 A;  3X1U B;  3LZ0 D;  5B32 A;  1TZY A;  3MGP A;  1P3I C;  2HUE B;  4Z5T D;  4H9N A;  4X23 C;  1EQZ A;  3B6F C;  3W98 D;  5B1M B;  5AV5 A;  5F99 C;  5C3I C;  4J8W D;  5CPK C;  3AZI C;  3WKJ C;  2NZD B;  3LEL C;  5B24 A;  1KX3 C;  5AV6 D;  5B2J C;  2F8N D;  5GT3 A;  4X23 B;  2CWE A;  5AY8 A;  4ZUX C;  3MNN D;  3UTB C;  2JSS A;  5B1L C;  5F99 B;  5C3I B;  3AN2 B;  3B6F D;  3B6G A;  5CPK D;  1ID3 C;  3UTA A;  5BS7 A;  4ZUX B;  1KX3 D;  1BFM A;  3MGQ C;  4J8X B;  4XUJ B;  1P3P C;  5B40 C;  1P3G C;  1S32 B;  5GT0 C;  1M19 D;  3UTB D;  1KX4 D;  2ARO A;  3AZN D;  1TZY C;  3NQU B;  3MGP C;  3AYW A;  2F8N H;  4YS3 C;  1ID3 D;  5G49 B;  3B0C W;  5BNV B;  4G92 B;  2F8N K;  5B40 B;  5AV9 A;  1P3G B;  3AZG A;  3MGR D;  5AV5 C;  3AZK D;  5B0Z D;  3AV2 D;  1P3P D;  3WAA B;  1ZLA D;  2FJ7 B;  4KGC A;  3MVD D;  4WU9 A;  4CSR B;  5B24 C;  5JA4 A;  4YS3 B;  5GSU D;  5GT3 C;  1M1A A;  5B32 D;  5AY8 C;  4WNN A;  3WA9 C;  5DNM D;  4EO5 C;  1HQ3 A;  5B32 G;  1EQZ D;  3A6N B;  4Z66 A;  3B6G C;  3W99 D;  5BS7 C;  1KU5 A;  4J8V A;  4KUD A;  3NQJ A;  4Z2M G;  3AZM A;  3VH6 W;  3C1B A;  3REK B;  3WA9 B;  5GT3 D;  1P34 D;  3LZ0 A;  1WWI A;  5GXQ A;  1WWS A;  5BT1 C;  1P3M A;  2ARO C;  4Z5T A;  3AYW C;  3X1T A;  3B6G D;  3UTA D;  4XZQ A;  3KUY D;  3AZG C;  3REH D;  5CP6 B;  4Z2M H;  3LZ1 B;  5CHL B;  3AZJ A;  5AV6 A;  2PYO B;  2F8N A;  4WU9 C;  1HTA A;  2CV5 C;  3MNN A;  4YM6 D;  2ARO D;  5AV8 B;  1M1A C;  1M18 B;  3KXB B;  3AZL C;  4H9R B;  3W96 B;  3REL B;  3B0D B;  5DNN A;  3V9R B;  3AZE D;  1P3O C;  2NQB D;  5AV9 D;  5B31 B;  3AZG D;  1HQ3 C;  2BYM B;  1B67 A;  4Z66 C;  4DRB A;  3AZF A;  5FUG B;  4NFT A;  2CV5 B;  1P3B B;  2YFV B;  4J8V C;  3AZM C;  4KGC D;  4WU9 D;  4QLC B;  4WU8 A;  3AZL B;  3AZH A;  1M19 A;  3LZ0 C;  5GXQ C;  1P3O B;  1AOI B;  1Q9C A;  3AZN A;  1P3F B;  1P3A D;  1U35 D;  4Z5T C;  3UT9 B;  4M6B A;  3WTP B;  3MGR A;  4J8W C;  3AV2 A;  3MGS A;  4KUD D;  1P3L A;  4LD9 D;  5CPJ D;  3C1B D;  5E5A A;  3AFA B;  3MVD A;  3AZJ C;  3R45 B;  5AV6 C;  5GXQ D;  5GSU A;  3AV1 D;  3VH6 T;  4J8U B;  1P3M D;  3MNN C;  3W98 B;  4G91 C;  5AVB D;  3X1V D;  5BNX B;  4J8W B;  5DNM A;  3X1T D;  1F66 B;  1BH9 A;  5CPI B;  2L5A A;  4XZQ D;  3W99 A;  5KDM A;  1H3O A;  4H9O B;  3AZF C;  1P3I B;  3AZJ D;  4HGA C;  1JFI B;  4JJN D;  1P34 A;  1M18 D;  4E44 A;  1M19 C;  3B6F B;  4R8P D;  2HIO D;  