3X1UC

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
VKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uC00
5B40D 1P3AA 3W96C 5BO0A 4G92B 5B32D 3AZLD 5BNVA 2AROB 5BT1D 5AVBB 3MNNC 3VH6A 1M1AD 1F66C 1HTAA 5GSUA 1AOID 5CP6D 1P3KD 3KXBA 1P3LB 3REJA 4XUJC 4KUDA 3MGPC 4KGCC 5B1LB 4H9NA 4XZQB 1S32C 5DNNC 3AZEA 5JA4A 5F99A 3W97D 4J8VA 3AV2B 1M19C 3WKJA 5KDMA 5C3IC 3AN2A 3LZ1A 1M18C 5B0YC 5JRGA 4Z5TC 4LD9B 3X1UD 3A6ND 5B40C 3W99B 5B2JD 4NE6A 3AZLC 3X1SD 3KWQA 3B0BA 3W98D 5BT1C 5B2ID 5BS7A 5AV6B 5CPKB 2BYMB 3WAAD 2NZDA 1KX4D 5FUGB 4H9OA 1M1AC 3B6GA 3X1TD 1AOIC 1BH8A 5CP6C 4YM6A 4J8UB 3LZ0D 4ZBJB 1P3MA 1H3OB 3AZKA 5B24C 5DNMB 3UTAA 1ZLAB 1KX3A 3C1CA 3X1VD 5AV8C 3LJAD 3W97C 4Z66D 3AZFB 4WU9B 4EO5B 1BH9A 2PYOD 3REIB 4WU8A 1P3OD 3LELA 1U35D 1P34D 3WTPB 3A6NC 1P3IC 3AZIA 3AFAA 5B2JC 3AZNA 4J8WC 3X1SC 5BO0B 1ID3A 1WWSA 3W98C 5BNVB 5B2IC 3WAAC 5GXQD 1B6WA 1KX4C 4H9RA 3X1TC 4ZUXC 5GT0D 3LZ0C 5GSUB 4AWLB 5B31D 3KXBB 5B1MD 3REJB 2NQBD 3W96A 4KUDB 4H9SC 3MGQC 1P3GB 4H9NB 3X1VC 1P3BA 3UTBA 3LJAC 3MNNA 3AZEB 5JA4B 4Z66C 1EQZD 5AY8D 5F99B 4E45A 1F66A 4J8VB 4QLCD 4KHAA 2PYOC 5KDMB 3MVDD 1P3OC 4X23B 3AN2B 1U35C 4XUJA 3AYWD 3MGPA 3VH5T 3LZ1B 1Q9CA 5E5AD 1KX5D 5JRGB 1S32A 5DNNA 1JFIB 1B67A 2CV5D 5CPJD 3KWQB 5GXQC 1M19A 2NZDB 3UT9A 3R45A 3B0CT 4UUZA 4H9OB 3B6GB 4Z2MG 1BH8B 4YM6B 3AZHD 5B31C 2BYKA 5B0YA 4Z5TA 5B40A 3AV1C 2NQBC 4J8XB 3AZJD 5B32A 3AZKB 3AZLA 2IO5B 3O62D 3UTAB 3REKB 4DRAA 1KX3B 3C1CB 5AV9C 1EQZC 1M1AA 4YS3D 1AOIA 4KGCD 1P3KA 1BH9B 2JSSA 3MVDC 2HUEB 4WU8B 3AYWC 3LELB 1KX5C 4R8PA 3AZIB 3AFAB 2YFWA 3AZNB 1TZYD 2CV5C 5CPJC 2L5AA 1ID3B 3NQUA 3W97A 5B32G 3WA9C 5B0ZC 3AZHC 1P3PB 3B0DB 3X1UA 3A6NA 1N1JA 3AZJC 3X1SA 5G49A 4CSRA 3W96B 3O62C 4Z2MH 3W98A 5B2IA 3WAAA 1P3BB 3UTBB 1KX4A 3MNNB 4YS3C 2CWEA 3X1TA 1F66B 5B24D 4G92C 5AV8D 5CPKD 3MGSD 4XUJB 4H9SA 3MGPB 5DNNB 1TZYC 3LJAA 3NQJA 3KUYD 1KU5A 1HQ3D 4XZQC 3UT9B 1P3ID 2F8NA 3R45B 2PYOA 4UUZB 4J8WD 1P3OA 1U35A 3TU4D 1P34A 5B33D 3AZFD 3MGRB 2BYKB 5B0YB 4Z5TB 4WU9D 5B40B 5B32B 3AZLB 4NE5A 4ZUXD 4M6BA 5GXQA 3B0DC 3W99C 5GT0A 3MGQD 4H9QA 1AOIB 3C1BA 5B31A 1P3KB 5B1MA 5CPKC 3MGSC 2NQBA 2F8NG 4DRBA 4R8PB 1EQZA 2YFWB 3KXBD 3AZMD 5AY8A 3NQUB 3B6FB 3W97B 3KUYC 4QLCA 1HQ3C 3KSYA 1P3GD 4JJND 1P3AB 3TU4C 5B33C 3AYWA 1KX5A 3AZFC 5E5AA 2HIOD 4WU9C 3AZGD 3X1UB 3A6NB 1N1JB 5CPID 2CV5A 5BNXA 5AVCD 3X1SB 1A7WA 5G49B 4CSRB 5CPJA 3W98B 4X23D 5B2IB 3WAAB 3WTPC 1KX4B 1P3FD 3AV1D 5AV5D 3X1TB 4HGAC 3AZHA 3VH5W 5AV9D 3AZJA 3O62A 4WNNA 3WKJB 4AWLC 3AZMC 3KXBC 3LJAB 3NQJB 3B0CW 5GT3D 4YS3A 4KGCA 4J8XD 2F8NH 4KUDC 1P3GC 2F8NB 4JJNC 2PYOB 3REKD 1KX3D 1P3OB 2RVQD 1P34B 5F99C 2HIOC 4J8VC 3AZGC 5CPIC 3REHD 3WA9D 1TZYA 5AVCC 4X23C 5B0ZD 2FJ7D 1M18A 5GXQB 3V9RA 3LZ1C 1P3MB 1P3FC 5JRGC 3VH6T 3RELD 4G91C 5AV5C 3AZND 5GT0B 4H9QB 3C1BB 5BS7C 5B1MB 2NZDC 2NQBB 2YFVA 5CP6A 4YM6C 2AROD 1P3PD 1EQZB 5GT3C 5AVBD 5AY8B 4J8XC 5B24A 4QLCB 3REKC 5AV8A 1KX3C 1P3LD 3MGSA 2RVQC 1P3BD 3UTBD 3AYWB 1KX5B 5E5AB 5B1LD 4XZQD 3REHC 4H9PA 4H9RB 2CV5B 5BNXB 2HUEC 5CPJB 2FJ7C 4WU8C 3KUYA 1HQ3A 1P3IA 3AV2D 3RELC 5B2JA 4J8WA 3AFAC 3AZNC 3TU4A 5B33A 3AZHB 3VH5A 4LD9D 3AZJB 3W99D 4ZUXA 4WNNB 3LZ0A 4KHAB 2AROC 1P3PC 5AVBC 5AV6D 3MGRD 4YS3B 3MGQA 4KGCB 3X1VA 1S32B 1P3LC 4J8UD 1P3BC 3UTBC 4Z66A 1WWIA 1M19B 5B1LC 5DNMD 1ZLAD 3AZMA 1TZYB 5C3IB 1M18B 3AV2C 3V9RB 1P3GA 4JJNA 4R8PD 3REID 2HIOA 3B6FD 3AZGA 3WTPD 4LD9C 5CPIA 4CAYA 3UT9C 1M1AB 5AVCA 2YFVB 4X23A 1P3AD 4NE3A 5CP6B 5AV6C 3MGRC 3AV1A 1P3FA 5AV5A 1JFIA 1TAFA 5B24B 5B32C 4J8UC 4ZBJC 5AV8B 5GSUD 5AV9A 3MGSB 3REJD 4KUDD 5DNMC 1ZLAC 1P3KC 3MVDA 4H9PB 1F1EA 5GT3A 2LY8A 3AZED 4J8XA 3KUYB 5F99D 4WV4B 4J8VD 1HQ3B 4EO5C 1P3IB 3WKJD 3REKA 1BFMA 4R8PC 4WZSB 5B2JB 4J8WB 3REIC 5B31G 3TU4B 5B33B 3AN2D 3B6FC 3LZ1D 5JRGD 3REHA 3WA9A 2F8ND 1P3AC 5B0ZA 2FJ7A 4ZUXB 3LZ0B 3KWQD 3RELA 3X1UC 2NZDD 3MGQB 3B6GD 4HGAB 3X1VB 5GSUC 4YM6D 4NFTA 1P3MD 4Z66B 3REJC 3AZKD 3UTAD 2AROA 1P3PA 1ULYA 3C1BD 5AVBA 3WTPE 3C1CD 3VH6W 3AZMB 3AZEC 1U35B 2F8NK 3WKJC 1R4VA 1P3LA 4JJNB 3AN2C 4WU8D 2HIOB 3LELD 5B1LA 4XZQA 3AZGB 5CPIB 4CAYB 3AZID 5AVCB 3AFAD 1ID3D 3KWQC 5B31B 1P34C 3AV2A 1P3FB 3AV1B 4G91B 5AV5B 3B6GC 1TAFB 5AV9B 1P3MC 4LD9A 3W99A 3AZKC 3W96D 2IO5C 5GT0C 3UTAC 3C1BC 3C1CC 5AV6A 3MVDB 2BYMA 3MGRA 5CPKA 5GT3B 5B1MC 5FUGA 3MNND 1F66D 4J8UA 5AY8C 1H3OA 3LELC 4XUJD 5DNMA 1ZLAA 3MGPD 4QLCC 3REHB 1S32D 3AZIC 3WA9B 5DNND 1ID3C 5B0ZB 2FJ7B 3AZFA 5CHLB 5E5AC 4WU9A 1M19D 3RELB 3UT9D 3REIA 3O62B 4E44A 3B6FA 3WTPA 1M18D 5B0YD 4Z5TD
