4WU8C

Structure of trptnap-ncp145
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8C00
1AOIC 5AVBB 3W98B 3RELC 5B31G 5G49B 4E45A 5E5AC 5AVBA 3W98A 5B1LD 3X1VA 4WU8A 3AFAB 1M18A 3B6GD 5G49A 3WTPC 3AFAA 1HQ3D 2IO5B 3R45A 5AV5B 4ZUXB 3REKD 3MNND 3AN2D 3W97C 4XUJD 5JA4A 3AZMB 3AZND 3REID 5BNVA 3NQJA 1KX3A 4QLCA 3MVDD 5AY8A 3RELD 4KGCB 3VH5T 1ID3B 2NZDC 5B31B 4ZBJB 5AV9B 4R8PA 3AZGA 3X1SB 3AZLA 3AYWA 4HGAC 5AV9A 3LZ0D 3AZHA 2NQBD 5GT0A 3REHB 5AV8C 1P3MC 2FJ7B 1EQZC 4J8XD 3REHA 2FJ7A 1P3IB 3TU4A 4LD9B 1P3PB 5DNNA 3MGSA 4LD9A 1P3PA 4JJNA 3AZJC 1P3FD 4H9RA 2F8NG 3WTPE 1WWIA 3WAAD 1ZLAC 5GXQC 2HIOD 5F99D 1P34B 1TZYB 5B0ZD 3AZFD 1TZYA 4EO5C 3C1CD 4YM6D 1M1AB 5BS7C 4WNNA 1AOIA 5CP6C 3KXBD 1S32A 1ULYA 4M6BA 5E5AA 2RVQC 3LZ1C 4H9SA 5B33D 3O62B 2CV5D 2F8NB 1M19B 3WTPA 4J8UC 3AZID 3AV2B 4CAYA 1WWSA 3W97A 1KX5C 1M19A 3MGRC 4Z2MG 1BH9B 3REJA 4J8WC 4YS3C 3C1CB 4Z66D 4H9QB 5GT3B 3UTAC 1KU5A 4J8VC 5C3IC 4Z5TB 1H3OA 3B6FC 3A6NB 3UTBB 1P3AB 4Z5TA 3WKJC 2NZDA 3UTBA 1U35D 1F66D 3LELD 5B1MC 3W96B 5AVCC 5CPKB 3W96A 3KWQB 2AROC 1P3MA 3W99C 5B2IC 2PYOB 5BO0B 3KWQA 4X23B 3MGQD 3WA9D 3LJAB 5DNMD 5B40B 3MGPB 1P3OC 2PYOA 5B2JC 3X1UD 3LJAA 3AV1C 3AZMC 3AZKA 5GSUC 1U35B 3AZEC 3KUYB 5B24B 5AVBD 5KDMB 3W98D 4KUDB 4NE6A 5B0YB 3UT9B 1ZLAA 5B32B 5B1LC 3AFAD 1KX4B 3B6GC 2CWEA 4XZQB 3X1TB 1HQ3C 5AV5D 4ZUXD 3REKC 3AN2C 3MNNC 4G91C 4XUJC 5BS7A 3AZNC 3REIC 3B0BA 3MVDC 3LZ1A 3X1VB 4WU8B 1P3IC 1M18B 4KGCD 3C1BB 4R8PD 1P3LA 1ID3D 4H9PA 3R45B 5B31D 5AV9D 3C1BA 1KX5A 3X1SD 3MGRA 5JA4B 1P3BB 3LZ0C 5BNVB 3NQJB 2NQBC 1KX3B 4QLCB 3REHD 5AV6B 4J8VA 1P3BA 2FJ7D 5AY8B 5AV6A 4J8XC 1P3ID 4LD9D 4H9OB 1P3PD 1A7WA 3AZGB 4R8PB 4H9OA 5B1MA 3AZLB 3AYWB 1P3GA 1P3FC 3AZHB 5GT0B 3WAAC 3W99A 5B2IA 5JRGA 2HIOC 1P34D 5F99C 1R4VA 1P3OA 3TU4B 1TZYD 5B2JA 5B0ZC 5DNNB 3MGSB 5CPJB 3AZFC 5CPIB 3AV1A 3B0DC 5CPJA 3KSYA 5GSUA 4JJNB 3C1CC 4YM6C 5CPIA 4H9RB 1M1AD 3KXBC 4AWLB 4G92C 4WZSB 5B33C 3O62D 2F8ND 2CV5C 1M19D 3AV2D 3AZIC 4WU9B 1N1JB 3REKA 3AN2A 3MNNA 4WU9A 5CPKC 1N1JA 3AZNA 4WNNB 3REIA 1AOIB 1S32B 4Z66C 1P3KA 5FUGA 5E5AB 5GT3D 4Z5TD 3MGPC 3RELA 3A6ND 3UTBD 1P3AD 3WTPB 4CAYB 3W97B 2LY8A 1U35C 1F66C 3LELC 3KUYC 3W96D 3REJB 4KUDC 3LZ0A 5CPKD 2NQBA 2HUEC 3KWQD 2PYOD 4XZQC 1H3OB 4X23D 3MGQC 3LJAD 3WA9C 5B40D 5DNMC 3MGPD 3AZKD 3X1UC 2NZDB 3VH6A 4HGAB 3V9RA 3KUYD 5B24D 5AVBC 3W98C 4KUDD 3WAAA 3X1VC 5AV8B 1P3MB 5B0YD 3UT9D 1EQZB 5B32D 1KX4D 5AV8A 2HIOA 3AFAC 5F99A 1EQZA 5BNXA 5B0ZA 3X1TD 4XZQD 3VH6W 3VH5A 2F8NK 2IO5C 5AV5C 4ZUXC 3AZKB 3AZJB 4YM6A 1KX3C 3AZJA 4H9NA 1ZLAB 5GXQB 3X1VD 4WU8D 1P3LD 1M18D 4KGCC 5B33A 1B67A 3C1BD 5GXQA 2CV5A 4R8PC 3AZIA 2BYMA 1ID3C 3AYWC 5B31C 4ZBJC 4UUZA 5AV9C 3X1SC 1P3BD 5CP6B 4Z66A 1KX3D 4QLCD 5AV6D 3REHC 5CP6A 2FJ7C 5AY8D 3LZ1B 4NE5A 2BYKA 2F8NH 3B0CW 4J8UB 1P3LB 4LD9C 1P3PC 4H9PB 4JJNC 1P3GD 3AZGD 1KX5B 4J8UA 1F66A 3MGRB 3AZLD 3AYWD 4J8WB 4YS3B 3AZHD 5JRGD 2YFVA 5GT0D 4J8WA 4J8VB 5C3IB 4YS3A 3UTAA 3MGQA 3WA9A 1P34C 3WKJB 3TU4D 1TZYC 5CPJD 5DNND 3MGSD 3B6FA 5CPID 3WKJA 3NQUB 5B1MB 4JJND 1P3GB 1S32C 1JFIA 3NQUA 5AVCB 1M1AC 2AROB 4H9SC 5B2IB 3W99B 5AVCA 3VH6T 2AROA 5JRGB 4Z2MH 1P3OB 5B2JB 3O62C 1M19C 3AV2C 5BT1D 4WU9D 3AV1B 5AV5A 4ZUXA 3REJC 5GSUB 3AZEB 1P3KD 3AZMA 1AOID 1S32D 3AZEA 5E5AD 5GT3C 5B1LB 4Z5TC 3B6GB 4KGCA 3A6NC 2YFWB 3UTBC 5B1LA 3WTPD 1P3AC 3B6GA 1ID3A 1HQ3B 3W97D 4WV4B 5B31A 3REKB 2YFWA 3MNNB 3AN2B 3X1SA 4G91B 4XUJB 1HQ3A 3W96C 3REJD 3AZNB 4DRBA 3REIB 4XUJA 3B0CT 3KWQC 1P3KB 5FUGB 4KHAB 3MVDB 2PYOC 3RELB 2JSSA 4X23C 4KHAA 3MVDA 1P3IA 3LJAC 5B40C 3AZKC 2NZDD 1TAFB 3LZ0B 2NQBB 5B24C 1TAFA 5AV8D 1P3MD 5B0YC 3UT9C 1EQZD 5B32C 4J8XB 1KX4C 1P34A 2L5AA 3X1TC 4J8XA 4E44A 3AZJD 3V9RB 1P3FB 1M1AA 3WAAB 1P3FA 1ZLAD 5GXQD 4WU8C 2HIOB 1P3LC 1M18C 5F99B 5BNXB 5B0ZB 3O62A 3C1BC 2F8NA 3AV2A 3AZFB 4CSRB 3B0DB 3AZFA 4CSRA 4YM6B 1BH9A 5CP6D 1P3BC 4H9NB 3KXBB 3C1CA 4G92B 4H9QA 2RVQD 4QLCC 5GT3A 5AV6C 3LZ1D 3KXBA 5AY8C 1BFMA 4DRAA 5B33B 3A6NA 2CV5B 1P3AA 1BH8B 4J8UD 3AZIB 2BYMB 5B32G 1P3GC 1KX5D 3AZGC 1BH8A 4UUZB 3MGRD 3VH5W 5CHLB 3AZLC 4J8WD 4EO5B 4NE3A 4YS3D 5CPKA 3AZHC 4Z66B 5JRGC 5GT0C 3UTAD 1B6WA 4J8VD 5BO0A 3B6FD 2BYKB 4X23A 3WKJD 5B40A 3MGPA 3TU4C 5DNNC 3MGSC 5CPJC 5CPIC 1F66B 3LELB 5B1MD 1U35A 5AVCD 3LELA 3KUYA 2HUEB 5B24A 2AROD 5KDMA 2YFVB 4KUDA 4AWLC 3W99D 5B2ID 5B0YA 3UT9A 1Q9CA 5B32A 1KX4A 3UTAB 3MGQB 3WA9B 1P3OD 5DNMB 4XZQA 5B2JD 3X1TA 3X1UB 3B6FB 5BT1C 4WU9C 3AV1D 5DNMA 3AZMD 1F1EA 1HTAA 4NFTA 5GSUD 3X1UA 1JFIB 3AZED 1P3KC