3C1C A;  1KX4 C;  5CPK B;  1BH8 A;  1KX5 A;  3AZI B;  3X1U D;  3AZN C;  2F8N G;  3WKJ B;  5DNN D;  4H9Q A;  3LEL B;  1KX3 B;  4HGA B;  5B2J B;  4CAY B;  3KUY A;  2BYK A;  3MGR C;  3REH A;  3AZF D;  3AZK C;  5B0Z C;  3UTB B;  3AV2 C;  3MGS C;  5B1L B;  4H9S A;  2YFW B;  1P3L C;  1KX4 B;  4WU8 D;  1ZLA C;  3AZH D;  3MVD C;  3TU4 A;  4YM6 A;  5GSU C;  1ID3 B;  5B32 C;  2RVQ D;  4H9P B;  5BO0 B;  3AZK B;  5B0Z B;  4ZBJ C;  3MGQ B;  3AZE A;  1P3P B;  2NQB A;  5DNM C;  1EQZ C;  1ZLA B;  5GT0 B;  3LJA A;  3W99 C;  3AN2 D;  3MGS D;  3REI A;  1P3L D;  5B32 B;  5E5A D;  1TZY B;  3MGP B;  1P3K A;  1R4V A;  3REJ A;  4H9N B;  1P34 C;  1EQZ B;  1P3A A;  4XUJ D;  3C1C C;  1U35 A;  5AV5 B;  1KX5 C;  5B33 A;  1S32 D;  5AVC A;  5JRG A;  4NE5 A;  3KSY A;  1N1J A;  3UTA C;  5B24 B;  5GT3 B;  3KUY C;  4LD9 A;  5AY8 B;  3REH C;  5CPJ A;  1TAF A;  4H9S C;  3X1S A;  4EO5 B;  3AV1 A;  3C1C D;  1F1E A;  3B6G B;  4YM6 C;  1KX5 D;  5AVB A;  3UTA B;  4UUZ A;  3X1V A;  2FJ7 D;  3O62 A;  3W97 A;  4WV4 B;  3VH5 A;  3AZE C;  2NQB C;  5AV9 C;  5B0Y A;  3REI C;  2ARO B;  3A6N D;  4KGC C;  4JJN A;  3AYW B;  4KHA A;  5B2I A;  3KWQ A;  3REJ C;  1M18 A;  3TU4 D;  4R8P A;  2HIO A;  5AV9 B;  3X1U A;  3REK D;  3AZG B;  1P3A C;  1U35 C;  5AVC C;  5JRG C;  4KGC B;  4AWL C;  4WU9 B;  3LJA D;  5JA4 B;  3REI D;  1M1A B;  4KUD C;  4LD9 C;  1P3K D;  5B1M A;  5CPJ C;  3C1B C;  3REJ D;  4WNN B;  4DRA A;  2NZD A;  3LZ1 D;  3AV1 C;  1HQ3 B;  4AWL B;  4Z66 B;  1P3M C;  5AVB C;  5B33 D;  5AVC D;  4WZS B;  5JRG D;  3X1V C;  4X23 A;  4J8V B;  3O62 C;  3NQJ B;  3AZM B;  3W97 C;  3X1T C;  4KUD B;  5AV8 D;  3C1B B;  5F99 A;  3KXB D;  4XZQ C;  3AN2 A;  3W96 D;  3LZ0 B;  5GXQ B;  3REL D;  5B0Y C;  1P3M B;  4NE6 A;  3X1S D;  4Z5T B;  4JJN C;  4ZUX A;  1M18 C;  1P3B D;  3X1T B;  4J8X A;  4XUJ A;  4R8P C;  2HIO C;  4E45 A;  4QLC D;  4XZQ B;  1S32 A;  2IO5 C;  3X1U C;  3O62 D;  3W97 D;  5DNN C;  1AOI D;  3AZJ B;  3NQU A;  5AV6 B;  2F8N B;  2HUE C;  5B0Y D;  5G49 A;  3UT9 D;  5BNV A;  3MNN B;  3WTP D;  4G91 B;  5B40 A;  1P3G A;  4WU8 C;  2IO5 B;  5B2I D;  3KWQ D;  3AZH C;  3WAA A;  5DNN B;  2FJ7 A;  3AFA D;  2NZD C;  4CSR A;  2RVQ C;  4YS3 A;  3AZF B;  4J8U D;  3VH5 W;  4WU8 B;  3AZH B;  1M19 B;  3AN2 C;  1F66 D;  5B1M D;  3A6N A;  3AZN B;  5CPI D;  5E5A C;  2NZD D;  1P3I D;  3REK A;  3WA9 A;  3MGR B;  4XUJ C;  4J8X C;  3B0B A;  4X23 D;  1S32 C;  3AV2 B;  3MGS B;  1P3L B;  5E5A B;  5F99 D;  3MVD B;  2LY8 A;  3AZI D;  5GSU B;  3WKJ D;  3LEL D;  5B2J D;  4G92 C; 