chains in the Genus database with same CATH superfamily
5B40D 1P3AA 3W96C 5BO0A 4G92B 5B32D 3AZLD 5BNVA 2Y2JA 2AROB 5BT1D 5AVBB 3MNNC 3VH6A 2W8SA 1M1AD 1F66C 1HTAA 5GSUA 1AOID 5CP6D 1P3KD 3KXBA 1P3LB 3REJA 4XUJC 4KUDA 3MGPC 4KGCC 5B1LB 4H9NA 4XZQB 1S32C 2XD5A 5DNNC 3EPLA 3AZEA 5JA4A 5F99A 3W97D 4J8VA 3AV2B 1M19C 3WKJA 5KDMA 5C3IC 3AN2A 3LZ1A 1M18C 5B0YC 5JRGA 4Z5TC 4LD9B 3X1UD 3A6ND 5B40C 3W99B 5B2JD 4NE6A 3AZLC 3X1SD 3KWQA 3B0BA 3W98D 5BT1C 5B2ID 5BS7A 5AV6B 5CPKB 2BYMB 3WAAD 2NZDA 1KX4D 2J8PA 5FUGB 4H9OA 1M1AC 3B6GA 3X1TD 1AOIC 1BH8A 5CP6C 4YM6A 4J8UB 3LZ0D 4ZBJB 1P3MA 3KFUG 1H3OB 3AZKA 5B24C 5DNMB 3UTAA 1ZLAB 1KX3A 3C1CA 3X1VD 5AV8C 3LJAD 3W97C 4Z66D 3AZFB 4WU9B 4DQYB 4EO5B 1BH9A 2PYOD 3REIB 4WU8A 1P3OD 3LELA 1U35D 1P34D 3WTPB 3A6NC 1P3IC 3AZIA 3AFAA 5B2JC 3AZNA 4J8WC 3X1SC 5BO0B 1ID3A 1WWSA 3W98C 5BNVB 5B2IC 3WAAC 5GXQD 1B6WA 1KX4C 4H9RA 3X1TC 4ZUXC 2Y2OA 5GT0D 3LZ0C 5GSUB 4AWLB 5B31D 3KXBB 5B1MD 3REJB 2NQBD 3W96A 4KUDB 4H9SC 3MGQC 1P3GB 4H9NB 3X1VC 1P3BA 2FFFB 3UTBA 3LJAC 3MNNA 3AZEB 5JA4B 4Z66C 1EQZD 5AY8D 5F99B 4E45A 1F66A 2BG1A 4J8VB 4QLCD 4KHAA 3H0LC 2PYOC 5KDMB 3MVDD 1P3OC 4X23B 3AN2B 1U35C 4XUJA 3AYWD 3MGPA 3VH5T 3LZ1B 1Q9CA 5E5AD 1KX5D 5JRGB 1S32A 5DNNA 1JFIB 1B67A 2CV5D 5CPJD 3KWQB 5GXQC 1M19A 2NZDB 3UT9A 3R45A 3B0CT 4UUZA 4H9OB 3B6GB 4Z2MG 1BH8B 4YM6B 3AZHD 5B31C 2BYKA 5B0YA 4Z5TA 5B40A 3AV1C 2NQBC 4J8XB 3AZJD 3H0RC 5B32A 3AZKB 3AZLA 2IO5B 3O62D 3UTAB 3REKB 4DRAA 1KX3B 3C1CB 5AV9C 1EQZC 3EPKA 1M1AA 4YS3D 1AOIA 4KGCD 1P3KA 1BH9B 2JSSA 3MVDC 2HUEB 4WU8B 3AYWC 2Y2IA 2Y2LA 3LELB 1KX5C 4R8PA 3AZIB 3AFAB 2YFWA 3AZNB 1TZYD 2CV5C 5CPJC 2L5AA 1ID3B 3NQUA 3W97A 5B32G 3WA9C 3EPHA 5B0ZC 3AZHC 2ZY5A 1P3PB 3B0DB 3X1UA 3A6NA 1N1JA 3AZJC 3X1SA 5G49A 4CSRA 3W96B 3O62C 4Z2MH 3W98A 5B2IA 3WAAA 1P3BB 3UTBB 1KX4A 3MNNB 4YS3C 2CWEA 3X1TA 1F66B 5B24D 4G92C 2Y2QA 5AV8D 5CPKD 3MGSD 4XUJB 4H9SA 3MGPB 5DNNB 1TZYC 3LJAA 3NQJA 2Y2NA 3KUYD 1KU5A 1HQ3D 4XZQC 3UT9B 1P3ID 2F8NA 3R45B 2PYOA 4UUZB 4J8WD 1P3OA 1U35A 3TU4D 1P34A 5B33D 3AZFD 3MGRB 2BYKB 5B0YB 4Z5TB 4WU9D 1PZRA 5B40B 5B32B 3AZLB 4NE5A 4ZUXD 4M6BA 5GXQA 1Z2CB 3B0DC 3W99C 5GT0A 3MGQD 4H9QA 1AOIB 3C1BA 5B31A 1P3KB 5B1MA 5CPKC 3MGSC 2NQBA 2F8NG 4DRBA 4R8PB 4UPKA 1EQZA 2YFWB 3KXBD 3AZMD 5AY8A 3NQUB 3B6FB 3W97B 3KUYC 3IP4C 4QLCA 1HQ3C 2F2AC 3KSYA 1P3GD 4JJND 1P3AB 3TU4C 5B33C 3AYWA 1KX5A 3AZFC 5E5AA 2HIOD 4WU9C 3AZGD 3X1UB 3A6NB 2DQNC 1N1JB 5CPID 2CV5A 5BNXA 5AVCD 3X1SB 1A7WA 5G49B 4CSRB 5CPJA 3W98B 4X23D 5B2IB 3WAAB 3WTPC 1KX4B 1P3FD 3AV1D 5AV5D 3X1TB 4HGAC 3AZHA 3VH5W 5AV9D 3AZJA 3O62A 4WNNA 3WKJB 4AWLC 2XD1A 3KXBC 3LJAB 3AZMC 3NQJB 3B0CW 5GT3D 4YS3A 4KGCA 4J8XD 2F8NH 4KUDC 3H0MC 1P3GC 2F8NB 2DF4C 2UWXA 4JJNC 3REKD 1KX3D 2PYOB 1P3OB 2RVQD 1P34B 5F99C 2HIOC 4J8VC 3AZGC 5CPIC 3REHD 3WA9D 1TZYA 5AVCC 4X23C 5B0ZD 2FJ7D 1M18A 5GXQB 3V9RA 3LZ1C 1P3MB 1P3FC 5JRGC 3VH6T 3RELD 4G91C 5AV5C 2VQRA 3AZND 5GT0B 4H9QB 3C1BB 5BS7C 5B1MB 2NZDC 2NQBB 2YFVA 5CP6A 4YM6C 2AROD 1P3PD 1EQZB 5GT3C 5AVBD 5AY8B 4J8XC 5B24A 4QLCB 3REKC 5AV8A 1KX3C 1P3LD 3MGSA 2RVQC 1P3BD 3P5JB 3UTBD 3AYWB 1KX5B 5E5AB 5B1LD 4XZQD 3EPJA 3REHC 4H9PA 4H9RB 2CV5B 5BNXB 2HUEC 5CPJB 2FJ7C 4WU8C 3KUYA 1HQ3A 1P3IA 3AV2D 3RELC 2ZM5A 5B2JA 4J8WA 3AFAC 3AZNC 3TU4A 5B33A 3AZHB 3VH5A 4LD9D 3AZJB 3W99D 4ZUXA 4WNNB 3LZ0A 3F6TA 4KHAB 3A1IA 2AROC 1P3PC 2Y2PA 5AVBC 5AV6D 3MGRD 4YS3B 3MGQA 4KGCB 3X1VA 1S32B 1P3LC 4J8UD 3AL0C 1P3BC 3UTBC 4Z66A 2G5IC 2JCHA 1WWIA 1M19B 5B1LC 5DNMD 1ZLAD 3AZMA 1TZYB 5C3IB 2Y2GA 1M18B 3AV2C 3V9RB 1P3GA 4JJNA 4R8PD 3REID 2HIOA 2ZY2A 3B6FD 3AZGA 3WTPD 4LD9C 5CPIA 4CAYA 3UT9C 1M1AB 5AVCA 2YFVB 4X23A 1P3AD 4NE3A 5CP6B 5AV6C 3MGRC 3AV1A 1P3FA 5AV5A 1JFIA 1TAFA 5B24B 5B32C 4J8UC 4ZBJC 5AV8B 5GSUD 5AV9A 3MGSB 3REJD 4KUDD 5DNMC 1ZLAC 1P3KC 3MVDA 4H9PB 1F1EA 5GT3A 2LY8A 3AZED 4J8XA 3KUYB 5F99D 1W2EA 4WV4B 4J8VD 1HQ3B 4EO5C 1P3IB 3WKJD 3EG5B 3REKA 4R8PC 4WZSB 5B2JB 1BFMA 4J8WB 3REIC 4WJ3C 5B31G 3TU4B 5B33B 3AN2D 3B6FC 3LZ1D 5JRGD 3REHA 3WA9A 2Y2MA 2F8ND 1P3AC 5B0ZA 2FJ7A 4ZUXB 3LZ0B 3KWQD 3RELA 3X1UC 2NZDD 3MGQB 3B6GD 4HGAB 3X1VB 5GSUC 4YM6D 4NFTA 1P3MD 4Z66B 3REJC 3AZKD 3UTAD 2AROA 1P3PA 1ULYA 3C1BD 5AVBA 3WTPE 3C1CD 3VH6W 3AZMB 2JE5A 3AZEC 1U35B 2F8NK 3WKJC 1R4VA 1P3LA 4JJNB 3AN2C 4WU8D 2HIOB 3LELD 5B1LA 4XZQA 3AZGB 5CPIB 4CAYB 3AZID 5AVCB 3AFAD 1ID3D 3KWQC 5B31B 1P34C 3AV2A 1P3FB 3AV1B 2ZY3A 4G91B 5AV5B 3B6GC 1TAFB 1T3UA 5AV9B 1P3MC 4LD9A 3W99A 3AZKC 3W96D 2IO5C 5GT0C 3UTAC 3C1BC 3C1CC 5AV6A 3MVDB 2BYMA 3MGRA 5CPKA 5GT3B 5B1MC 5FUGA 3MNND 3A1KA 1F66D 4J8UA 5AY8C 1H3OA 3LELC 4XUJD 5DNMA 1ZLAA 3MGPD 4QLCC 2ZY4A 3REHB 3AZIC 1S32D 3WA9B 5DNND 1ID3C 5B0ZB 2FJ7B 3AZFA 3FDDA 5CHLB 5E5AC 4WU9A 1M19D 3RELB 2Y2KA 3UT9D 3REIA 2G5HC 2RIQA 4E44A 3O62B 3B6FA 3WTPA 1M18D 2Y2HA 5B0YD 4Z5TD