chains in the Genus database with same CATH superfamily
1AOIC 5AVBB 3W98B 3EPHA 3RELC 5B31G 5G49B 4E45A 5E5AC 5AVBA 3W98A 5B1LD 3X1VA 4WU8A 3AFAB 1M18A 3B6GD 5G49A 3WTPC 3AFAA 4DQYB 1HQ3D 2IO5B 3R45A 5AV5B 4ZUXB 3REKD 3MNND 1Z2CB 3AN2D 4XUJD 3W97C 5JA4A 3AZMB 3AZND 3REID 5BNVA 3NQJA 1KX3A 4QLCA 3MVDD 5AY8A 3RELD 4KGCB 3VH5T 2DQNC 1ID3B 2NZDC 5B31B 4ZBJB 5AV9B 4R8PA 3AZGA 3X1SB 3AZLA 3AYWA 4HGAC 5AV9A 3LZ0D 3A1KA 3AZHA 2NQBD 2Y2QA 5GT0A 3REHB 5AV8C 1P3MC 2FJ7B 1EQZC 2ZY2A 4J8XD 3REHA 2FJ7A 1P3IB 3TU4A 4LD9B 1P3PB 5DNNA 3MGSA 4LD9A 1P3PA 4JJNA 3AZJC 3EPJA 1P3FD 4H9RA 2F8NG 3WTPE 1WWIA 3WAAD 1ZLAC 5GXQC 2HIOD 5F99D 1P34B 2Y2PA 2Y2LA 3EG5B 1TZYB 5B0ZD 3AZFD 1TZYA 4EO5C 3C1CD 4YM6D 1M1AB 5BS7C 4WNNA 1AOIA 5CP6C 3KXBD 1S32A 1ULYA 4M6BA 5E5AA 2RVQC 3LZ1C 4H9SA 2Y2IA 3P5JB 5B33D 3O62B 2CV5D 2F8NB 1M19B 3WTPA 4J8UC 3AZID 3AV2B 4CAYA 1WWSA 3W97A 3EPLA 1KX5C 1M19A 3MGRC 4Z2MG 1BH9B 2RIQA 3REJA 4J8WC 4YS3C 3C1CB 4Z66D 4H9QB 5GT3B 3UTAC 1KU5A 4J8VC 5C3IC 4Z5TB 1H3OA 3B6FC 3A6NB 3UTBB 1P3AB 4Z5TA 3WKJC 2NZDA 4UPKA 3UTBA 4WJ3C 1U35D 1F66D 3LELD 5B1MC 3W96B 2G5IC 5AVCC 5CPKB 2UWXA 3W96A 2J8PA 3KWQB 2AROC 1P3MA 3W99C 5B2IC 2Y2NA 2PYOB 5BO0B 3KWQA 4X23B 3MGQD 3WA9D 3LJAB 5DNMD 5B40B 3MGPB 1P3OC 2PYOA 5B2JC 3A1IA 3X1UD 3LJAA 3AV1C 3AZMC 3AZKA 5GSUC 1U35B 3AZEC 3KUYB 5B24B 5AVBD 5KDMB 3W98D 4KUDB 4NE6A 5B0YB 3UT9B 1ZLAA 5B32B 5B1LC 3AFAD 1KX4B 3B6GC 2CWEA 4XZQB 3X1TB 2JE5A 1HQ3C 5AV5D 4ZUXD 3REKC 3AN2C 3MNNC 4G91C 4XUJC 5BS7A 3AZNC 3REIC 3B0BA 3MVDC 2FFFB 3LZ1A 3X1VB 4WU8B 1P3IC 1M18B 4KGCD 3C1BB 4R8PD 1P3LA 1ID3D 4H9PA 3R45B 5B31D 5AV9D 3C1BA 1KX5A 3X1SD 3MGRA 5JA4B 1P3BB 3LZ0C 5BNVB 3NQJB 2NQBC 1KX3B 4QLCB 3REHD 5AV6B 4J8VA 1P3BA 2FJ7D 5AY8B 5AV6A 4J8XC 1P3ID 4LD9D 4H9OB 3AL0C 1P3PD 1A7WA 3AZGB 4R8PB 4H9OA 5B1MA 3AZLB 3AYWB 1P3GA 1P3FC 3AZHB 5GT0B 3WAAC 2ZM5A 5B2IA 3W99A 5JRGA 2ZY3A 2HIOC 1P34D 5F99C 1R4VA 1P3OA 3TU4B 1TZYD 5B2JA 5B0ZC 5DNNB 3MGSB 5CPJB 3AZFC 2XD1A 5CPIB 3EPKA 3AV1A 3B0DC 5CPJA 3KSYA 5GSUA 4JJNB 3C1CC 4YM6C 5CPIA 4H9RB 1M1AD 3KXBC 4AWLB 4G92C 2ZY5A 4WZSB 5B33C 3O62D 2F8ND 2CV5C 1M19D 3AV2D 3KFUG 3AZIC 4WU9B 1N1JB 3REKA 3AN2A 3MNNA 4WU9A 5CPKC 1N1JA 3AZNA 4WNNB 3REIA 2G5HC 1AOIB 1S32B 4Z66C 1P3KA 5FUGA 5E5AB 5GT3D 4Z5TD 3MGPC 3RELA 2Y2JA 3A6ND 3UTBD 1P3AD 3WTPB 4CAYB 2Y2HA 3W97B 1PZRA 2LY8A 1U35C 1F66C 3LELC 2Y2KA 3KUYC 3W96D 3REJB 4KUDC 3LZ0A 5CPKD 2NQBA 2DF4C 2HUEC 3KWQD 2PYOD 4XZQC 1H3OB 4X23D 3MGQC 3LJAD 3WA9C 5B40D 5DNMC 3MGPD 3AZKD 3X1UC 2NZDB 2JCHA 3VH6A 4HGAB 3V9RA 3KUYD 5B24D 5AVBC 3W98C 4KUDD 3WAAA 3X1VC 5AV8B 1P3MB 5B0YD 3UT9D 1EQZB 5B32D 1KX4D 5AV8A 2HIOA 3AFAC 5F99A 1EQZA 5BNXA 5B0ZA 3X1TD 4XZQD 3VH6W 3VH5A 2F8NK 2IO5C 5AV5C 4ZUXC 2Y2GA 3AZKB 3AZJB 4YM6A 1KX3C 3AZJA 4H9NA 1ZLAB 5GXQB 3X1VD 4WU8D 1P3LD 1M18D 4KGCC 5B33A 1B67A 3C1BD 5GXQA 2CV5A 4R8PC 3AZIA 2BYMA 1ID3C 3AYWC 5B31C 4ZBJC 4UUZA 5AV9C 3F6TA 3X1SC 1P3BD 5CP6B 4Z66A 1KX3D 4QLCD 5AV6D 3REHC 5CP6A 2FJ7C 5AY8D 3LZ1B 4NE5A 2BYKA 2F8NH 3B0CW 4J8UB 1P3LB 4LD9C 1P3PC 4H9PB 4JJNC 1P3GD 3AZGD 2Y2MA 1KX5B 4J8UA 1F66A 3MGRB 3AZLD 3AYWD 4J8WB 4YS3B 3AZHD 3FDDA 5JRGD 2YFVA 5GT0D 4J8WA 4J8VB 5C3IB 4YS3A 3UTAA 3MGQA 3WA9A 1P34C 3WKJB 3TU4D 1TZYC 5CPJD 5DNND 3MGSD 3B6FA 5CPID 3WKJA 3NQUB 5B1MB 4JJND 1P3GB 1S32C 1JFIA 3NQUA 5AVCB 1M1AC 2AROB 4H9SC 5B2IB 2VQRA 5AVCA 3W99B 3VH6T 2AROA 5JRGB 4Z2MH 1P3OB 3H0MC 5B2JB 3O62C 1M19C 3AV2C 5BT1D 4WU9D 3AV1B 5AV5A 4ZUXA 3REJC 2ZY4A 5GSUB 3AZEB 1P3KD 3AZMA 1AOID 1S32D 3AZEA 5E5AD 5GT3C 5B1LB 4Z5TC 3B6GB 4KGCA 3A6NC 2YFWB 3UTBC 5B1LA 3WTPD 1P3AC 3B6GA 1ID3A 1HQ3B 3W97D 4WV4B 5B31A 3REKB 2YFWA 3MNNB 3AN2B 3X1SA 4G91B 4XUJB 1HQ3A 3W96C 3REJD 3AZNB 4DRBA 3REIB 4XUJA 3B0CT 3KWQC 1P3KB 5FUGB 4KHAB 3MVDB 3H0LC 2PYOC 3RELB 2JSSA 4X23C 1W2EA 4KHAA 3MVDA 3LJAC 1P3IA 5B40C 3AZKC 2NZDD 3IP4C 1TAFB 2W8SA 3LZ0B 2NQBB 5B24C 1TAFA 5AV8D 1P3MD 5B0YC 3UT9C 1EQZD 5B32C 4J8XB 1KX4C 1P34A 2L5AA 2XD5A 3X1TC 4J8XA 4E44A 3AZJD 2Y2OA 3V9RB 1P3FB 1M1AA 3WAAB 1P3FA 1ZLAD 5GXQD 4WU8C 2HIOB 1P3LC 1M18C 5F99B 5BNXB 5B0ZB 3O62A 3C1BC 2F8NA 3AV2A 3AZFB 4CSRB 3B0DB 3AZFA 4CSRA 4YM6B 1BH9A 2BG1A 5CP6D 1T3UA 4H9NB 1P3BC 3KXBB 3C1CA 4G92B 4H9QA 2RVQD 4QLCC 5GT3A 5AV6C 3LZ1D 3KXBA 5AY8C 1BFMA 4DRAA 5B33B 3A6NA 2CV5B 1P3AA 1BH8B 4J8UD 3AZIB 2BYMB 5B32G 1P3GC 1KX5D 3AZGC 1BH8A 4UUZB 3MGRD 3VH5W 5CHLB 3AZLC 4J8WD 4EO5B 4NE3A 4YS3D 5CPKA 3AZHC 4Z66B 5JRGC 5GT0C 3UTAD 1B6WA 4J8VD 5BO0A 3B6FD 2BYKB 4X23A 3WKJD 5B40A 2F2AC 3MGPA 3TU4C 5DNNC 3MGSC 5CPJC 5CPIC 1F66B 3LELB 5B1MD 3H0RC 1U35A 5AVCD 3LELA 3KUYA 2HUEB 5B24A 2AROD 5KDMA 2YFVB 4KUDA 4AWLC 3W99D 5B2ID 5B0YA 3UT9A 1Q9CA 5B32A 1KX4A 3UTAB 3MGQB 3WA9B 1P3OD 5DNMB 4XZQA 5B2JD 3X1TA 3X1UB 3B6FB 5BT1C 4WU9C 3AV1D 5DNMA 3AZMD 1F1EA 1HTAA 4NFTA 5GSUD 3X1UA 1JFIB 3AZED 1P3KC
