5GT3C

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3C00
1M19C 2LY8A 4QLCC 3LELD 5FUGA 3LZ0D 3R45A 3UTAD 3C1CA 1AOIC 1P3FD 3W97C 5BS7A 3W96B 2JSSA 5B1MD 3AZKC 5JRGD 2PYOA 1U35C 4Z66B 2HUEB 4WNNA 5AV8B 3AN2A 3B6GC 3AZED 1ID3C 1HQ3A 1U35B 2F8NK 4XZQA 3W96A 5AVCA 5B1LB 4JJNB 2CV5C 1KX3D 3AZKB 3KWQC 5DNND 4J8XA 3X1VA 5B2JA 5GT3A 1AOIB 3W97B 3X1TB 5BNXA 5GSUA 1M19B 3REHC 1WWSA 4KGCC 5B1MB 5AVBC 5CPJD 3WTPB 3AZFD 3W98C 3X1SA 4JJNA 3AZHA 1P3MB 4YM6C 1P3PC 2IO5C 5GXQD 4XZQB 3C1BC 4KGCD 3AV2A 5B40A 3WAAB 5AV9A 3AZJC 3W97A 4ZUXB 1M1AD 1AOIA 2F8NB 3MGRB 3O62B 5CPID 3MGPC 5AV6B 3WA9C 4J8UC 4E45A 4G91B 3LZ1C 5DNMC 2RVQD 3O62D 5CPIB 1P3BA 5CPIC 3MVDC 1P3OC 4WU9B 1BH9A 3WA9B 1ID3A 5GXQB 3RELC 1P3MD 5CPKA 4ZUXC 5CPJB 4NE3A 3WAAC 3KUYD 5B2IB 5B31G 2IO5B 3B0BA 2NQBC 3X1TD 4H9RB 3AZGC 3REHD 3MGQD 5B32B 1KX4C 1P3IC 5AVBD 3B6GA 4WV4B 4Z5TD 5B1LD 4AWLB 3REKA 3X1TC 1KX3B 1P3AA 5B33C 5KDMB 3A6NC 1H3OB 1U35D 3MGSC 4CSRB 3UTBD 1P3AC 3AZEB 2YFVB 4EO5C 3WKJC 1M1AC 5CP6A 3AZLA 4Z66D 3AZIC 4X23C 1KX5C 4UUZA 5B32A 4J8UD 3VH6A 4WNNB 3MNNC 3B6GB 1B6WA 5AV8C 4WU8B 3WTPE 3WKJD 3MNNB 3AZNC 1P3FB 2F8NG 3UTAB 3MVDA 1P3OA 4EO5B 3W99A 5B24C 3REIB 3A6NB 4R8PA 5GSUB 1P3GC 3W99D 1BFMA 4WU8A 5FUGB 5DNMA 1P3IB 2NZDB 3AZGB 1P3ID 4XUJB 5AV5B 3AN2C 1ZLAA 3B6FC 3UT9D 5B0YC 5AY8A 3NQUA 1N1JA 5B2IC 1EQZB 1P34C 2BYMA 4ZUXA 3KXBB 4J8WA 3UTBA 2AROC 2FJ7A 4DRAA 5AVCB 2F8NH 5AY8D 3LJAB 4Z5TA 3NQJB 3AFAB 3UT9A 1P3IA 3B6GD 4H9OB 5AVBA 3LZ1B 5BT1C 4WU9A 4CAYB 4J8UB 5DNMD 3MGPB 3REHA 3MGRC 4QLCD 3LELC 3AZJB 3LZ0C 5B40C 1P3LC 3UTBB 3C1BB 1M19A 5GT0B 2BYKB 4H9RA 4Z5TB 4M6BA 5AVBB 3LZ1A 1S32C 5B1MC 4YS3B 2FJ7B 1F1EA 5C3IB 5B32G 3MGPA 3REHB 4LD9B 1TZYA 1KU5A 3B0CT 1ZLAC 3B6FA 4ZBJC 4HGAB 3KWQB 3KUYB 1A7WA 2F8NA 4QLCA 5B1LC 5BS7C 4J8VB 4WU9D 1P3AD 1ID3B 3REKD 2HUEC 3AZFA 4Z66C 5GT3C 2FJ7D 1BH9B 3MGQA 5B2JB 4J8WD 3REKC 3X1TA 2YFWB 2F8ND 4ZUXD 2HIOC 5GT3D 3W96C 3KUYA 5DNNA 5G49B 3B6FD 3VH5W 4QLCB 4J8WC 5CPKD 1TZYD 5CP6C 3AZLC 3MGPD 5E5AB 1KX3A 4G92C 5B2JC 5AV9C 5KDMA 3LZ1D 3AV2B 1P3KC 5F99C 4WZSB 1P3BD 2YFWA 1M19D 4KUDB 4R8PD 3REJC 4J8VC 5DNNB 1M18B 5CPIA 3MVDD 1P3OD 4KHAA 4R8PC 3C1CD 4LD9C 3KSYA 1P3LD 2PYOC 5C3IC 5JA4A 4YS3C 4Z66A 3W99B 5AY8C 5GSUD 3MGQC 5BT1D 4KHAB 3X1VD 1U35A 2NZDA 2HIOA 4E44A 3LZ0B 3LELB 1ZLAD 1N1JB 3X1VC 4NFTA 4WU8D 3AZFC 3AN2D 2YFVA 3AFAC 3LJAC 5BO0B 4J8XC 2L5AA 1F66C 5JRGA 3AV1B 3AYWB 1B67A 1P3MA 1M18C 5DNNC 3C1CB 3AZMC 1P34B 3MGSA 3REJB 3VH5A 1P3FA 3X1SB 3LZ0A 3AZHB 3WKJA 5F99B 