chains in the Genus database with same CATH topology
5B40D 1P3AA 3W96C 5BO0A 4G92B 5B32D 3AZLD 5BNVA 2Y2JA 2AROB 5BT1D 5AVBB 3MNNC 3VH6A 2W8SA 1M1AD 1F66C 1HTAA 5GSUA 1AOID 5CP6D 1P3KD 3KXBA 1P3LB 3REJA 4XUJC 4KUDA 3MGPC 4KGCC 5B1LB 4H9NA 4XZQB 1S32C 2XD5A 5DNNC 3EPLA 3AZEA 5JA4A 5F99A 3W97D 4J8VA 3AV2B 1M19C 3WKJA 5KDMA 5C3IC 3AN2A 3LZ1A 1M18C 5B0YC 5JRGA 4Z5TC 4LD9B 3X1UD 3A6ND 5B40C 3W99B 5B2JD 4NE6A 3AZLC 3X1SD 3KWQA 3B0BA 3W98D 5BT1C 5B2ID 5BS7A 5AV6B 5CPKB 2BYMB 3WAAD 2NZDA 1KX4D 2J8PA 5FUGB 4H9OA 1M1AC 3B6GA 3X1TD 1AOIC 1BH8A 5CP6C 4YM6A 4J8UB 3LZ0D 4ZBJB 1P3MA 3KFUG 1H3OB 3AZKA 5B24C 5DNMB 3UTAA 1ZLAB 1KX3A 3C1CA 3X1VD 5AV8C 3LJAD 3W97C 4Z66D 3AZFB 4WU9B 4DQYB 4EO5B 1BH9A 2PYOD 3REIB 4WU8A 1P3OD 3LELA 1U35D 1P34D 3WTPB 3A6NC 1P3IC 3AZIA 3AFAA 5B2JC 3AZNA 4J8WC 3X1SC 5BO0B 1ID3A 1WWSA 3W98C 5BNVB 5B2IC 3WAAC 5GXQD 1B6WA 1KX4C 4H9RA 3X1TC 4ZUXC 2Y2OA 5GT0D 3LZ0C 5GSUB 4AWLB 5B31D 3KXBB 5B1MD 3REJB 2NQBD 3W96A 4KUDB 4H9SC 3MGQC 1P3GB 4H9NB 3X1VC 1P3BA 2FFFB 3UTBA 3LJAC 3MNNA 3AZEB 5JA4B 4Z66C 1EQZD 5AY8D 5F99B 4E45A 1F66A 2BG1A 4J8VB 4QLCD 4KHAA 3H0LC 2PYOC 5KDMB 3MVDD 1P3OC 4X23B 3AN2B 1U35C 4XUJA 3AYWD 3MGPA 3VH5T 3LZ1B 1Q9CA 5E5AD 1KX5D 5JRGB 1S32A 5DNNA 1JFIB 1B67A 2CV5D 5CPJD 3KWQB 5GXQC 1M19A 2NZDB 3UT9A 3R45A 3B0CT 4UUZA 4H9OB 3B6GB 4Z2MG 1BH8B 4YM6B 3AZHD 5B31C 2BYKA 5B0YA 4Z5TA 5B40A 3AV1C 2NQBC 4J8XB 3AZJD 3H0RC 5B32A 3AZKB 3AZLA 2IO5B 3O62D 3UTAB 3REKB 4DRAA 1KX3B 3C1CB 5AV9C 1EQZC 3EPKA 1M1AA 4YS3D 1AOIA 4KGCD 1P3KA 1BH9B 2JSSA 3MVDC 2HUEB 4WU8B 3AYWC 2Y2IA 2Y2LA 3LELB 1KX5C 4R8PA 3AZIB 3AFAB 2YFWA 3AZNB 1TZYD 2CV5C 5CPJC 2L5AA 1ID3B 3NQUA 3W97A 5B32G 3WA9C 3EPHA 5B0ZC 3AZHC 2ZY5A 1P3PB 3B0DB 3X1UA 3A6NA 1N1JA 3AZJC 3X1SA 5G49A 4CSRA 3W96B 3O62C 4Z2MH 3W98A 5B2IA 3WAAA 1P3BB 3UTBB 1KX4A 3MNNB 4YS3C 2CWEA 3X1TA 1F66B 5B24D 4G92C 2Y2QA 5AV8D 5CPKD 3MGSD 4XUJB 4H9SA 3MGPB 5DNNB 1TZYC 3LJAA 3NQJA 2Y2NA 3KUYD 1KU5A 1HQ3D 4XZQC 3UT9B 1P3ID 2F8NA 3R45B 2PYOA 4UUZB 4J8WD 1P3OA 1U35A 3TU4D 1P34A 5B33D 3AZFD 3MGRB 2BYKB 5B0YB 4Z5TB 4WU9D 1PZRA 5B40B 5B32B 3AZLB 4NE5A 4ZUXD 4M6BA 5GXQA 1Z2CB 3B0DC 3W99C 5GT0A 3MGQD 4H9QA 1AOIB 3C1BA 5B31A 1P3KB 5B1MA 5CPKC 3MGSC 2NQBA 2F8NG 4DRBA 4R8PB 4UPKA 1EQZA 2YFWB 3KXBD 3AZMD 5AY8A 3NQUB 3B6FB 3W97B 3KUYC 3IP4C 4QLCA 1HQ3C 2F2AC 3KSYA 1P3GD 4JJND 1P3AB 3TU4C 5B33C 3AYWA 1KX5A 3AZFC 5E5AA 2HIOD 4WU9C 3AZGD 3X1UB 3A6NB 2DQNC 1N1JB 5CPID 2CV5A 5BNXA 5AVCD 3X1SB 1A7WA 5G49B 4CSRB 5CPJA 3W98B 4X23D 5B2IB 3WAAB 3WTPC 1KX4B 1P3FD 3AV1D 5AV5D 3X1TB 4HGAC 3AZHA 3VH5W 5AV9D 3AZJA 3O62A 4WNNA 3WKJB 4AWLC 2XD1A 3KXBC 3LJAB 3AZMC 3NQJB 3B0CW 5GT3D 4YS3A 4KGCA 4J8XD 2F8NH 4KUDC 3H0MC 1P3GC 2F8NB 2DF4C 2UWXA 4JJNC 3REKD 1KX3D 2PYOB 1P3OB 2RVQD 1P34B 5F99C 2HIOC 4J8VC 3AZGC 5CPIC 3REHD 3WA9D 1TZYA 5AVCC 4X23C 5B0ZD 2FJ7D 1M18A 5GXQB 3V9RA 3LZ1C 1P3MB 1P3FC 5JRGC 3VH6T 3RELD 4G91C 5AV5C 2VQRA 3AZND 5GT0B 4H9QB 3C1BB 5BS7C 5B1MB 2NZDC 2NQBB 2YFVA 5CP6A 4YM6C 2AROD 1P3PD 1EQZB 5GT3C 5AVBD 5AY8B 4J8XC 5B24A 4QLCB 3REKC 5AV8A 1KX3C 1P3LD 3MGSA 2RVQC 1P3BD 3P5JB 3UTBD 3AYWB 1KX5B 5E5AB 5B1LD 4XZQD 3EPJA 3REHC 4H9PA 4H9RB 2CV5B 5BNXB 2HUEC 5CPJB 2FJ7C 4WU8C 3KUYA 1HQ3A 1P3IA 3AV2D 3RELC 2ZM5A 5B2JA 4J8WA 3AFAC 3AZNC 3TU4A 5B33A 3AZHB 3VH5A 4LD9D 3AZJB 3W99D 4ZUXA 4WNNB 3LZ0A 3F6TA 4KHAB 3A1IA 2AROC 1P3PC 2Y2PA 5AVBC 5AV6D 3MGRD 4YS3B 3MGQA 4KGCB 3X1VA 1S32B 1P3LC 4J8UD 3AL0C 1P3BC 3UTBC 4Z66A 2G5IC 2JCHA 1WWIA 1M19B 5B1LC 5DNMD 1ZLAD 3AZMA 1TZYB 5C3IB 2Y2GA 1M18B 3AV2C 3V9RB 1P3GA 4JJNA 4R8PD 3REID 2HIOA 2ZY2A 3B6FD 3AZGA 3WTPD 4LD9C 5CPIA 4CAYA 3UT9C 1M1AB 5AVCA 2YFVB 4X23A 1P3AD 4NE3A 5CP6B 5AV6C 3MGRC 3AV1A 1P3FA 5AV5A 1JFIA 1TAFA 5B24B 5B32C 4J8UC 4ZBJC 5AV8B 5GSUD 5AV9A 3MGSB 3REJD 4KUDD 5DNMC 1ZLAC 1P3KC 3MVDA 4H9PB 1F1EA 5GT3A 2LY8A 3AZED 4J8XA 3KUYB 5F99D 1W2EA 4WV4B 