chains in the Genus database with same CATH topology
1AOIC 5AVBB 3W98B 3EPHA 3RELC 5B31G 5G49B 4E45A 5E5AC 5AVBA 3W98A 5B1LD 3X1VA 4WU8A 3AFAB 1M18A 3B6GD 5G49A 3WTPC 3AFAA 4DQYB 1HQ3D 2IO5B 3R45A 5AV5B 4ZUXB 3REKD 3MNND 1Z2CB 3AN2D 4XUJD 3W97C 5JA4A 3AZMB 3AZND 3REID 5BNVA 3NQJA 1KX3A 4QLCA 3MVDD 5AY8A 3RELD 4KGCB 3VH5T 2DQNC 1ID3B 2NZDC 5B31B 4ZBJB 5AV9B 4R8PA 3AZGA 3X1SB 3AZLA 3AYWA 4HGAC 5AV9A 3LZ0D 3A1KA 3AZHA 2NQBD 2Y2QA 5GT0A 3REHB 5AV8C 1P3MC 2FJ7B 1EQZC 2ZY2A 4J8XD 3REHA 2FJ7A 1P3IB 3TU4A 4LD9B 1P3PB 5DNNA 3MGSA 4LD9A 1P3PA 4JJNA 3AZJC 3EPJA 1P3FD 4H9RA 2F8NG 3WTPE 1WWIA 3WAAD 1ZLAC 5GXQC 2HIOD 5F99D 1P34B 2Y2PA 2Y2LA 3EG5B 1TZYB 5B0ZD 3AZFD 1TZYA 4EO5C 3C1CD 4YM6D 1M1AB 5BS7C 4WNNA 1AOIA 5CP6C 3KXBD 1S32A 1ULYA 4M6BA 5E5AA 2RVQC 3LZ1C 4H9SA 2Y2IA 3P5JB 5B33D 3O62B 2CV5D 2F8NB 1M19B 3WTPA 4J8UC 3AZID 3AV2B 4CAYA 1WWSA 3W97A 3EPLA 1KX5C 1M19A 3MGRC 4Z2MG 1BH9B 2RIQA 3REJA 4J8WC 4YS3C 3C1CB 4Z66D 4H9QB 5GT3B 3UTAC 1KU5A 4J8VC 5C3IC 4Z5TB 1H3OA 3B6FC 3A6NB 3UTBB 1P3AB 4Z5TA 3WKJC 2NZDA 4UPKA 3UTBA 4WJ3C 1U35D 1F66D 3LELD 5B1MC 3W96B 2G5IC 5AVCC 5CPKB 2UWXA 3W96A 2J8PA 3KWQB 2AROC 1P3MA 3W99C 5B2IC 2Y2NA 2PYOB 5BO0B 3KWQA 4X23B 3MGQD 3WA9D 3LJAB 5DNMD 5B40B 3MGPB 1P3OC 2PYOA 5B2JC 3A1IA 3X1UD 3LJAA 3AV1C 3AZMC 3AZKA 5GSUC 1U35B 3AZEC 3KUYB 5B24B 5AVBD 5KDMB 3W98D 4KUDB 4NE6A 5B0YB 3UT9B 1ZLAA 5B32B 5B1LC 3AFAD 1KX4B 3B6GC 2CWEA 4XZQB 3X1TB 2JE5A 1HQ3C 5AV5D 4ZUXD 3REKC 3AN2C 3MNNC 4G91C 4XUJC 5BS7A 3AZNC 3REIC 3B0BA 3MVDC 2FFFB 3LZ1A 3X1VB 4WU8B 1P3IC 1M18B 4KGCD 3C1BB 4R8PD 1P3LA 1ID3D 4H9PA 3R45B 5B31D 5AV9D 3C1BA 1KX5A 3X1SD 3MGRA 5JA4B 1P3BB 3LZ0C 5BNVB 3NQJB 2NQBC 1KX3B 4QLCB 3REHD 5AV6B 4J8VA 1P3BA 2FJ7D 5AY8B 5AV6A 4J8XC 1P3ID 4LD9D 4H9OB 3AL0C 1P3PD 1A7WA 3AZGB 4R8PB 4H9OA 5B1MA 3AZLB 3AYWB 1P3GA 1P3FC 3AZHB 5GT0B 3WAAC 2ZM5A 5B2IA 3W99A 5JRGA 2ZY3A 2HIOC 1P34D 5F99C 1R4VA 1P3OA 3TU4B 1TZYD 5B2JA 5B0ZC 5DNNB 3MGSB 5CPJB 3AZFC 2XD1A 5CPIB 3EPKA 3AV1A 3B0DC 5CPJA 3KSYA 5GSUA 4JJNB 3C1CC 4YM6C 5CPIA 4H9RB 1M1AD 3KXBC 4AWLB 4G92C 2ZY5A 4WZSB 5B33C 3O62D 2F8ND 2CV5C 1M19D 3AV2D 3KFUG 3AZIC 4WU9B 1N1JB 3REKA 3AN2A 3MNNA 4WU9A 5CPKC 1N1JA 3AZNA 4WNNB 3REIA 2G5HC 1AOIB 1S32B 4Z66C 1P3KA 5FUGA 5E5AB 5GT3D 4Z5TD 3MGPC 3RELA 2Y2JA 3A6ND 3UTBD 1P3AD 3WTPB 4CAYB 2Y2HA 3W97B 1PZRA 2LY8A 1U35C 1F66C 3LELC 2Y2KA 3KUYC 3W96D 3REJB 4KUDC 3LZ0A 5CPKD 2NQBA 2DF4C 2HUEC 3KWQD 2PYOD 4XZQC 1H3OB 4X23D 3MGQC 3LJAD 3WA9C 5B40D 5DNMC 3MGPD 3AZKD 3X1UC 2NZDB 2JCHA 3VH6A 4HGAB 3V9RA 3KUYD 5B24D 5AVBC 3W98C 4KUDD 3WAAA 3X1VC 5AV8B 1P3MB 5B0YD 3UT9D 1EQZB 5B32D 1KX4D 5AV8A 2HIOA 3AFAC 5F99A 1EQZA 5BNXA 5B0ZA 3X1TD 4XZQD 3VH6W 3VH5A 2F8NK 2IO5C 5AV5C 4ZUXC 2Y2GA 3AZKB 3AZJB 4YM6A 1KX3C 3AZJA 4H9NA 1ZLAB 5GXQB 3X1VD 4WU8D 1P3LD 1M18D 4KGCC 5B33A 1B67A 3C1BD 5GXQA 2CV5A 4R8PC 3AZIA 2BYMA 1ID3C 3AYWC 5B31C 4ZBJC 4UUZA 5AV9C 3F6TA 3X1SC 1P3BD 5CP6B 4Z66A 1KX3D 4QLCD 5AV6D 3REHC 5CP6A 2FJ7C 5AY8D 3LZ1B 4NE5A 2BYKA 2F8NH 3B0CW 4J8UB 1P3LB 4LD9C 1P3PC 4H9PB 4JJNC 1P3GD 3AZGD 2Y2MA 1KX5B 4J8UA 1F66A 3MGRB 3AZLD 3AYWD 4J8WB 4YS3B 3AZHD 3FDDA 5JRGD 2YFVA 5GT0D 4J8WA 4J8VB 5C3IB 4YS3A 3UTAA 3MGQA 3WA9A 1P34C 3WKJB 3TU4D 1TZYC 5CPJD 5DNND 3MGSD 3B6FA 5CPID 3WKJA 3NQUB 5B1MB 4JJND 1P3GB 1S32C 1JFIA 3NQUA 5AVCB 1M1AC 2AROB 4H9SC 5B2IB 2VQRA 5AVCA 3W99B 3VH6T 2AROA 5JRGB 4Z2MH 1P3OB 3H0MC 5B2JB 3O62C 1M19C 3AV2C 5BT1D 4WU9D 3AV1B 5AV5A 4ZUXA 3REJC 2ZY4A 5GSUB 3AZEB 1P3KD 3AZMA 1AOID 1S32D 3AZEA 5E5AD 5GT3C 5B1LB 4Z5TC 3B6GB 4KGCA 3A6NC 2YFWB 3UTBC 5B1LA 3WTPD 1P3AC 3B6GA 1ID3A 1HQ3B 3W97D 4WV4B 5B31A 3REKB 2YFWA 3MNNB 3AN2B 3X1SA 4G91B 4XUJB 1HQ3A 3W96C 3REJD 3AZNB 4DRBA 3REIB 4XUJA 3B0CT 3KWQC 1P3KB 5FUGB 4KHAB 3MVDB 3H0LC 2PYOC 3RELB 2JSSA 4X23C 1W2EA 4KHAA 3MVDA 3LJAC 1P3IA 5B40C 3AZKC 2NZDD 3IP4C 1TAFB 2W8SA 3LZ0B 2NQBB 5B24C 1TAFA 5AV8D 1P3MD 