#chains in the Genus database with same CATH topology
 2Y2M A;  4ZUX D;  4ZBJ B;  5CP6 A;  3LZ1 A;  5DNM B;  1BH9 B;  4J8X D;  3WAA C;  4WJ3 C;  5B1L D;  2PYO A;  2FJ7 C;  3W99 B;  3P5J B;  5KDM B;  1H3O B;  5AV8 A;  1A7W A;  3KXB A;  4H9R A;  3W96 A;  3REL A;  1P34 B;  1Z2C B;  3MGQ D;  3V9R A;  5B40 D;  5B31 A;  3C1C B;  1P3G D;  2BYM A;  1KX5 B;  1BH8 B;  5GT0 D;  3A6N C;  5FUG A;  2CV5 A;  3WAA D;  1P3B A;  3TU4 C;  2YFV A;  4H9Q B;  1TZY D;  3MGP D;  4QLC A;  3AZL A;  2DF4 C;  3REK C;  3KUY B;  4YS3 D;  2BYK B;  3REH B;  3EPH A;  1AOI A;  1P3O A;  1P3F A;  2ZY3 A;  5AV5 D;  3LJA C;  3UT9 A;  3TU4 B;  3WTP A;  4YM6 B;  3VH5 T;  2UWX A;  2ZM5 A;  1P3K C;  5B24 D;  4DQY B;  5AY8 D;  5CP6 C;  3AZE B;  2NQB B;  3AFA A;  3LZ1 C;  3WA9 D;  3R45 A;  2PYO C;  3LJA B;  5B33 C;  3REI B;  4J8U A;  3W98 A;  1P3K B;  5AV8 C;  3REJ B;  5BNX A;  3KXB C;  1ULY A;  4J8W A;  1F66 A;  3W96 C;  3REL C;  3B0D C;  5CPI A;  1P3A B;  1U35 B;  5B31 C;  3X1S C;  5B33 B;  5CP6 D;  5AVC B;  5JRG B;  4H9O A;  1N1J B;  3WTP E;  1P3I A;  5BT1 D;  3A1K A;  1P3B C;  2PYO D;  1JFI A;  4QLC C;  3AYW D;  3B6F A;  4LD9 B;  3IP4 C;  5CPJ B;  1TAF B;  5CPK A;  1AOI C;  3AZI A;  1P3F C;  1B6W A;  3X1S B;  2ZY5 A;  3WKJ A;  3AV1 B;  3B0C T;  3LEL A;  1KX3 A;  3UT9 C;  5B31 D;  5B2J A;  3WTP C;  4CAY A;  5AVB B;  4UUZ B;  3EPL A;  3X1V B;  2Y2J A;  2CV5 D;  3O62 B;  5B2I C;  3KWQ C;  3W97 B;  3UTB A;  2FFF B;  1M1A D;  1KX4 A;  5B1L A;  2YFW A;  5B31 G;  3AZL D;  3AFA C;  5B0Y B;  1ID3 A;  1P3O D;  2VQR A;  4NE3 A;  1P3F D;  1HQ3 D;  1W2E A;  4H9P A;  4Z66 D;  4J8U C;  4JJN B;  2ZY2 A;  5BO0 A;  3W98 C;  4KHA B;  5B2I B;  3KWQ B;  3AZK A;  3VH6 A;  5B0Z A;  3MGQ A;  1P3P A;  4R8P B;  2HIO B;  4J8V D;  3AZM D;  1F66 C;  1ZLA A;  5B1M C;  5CPI C;  5GT0 A;  3X1U B;  2G5I C;  3AL0 C;  3LZ0 D;  5B32 A;  1TZY A;  3MGP A;  1P3I C;  2HUE B;  4Z5T D;  3EPK A;  4H9N A;  4X23 C;  1EQZ A;  3B6F C;  3W98 D;  5B1M B;  5AV5 A;  5F99 C;  5C3I C;  4J8W D;  5CPK C;  3AZI C;  3WKJ C;  2NZD B;  3LEL C;  5B24 A;  1KX3 C;  5AV6 D;  5B2J C;  2F8N D;  5GT3 A;  4X23 B;  2CWE A;  5AY8 A;  4ZUX C;  4UPK A;  3MNN D;  3UTB C;  2JSS A;  5B1L C;  5F99 B;  5C3I B;  3AN2 B;  3B6F D;  3B6G A;  