4J8VD 1HQ3B 4EO5C 1P3IB 3WKJD 3EG5B 3REKA 4R8PC 4WZSB 5B2JB 1BFMA 4J8WB 3REIC 4WJ3C 5B31G 3TU4B 5B33B 3AN2D 3B6FC 3LZ1D 5JRGD 3REHA 3WA9A 2Y2MA 2F8ND 1P3AC 5B0ZA 2FJ7A 4ZUXB 3LZ0B 3KWQD 3RELA 3X1UC 2NZDD 3MGQB 3B6GD 4HGAB 3X1VB 5GSUC 4YM6D 4NFTA 1P3MD 4Z66B 3REJC 3AZKD 3UTAD 2AROA 1P3PA 1ULYA 3C1BD 5AVBA 3WTPE 3C1CD 3VH6W 3AZMB 2JE5A 3AZEC 1U35B 2F8NK 3WKJC 1R4VA 1P3LA 4JJNB 3AN2C 4WU8D 2HIOB 3LELD 5B1LA 4XZQA 3AZGB 5CPIB 4CAYB 3AZID 5AVCB 3AFAD 1ID3D 3KWQC 5B31B 1P34C 3AV2A 1P3FB 3AV1B 2ZY3A 4G91B 5AV5B 3B6GC 1TAFB 1T3UA 5AV9B 1P3MC 4LD9A 3W99A 3AZKC 3W96D 2IO5C 5GT0C 3UTAC 3C1BC 3C1CC 5AV6A 3MVDB 2BYMA 3MGRA 5CPKA 5GT3B 5B1MC 5FUGA 3MNND 3A1KA 1F66D 4J8UA 5AY8C 1H3OA 3LELC 4XUJD 5DNMA 1ZLAA 3MGPD 4QLCC 2ZY4A 3REHB 3AZIC 1S32D 3WA9B 5DNND 1ID3C 5B0ZB 2FJ7B 3AZFA 3FDDA 5CHLB 5E5AC 4WU9A 1M19D 3RELB 2Y2KA 3UT9D 3REIA 2G5HC 2RIQA 4E44A 3O62B 3B6FA 3WTPA 1M18D 2Y2HA 5B0YD 4Z5TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 D;  1P3A A;  3W96 C;  5BO0 A;  4G92 B;  5B32 D;  3AZL D;  5BNV A;  2ARO B;  5BT1 D;  5AVB B;  3MNN C;  3VH6 A;  1M1A D;  1F66 C;  1HTA A;  5GSU A;  1AOI D;  5CP6 D;  1P3K D;  3KXB A;  1P3L B;  3REJ A;  4XUJ C;  4KUD A;  3MGP C;  4KGC C;  5B1L B;  4H9N A;  4XZQ B;  1S32 C;  5DNN C;  3AZE A;  5JA4 A;  5F99 A;  3W97 D;  4J8V A;  3AV2 B;  1M19 C;  3WKJ A;  5KDM A;  5C3I C;  3AN2 A;  3LZ1 A;  1M18 C;  5B0Y C;  5JRG A;  4Z5T C;  4LD9 B;  3X1U D;  3A6N D;  5B40 C;  3W99 B;  5B2J D;  4NE6 A;  3AZL C;  3X1S D;  3KWQ A;  3B0B A;  3W98 D;  5BT1 C;  5B2I D;  5BS7 A;  5AV6 B;  5CPK B;  2BYM B;  3WAA D;  2NZD A;  1KX4 D;  5FUG B;  4H9O A;  1M1A C;  3B6G A;  3X1T D;  1AOI C;  1BH8 A;  5CP6 C;  4YM6 A;  4J8U B;  3LZ0 D;  4ZBJ B;  1P3M A;  1H3O B;  3AZK A;  5B24 C;  5DNM B;  3UTA A;  1ZLA B;  1KX3 A;  3C1C A;  3X1V D;  5AV8 C;  3LJA D;  3W97 C;  4Z66 D;  3AZF B;  4WU9 B;  4EO5 B;  1BH9 A;  2PYO D;  3REI B;  4WU8 A;  1P3O D;  3LEL A;  1U35 D;  1P34 D;  3WTP B;  3A6N C;  1P3I C;  3AZI A;  3AFA A;  5B2J C;  3AZN A;  4J8W C;  3X1S C;  5BO0 B;  1ID3 A;  1WWS A;  3W98 C;  5BNV B;  5B2I C;  3WAA C;  5GXQ D;  1B6W A;  1KX4 C;  4H9R A;  3X1T C;  4ZUX C;  5GT0 D;  3LZ0 C;  5GSU B;  4AWL B;  5B31 D;  3KXB B;  5B1M D;  3REJ B;  2NQB D;  3W96 A;  4KUD B;  4H9S C;  3MGQ C;  1P3G B;  4H9N B;  3X1V C;  1P3B A;  3UTB A;  3LJA C;  3MNN A;  3AZE B;  5JA4 B;  4Z66 C;  1EQZ D;  5AY8 D;  5F99 B;  4E45 A;  1F66 A;  4J8V B;  4QLC D;  4KHA A;  2PYO C;  5KDM B;  3MVD D;  1P3O C;  4X23 B;  3AN2 B;  1U35 C;  4XUJ A;  3AYW D;  3MGP A;  3VH5 T;  3LZ1 B;  1Q9C A;  5E5A D;  1KX5 D;  5JRG B;  1S32 A;  5DNN A;  1JFI B;  1B67 A;  2CV5 D;  5CPJ D;  3KWQ B;  5GXQ C;  1M19 A;  2NZD B;  3UT9 A;  3R45 A;  3B0C T;  4UUZ A;  4H9O B;  3B6G B;  4Z2M G;  1BH8 B;  4YM6 B;  3AZH D;  5B31 C;  2BYK A;  5B0Y A;  4Z5T A;  5B40 A;  3AV1 C;  2NQB C;  4J8X B;  3AZJ D;  5B32 A;  3AZK B;  3AZL A;  2IO5 B;  3O62 D;  3UTA B;  3REK B;  4DRA A;  1KX3 B;  3C1C B;  5AV9 C;  1EQZ C;  1M1A A;  4YS3 D;  1AOI A;  4KGC D;  1P3K A;  1BH9 B;  2JSS A;  3MVD C;  2HUE B;  4WU8 B;  3AYW C;  3LEL B;  1KX5 C;  4R8P A;  3AZI B;  3AFA B;  2YFW A;  3AZN B;  1TZY D;  2CV5 C;  5CPJ C;  2L5A A;  1ID3 B;  3NQU A;  3W97 A;  5B32 G;  3WA9 C;  5B0Z C;  3AZH C;  1P3P B;  3B0D B;  3X1U A;  3A6N A;  1N1J A;  3AZJ C;  3X1S A;  5G49 A;  4CSR A;  3W96 B;  3O62 C;  4Z2M H;  3W98 A;  5B2I A;  3WAA A;  1P3B B;  3UTB B;  1KX4 A;  3MNN B;  4YS3 C;  2CWE A;  3X1T A;  1F66 B;  5B24 D;  4G92 C;  5AV8 D;  5CPK D;  3MGS D;  4XUJ B;  4H9S A;  3MGP B;  5DNN B;  1TZY C;  3LJA A;  3NQJ A;  3KUY D;  1KU5 A;  1HQ3 D;  4XZQ C;  3UT9 B;  1P3I D;  2F8N A;  3R45 B;  2PYO A;  4UUZ B;  4J8W D;  1P3O A;  1U35 A;  3TU4 D;  1P34 A;  5B33 D;  3AZF D;  3MGR B;  2BYK B;  5B0Y B;  4Z5T B;  4WU9 D;  5B40 B;  5B32 B;  3AZL B;  4NE5 A;  4ZUX D;  4M6B A;  5GXQ A;  3B0D C;  3W99 C;  5GT0 A;  3MGQ D;  4H9Q A;  1AOI B;  3C1B A;  5B31 A;  1P3K B;  5B1M A;  5CPK C;  3MGS C;  2NQB A;  2F8N G;  4DRB A;  4R8P B;  1EQZ A;  2YFW B;  3KXB D;  3AZM D;  5AY8 A;  3NQU B;  3B6F B;  3W97 B;  3KUY C;  4QLC A;  1HQ3 C;  3KSY A;  1P3G D;  4JJN D;  1P3A B;  3TU4 C;  5B33 C;  3AYW A;  1KX5 A;  3AZF C;  5E5A A;  2HIO D;  4WU9 C;  3AZG D;  3X1U B;  3A6N B;  1N1J B;  5CPI D;  2CV5 A;  5BNX A;  5AVC D;  3X1S B;  1A7W A;  5G49 B;  4CSR