5B0YC 3UT9C 1EQZD 5B32C 4J8XB 1KX4C 1P34A 2L5AA 2XD5A 3X1TC 4J8XA 4E44A 3AZJD 2Y2OA 3V9RB 1P3FB 1M1AA 3WAAB 1P3FA 1ZLAD 5GXQD 4WU8C 2HIOB 1P3LC 1M18C 5F99B 5BNXB 5B0ZB 3O62A 3C1BC 2F8NA 3AV2A 3AZFB 4CSRB 3B0DB 3AZFA 4CSRA 4YM6B 1BH9A 2BG1A 5CP6D 1T3UA 4H9NB 1P3BC 3KXBB 3C1CA 4G92B 4H9QA 2RVQD 4QLCC 5GT3A 5AV6C 3LZ1D 3KXBA 5AY8C 1BFMA 4DRAA 5B33B 3A6NA 2CV5B 1P3AA 1BH8B 4J8UD 3AZIB 2BYMB 5B32G 1P3GC 1KX5D 3AZGC 1BH8A 4UUZB 3MGRD 3VH5W 5CHLB 3AZLC 4J8WD 4EO5B 4NE3A 4YS3D 5CPKA 3AZHC 4Z66B 5JRGC 5GT0C 3UTAD 1B6WA 4J8VD 5BO0A 3B6FD 2BYKB 4X23A 3WKJD 5B40A 2F2AC 3MGPA 3TU4C 5DNNC 3MGSC 5CPJC 5CPIC 1F66B 3LELB 5B1MD 3H0RC 1U35A 5AVCD 3LELA 3KUYA 2HUEB 5B24A 2AROD 5KDMA 2YFVB 4KUDA 4AWLC 3W99D 5B2ID 5B0YA 3UT9A 1Q9CA 5B32A 1KX4A 3UTAB 3MGQB 3WA9B 1P3OD 5DNMB 4XZQA 5B2JD 3X1TA 3X1UB 3B6FB 5BT1C 4WU9C 3AV1D 5DNMA 3AZMD 1F1EA 1HTAA 4NFTA 5GSUD 3X1UA 1JFIB 3AZED 1P3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI C;  5AVB B;  3W98 B;  3REL C;  5B31 G;  5G49 B;  4E45 A;  5E5A C;  5AVB A;  3W98 A;  5B1L D;  3X1V A;  4WU8 A;  3AFA B;  1M18 A;  3B6G D;  5G49 A;  3WTP C;  3AFA A;  1HQ3 D;  2IO5 B;  3R45 A;  5AV5 B;  4ZUX B;  3REK D;  3MNN D;  3AN2 D;  3W97 C;  4XUJ D;  5JA4 A;  3AZM B;  3AZN D;  3REI D;  5BNV A;  3NQJ A;  1KX3 A;  4QLC A;  3MVD D;  5AY8 A;  3REL D;  4KGC B;  3VH5 T;  1ID3 B;  2NZD C;  5B31 B;  4ZBJ B;  5AV9 B;  4R8P A;  3AZG A;  3X1S B;  3AZL A;  3AYW A;  4HGA C;  5AV9 A;  3LZ0 D;  3AZH A;  2NQB D;  5GT0 A;  3REH B;  5AV8 C;  1P3M C;  2FJ7 B;  1EQZ C;  4J8X D;  3REH A;  2FJ7 A;  1P3I B;  3TU4 A;  4LD9 B;  1P3P B;  5DNN A;  3MGS A;  4LD9 A;  1P3P A;  4JJN A;  3AZJ C;  1P3F D;  4H9R A;  2F8N G;  3WTP E;  1WWI A;  3WAA D;  1ZLA C;  5GXQ C;  2HIO D;  5F99 D;  1P34 B;  1TZY B;  5B0Z D;  3AZF D;  1TZY A;  4EO5 C;  3C1C D;  4YM6 D;  1M1A B;  5BS7 C;  4WNN A;  1AOI A;  5CP6 C;  3KXB D;  1S32 A;  1ULY A;  4M6B A;  5E5A A;  2RVQ C;  3LZ1 C;  4H9S A;  5B33 D;  3O62 B;  2CV5 D;  2F8N B;  1M19 B;  3WTP A;  4J8U C;  3AZI D;  3AV2 B;  4CAY A;  1WWS A;  3W97 A;  1KX5 C;  1M19 A;  3MGR C;  4Z2M G;  1BH9 B;  3REJ A;  4J8W C;  4YS3 C;  3C1C B;  4Z66 D;  4H9Q B;  5GT3 B;  3UTA C;  1KU5 A;  4J8V C;  5C3I C;  4Z5T B;  1H3O A;  3B6F C;  3A6N B;  3UTB B;  1P3A B;  4Z5T A;  3WKJ C;  2NZD A;  3UTB A;  1U35 D;  1F66 D;  3LEL D;  5B1M C;  3W96 B;  5AVC C;  5CPK B;  3W96 A;  3KWQ B;  2ARO C;  1P3M A;  3W99 C;  5B2I C;  2PYO B;  5BO0 B;  3KWQ A;  4X23 B;  3MGQ D;  3WA9 D;  3LJA B;  5DNM D;  5B40 B;  3MGP B;  1P3O C;  2PYO A;  5B2J C;  3X1U D;  3LJA A;  3AV1 C;  3AZM C;  3AZK A;  5GSU C;  1U35 B;  3AZE C;  3KUY B;  5B24 B;  5AVB D;  5KDM B;  3W98 D;  4KUD B;  4NE6 A;  5B0Y B;  3UT9 B;  1ZLA A;  5B32 B;  5B1L C;  3AFA D;  1KX4 B;  3B6G C;  2CWE A;  4XZQ B;  3X1T B;  1HQ3 C;  5AV5 D;  4ZUX D;  3REK C;  3AN2 C;  3MNN C;  4G91 C;  4XUJ C;  5BS7 A;  3AZN C;  3REI C;  3B0B A;  3MVD C;  3LZ1 A;  3X1V B;  4WU8 B;  1P3I C;  1M18 B;  4KGC D;  3C1B B;  4R8P D;  1P3L A;  1ID3 D;  4H9P A;  3R45 B;  5B31 D;  5AV9 D;  3C1B A;  1KX5 A;  3X1S D;  3MGR A;  5JA4 B;  1P3B B;  3LZ0 C;  5BNV B;  3NQJ B;  2NQB C;  1KX3 B;  4QLC B;  3REH D;  5AV6 B;  4J8V A;  1P3B A;  2FJ7 D;  5AY8 B;  5AV6 A;  4J8X C;  1P3I D;  4LD9 D;  4H9O B;  1P3P D;  1A7W A;  3AZG B;  4R8P B;  4H9O A;  5B1M A;  3AZL B;  3AYW B;  1P3G A;  1P3F C;  3AZH B;  5GT0 B;  3WAA C;  3W99 A;  5B2I A;  5JRG A;  2HIO C;  1P34 D;  5F99 C;  1R4V A;  1P3O A;  3TU4 B;  1TZY D;  5B2J A;  5B0Z C;  5DNN B;  3MGS B;  5CPJ B;  3AZF C;  5CPI B;  3AV1 A;  3B0D C;  5CPJ A;  3KSY A;  5GSU A;  4JJN B;  3C1C C;  4YM6 C;  5CPI A;  4H9R B;  1M1A D;  3KXB C;  4AWL B;  4G92 C;  4WZS B;  5B33 C;  3O62 D;  2F8N D;  2CV5 C;  1M19 D;  3AV2 D;  3AZI C;  4WU9 B;  1N1J B;  3REK A;  3AN2 A;  3MNN A;  4WU9 A;  5CPK C;  1N1J A;  3AZN A;  4WNN B;  3REI A;  1AOI B;  1S32 B;  4Z66 C;  1P3K A;  5FUG A;  5E5A B;  5GT3 D;  4Z5T D;  3MGP C;  3REL A;  3A6N D;  3UTB D;  1P3A D;  3WTP B;  4CAY B;  3W97 B;  2LY8 A;  1U35 C;  1F66 C;  3LEL C;  3KUY C;  3W96 D;  3REJ B;  4KUD C;  3LZ0 A;  5CPK D;  2NQB A;  2HUE C;  3KWQ D;  2PYO D;  4XZQ C;  1H3O B;  4X23 D;  3MGQ C;  3LJA D;  3WA9 C;  5B40 D;  5DNM C;  3MGP D;  3AZK D;  3X1U C;  2NZD B;  3VH6 A;  4HGA B;  3V9R A;  3KUY D;  5B24 D;  5AVB C;  3W98 C;  4KUD D;  3WAA A;  