5CPK D;  1ID3 C;  3UTA A;  5BS7 A;  4ZUX B;  1KX3 D;  1BFM A;  3MGQ C;  4J8X B;  4XUJ B;  1P3P C;  5B40 C;  1P3G C;  1S32 B;  5GT0 C;  1M19 D;  3UTB D;  1KX4 D;  2ARO A;  3AZN D;  1TZY C;  3NQU B;  3MGP C;  3AYW A;  2F8N H;  4YS3 C;  1ID3 D;  5G49 B;  3B0C W;  5BNV B;  4G92 B;  2F8N K;  5B40 B;  5AV9 A;  1P3G B;  3AZG A;  2BG1 A;  3MGR D;  5AV5 C;  3AZK D;  5B0Z D;  3AV2 D;  1P3P D;  3WAA B;  1ZLA D;  2FJ7 B;  4KGC A;  3MVD D;  4WU9 A;  4CSR B;  5B24 C;  5JA4 A;  4YS3 B;  5GSU D;  5GT3 C;  1M1A A;  5B32 D;  5AY8 C;  4WNN A;  3WA9 C;  5DNM D;  4EO5 C;  1HQ3 A;  2Y2I A;  5B32 G;  1EQZ D;  3A6N B;  4Z66 A;  3B6G C;  3A1I A;  3W99 D;  5BS7 C;  1KU5 A;  2Y2L A;  4J8V A;  4KUD A;  3NQJ A;  4Z2M G;  3AZM A;  3VH6 W;  3C1B A;  3REK B;  3WA9 B;  5GT3 D;  1P34 D;  3LZ0 A;  1WWI A;  5GXQ A;  1WWS A;  5BT1 C;  1P3M A;  2ARO C;  3F6T A;  4Z5T A;  3AYW C;  3X1T A;  3B6G D;  3UTA D;  2Y2G A;  4XZQ A;  3KUY D;  3AZG C;  3REH D;  5CP6 B;  4Z2M H;  3LZ1 B;  5CHL B;  3AZJ A;  5AV6 A;  3H0L C;  2PYO B;  2F8N A;  3KFU G;  4WU9 C;  1HTA A;  2CV5 C;  3MNN A;  4YM6 D;  2ARO D;  5AV8 B;  1M1A C;  1M18 B;  3KXB B;  3AZL C;  4H9R B;  3W96 B;  3REL B;  3B0D B;  5DNN A;  3V9R B;  3AZE D;  1P3O C;  2NQB D;  5AV9 D;  5B31 B;  3AZG D;  1HQ3 C;  2BYM B;  1B67 A;  4Z66 C;  4DRB A;  3AZF A;  5FUG B;  4NFT A;  2CV5 B;  3EG5 B;  1P3B B;  2YFV B;  4J8V C;  3AZM C;  4KGC D;  4WU8 A;  4WU9 D;  4QLC B;  3AZL B;  3AZH A;  1M19 A;  3LZ0 C;  5GXQ C;  1P3O B;  1AOI B;  1Q9C A;  3AZN A;  1P3F B;  1P3A D;  1U35 D;  4Z5T C;  3UT9 B;  4M6B A;  3WTP B;  3MGR A;  2J8P A;  4J8W C;  3AV2 A;  3MGS A;  4KUD D;  1P3L A;  4LD9 D;  5CPJ D;  3C1B D;  5E5A A;  3AFA B;  3MVD A;  3H0M C;  3H0R C;  3R45 B;  5AV6 C;  3AZJ C;  5GXQ D;  5GSU A;  3AV1 D;  3VH6 T;  4J8U B;  1P3M D;  3MNN C;  3W98 B;  2Y2K A;  4G91 C;  5AVB D;  3X1V D;  5BNX B;  4J8W B;  5DNM A;  3X1T D;  1F66 B;  1BH9 A;  5CPI B;  2L5A A;  4XZQ D;  3W99 A;  5KDM A;  1H3O A;  4H9O B;  3AZF C;  1P3I B;  3AZJ D;  4HGA C;  1JFI B;  4JJN D;  1P34 A;  1M18 D;  4E44 A;  1M19 C;  3B6F B;  4R8P D;  2HIO D;  3C1C A;  1KX4 C;  5CPK B;  1BH8 A;  1KX5 A;  3AZI B;  3X1U D;  3AZN C;  2F8N G;  3WKJ B;  5DNN D;  4H9Q A;  3LEL B;  1KX3 B;  4HGA B;  5B2J B;  4CAY B;  3KUY A;  2BYK A;  3MGR C;  2ZY4 A;  3REH A;  3AZF D;  1PZR A;  3AZK C;  5B0Z C;  3UTB B;  3AV2 C;  3MGS C;  5B1L