B;  5CPJ A;  3W98 B;  4X23 D;  5B2I B;  3WAA B;  3WTP C;  1KX4 B;  1P3F D;  3AV1 D;  5AV5 D;  3X1T B;  4HGA C;  3AZH A;  3VH5 W;  5AV9 D;  3AZJ A;  3O62 A;  4WNN A;  3WKJ B;  4AWL C;  3AZM C;  3KXB C;  3LJA B;  3NQJ B;  3B0C W;  5GT3 D;  4YS3 A;  4KGC A;  4J8X D;  2F8N H;  4KUD C;  1P3G C;  2F8N B;  4JJN C;  2PYO B;  3REK D;  1KX3 D;  1P3O B;  2RVQ D;  1P34 B;  5F99 C;  2HIO C;  4J8V C;  3AZG C;  5CPI C;  3REH D;  3WA9 D;  1TZY A;  5AVC C;  4X23 C;  5B0Z D;  2FJ7 D;  1M18 A;  5GXQ B;  3V9R A;  3LZ1 C;  1P3M B;  1P3F C;  5JRG C;  3VH6 T;  3REL D;  4G91 C;  5AV5 C;  3AZN D;  5GT0 B;  4H9Q B;  3C1B B;  5BS7 C;  5B1M B;  2NZD C;  2NQB B;  2YFV A;  5CP6 A;  4YM6 C;  2ARO D;  1P3P D;  1EQZ B;  5GT3 C;  5AVB D;  5AY8 B;  4J8X C;  5B24 A;  4QLC B;  3REK C;  5AV8 A;  1KX3 C;  1P3L D;  3MGS A;  2RVQ C;  1P3B D;  3UTB D;  3AYW B;  1KX5 B;  5E5A B;  5B1L D;  4XZQ D;  3REH C;  4H9P A;  4H9R B;  2CV5 B;  5BNX B;  2HUE C;  5CPJ B;  2FJ7 C;  4WU8 C;  3KUY A;  1HQ3 A;  1P3I A;  3AV2 D;  3REL C;  5B2J A;  4J8W A;  3AFA C;  3AZN C;  3TU4 A;  5B33 A;  3AZH B;  3VH5 A;  4LD9 D;  3AZJ B;  3W99 D;  4ZUX A;  4WNN B;  3LZ0 A;  4KHA B;  2ARO C;  1P3P C;  5AVB C;  5AV6 D;  3MGR D;  4YS3 B;  3MGQ A;  4KGC B;  3X1V A;  1S32 B;  1P3L C;  4J8U D;  1P3B C;  3UTB C;  4Z66 A;  1WWI A;  1M19 B;  5B1L C;  5DNM D;  1ZLA D;  3AZM A;  1TZY B;  5C3I B;  1M18 B;  3AV2 C;  3V9R B;  1P3G A;  4JJN A;  4R8P D;  3REI D;  2HIO A;  3B6F D;  3AZG A;  3WTP D;  4LD9 C;  5CPI A;  4CAY A;  3UT9 C;  1M1A B;  5AVC A;  2YFV B;  4X23 A;  1P3A D;  4NE3 A;  5CP6 B;  5AV6 C;  3MGR C;  3AV1 A;  1P3F A;  5AV5 A;  1JFI A;  1TAF A;  5B24 B;  5B32 C;  4J8U C;  4ZBJ C;  5AV8 B;  5GSU D;  5AV9 A;  3MGS B;  3REJ D;  4KUD D;  5DNM C;  1ZLA C;  1P3K C;  3MVD A;  4H9P B;  1F1E A;  5GT3 A;  2LY8 A;  3AZE D;  4J8X A;  3KUY B;  5F99 D;  4WV4 B;  4J8V D;  1HQ3 B;  4EO5 C;  1P3I B;  3WKJ D;  3REK A;  1BFM A;  4R8P C;  4WZS B;  5B2J B;  4J8W B;  3REI C;  5B31 G;  3TU4 B;  5B33 B;  3AN2 D;  3B6F C;  3LZ1 D;  5JRG D;  3REH A;  3WA9 A;  2F8N D;  1P3A C;  5B0Z A;  2FJ7 A;  4ZUX B;  3LZ0 B;  3KWQ D;  3REL A;  3X1U C;  2NZD D;  3MGQ B;  3B6G D;  4HGA B;  3X1V B;  5GSU C;  4YM6 D;  4NFT A;  1P3M D;  4Z66 B;  3REJ C;  3AZK D;  3UTA D;  2ARO A;  1P3P A;  1ULY A;  3C1B D;  5AVB A;  3WTP E;  3C1C D;  3VH6 W;  3AZM B;  3AZE C;  1U35 B;  2F8N K;  3WKJ C;  1R4V A;  1P3L A;  4JJN B;  3AN2 C;  4WU8 D;  2HIO B;  3LEL D;  5B1L A;  4XZQ A;  3AZG B;  5CPI B;  4CAY B;  3AZI D;  5AVC B;  3AFA D;  1ID3 D;  3KWQ C;  5B31 B;  1P34 C;  3AV2 A;  1P3F B;  3AV1 B;  4G91 B;  5AV5 B;  3B6G C;  1TAF B;  5AV9 B;  1P3M C;  4LD9 A;  3W99 A;  3AZK C;  3W96 D;  2IO5 C;  5GT0 C;  3UTA C;  3C1B C;  3C1C C;  5AV6 A;  3MVD B;  2BYM A;  3MGR A;  5CPK A;  5GT3 B;  5B1M C;  5FUG A;  3MNN D;  1F66 D;  4J8U A;  5AY8 C;  1H3O A;  3LEL C;  4XUJ D;  5DNM A;  1ZLA A;  3MGP D;  4QLC C;  3REH B;  1S32 D;  3AZI C;  3WA9 B;  5DNN D;  1ID3 C;  5B0Z B;  2FJ7 B;  3AZF A;  5CHL B;  5E5A C;  4WU9 A;  1M19 D;  3REL B;  3UT9 D;  3REI A;  3O62 B;  4E44 A;  3B6F A;  3WTP A;  1M18 D;  5B0Y D;  4Z5T D; 
#chains in the Genus database with same CATH topology
 5B40 D;  1P3A A;  3W96 C;  5BO0 A;  4G92 B;  5B32 D;  3AZL D;  5BNV A;  2Y2J A;  2ARO B;  5BT1 D;  5AVB B;  3MNN C;  3VH6 A;  2W8S A;  1M1A D;  1F66 C;  1HTA A;  5GSU A;  1AOI D;  5CP6 D;  1P3K D;  3KXB A;  1P3L B;  3REJ A;  4XUJ C;  4KUD A;  3MGP C;  4KGC C;  5B1L B;  4H9N A;  4XZQ B;  1S32 C;  2XD5 A;  5DNN C;  3EPL A;  3AZE A;  5JA4 A;  5F99 A;  3W97 D;  4J8V A;  3AV2 B;  1M19 C;  3WKJ A;  5KDM A;  5C3I C;  3AN2 A;  3LZ1 A;  1M18 C;  5B0Y C;  5JRG A;  4Z5T C;  4LD9 B;  3X1U D;  3A6N D;  5B40 C;  3W99 B;  5B2J D;  4NE6 A;  3AZL C;  3X1S D;  3KWQ A;  3B0B A;  3W98 D;  5BT1 C;  5B2I D;  5BS7 A;  5AV6 B;  5CPK B;  2BYM B;  3WAA D;  2NZD A;  1KX4 D;  2J8P A;  5FUG B;  4H9O A;  1M1A C;  3B6G A;  3X1T D;  1AOI C;  1BH8 A;  5CP6 C;  4YM6 A;  4J8U B;  3LZ0 D;  4ZBJ B;  1P3M A;  3KFU G;  1H3O B;  3AZK A;  5B24 C;  5DNM B;  3UTA A;  1ZLA B;  1KX3 A;  3C1C A;  3X1V D;  5AV8 C;  3LJA D;  3W97 C;  4Z66 D;  3AZF B;  4WU9 B;  4DQY B;  4EO5 B;  1BH9 A;  2PYO D;  3REI B;  4WU8 A;  1P3O D;  3LEL A;  1U35 D;  1P34 D;  3WTP B;  3A6N C;  1P3I C;  3AZI A;  3AFA A;  5B2J C;  3AZN A;  4J8W C;  3X1S