3X1V C;  5AV8 B;  1P3M B;  5B0Y D;  3UT9 D;  1EQZ B;  5B32 D;  1KX4 D;  5AV8 A;  2HIO A;  3AFA C;  5F99 A;  1EQZ A;  5BNX A;  5B0Z A;  3X1T D;  4XZQ D;  3VH6 W;  3VH5 A;  2F8N K;  2IO5 C;  5AV5 C;  4ZUX C;  3AZK B;  3AZJ B;  4YM6 A;  1KX3 C;  3AZJ A;  4H9N A;  1ZLA B;  5GXQ B;  3X1V D;  4WU8 D;  1P3L D;  1M18 D;  4KGC C;  5B33 A;  1B67 A;  3C1B D;  5GXQ A;  2CV5 A;  4R8P C;  3AZI A;  2BYM A;  1ID3 C;  3AYW C;  5B31 C;  4ZBJ C;  4UUZ A;  5AV9 C;  3X1S C;  1P3B D;  5CP6 B;  4Z66 A;  1KX3 D;  4QLC D;  5AV6 D;  3REH C;  5CP6 A;  2FJ7 C;  5AY8 D;  3LZ1 B;  4NE5 A;  2BYK A;  2F8N H;  3B0C W;  4J8U B;  1P3L B;  4LD9 C;  1P3P C;  4H9P B;  4JJN C;  1P3G D;  3AZG D;  1KX5 B;  4J8U A;  1F66 A;  3MGR B;  3AZL D;  3AYW D;  4J8W B;  4YS3 B;  3AZH D;  5JRG D;  2YFV A;  5GT0 D;  4J8W A;  4J8V B;  5C3I B;  4YS3 A;  3UTA A;  3MGQ A;  3WA9 A;  1P34 C;  3WKJ B;  3TU4 D;  1TZY C;  5CPJ D;  5DNN D;  3MGS D;  3B6F A;  5CPI D;  3WKJ A;  3NQU B;  5B1M B;  4JJN D;  1P3G B;  1S32 C;  1JFI A;  3NQU A;  5AVC B;  1M1A C;  2ARO B;  4H9S C;  5B2I B;  3W99 B;  5AVC A;  3VH6 T;  2ARO A;  5JRG B;  4Z2M H;  1P3O B;  5B2J B;  3O62 C;  1M19 C;  3AV2 C;  5BT1 D;  4WU9 D;  3AV1 B;  5AV5 A;  4ZUX A;  3REJ C;  5GSU B;  3AZE B;  1P3K D;  3AZM A;  1AOI D;  1S32 D;  3AZE A;  5E5A D;  5GT3 C;  5B1L B;  4Z5T C;  3B6G B;  4KGC A;  3A6N C;  2YFW B;  3UTB C;  5B1L A;  3WTP D;  1P3A C;  3B6G A;  1ID3 A;  1HQ3 B;  3W97 D;  4WV4 B;  5B31 A;  3REK B;  2YFW A;  3MNN B;  3AN2 B;  3X1S A;  4G91 B;  4XUJ B;  1HQ3 A;  3W96 C;  3REJ D;  3AZN B;  4DRB A;  3REI B;  4XUJ A;  3B0C T;  3KWQ C;  1P3K B;  5FUG B;  4KHA B;  3MVD B;  2PYO C;  3REL B;  2JSS A;  4X23 C;  4KHA A;  3MVD A;  1P3I A;  3LJA C;  5B40 C;  3AZK C;  2NZD D;  1TAF B;  3LZ0 B;  2NQB B;  5B24 C;  1TAF A;  5AV8 D;  1P3M D;  5B0Y C;  3UT9 C;  1EQZ D;  5B32 C;  4J8X B;  1KX4 C;  1P34 A;  2L5A A;  3X1T C;  4J8X A;  4E44 A;  3AZJ D;  3V9R B;  1P3F B;  1M1A A;  3WAA B;  1P3F A;  1ZLA D;  5GXQ D;  4WU8 C;  2HIO B;  1P3L C;  1M18 C;  5F99 B;  5BNX B;  5B0Z B;  3O62 A;  3C1B C;  2F8N A;  3AV2 A;  3AZF B;  4CSR B;  3B0D B;  3AZF A;  4CSR A;  4YM6 B;  1BH9 A;  5CP6 D;  1P3B C;  4H9N B;  3KXB B;  3C1C A;  4G92 B;  4H9Q A;  2RVQ D;  4QLC C;  5GT3 A;  5AV6 C;  3LZ1 D;  3KXB A;  5AY8 C;  1BFM A;  4DRA A;  5B33 B;  3A6N A;  2CV5 B;  1P3A A;  1BH8 B;  4J8U D;  3AZI B;  2BYM B;  5B32 G;  1P3G C;  1KX5 D;  3AZG C;  1BH8 A;  4UUZ B;  3MGR D;  3VH5 W;  5CHL B;  3AZL C;  4J8W D;  4EO5 B;  4NE3 A;  4YS3 D;  5CPK A;  3AZH C;  4Z66 B;  5JRG C;  5GT0 C;  3UTA D;  1B6W A;  4J8V D;  5BO0 A;  3B6F D;  2BYK B;  4X23 A;  3WKJ D;  5B40 A;  3MGP A;  3TU4 C;  5DNN C;  3MGS C;  5CPJ C;  5CPI C;  1F66 B;  3LEL B;  5B1M D;  1U35 A;  5AVC D;  3LEL A;  3KUY A;  2HUE B;  5B24 A;  2ARO D;  5KDM A;  2YFV B;  4KUD A;  4AWL C;  3W99 D;  5B2I D;  5B0Y A;  3UT9 A;  1Q9C A;  5B32 A;  1KX4 A;  3UTA B;  3MGQ B;  3WA9 B;  1P3O D;  5DNM B;  4XZQ A;  5B2J D;  3X1T A;  3X1U B;  3B6F B;  5BT1 C;  4WU9 C;  3AV1 D;  5DNM A;  3AZM D;  1F1E A;  1HTA A;  4NFT A;  5GSU D;  3X1U A;  1JFI B;  3AZE D;  1P3K C; 
#chains in the Genus database with same CATH topology
 1AOI C;  5AVB B;  3W98 B;  3EPH A;  3REL C;  5B31 G;  5G49 B;  4E45 A;  5E5A C;  5AVB A;  3W98 A;  5B1L D;  3X1V A;  4WU8 A;  3AFA B;  1M18 A;  3B6G D;  5G49 A;  3WTP C;  3AFA A;  4DQY B;  1HQ3 D;  2IO5 B;  3R45 A;  5AV5 B;  4ZUX B;  3REK D;  3MNN D;  1Z2C B;  3AN2 D;  4XUJ D;  3W97 C;  5JA4 A;  3AZM B;  3AZN D;  3REI D;  5BNV A;  3NQJ A;  1KX3 A;  4QLC A;  3MVD D;  5AY8 A;  3REL D;  4KGC B;  3VH5 T;  2DQN C;  1ID3 B;  2NZD C;  5B31 B;  4ZBJ B;  5AV9 B;  4R8P A;  3AZG A;  3X1S B;  3AZL A;  3AYW A;  4HGA C;  5AV9 A;  3LZ0 D;  3A1K A;  3AZH A;  2NQB D;  2Y2Q A;  5GT0 A;  3REH B;  5AV8 C;  1P3M C;  2FJ7 B;  1EQZ C;  2ZY2 A;  4J8X D;  3REH A;  2FJ7 A;  1P3I B;  3TU4 A;  4LD9 B;  1P3P B;  5DNN A;  3MGS A;  4LD9 A;  1P3P A;  4JJN A;  3AZJ C;  3EPJ A;  1P3F D;  4H9R A;  2F8N G;  3WTP E;  1WWI A;  3WAA D;  1ZLA C;  5GXQ C;  2HIO D;  5F99 D;  1P34 B;  2Y2P A;  2Y2L A;  3EG5 B;  1TZY B;  5B0Z D;  3AZF D;  1TZY A;  4EO5 C;  3C1C D;  4YM6 D;  1M1A B;  5BS7 C;  4WNN A;  1AOI A;  5CP6 C;  3KXB D;  1S32 A;  1ULY A;  4M6B A;  5E5A A;  2RVQ C;  3LZ1 C;  4H9S A;  2Y2I A;  3P5J B;  5B33 D;  3O62 B;  2CV5 