B;  4H9S A;  2YFW B;  1P3L C;  1KX4 B;  4WU8 D;  1ZLA C;  2G5H C;  3AZH D;  3MVD C;  3TU4 A;  4YM6 A;  5GSU C;  1ID3 B;  5B32 C;  2RVQ D;  4H9P B;  5BO0 B;  3AZK B;  5B0Z B;  4ZBJ C;  3MGQ B;  3AZE A;  1P3P B;  2NQB A;  5DNM C;  1EQZ C;  1ZLA B;  5GT0 B;  2W8S A;  3LJA A;  3W99 C;  3AN2 D;  3MGS D;  3REI A;  1P3L D;  5B32 B;  5E5A D;  1TZY B;  3MGP B;  1P3K A;  1R4V A;  3REJ A;  4H9N B;  1P34 C;  1EQZ B;  1P3A A;  4XUJ D;  3C1C C;  1U35 A;  5AV5 B;  2JE5 A;  1KX5 C;  5B33 A;  1S32 D;  5AVC A;  5JRG A;  4NE5 A;  3KSY A;  1N1J A;  3UTA C;  5B24 B;  5GT3 B;  2Y2Q A;  3KUY C;  4LD9 A;  5AY8 B;  3REH C;  5CPJ A;  1TAF A;  2F2A C;  4H9S C;  3X1S A;  4EO5 B;  3AV1 A;  3C1C D;  1F1E A;  3B6G B;  4YM6 C;  1KX5 D;  5AVB A;  3UTA B;  4UUZ A;  3X1V A;  2FJ7 D;  3O62 A;  3W97 A;  4WV4 B;  3VH5 A;  3AZE C;  2NQB C;  5AV9 C;  5B0Y A;  2Y2P A;  2XD1 A;  3REI C;  2ARO B;  3A6N D;  4KGC C;  4JJN A;  3AYW B;  4KHA A;  5B2I A;  3KWQ A;  3REJ C;  1M18 A;  3TU4 D;  4R8P A;  2HIO A;  5AV9 B;  3X1U A;  3REK D;  3AZG B;  1P3A C;  1U35 C;  5AVC C;  5JRG C;  4KGC B;  4AWL C;  4WU9 B;  3LJA D;  5JA4 B;  3REI D;  3EPJ A;  1M1A B;  4KUD C;  4LD9 C;  1P3K D;  5B1M A;  5CPJ C;  3C1B C;  3REJ D;  4WNN B;  4DRA A;  2NZD A;  3LZ1 D;  3AV1 C;  1HQ3 B;  4AWL B;  4Z66 B;  1P3M C;  5AVB C;  5B33 D;  5AVC D;  4WZS B;  5JRG D;  3X1V C;  4X23 A;  4J8V B;  3O62 C;  3NQJ B;  3AZM B;  3W97 C;  3X1T C;  4KUD B;  5AV8 D;  3C1B B;  5F99 A;  3KXB D;  4XZQ C;  1T3U A;  3AN2 A;  3W96 D;  3LZ0 B;  5GXQ B;  3REL D;  5B0Y C;  2Y2O A;  1P3M B;  4NE6 A;  3X1S D;  4Z5T B;  4JJN C;  4ZUX A;  2RIQ A;  1M18 C;  1P3B D;  3X1T B;  4J8X A;  4XUJ A;  4R8P C;  2HIO C;  4E45 A;  4QLC D;  4XZQ B;  1S32 A;  2IO5 C;  3X1U C;  3O62 D;  3W97 D;  5DNN C;  1AOI D;  3AZJ B;  3NQU A;  5AV6 B;  2F8N B;  2HUE C;  5B0Y D;  5G49 A;  3UT9 D;  5BNV A;  2XD5 A;  2Y2H A;  3WTP D;  4G91 B;  5B40 A;  3MNN B;  1P3G A;  4WU8 C;  2IO5 B;  5B2I D;  3KWQ D;  3AZH C;  2JCH A;  3WAA A;  5DNN B;  2FJ7 A;  3AFA D;  2NZD C;  4CSR A;  2RVQ C;  4YS3 A;  3AZF B;  4J8U D;  3VH5 W;  4WU8 B;  3AZH B;  1M19 B;  3AN2 C;  1F66 D;  5B1M D;  3A6N A;  3AZN B;  5CPI D;  5E5A C;  2NZD D;  1P3I D;  3REK A;  3WA9 A;  3MGR B;  4XUJ C;  4J8X C;  3B0B A;  4X23 D;  1S32 C;  3AV2 B;  3MGS B;  2DQN C;  1P3L B;  5E5A B;  5F99 D;  3MVD B;  2LY8 A;  3AZI D;  5GSU B;  3WKJ D;  3FDD A;  3LEL D;  2Y2N A;  5B2J D;  4G92 C; 