C;  5BO0 B;  1ID3 A;  1WWS A;  3W98 C;  5BNV B;  5B2I C;  3WAA C;  5GXQ D;  1B6W A;  1KX4 C;  4H9R A;  3X1T C;  4ZUX C;  2Y2O A;  5GT0 D;  3LZ0 C;  5GSU B;  4AWL B;  5B31 D;  3KXB B;  5B1M D;  3REJ B;  2NQB D;  3W96 A;  4KUD B;  4H9S C;  3MGQ C;  1P3G B;  4H9N B;  3X1V C;  1P3B A;  2FFF B;  3UTB A;  3LJA C;  3MNN A;  3AZE B;  5JA4 B;  4Z66 C;  1EQZ D;  5AY8 D;  5F99 B;  4E45 A;  1F66 A;  2BG1 A;  4J8V B;  4QLC D;  4KHA A;  3H0L C;  2PYO C;  5KDM B;  3MVD D;  1P3O C;  4X23 B;  3AN2 B;  1U35 C;  4XUJ A;  3AYW D;  3MGP A;  3VH5 T;  3LZ1 B;  1Q9C A;  5E5A D;  1KX5 D;  5JRG B;  1S32 A;  5DNN A;  1JFI B;  1B67 A;  2CV5 D;  5CPJ D;  3KWQ B;  5GXQ C;  1M19 A;  2NZD B;  3UT9 A;  3R45 A;  3B0C T;  4UUZ A;  4H9O B;  3B6G B;  4Z2M G;  1BH8 B;  4YM6 B;  3AZH D;  5B31 C;  2BYK A;  5B0Y A;  4Z5T A;  5B40 A;  3AV1 C;  2NQB C;  4J8X B;  3AZJ D;  3H0R C;  5B32 A;  3AZK B;  3AZL A;  2IO5 B;  3O62 D;  3UTA B;  3REK B;  4DRA A;  1KX3 B;  3C1C B;  5AV9 C;  1EQZ C;  3EPK A;  1M1A A;  4YS3 D;  1AOI A;  4KGC D;  1P3K A;  1BH9 B;  2JSS A;  3MVD C;  2HUE B;  4WU8 B;  3AYW C;  2Y2I A;  2Y2L A;  3LEL B;  1KX5 C;  4R8P A;  3AZI B;  3AFA B;  2YFW A;  3AZN B;  1TZY D;  2CV5 C;  5CPJ C;  2L5A A;  1ID3 B;  3NQU A;  3W97 A;  5B32 G;  3WA9 C;  3EPH A;  5B0Z C;  3AZH C;  2ZY5 A;  1P3P B;  3B0D B;  3X1U A;  3A6N A;  1N1J A;  3AZJ C;  3X1S A;  5G49 A;  4CSR A;  3W96 B;  3O62 C;  4Z2M H;  3W98 A;  5B2I A;  3WAA A;  1P3B B;  3UTB B;  1KX4 A;  3MNN B;  4YS3 C;  2CWE A;  3X1T A;  1F66 B;  5B24 D;  4G92 C;  2Y2Q A;  5AV8 D;  5CPK D;  3MGS D;  4XUJ B;  4H9S A;  3MGP B;  5DNN B;  1TZY C;  3LJA A;  3NQJ A;  2Y2N A;  3KUY D;  1KU5 A;  1HQ3 D;  4XZQ C;  3UT9 B;  1P3I D;  2F8N A;  3R45 B;  2PYO A;  4UUZ B;  4J8W D;  1P3O A;  1U35 A;  3TU4 D;  1P34 A;  5B33 D;  3AZF D;  3MGR B;  2BYK B;  5B0Y B;  4Z5T B;  4WU9 D;  1PZR A;  5B40 B;  5B32 B;  3AZL B;  4NE5 A;  4ZUX D;  4M6B A;  5GXQ A;  1Z2C B;  3B0D C;  3W99 C;  5GT0 A;  3MGQ D;  4H9Q A;  1AOI B;  3C1B A;  5B31 A;  1P3K B;  5B1M A;  5CPK C;  3MGS C;  2NQB A;  2F8N G;  4DRB A;  4R8P B;  4UPK A;  1EQZ A;  2YFW B;  3KXB D;  3AZM D;  5AY8 A;  3NQU B;  3B6F B;  3W97 B;  3KUY C;  3IP4 C;  4QLC A;  1HQ3 C;  2F2A C;  3KSY A;  1P3G D;  4JJN D;  1P3A B;  3TU4 C;  5B33 C;  3AYW A;  1KX5 A;  3AZF C;  5E5A A;  2HIO D;  4WU9 C;  3AZG D;  3X1U B;  3A6N B;  2DQN C;  1N1J B;  5CPI D;  2CV5 A;  5BNX A;  5AVC D;  3X1S B;  1A7W A;  5G49 B;  4CSR B;  5CPJ A;  3W98 B;  4X23 D;  5B2I B;  3WAA B;  3WTP C;  1KX4 B;  1P3F D;  3AV1 D;  5AV5 D;  3X1T B;  4HGA C;  3AZH A;  3VH5 W;  5AV9 D;  3AZJ A;  3O62 A;  4WNN A;  3WKJ B;  4AWL C;  2XD1 A;  3KXB C;  3LJA B;  3AZM C;  3NQJ B;  3B0C W;  5GT3 D;  4YS3 A;  4KGC A;  4J8X D;  2F8N H;  4KUD C;  3H0M C;  1P3G C;  2F8N B;  2DF4 C;  2UWX A;  4JJN C;  3REK D;  1KX3 D;  2PYO B;  1P3O B;  2RVQ D;  1P34 B;  5F99 C;  2HIO C;  4J8V C;  3AZG C;  5CPI C;  3REH D;  3WA9 D;  1TZY A;  5AVC C;  4X23 C;  5B0Z D;  2FJ7 D;  1M18 A;  5GXQ B;  3V9R A;  3LZ1 C;  1P3M B;  1P3F C;  5JRG C;  3VH6 T;  3REL D;  4G91 C;  5AV5 C;  2VQR A;  3AZN D;  5GT0 B;  4H9Q B;  3C1B B;  5BS7 C;  5B1M B;  2NZD C;  2NQB B;  2YFV A;  5CP6 A;  4YM6 C;  2ARO D;  1P3P D;  1EQZ B;  5GT3 C;  5AVB D;  5AY8 B;  4J8X C;  5B24 A;  4QLC B;  3REK C;  5AV8 A;  1KX3 C;  1P3L D;  3MGS A;  2RVQ C;  1P3B D;  3P5J B;  3UTB D;  3AYW B;  1KX5 B;  5E5A B;  5B1L D;  4XZQ D;  3EPJ A;  3REH C;  4H9P A;  4H9R B;  2CV5 B;  5BNX B;  2HUE C;  5CPJ B;  2FJ7 C;  4WU8 C;  3KUY A;  1HQ3 A;  1P3I A;  3AV2 D;  3REL C;  2ZM5 A;  5B2J A;  4J8W A;  3AFA C;  3AZN C;  3TU4 A;  5B33 A;  3AZH B;  3VH5 A;  4LD9 D;  3AZJ B;  3W99 D;  4ZUX A;  4WNN B;  3LZ0 A;  3F6T A;  4KHA B;  3A1I A;  2ARO C;  1P3P C;  2Y2P A;  5AVB C;  5AV6 D;  3MGR D;  4YS3 B;  3MGQ A;  4KGC B;  3X1V A;  1S32 B;  1P3L C;  4J8U D;  3AL0 C;  1P3B C;  3UTB C;  4Z66 A;  2G5I C;  2JCH A;  1WWI A;  1M19 B;  5B1L C;  5DNM D;  1ZLA D;  3AZM A;  1TZY B;  5C3I B;  2Y2G A;  1M18 B;  3AV2 C;  3V9R B;  1P3G A;  4JJN A;  4R8P D;  3REI D;  2HIO A;  2ZY2 A;  3B6F D;  3AZG A;  3WTP D;  4LD9 C;  5CPI A;  4CAY A;  3UT9 C;  1M1A B;  5AVC A;  2YFV B;  4X23 A;  1P3A D;  4NE3 A;  5CP6 B;  5AV6 C;  3MGR C;  3AV1 A;  1P3F A;  5AV5 A;  1JFI A;  1TAF A;  5B24 B;  5B32 C;  4J8U C;  4ZBJ C;  5AV8 B;  5GSU D;  5AV9 A;  