D;  2F8N B;  1M19 B;  3WTP A;  4J8U C;  3AZI D;  3AV2 B;  4CAY A;  1WWS A;  3W97 A;  3EPL A;  1KX5 C;  1M19 A;  3MGR C;  4Z2M G;  1BH9 B;  2RIQ A;  3REJ A;  4J8W C;  4YS3 C;  3C1C B;  4Z66 D;  4H9Q B;  5GT3 B;  3UTA C;  1KU5 A;  4J8V C;  5C3I C;  4Z5T B;  1H3O A;  3B6F C;  3A6N B;  3UTB B;  1P3A B;  4Z5T A;  3WKJ C;  2NZD A;  4UPK A;  3UTB A;  4WJ3 C;  1U35 D;  1F66 D;  3LEL D;  5B1M C;  3W96 B;  2G5I C;  5AVC C;  5CPK B;  2UWX A;  3W96 A;  2J8P A;  3KWQ B;  2ARO C;  1P3M A;  3W99 C;  5B2I C;  2Y2N A;  2PYO B;  5BO0 B;  3KWQ A;  4X23 B;  3MGQ D;  3WA9 D;  3LJA B;  5DNM D;  5B40 B;  3MGP B;  1P3O C;  2PYO A;  5B2J C;  3A1I A;  3X1U D;  3LJA A;  3AV1 C;  3AZM C;  3AZK A;  5GSU C;  1U35 B;  3AZE C;  3KUY B;  5B24 B;  5AVB D;  5KDM B;  3W98 D;  4KUD B;  4NE6 A;  5B0Y B;  3UT9 B;  1ZLA A;  5B32 B;  5B1L C;  3AFA D;  1KX4 B;  3B6G C;  2CWE A;  4XZQ B;  3X1T B;  2JE5 A;  1HQ3 C;  5AV5 D;  4ZUX D;  3REK C;  3AN2 C;  3MNN C;  4G91 C;  4XUJ C;  5BS7 A;  3AZN C;  3REI C;  3B0B A;  3MVD C;  2FFF B;  3LZ1 A;  3X1V B;  4WU8 B;  1P3I C;  1M18 B;  4KGC D;  3C1B B;  4R8P D;  1P3L A;  1ID3 D;  4H9P A;  3R45 B;  5B31 D;  5AV9 D;  3C1B A;  1KX5 A;  3X1S D;  3MGR A;  5JA4 B;  1P3B B;  3LZ0 C;  5BNV B;  3NQJ B;  2NQB C;  1KX3 B;  4QLC B;  3REH D;  5AV6 B;  4J8V A;  1P3B A;  2FJ7 D;  5AY8 B;  5AV6 A;  4J8X C;  1P3I D;  4LD9 D;  4H9O B;  3AL0 C;  1P3P D;  1A7W A;  3AZG B;  4R8P B;  4H9O A;  5B1M A;  3AZL B;  3AYW B;  1P3G A;  1P3F C;  3AZH B;  5GT0 B;  3WAA C;  2ZM5 A;  5B2I A;  3W99 A;  5JRG A;  2ZY3 A;  2HIO C;  1P34 D;  5F99 C;  1R4V A;  1P3O A;  3TU4 B;  1TZY D;  5B2J A;  5B0Z C;  5DNN B;  3MGS B;  5CPJ B;  3AZF C;  2XD1 A;  5CPI B;  3EPK A;  3AV1 A;  3B0D C;  5CPJ A;  3KSY A;  5GSU A;  4JJN B;  3C1C C;  4YM6 C;  5CPI A;  4H9R B;  1M1A D;  3KXB C;  4AWL B;  4G92 C;  2ZY5 A;  4WZS B;  5B33 C;  3O62 D;  2F8N D;  2CV5 C;  1M19 D;  3AV2 D;  3KFU G;  3AZI C;  4WU9 B;  1N1J B;  3REK A;  3AN2 A;  3MNN A;  4WU9 A;  5CPK C;  1N1J A;  3AZN A;  4WNN B;  3REI A;  2G5H C;  1AOI B;  1S32 B;  4Z66 C;  1P3K A;  5FUG A;  5E5A B;  5GT3 D;  4Z5T D;  3MGP C;  3REL A;  2Y2J A;  3A6N D;  3UTB D;  1P3A D;  3WTP B;  4CAY B;  2Y2H A;  3W97 B;  1PZR A;  2LY8 A;  1U35 C;  1F66 C;  3LEL C;  2Y2K A;  3KUY C;  3W96 D;  3REJ B;  4KUD C;  3LZ0 A;  5CPK D;  2NQB A;  2DF4 C;  2HUE C;  3KWQ D;  2PYO D;  4XZQ C;  1H3O B;  4X23 D;  3MGQ C;  3LJA D;  3WA9 C;  5B40 D;  5DNM C;  3MGP D;  3AZK D;  3X1U C;  2NZD B;  2JCH A;  3VH6 A;  4HGA B;  3V9R A;  3KUY D;  5B24 D;  5AVB C;  3W98 C;  4KUD D;  3WAA A;  3X1V C;  5AV8 B;  1P3M B;  5B0Y D;  3UT9 D;  1EQZ B;  5B32 D;  1KX4 D;  5AV8 A;  2HIO A;  3AFA C;  5F99 A;  1EQZ A;  5BNX A;  5B0Z A;  3X1T D;  4XZQ D;  3VH6 W;  3VH5 A;  2F8N K;  2IO5 C;  5AV5 C;  4ZUX C;  2Y2G A;  3AZK B;  3AZJ B;  4YM6 A;  1KX3 C;  3AZJ A;  4H9N A;  1ZLA B;  5GXQ B;  3X1V D;  4WU8 D;  1P3L D;  1M18 D;  4KGC C;  5B33 A;  1B67 A;  3C1B D;  5GXQ A;  2CV5 A;  4R8P C;  3AZI A;  2BYM A;  1ID3 C;  3AYW C;  5B31 C;  4ZBJ C;  4UUZ A;  5AV9 C;  3F6T A;  3X1S C;  1P3B D;  5CP6 B;  4Z66 A;  1KX3 D;  4QLC D;  5AV6 D;  3REH C;  5CP6 A;  2FJ7 C;  5AY8 D;  3LZ1 B;  4NE5 A;  2BYK A;  2F8N H;  3B0C W;  4J8U B;  1P3L B;  4LD9 C;  1P3P C;  4H9P B;  4JJN C;  1P3G D;  3AZG D;  2Y2M A;  1KX5 B;  4J8U A;  1F66 A;  3MGR B;  3AZL D;  3AYW D;  4J8W B;  4YS3 B;  3AZH D;  3FDD A;  5JRG D;  2YFV A;  5GT0 D;  4J8W A;  4J8V B;  5C3I B;  4YS3 A;  3UTA A;  3MGQ A;  3WA9 A;  1P34 C;  3WKJ B;  3TU4 D;  1TZY C;  5CPJ D;  5DNN D;  3MGS D;  3B6F A;  5CPI D;  3WKJ A;  3NQU B;  5B1M B;  4JJN D;  1P3G B;  1S32 C;  1JFI A;  3NQU A;  5AVC B;  1M1A C;  2ARO B;  4H9S C;  5B2I B;  2VQR A;  5AVC A;  3W99 B;  3VH6 T;  2ARO A;  5JRG B;  4Z2M H;  1P3O B;  3H0M C;  5B2J B;  3O62 C;  1M19 C;  3AV2 C;  5BT1 D;  4WU9 D;  3AV1 B;  5AV5 A;  4ZUX A;  3REJ C;  2ZY4 A;  5GSU B;  3AZE B;  1P3K D;  3AZM A;  1AOI D;  1S32 D;  3AZE A;  5E5A D;  5GT3 C;  5B1L B;  4Z5T C;  3B6G B;  4KGC A;  3A6N C;  2YFW B;  3UTB C;  5B1L A;  3WTP D;  1P3A C;  3B6G A;  1ID3 A;  1HQ3 B;  3W97 D;  4WV4 B;  5B31 A;  3REK B;  2YFW A;  3MNN B;  3AN2 B;  3X1S A;  4G91 B;  4XUJ B;  1HQ3 A;  3W96 C;  3REJ D;  3AZN B;  4DRB A;  3REI B;  4XUJ A;  3B0C T;  3KWQ C;  1P3K B;  5FUG B;  4KHA B;  3MVD B;  3H0L C;  2PYO C;  3REL