#chains in the Genus database with same CATH homology
 2Y2M A;  4ZUX D;  4ZBJ B;  5CP6 A;  3LZ1 A;  5DNM B;  1BH9 B;  4J8X D;  3WAA C;  4WJ3 C;  5B1L D;  2PYO A;  2FJ7 C;  3W99 B;  3P5J B;  5KDM B;  1H3O B;  5AV8 A;  1A7W A;  3KXB A;  4H9R A;  3W96 A;  3REL A;  1P34 B;  1Z2C B;  3MGQ D;  3V9R A;  5B40 D;  5B31 A;  3C1C B;  1P3G D;  2BYM A;  1KX5 B;  1BH8 B;  5GT0 D;  3A6N C;  5FUG A;  2CV5 A;  3WAA D;  1P3B A;  3TU4 C;  2YFV A;  4H9Q B;  1TZY D;  3MGP D;  4QLC A;  3AZL A;  2DF4 C;  3REK C;  3KUY B;  4YS3 D;  2BYK B;  3REH B;  3EPH A;  1AOI A;  1P3O A;  1P3F A;  2ZY3 A;  5AV5 D;  3LJA C;  3UT9 A;  3TU4 B;  3WTP A;  4YM6 B;  3VH5 T;  2UWX A;  2ZM5 A;  1P3K C;  5B24 D;  4DQY B;  5AY8 D;  5CP6 C;  3AZE B;  2NQB B;  3AFA A;  3LZ1 C;  3WA9 D;  3R45 A;  2PYO C;  3LJA B;  5B33 C;  3REI B;  4J8U A;  3W98 A;  1P3K B;  5AV8 C;  3REJ B;  5BNX A;  3KXB C;  1ULY A;  4J8W A;  1F66 A;  3W96 C;  3REL C;  3B0D C;  5CPI A;  1P3A B;  1U35 B;  5B31 C;  3X1S C;  5B33 B;  5CP6 D;  5AVC B;  5JRG B;  4H9O A;  1N1J B;  3WTP E;  1P3I A;  5BT1 D;  3A1K A;  1P3B C;  2PYO D;  1JFI A;  4QLC C;  3AYW D;  3B6F A;  4LD9 B;  3IP4 C;  5CPJ B;  1TAF B;  5CPK A;  1AOI C;  3AZI A;  1P3F C;  1B6W A;  3X1S B;  2ZY5 A;  3WKJ A;  3AV1 B;  3B0C T;  3LEL A;  1KX3 A;  3UT9 C;  5B31 D;  5B2J A;  3WTP C;  4CAY A;  5AVB B;  4UUZ B;  3EPL A;  3X1V B;  2Y2J A;  2CV5 D;  3O62 B;  5B2I C;  3KWQ C;  3W97 B;  3UTB A;  2FFF B;  1M1A D;  1KX4 A;  5B1L A;  2YFW A;  5B31 G;  3AZL D;  3AFA C;  5B0Y B;  1ID3 A;  1P3O D;  2VQR A;  4NE3 A;  1P3F D;  1HQ3 D;  1W2E A;  4H9P A;  4Z66 D;  4J8U C;  4JJN B;  2ZY2 A;  5BO0 A;  3W98 C;  4KHA B;  5B2I B;  3KWQ B;  3AZK A;  3VH6 A;  5B0Z A;  3MGQ A;  1P3P A;  4R8P B;  2HIO B;  4J8V D;  3AZM D;  1F66 C;  1ZLA A;  5B1M C;  5CPI C;  5GT0 A;  3X1U B;  2G5I C;  3AL0 C;  3LZ0 D;  5B32 A;  1TZY A;  3MGP A;  1P3I C;  2HUE B;  4Z5T D;  3EPK A;  4H9N A;  4X23 C;  1EQZ A;  3B6F C;  3W98 D;  5B1M B;  5AV5 A;  5F99 C;  5C3I C;  4J8W D;  5CPK C;  3AZI C;  3WKJ C;  2NZD B;  3LEL C;  5B24 A;  1KX3 C;  5AV6 D;  5B2J C;  2F8N D;  5GT3 A;  4X23 B;  2CWE A;  5AY8 A;  4ZUX C;  4UPK A;  3MNN D;  3UTB C;  2JSS A;  5B1L C;  5F99 B;  5C3I B;  3AN2 B;  3B6F D;  3B6G A;  5CPK D;  1ID3 C;  3UTA A;  5BS7 A;  4ZUX B;  1KX3 D;  1BFM A;  3MGQ C;  4J8X B;  4XUJ B;  1P3P