3MGS B;  3REJ D;  4KUD D;  5DNM C;  1ZLA C;  1P3K C;  3MVD A;  4H9P B;  1F1E A;  5GT3 A;  2LY8 A;  3AZE D;  4J8X A;  3KUY B;  5F99 D;  1W2E A;  4WV4 B;  4J8V D;  1HQ3 B;  4EO5 C;  1P3I B;  3WKJ D;  3EG5 B;  3REK A;  4R8P C;  4WZS B;  5B2J B;  1BFM A;  4J8W B;  3REI C;  4WJ3 C;  5B31 G;  3TU4 B;  5B33 B;  3AN2 D;  3B6F C;  3LZ1 D;  5JRG D;  3REH A;  3WA9 A;  2Y2M A;  2F8N D;  1P3A C;  5B0Z A;  2FJ7 A;  4ZUX B;  3LZ0 B;  3KWQ D;  3REL A;  3X1U C;  2NZD D;  3MGQ B;  3B6G D;  4HGA B;  3X1V B;  5GSU C;  4YM6 D;  4NFT A;  1P3M D;  4Z66 B;  3REJ C;  3AZK D;  3UTA D;  2ARO A;  1P3P A;  1ULY A;  3C1B D;  5AVB A;  3WTP E;  3C1C D;  3VH6 W;  3AZM B;  2JE5 A;  3AZE C;  1U35 B;  2F8N K;  3WKJ C;  1R4V A;  1P3L A;  4JJN B;  3AN2 C;  4WU8 D;  2HIO B;  3LEL D;  5B1L A;  4XZQ A;  3AZG B;  5CPI B;  4CAY B;  3AZI D;  5AVC B;  3AFA D;  1ID3 D;  3KWQ C;  5B31 B;  1P34 C;  3AV2 A;  1P3F B;  3AV1 B;  2ZY3 A;  4G91 B;  5AV5 B;  3B6G C;  1TAF B;  1T3U A;  5AV9 B;  1P3M C;  4LD9 A;  3W99 A;  3AZK C;  3W96 D;  2IO5 C;  5GT0 C;  3UTA C;  3C1B C;  3C1C C;  5AV6 A;  3MVD B;  2BYM A;  3MGR A;  5CPK A;  5GT3 B;  5B1M C;  5FUG A;  3MNN D;  3A1K A;  1F66 D;  4J8U A;  5AY8 C;  1H3O A;  3LEL C;  4XUJ D;  5DNM A;  1ZLA A;  3MGP D;  4QLC C;  2ZY4 A;  3REH B;  3AZI C;  1S32 D;  3WA9 B;  5DNN D;  1ID3 C;  5B0Z B;  2FJ7 B;  3AZF A;  3FDD A;  5CHL B;  5E5A C;  4WU9 A;  1M19 D;  3REL B;  2Y2K A;  3UT9 D;  3REI A;  2G5H C;  2RIQ A;  4E44 A;  3O62 B;  3B6F A;  3WTP A;  1M18 D;  2Y2H A;  5B0Y D;  4Z5T D; 
#chains in the Genus database with same CATH homology
 5B40 D;  1P3A A;  3W96 C;  5BO0 A;  4G92 B;  5B32 D;  3AZL D;  5BNV A;  2Y2J A;  2ARO B;  5BT1 D;  5AVB B;  3MNN C;  3VH6 A;  2W8S A;  1M1A D;  1F66 C;  1HTA A;  5GSU A;  1AOI D;  5CP6 D;  1P3K D;  3KXB A;  1P3L B;  3REJ A;  4XUJ C;  4KUD A;  3MGP C;  4KGC C;  5B1L B;  4H9N A;  4XZQ B;  1S32 C;  2XD5 A;  5DNN C;  3EPL A;  3AZE A;  5JA4 A;  5F99 A;  3W97 D;  4J8V A;  3AV2 B;  1M19 C;  3WKJ A;  5KDM A;  5C3I C;  3AN2 A;  3LZ1 A;  1M18 C;  5B0Y C;  5JRG A;  4Z5T C;  4LD9 B;  3X1U D;  3A6N D;  5B40 C;  3W99 B;  5B2J D;  4NE6 A;  3AZL C;  3X1S D;  3KWQ A;  3B0B A;  3W98 D;  5BT1 C;  5B2I D;  5BS7 A;  5AV6 B;  5CPK B;  2BYM B;  3WAA D;  2NZD A;  1KX4 D;  2J8P A;  5FUG B;  4H9O A;  1M1A C;  3B6G A;  3X1T D;  1AOI C;  1BH8 A;  5CP6 C;  4YM6 A;  4J8U B;  3LZ0 D;  4ZBJ B;  1P3M A;  3KFU G;  1H3O B;  3AZK A;  5B24 C;  5DNM B;  3UTA A;  1ZLA B;  1KX3 A;  3C1C A;  3X1V D;  5AV8 C;  3LJA D;  3W97 C;  4Z66 D;  3AZF B;  4WU9 B;  4DQY B;  4EO5 B;  1BH9 A;  2PYO D;  3REI B;  4WU8 A;  1P3O D;  3LEL A;  1U35 D;  1P34 D;  3WTP B;  3A6N C;  1P3I C;  3AZI A;  3AFA A;  5B2J C;  3AZN A;  4J8W C;  3X1S C;  5BO0 B;  1ID3 A;  1WWS A;  3W98 C;  5BNV B;  5B2I C;  3WAA C;  5GXQ D;  1B6W A;  1KX4 C;  4H9R A;  3X1T C;  4ZUX C;  2Y2O A;  5GT0 D;  3LZ0 C;  5GSU B;  4AWL B;  5B31 D;  3KXB B;  5B1M D;  3REJ B;  2NQB D;  3W96 A;  4KUD B;  4H9S C;  3MGQ C;  1P3G B;  4H9N B;  3X1V C;  1P3B A;  2FFF B;  3UTB A;  3LJA C;  3MNN A;  3AZE B;  5JA4 B;  4Z66 C;  1EQZ D;  5AY8 D;  5F99 B;  4E45 A;  1F66 A;  2BG1 A;  4J8V B;  4QLC D;  4KHA A;  3H0L C;  2PYO C;  5KDM B;  3MVD D;  1P3O C;  4X23 B;  3AN2 B;  1U35 C;  4XUJ A;  3AYW D;  3MGP A;  3VH5 T;  3LZ1 B;  1Q9C A;  5E5A D;  1KX5 D;  5JRG B;  1S32 A;  5DNN A;  1JFI B;  1B67 A;  2CV5 D;  5CPJ D;  3KWQ B;  5GXQ C;  1M19 A;  2NZD B;  3UT9 A;  3R45 A;  3B0C T;  4UUZ A;  4H9O B;  3B6G B;  4Z2M G;  1BH8 B;  4YM6 B;  3AZH D;  5B31 C;  2BYK A;  5B0Y A;  4Z5T A;  5B40 A;  3AV1 C;  2NQB C;  4J8X B;  3AZJ D;  3H0R C;  5B32 A;  3AZK B;  3AZL A;  2IO5 B;  3O62 D;  3UTA B;  3REK B;  4DRA A;  1KX3 B;  3C1C B;  5AV9 C;  1EQZ C;  3EPK A;  1M1A A;  4YS3 D;  1AOI A;  4KGC D;  1P3K A;  1BH9 B;  2JSS A;  3MVD C;  2HUE B;  4WU8 B;  3AYW C;  2Y2I A;  2Y2L A;  3LEL B;  1KX5 C;  4R8P A;  3AZI B;  3AFA B;  2YFW A;  3AZN B;  1TZY D;  2CV5 C;  5CPJ C;  2L5A A;  1ID3 B;  3NQU A;  3W97 A;  5B32 G;  3WA9 C;  3EPH A;  5B0Z C;  3AZH C;  2ZY5 A;  1P3P B;  3B0D B;  3X1U A;  3A6N A;  1N1J A;  3AZJ C;  3X1S A;  5G49 A;  4CSR A;  3W96 B;  3O62 C;  4Z2M H;  3W98 A;  5B2I A;  3WAA A;  1P3B B;  3UTB B;  1KX4 A;  3MNN B;  4YS3 C;  2CWE A;  3X1T A;  1F66 B;  5B24 D;  4G92 C;  2Y2Q A;  5AV8 D;  5CPK D;  3MGS D;  4XUJ B;  4H9S