B;  2JSS A;  4X23 C;  1W2E A;  4KHA A;  3MVD A;  3LJA C;  1P3I A;  5B40 C;  3AZK C;  2NZD D;  3IP4 C;  1TAF B;  2W8S A;  3LZ0 B;  2NQB B;  5B24 C;  1TAF A;  5AV8 D;  1P3M D;  5B0Y C;  3UT9 C;  1EQZ D;  5B32 C;  4J8X B;  1KX4 C;  1P34 A;  2L5A A;  2XD5 A;  3X1T C;  4J8X A;  4E44 A;  3AZJ D;  2Y2O A;  3V9R B;  1P3F B;  1M1A A;  3WAA B;  1P3F A;  1ZLA D;  5GXQ D;  4WU8 C;  2HIO B;  1P3L C;  1M18 C;  5F99 B;  5BNX B;  5B0Z B;  3O62 A;  3C1B C;  2F8N A;  3AV2 A;  3AZF B;  4CSR B;  3B0D B;  3AZF A;  4CSR A;  4YM6 B;  1BH9 A;  2BG1 A;  5CP6 D;  1T3U A;  4H9N B;  1P3B C;  3KXB B;  3C1C A;  4G92 B;  4H9Q A;  2RVQ D;  4QLC C;  5GT3 A;  5AV6 C;  3LZ1 D;  3KXB A;  5AY8 C;  1BFM A;  4DRA A;  5B33 B;  3A6N A;  2CV5 B;  1P3A A;  1BH8 B;  4J8U D;  3AZI B;  2BYM B;  5B32 G;  1P3G C;  1KX5 D;  3AZG C;  1BH8 A;  4UUZ B;  3MGR D;  3VH5 W;  5CHL B;  3AZL C;  4J8W D;  4EO5 B;  4NE3 A;  4YS3 D;  5CPK A;  3AZH C;  4Z66 B;  5JRG C;  5GT0 C;  3UTA D;  1B6W A;  4J8V D;  5BO0 A;  3B6F D;  2BYK B;  4X23 A;  3WKJ D;  5B40 A;  2F2A C;  3MGP A;  3TU4 C;  5DNN C;  3MGS C;  5CPJ C;  5CPI C;  1F66 B;  3LEL B;  5B1M D;  3H0R C;  1U35 A;  5AVC D;  3LEL A;  3KUY A;  2HUE B;  5B24 A;  2ARO D;  5KDM A;  2YFV B;  4KUD A;  4AWL C;  3W99 D;  5B2I D;  5B0Y A;  3UT9 A;  1Q9C A;  5B32 A;  1KX4 A;  3UTA B;  3MGQ B;  3WA9 B;  1P3O D;  5DNM B;  4XZQ A;  5B2J D;  3X1T A;  3X1U B;  3B6F B;  5BT1 C;  4WU9 C;  3AV1 D;  5DNM A;  3AZM D;  1F1E A;  1HTA A;  4NFT A;  5GSU D;  3X1U A;  1JFI B;  3AZE D;  1P3K C; 
#chains in the Genus database with same CATH homology
 1AOI C;  5AVB B;  3W98 B;  3EPH A;  3REL C;  5B31 G;  5G49 B;  4E45 A;  5E5A C;  5AVB A;  3W98 A;  5B1L D;  3X1V A;  4WU8 A;  3AFA B;  1M18 A;  3B6G D;  5G49 A;  3WTP C;  3AFA A;  4DQY B;  1HQ3 D;  2IO5 B;  3R45 A;  5AV5 B;  4ZUX B;  3REK D;  3MNN D;  1Z2C B;  3AN2 D;  4XUJ D;  3W97 C;  5JA4 A;  3AZM B;  3AZN D;  3REI D;  5BNV A;  3NQJ A;  1KX3 A;  4QLC A;  3MVD D;  5AY8 A;  3REL D;  4KGC B;  3VH5 T;  2DQN C;  1ID3 B;  2NZD C;  5B31 B;  4ZBJ B;  5AV9 B;  4R8P A;  3AZG A;  3X1S B;  3AZL A;  3AYW A;  4HGA C;  5AV9 A;  3LZ0 D;  3A1K A;  3AZH A;  2NQB D;  2Y2Q A;  5GT0 A;  3REH B;  5AV8 C;  1P3M C;  2FJ7 B;  1EQZ C;  2ZY2 A;  4J8X D;  3REH A;  2FJ7 A;  1P3I B;  3TU4 A;  4LD9 B;  1P3P B;  5DNN A;  3MGS A;  4LD9 A;  1P3P A;  4JJN A;  3AZJ C;  3EPJ A;  1P3F D;  4H9R A;  2F8N G;  3WTP E;  1WWI A;  3WAA D;  1ZLA C;  5GXQ C;  2HIO D;  5F99 D;  1P34 B;  2Y2P A;  2Y2L A;  3EG5 B;  1TZY B;  5B0Z D;  3AZF D;  1TZY A;  4EO5 C;  3C1C D;  4YM6 D;  1M1A B;  5BS7 C;  4WNN A;  1AOI A;  5CP6 C;  3KXB D;  1S32 A;  1ULY A;  4M6B A;  5E5A A;  2RVQ C;  3LZ1 C;  4H9S A;  2Y2I A;  3P5J B;  5B33 D;  3O62 B;  2CV5 D;  2F8N B;  1M19 B;  3WTP A;  4J8U C;  3AZI D;  3AV2 B;  4CAY A;  1WWS A;  3W97 A;  3EPL A;  1KX5 C;  1M19 A;  3MGR C;  4Z2M G;  1BH9 B;  2RIQ A;  3REJ A;  4J8W C;  4YS3 C;  3C1C B;  4Z66 D;  4H9Q B;  5GT3 B;  3UTA C;  1KU5 A;  4J8V C;  5C3I C;  4Z5T B;  1H3O A;  3B6F C;  3A6N B;  3UTB B;  1P3A B;  4Z5T A;  3WKJ C;  2NZD A;  4UPK A;  3UTB A;  4WJ3 C;  1U35 D;  1F66 D;  3LEL D;  5B1M C;  3W96 B;  2G5I C;  5AVC C;  5CPK B;  2UWX A;  3W96 A;  2J8P A;  3KWQ B;  2ARO C;  1P3M A;  3W99 C;  5B2I C;  2Y2N A;  2PYO B;  5BO0 B;  3KWQ A;  4X23 B;  3MGQ D;  3WA9 D;  3LJA B;  5DNM D;  5B40 B;  3MGP B;  1P3O C;  2PYO A;  5B2J C;  3A1I A;  3X1U D;  3LJA A;  3AV1 C;  3AZM C;  3AZK A;  5GSU C;  1U35 B;  3AZE C;  3KUY B;  5B24 B;  5AVB D;  5KDM B;  3W98 D;  4KUD B;  4NE6 A;  5B0Y B;  3UT9 B;  1ZLA A;  5B32 B;  5B1L C;  3AFA D;  1KX4 B;  3B6G C;  2CWE A;  4XZQ B;  3X1T B;  2JE5 A;  1HQ3 C;  5AV5 D;  4ZUX D;  3REK C;  3AN2 C;  3MNN C;  4G91 C;  4XUJ C;  5BS7 A;  3AZN C;  3REI C;  3B0B A;  3MVD C;  2FFF B;  3LZ1 A;  3X1V B;  4WU8 B;  1P3I C;  1M18 B;  4KGC D;  3C1B B;  4R8P D;  1P3L A;  1ID3 D;  4H9P A;  3R45 B;  5B31 D;  5AV9 D;  3C1B A;  1KX5 A;  3X1S D;  3MGR A;  5JA4 B;  1P3B B;  3LZ0 C;  5BNV B;  3NQJ B;  2NQB C;  1KX3 B;  4QLC B;  3REH D;  5AV6 B;  4J8V A;  1P3B A;  2FJ7 D;  5AY8 B;  5AV6 A;  4J8X C;  1P3I D;  4LD9 D;  4H9O B;  3AL0 C;  1P3P D;  1A7W A;  3AZG B;  4R8P B;  4H9O A;  5B1M A;  3AZL B;  3AYW B;  1P3G A;  1P3F C;  3AZH B;  5GT0 B;  3WAA C;  2ZM5 A;  5B2I A;  3W99 A;  5JRG A;  2ZY3 A;  2HIO C;  1P34 D;  5F99 