C;  5B40 C;  1P3G C;  1S32 B;  5GT0 C;  1M19 D;  3UTB D;  1KX4 D;  2ARO A;  3AZN D;  1TZY C;  3NQU B;  3MGP C;  3AYW A;  2F8N H;  4YS3 C;  1ID3 D;  5G49 B;  3B0C W;  5BNV B;  4G92 B;  2F8N K;  5B40 B;  5AV9 A;  1P3G B;  3AZG A;  2BG1 A;  3MGR D;  5AV5 C;  3AZK D;  5B0Z D;  3AV2 D;  1P3P D;  3WAA B;  1ZLA D;  2FJ7 B;  4KGC A;  3MVD D;  4WU9 A;  4CSR B;  5B24 C;  5JA4 A;  4YS3 B;  5GSU D;  5GT3 C;  1M1A A;  5B32 D;  5AY8 C;  4WNN A;  3WA9 C;  5DNM D;  4EO5 C;  1HQ3 A;  2Y2I A;  5B32 G;  1EQZ D;  3A6N B;  4Z66 A;  3B6G C;  3A1I A;  3W99 D;  5BS7 C;  1KU5 A;  2Y2L A;  4J8V A;  4KUD A;  3NQJ A;  4Z2M G;  3AZM A;  3VH6 W;  3C1B A;  3REK B;  3WA9 B;  5GT3 D;  1P34 D;  3LZ0 A;  1WWI A;  5GXQ A;  1WWS A;  5BT1 C;  1P3M A;  2ARO C;  3F6T A;  4Z5T A;  3AYW C;  3X1T A;  3B6G D;  3UTA D;  2Y2G A;  4XZQ A;  3KUY D;  3AZG C;  3REH D;  5CP6 B;  4Z2M H;  3LZ1 B;  5CHL B;  3AZJ A;  5AV6 A;  3H0L C;  2PYO B;  2F8N A;  3KFU G;  4WU9 C;  1HTA A;  2CV5 C;  3MNN A;  4YM6 D;  2ARO D;  5AV8 B;  1M1A C;  1M18 B;  3KXB B;  3AZL C;  4H9R B;  3W96 B;  3REL B;  3B0D B;  5DNN A;  3V9R B;  3AZE D;  1P3O C;  2NQB D;  5AV9 D;  5B31 B;  3AZG D;  1HQ3 C;  2BYM B;  1B67 A;  4Z66 C;  4DRB A;  3AZF A;  5FUG B;  4NFT A;  2CV5 B;  3EG5 B;  1P3B B;  2YFV B;  4J8V C;  3AZM C;  4KGC D;  4WU8 A;  4WU9 D;  4QLC B;  3AZL B;  3AZH A;  1M19 A;  3LZ0 C;  5GXQ C;  1P3O B;  1AOI B;  1Q9C A;  3AZN A;  1P3F B;  1P3A D;  1U35 D;  4Z5T C;  3UT9 B;  4M6B A;  3WTP B;  3MGR A;  2J8P A;  4J8W C;  3AV2 A;  3MGS A;  4KUD D;  1P3L A;  4LD9 D;  5CPJ D;  3C1B D;  5E5A A;  3AFA B;  3MVD A;  3H0M C;  3H0R C;  3R45 B;  5AV6 C;  3AZJ C;  5GXQ D;  5GSU A;  3AV1 D;  3VH6 T;  4J8U B;  1P3M D;  3MNN C;  3W98 B;  2Y2K A;  4G91 C;  5AVB D;  3X1V D;  5BNX B;  4J8W B;  5DNM A;  3X1T D;  1F66 B;  1BH9 A;  5CPI B;  2L5A A;  4XZQ D;  3W99 A;  5KDM A;  1H3O A;  4H9O B;  3AZF C;  1P3I B;  3AZJ D;  4HGA C;  1JFI B;  4JJN D;  1P34 A;  1M18 D;  4E44 A;  1M19 C;  3B6F B;  4R8P D;  2HIO D;  3C1C A;  1KX4 C;  5CPK B;  1BH8 A;  1KX5 A;  3AZI B;  3X1U D;  3AZN C;  2F8N G;  3WKJ B;  5DNN D;  4H9Q A;  3LEL B;  1KX3 B;  4HGA B;  5B2J B;  4CAY B;  3KUY A;  2BYK A;  3MGR C;  2ZY4 A;  3REH A;  3AZF D;  1PZR A;  3AZK C;  5B0Z C;  3UTB B;  3AV2 C;  3MGS C;  5B1L B;  4H9S A;  2YFW B;  1P3L C;  1KX4 B;  4WU8 D;  1ZLA C;  2G5H C;  3AZH D;  3MVD C;  3TU4 A;  