A;  3MGP B;  5DNN B;  1TZY C;  3LJA A;  3NQJ A;  2Y2N A;  3KUY D;  1KU5 A;  1HQ3 D;  4XZQ C;  3UT9 B;  1P3I D;  2F8N A;  3R45 B;  2PYO A;  4UUZ B;  4J8W D;  1P3O A;  1U35 A;  3TU4 D;  1P34 A;  5B33 D;  3AZF D;  3MGR B;  2BYK B;  5B0Y B;  4Z5T B;  4WU9 D;  1PZR A;  5B40 B;  5B32 B;  3AZL B;  4NE5 A;  4ZUX D;  4M6B A;  5GXQ A;  1Z2C B;  3B0D C;  3W99 C;  5GT0 A;  3MGQ D;  4H9Q A;  1AOI B;  3C1B A;  5B31 A;  1P3K B;  5B1M A;  5CPK C;  3MGS C;  2NQB A;  2F8N G;  4DRB A;  4R8P B;  4UPK A;  1EQZ A;  2YFW B;  3KXB D;  3AZM D;  5AY8 A;  3NQU B;  3B6F B;  3W97 B;  3KUY C;  3IP4 C;  4QLC A;  1HQ3 C;  2F2A C;  3KSY A;  1P3G D;  4JJN D;  1P3A B;  3TU4 C;  5B33 C;  3AYW A;  1KX5 A;  3AZF C;  5E5A A;  2HIO D;  4WU9 C;  3AZG D;  3X1U B;  3A6N B;  2DQN C;  1N1J B;  5CPI D;  2CV5 A;  5BNX A;  5AVC D;  3X1S B;  1A7W A;  5G49 B;  4CSR B;  5CPJ A;  3W98 B;  4X23 D;  5B2I B;  3WAA B;  3WTP C;  1KX4 B;  1P3F D;  3AV1 D;  5AV5 D;  3X1T B;  4HGA C;  3AZH A;  3VH5 W;  5AV9 D;  3AZJ A;  3O62 A;  4WNN A;  3WKJ B;  4AWL C;  2XD1 A;  3KXB C;  3LJA B;  3AZM C;  3NQJ B;  3B0C W;  5GT3 D;  4YS3 A;  4KGC A;  4J8X D;  2F8N H;  4KUD C;  3H0M C;  1P3G C;  2F8N B;  2DF4 C;  2UWX A;  4JJN C;  3REK D;  1KX3 D;  2PYO B;  1P3O B;  2RVQ D;  1P34 B;  5F99 C;  2HIO C;  4J8V C;  3AZG C;  5CPI C;  3REH D;  3WA9 D;  1TZY A;  5AVC C;  4X23 C;  5B0Z D;  2FJ7 D;  1M18 A;  5GXQ B;  3V9R A;  3LZ1 C;  1P3M B;  1P3F C;  5JRG C;  3VH6 T;  3REL D;  4G91 C;  5AV5 C;  2VQR A;  3AZN D;  5GT0 B;  4H9Q B;  3C1B B;  5BS7 C;  5B1M B;  2NZD C;  2NQB B;  2YFV A;  5CP6 A;  4YM6 C;  2ARO D;  1P3P D;  1EQZ B;  5GT3 C;  5AVB D;  5AY8 B;  4J8X C;  5B24 A;  4QLC B;  3REK C;  5AV8 A;  1KX3 C;  1P3L D;  3MGS A;  2RVQ C;  1P3B D;  3P5J B;  3UTB D;  3AYW B;  1KX5 B;  5E5A B;  5B1L D;  4XZQ D;  3EPJ A;  3REH C;  4H9P A;  4H9R B;  2CV5 B;  5BNX B;  2HUE C;  5CPJ B;  2FJ7 C;  4WU8 C;  3KUY A;  1HQ3 A;  1P3I A;  3AV2 D;  3REL C;  2ZM5 A;  5B2J A;  4J8W A;  3AFA C;  3AZN C;  3TU4 A;  5B33 A;  3AZH B;  3VH5 A;  4LD9 D;  3AZJ B;  3W99 D;  4ZUX A;  4WNN B;  3LZ0 A;  3F6T A;  4KHA B;  3A1I A;  2ARO C;  1P3P C;  2Y2P A;  5AVB C;  5AV6 D;  3MGR D;  4YS3 B;  3MGQ A;  4KGC B;  3X1V A;  1S32 B;  1P3L C;  4J8U D;  3AL0 C;  1P3B C;  3UTB C;  4Z66 A;  2G5I C;  2JCH A;  1WWI A;  1M19 B;  5B1L C;  5DNM D;  1ZLA D;  3AZM A;  1TZY B;  5C3I B;  2Y2G A;  1M18 B;  3AV2 C;  3V9R B;  1P3G A;  4JJN A;  4R8P D;  3REI D;  2HIO A;  2ZY2 A;  3B6F D;  3AZG A;  3WTP D;  4LD9 C;  5CPI A;  4CAY A;  3UT9 C;  1M1A B;  5AVC A;  2YFV B;  4X23 A;  1P3A D;  4NE3 A;  5CP6 B;  5AV6 C;  3MGR C;  3AV1 A;  1P3F A;  5AV5 A;  1JFI A;  1TAF A;  5B24 B;  5B32 C;  4J8U C;  4ZBJ C;  5AV8 B;  5GSU D;  5AV9 A;  3MGS B;  3REJ D;  4KUD D;  5DNM C;  1ZLA C;  1P3K C;  3MVD A;  4H9P B;  1F1E A;  5GT3 A;  2LY8 A;  3AZE D;  4J8X A;  3KUY B;  5F99 D;  1W2E A;  4WV4 B;  4J8V D;  1HQ3 B;  4EO5 C;  1P3I B;  3WKJ D;  3EG5 B;  3REK A;  4R8P C;  4WZS B;  5B2J B;  1BFM A;  4J8W B;  3REI C;  4WJ3 C;  5B31 G;  3TU4 B;  5B33 B;  3AN2 D;  3B6F C;  3LZ1 D;  5JRG D;  3REH A;  3WA9 A;  2Y2M A;  2F8N D;  1P3A C;  5B0Z A;  2FJ7 A;  4ZUX B;  3LZ0 B;  3KWQ D;  3REL A;  3X1U C;  2NZD D;  3MGQ B;  3B6G D;  4HGA B;  3X1V B;  5GSU C;  4YM6 D;  4NFT A;  1P3M D;  4Z66 B;  3REJ C;  3AZK D;  3UTA D;  2ARO A;  1P3P A;  1ULY A;  3C1B D;  5AVB A;  3WTP E;  3C1C D;  3VH6 W;  3AZM B;  2JE5 A;  3AZE C;  1U35 B;  2F8N K;  3WKJ C;  1R4V A;  1P3L A;  4JJN B;  3AN2 C;  4WU8 D;  2HIO B;  3LEL D;  5B1L A;  4XZQ A;  3AZG B;  5CPI B;  4CAY B;  3AZI D;  5AVC B;  3AFA D;  1ID3 D;  3KWQ C;  5B31 B;  1P34 C;  3AV2 A;  1P3F B;  3AV1 B;  2ZY3 A;  4G91 B;  5AV5 B;  3B6G C;  1TAF B;  1T3U A;  5AV9 B;  1P3M C;  4LD9 A;  3W99 A;  3AZK C;  3W96 D;  2IO5 C;  5GT0 C;  3UTA C;  3C1B C;  3C1C C;  5AV6 A;  3MVD B;  2BYM A;  3MGR A;  5CPK A;  5GT3 B;  5B1M C;  5FUG A;  3MNN D;  3A1K A;  1F66 D;  4J8U A;  5AY8 C;  1H3O A;  3LEL C;  4XUJ D;  5DNM A;  1ZLA A;  3MGP D;  4QLC C;  2ZY4 A;  3REH B;  3AZI C;  1S32 D;  3WA9 B;  5DNN D;  1ID3 C;  5B0Z B;  2FJ7 B;  3AZF A;  3FDD A;  5CHL B;  5E5A C;  4WU9 A;  1M19 D;  3REL B;  2Y2K A;  3UT9 D;  3REI A;  2G5H C;  2RIQ A;  4E44 A;  3O62 B;  3B6F A;  3WTP A;  1M18 D;  2Y2H A;  5B0Y D;  4Z5T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...