C;  1R4V A;  1P3O A;  3TU4 B;  1TZY D;  5B2J A;  5B0Z C;  5DNN B;  3MGS B;  5CPJ B;  3AZF C;  2XD1 A;  5CPI B;  3EPK A;  3AV1 A;  3B0D C;  5CPJ A;  3KSY A;  5GSU A;  4JJN B;  3C1C C;  4YM6 C;  5CPI A;  4H9R B;  1M1A D;  3KXB C;  4AWL B;  4G92 C;  2ZY5 A;  4WZS B;  5B33 C;  3O62 D;  2F8N D;  2CV5 C;  1M19 D;  3AV2 D;  3KFU G;  3AZI C;  4WU9 B;  1N1J B;  3REK A;  3AN2 A;  3MNN A;  4WU9 A;  5CPK C;  1N1J A;  3AZN A;  4WNN B;  3REI A;  2G5H C;  1AOI B;  1S32 B;  4Z66 C;  1P3K A;  5FUG A;  5E5A B;  5GT3 D;  4Z5T D;  3MGP C;  3REL A;  2Y2J A;  3A6N D;  3UTB D;  1P3A D;  3WTP B;  4CAY B;  2Y2H A;  3W97 B;  1PZR A;  2LY8 A;  1U35 C;  1F66 C;  3LEL C;  2Y2K A;  3KUY C;  3W96 D;  3REJ B;  4KUD C;  3LZ0 A;  5CPK D;  2NQB A;  2DF4 C;  2HUE C;  3KWQ D;  2PYO D;  4XZQ C;  1H3O B;  4X23 D;  3MGQ C;  3LJA D;  3WA9 C;  5B40 D;  5DNM C;  3MGP D;  3AZK D;  3X1U C;  2NZD B;  2JCH A;  3VH6 A;  4HGA B;  3V9R A;  3KUY D;  5B24 D;  5AVB C;  3W98 C;  4KUD D;  3WAA A;  3X1V C;  5AV8 B;  1P3M B;  5B0Y D;  3UT9 D;  1EQZ B;  5B32 D;  1KX4 D;  5AV8 A;  2HIO A;  3AFA C;  5F99 A;  1EQZ A;  5BNX A;  5B0Z A;  3X1T D;  4XZQ D;  3VH6 W;  3VH5 A;  2F8N K;  2IO5 C;  5AV5 C;  4ZUX C;  2Y2G A;  3AZK B;  3AZJ B;  4YM6 A;  1KX3 C;  3AZJ A;  4H9N A;  1ZLA B;  5GXQ B;  3X1V D;  4WU8 D;  1P3L D;  1M18 D;  4KGC C;  5B33 A;  1B67 A;  3C1B D;  5GXQ A;  2CV5 A;  4R8P C;  3AZI A;  2BYM A;  1ID3 C;  3AYW C;  5B31 C;  4ZBJ C;  4UUZ A;  5AV9 C;  3F6T A;  3X1S C;  1P3B D;  5CP6 B;  4Z66 A;  1KX3 D;  4QLC D;  5AV6 D;  3REH C;  5CP6 A;  2FJ7 C;  5AY8 D;  3LZ1 B;  4NE5 A;  2BYK A;  2F8N H;  3B0C W;  4J8U B;  1P3L B;  4LD9 C;  1P3P C;  4H9P B;  4JJN C;  1P3G D;  3AZG D;  2Y2M A;  1KX5 B;  4J8U A;  1F66 A;  3MGR B;  3AZL D;  3AYW D;  4J8W B;  4YS3 B;  3AZH D;  3FDD A;  5JRG D;  2YFV A;  5GT0 D;  4J8W A;  4J8V B;  5C3I B;  4YS3 A;  3UTA A;  3MGQ A;  3WA9 A;  1P34 C;  3WKJ B;  3TU4 D;  1TZY C;  5CPJ D;  5DNN D;  3MGS D;  3B6F A;  5CPI D;  3WKJ A;  3NQU B;  5B1M B;  4JJN D;  1P3G B;  1S32 C;  1JFI A;  3NQU A;  5AVC B;  1M1A C;  2ARO B;  4H9S C;  5B2I B;  2VQR A;  5AVC A;  3W99 B;  3VH6 T;  2ARO A;  5JRG B;  4Z2M H;  1P3O B;  3H0M C;  5B2J B;  3O62 C;  1M19 C;  3AV2 C;  5BT1 D;  4WU9 D;  3AV1 B;  5AV5 A;  4ZUX A;  3REJ C;  2ZY4 A;  5GSU B;  3AZE B;  1P3K D;  3AZM A;  1AOI D;  1S32 D;  3AZE A;  5E5A D;  5GT3 C;  5B1L B;  4Z5T C;  3B6G B;  4KGC A;  3A6N C;  2YFW B;  3UTB C;  5B1L A;  3WTP D;  1P3A C;  3B6G A;  1ID3 A;  1HQ3 B;  3W97 D;  4WV4 B;  5B31 A;  3REK B;  2YFW A;  3MNN B;  3AN2 B;  3X1S A;  4G91 B;  4XUJ B;  1HQ3 A;  3W96 C;  3REJ D;  3AZN B;  4DRB A;  3REI B;  4XUJ A;  3B0C T;  3KWQ C;  1P3K B;  5FUG B;  4KHA B;  3MVD B;  3H0L C;  2PYO C;  3REL B;  2JSS A;  4X23 C;  1W2E A;  4KHA A;  3MVD A;  3LJA C;  1P3I A;  5B40 C;  3AZK C;  2NZD D;  3IP4 C;  1TAF B;  2W8S A;  3LZ0 B;  2NQB B;  5B24 C;  1TAF A;  5AV8 D;  1P3M D;  5B0Y C;  3UT9 C;  1EQZ D;  5B32 C;  4J8X B;  1KX4 C;  1P34 A;  2L5A A;  2XD5 A;  3X1T C;  4J8X A;  4E44 A;  3AZJ D;  2Y2O A;  3V9R B;  1P3F B;  1M1A A;  3WAA B;  1P3F A;  1ZLA D;  5GXQ D;  4WU8 C;  2HIO B;  1P3L C;  1M18 C;  5F99 B;  5BNX B;  5B0Z B;  3O62 A;  3C1B C;  2F8N A;  3AV2 A;  3AZF B;  4CSR B;  3B0D B;  3AZF A;  4CSR A;  4YM6 B;  1BH9 A;  2BG1 A;  5CP6 D;  1T3U A;  4H9N B;  1P3B C;  3KXB B;  3C1C A;  4G92 B;  4H9Q A;  2RVQ D;  4QLC C;  5GT3 A;  5AV6 C;  3LZ1 D;  3KXB A;  5AY8 C;  1BFM A;  4DRA A;  5B33 B;  3A6N A;  2CV5 B;  1P3A A;  1BH8 B;  4J8U D;  3AZI B;  2BYM B;  5B32 G;  1P3G C;  1KX5 D;  3AZG C;  1BH8 A;  4UUZ B;  3MGR D;  3VH5 W;  5CHL B;  3AZL C;  4J8W D;  4EO5 B;  4NE3 A;  4YS3 D;  5CPK A;  3AZH C;  4Z66 B;  5JRG C;  5GT0 C;  3UTA D;  1B6W A;  4J8V D;  5BO0 A;  3B6F D;  2BYK B;  4X23 A;  3WKJ D;  5B40 A;  2F2A C;  3MGP A;  3TU4 C;  5DNN C;  3MGS C;  5CPJ C;  5CPI C;  1F66 B;  3LEL B;  5B1M D;  3H0R C;  1U35 A;  5AVC D;  3LEL A;  3KUY A;  2HUE B;  5B24 A;  2ARO D;  5KDM A;  2YFV B;  4KUD A;  4AWL C;  3W99 D;  5B2I D;  5B0Y A;  3UT9 A;  1Q9C A;  5B32 A;  1KX4 A;  3UTA B;  3MGQ B;  3WA9 B;  1P3O D;  5DNM B;  4XZQ A;  5B2J D;  3X1T A;  3X1U B;  3B6F B;  5BT1 C;  4WU9 C;  3AV1 D;  5DNM A;  3AZM D;  1F1E A;  1HTA A;  4NFT A;  5GSU D;  3X1U A;  1JFI B;  3AZE D;  1P3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...