4YM6 A;  5GSU C;  1ID3 B;  5B32 C;  2RVQ D;  4H9P B;  5BO0 B;  3AZK B;  5B0Z B;  4ZBJ C;  3MGQ B;  3AZE A;  1P3P B;  2NQB A;  5DNM C;  1EQZ C;  1ZLA B;  5GT0 B;  2W8S A;  3LJA A;  3W99 C;  3AN2 D;  3MGS D;  3REI A;  1P3L D;  5B32 B;  5E5A D;  1TZY B;  3MGP B;  1P3K A;  1R4V A;  3REJ A;  4H9N B;  1P34 C;  1EQZ B;  1P3A A;  4XUJ D;  3C1C C;  1U35 A;  5AV5 B;  2JE5 A;  1KX5 C;  5B33 A;  1S32 D;  5AVC A;  5JRG A;  4NE5 A;  3KSY A;  1N1J A;  3UTA C;  5B24 B;  5GT3 B;  2Y2Q A;  3KUY C;  4LD9 A;  5AY8 B;  3REH C;  5CPJ A;  1TAF A;  2F2A C;  4H9S C;  3X1S A;  4EO5 B;  3AV1 A;  3C1C D;  1F1E A;  3B6G B;  4YM6 C;  1KX5 D;  5AVB A;  3UTA B;  4UUZ A;  3X1V A;  2FJ7 D;  3O62 A;  3W97 A;  4WV4 B;  3VH5 A;  3AZE C;  2NQB C;  5AV9 C;  5B0Y A;  2Y2P A;  2XD1 A;  3REI C;  2ARO B;  3A6N D;  4KGC C;  4JJN A;  3AYW B;  4KHA A;  5B2I A;  3KWQ A;  3REJ C;  1M18 A;  3TU4 D;  4R8P A;  2HIO A;  5AV9 B;  3X1U A;  3REK D;  3AZG B;  1P3A C;  1U35 C;  5AVC C;  5JRG C;  4KGC B;  4AWL C;  4WU9 B;  3LJA D;  5JA4 B;  3REI D;  3EPJ A;  1M1A B;  4KUD C;  4LD9 C;  1P3K D;  5B1M A;  5CPJ C;  3C1B C;  3REJ D;  4WNN B;  4DRA A;  2NZD A;  3LZ1 D;  3AV1 C;  1HQ3 B;  4AWL B;  4Z66 B;  1P3M C;  5AVB C;  5B33 D;  5AVC D;  4WZS B;  5JRG D;  3X1V C;  4X23 A;  4J8V B;  3O62 C;  3NQJ B;  3AZM B;  3W97 C;  3X1T C;  4KUD B;  5AV8 D;  3C1B B;  5F99 A;  3KXB D;  4XZQ C;  1T3U A;  3AN2 A;  3W96 D;  3LZ0 B;  5GXQ B;  3REL D;  5B0Y C;  2Y2O A;  1P3M B;  4NE6 A;  3X1S D;  4Z5T B;  4JJN C;  4ZUX A;  2RIQ A;  1M18 C;  1P3B D;  3X1T B;  4J8X A;  4XUJ A;  4R8P C;  2HIO C;  4E45 A;  4QLC D;  4XZQ B;  1S32 A;  2IO5 C;  3X1U C;  3O62 D;  3W97 D;  5DNN C;  1AOI D;  3AZJ B;  3NQU A;  5AV6 B;  2F8N B;  2HUE C;  5B0Y D;  5G49 A;  3UT9 D;  5BNV A;  2XD5 A;  2Y2H A;  3WTP D;  4G91 B;  5B40 A;  3MNN B;  1P3G A;  4WU8 C;  2IO5 B;  5B2I D;  3KWQ D;  3AZH C;  2JCH A;  3WAA A;  5DNN B;  2FJ7 A;  3AFA D;  2NZD C;  4CSR A;  2RVQ C;  4YS3 A;  3AZF B;  4J8U D;  3VH5 W;  4WU8 B;  3AZH B;  1M19 B;  3AN2 C;  1F66 D;  5B1M D;  3A6N A;  3AZN B;  5CPI D;  5E5A C;  2NZD D;  1P3I D;  3REK A;  3WA9 A;  3MGR B;  4XUJ C;  4J8X C;  3B0B A;  4X23 D;  1S32 C;  3AV2 B;  3MGS B;  2DQN C;  1P3L B;  5E5A B;  5F99 D;  3MVD B;  2LY8 A;  3AZI D;  5GSU B;  3WKJ D;  3FDD A;  3LEL D;  2Y2N A;  5B2J D;  4G92 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...