5B0ZC 3O62A 1H3OA 5BO0A 1P3KA 4CAYA 5B32D 4J8UA 3AV2C 5AV9B 4G92B 1TZYC 5CP6D 3AZLD 3RELD 4KUDD 5CP6B 3AZLB 1P3BB 5AV6A 5B31C 3TU4A 1P3GB 4H9PB 5AV9D 5CHLB 5B40D 3AV2D 1JFIB 5GXQA 3REIC 5F99D 5B1LA 1P3BC 5B24A 3R45B 3X1SD 1TZYB 3AZHD 1P34A 1WWIA 5GT3B 4NE6A 3VH6T 5B0ZB 5CPKC 4WU8C 3KXBA 5B33D 3AZMB 5B2JD 1KX4A 4J8XD 1KX5B 1F66D 3AZIB 1M1AB 2NQBA 5JRGC 3AZEC 3KUYC 1ID3D 1P3AB 3WAAD 1HQ3C 4HGAC 4X23D 4XZQD 4ZBJB 4XUJA 5AV5A 1ZLAB 4H9NA 4AWLC 1ULYA 3AZFB 3WTPD 1KX3C 3X1VB 3KWQD 4CSRA 1S32B 2FJ7C 5B32C 1KX4B 5G49A 3V9RA 2CV5D 4Z5TC 4H9SC 1M1AA 5GT0C 1AOID 3W97D 2NQBB 5B1MA 4UUZB 1KX5A 1P3LB 4KGCA 4YS3D 3X1UA 3AZKD 5CPJC 3LELA 4JJND 3W99C 5GT0D 4YM6A 1P3PA 5CPJA 5GXQC 3REIA 2PYOB 3MVDB 1P3OB 5AV8D 3W98D 3AZJA 3AZJD 1M18D 1S32A 1HQ3B 5DNMB 4R8PB 2AROB 5JRGB 4G91C 3AV1A 5AV6C 3KXBC 5B31A 2BYKA 3AFAD 3VH6W 5AVCD 3NQUB 3W96D 4H9QB 2AROD 1EQZC 1HQ3D 5E5AD 4XZQC 1BH8B 3AZEA 5CPKB 5B0YA 4YM6B 1P3PB 2CV5A 3W98B 4XUJC 5AV5C 1P3KB 3WTPC 3B6FB 2NZDC 2BYMB 3KWQA 2PYOD 1EQZD 5E5AC 5B0YD 3LJAA 4J8WB 4H9PA 5GSUC 5E5AA 4XUJD 5AV5D 2AROA 3AZGD 4X23A 1JFIA 2HIOB 5B31B 3VH5T 3UTAA 1Q9CA 5B24B 1BH8A 3REKB 2NQBD 4H9OA 5BNVB 4JJNC 3UTAC 4H9QA 2CV5B 4J8VD 1P3FC 1KX4D 3AZNB 1S32D 4Z2MH 3A6NA 3C1BA 5B0ZA 3MGRA 1M18A 3W98A 3AZHC 3X1SC 3C1CC 4X23B 3AYWA 5GT0A 3MNNA 3MNND 3WKJB 4LD9A 3AYWC 4LD9D 3AV1C 3AZKA 3X1UD 5BNVA 3AZID 3MGSB 3REJA 4YS3A 1F66B 3WA9A 4J8XB 5JA4B 1KX5D 3AZMD 3AZNA 5B33B 3TU4D 4DRBA 3B0CW 5BNXB 3RELA 5B0ZD 3C1BD 5B2IA 3WTPA 3TU4B 1P3GA 3B0DB 3MGSD 3UTBC 3AZGA 3X1UB 5B40B 3WAAA 3MGQB 1TAFA 1P3GD 5AY8B 4NE5A 3LJAD 3UT9C 2CWEA 3RELB 1F66A 1EQZA 4WU9C 5B2ID 5B33A 3KXBD 4Z2MG 1R4VA 5AVCC 3AZMA 3AZND 3WA9D 3REJD 1P34D 3AZIA 4H9SA 5B24D 3AFAA 3O62C 3NQJA 2RVQC 4H9NB 5F99A 3UT9B 5B31D 2HIOD 2NZDD 3AYWD 3AV1D 3X1UC 4KUDC 1TAFB 5AV6D 1P3PD 5B0YB 3B0DC 3TU4C 1P3MC 4KUDA 3MGRD 5AV8A 3AN2B 3A6ND 4J8VA 1P3KD 3REID 1P3LA 4KGCB 3V9RB 4YM6D 1HTAA
chains in the Genus database with same CATH superfamily
1M19C 2LY8A 4QLCC 3LELD 5FUGA 3LZ0D 3R45A 2UWXA 3C1CA 3UTAD 1AOIC 1P3FD 3W97C 5BS7A 3W96B 2JSSA 5B1MD 2ZY5A 3AZKC 5JRGD 2PYOA 4DQYB 1U35C 4Z66B 2HUEB 4WNNA 5AV8B 3AN2A 3B6GC 3AZED 1ID3C 1HQ3A 1U35B 2F8NK 4XZQA 3W96A 5AVCA 5B1LB 4JJNB 2CV5C 1KX3D 3AZKB 3KWQC 5DNND 4J8XA 3X1VA 5B2JA 5GT3A 1AOIB 3W97B 3X1TB 5BNXA 5GSUA 1M19B 3REHC 1WWSA 4KGCC 5B1MB 5AVBC 5CPJD 3WTPB 3AZFD 3W98C 3X1SA 4JJNA 3AZHA 1P3MB 4YM6C 1P3PC 2IO5C 4WJ3C 5GXQD 4XZQB 3C1BC 4KGCD 3AV2A 5B40A 3WAAB 5AV9A 3AZJC 2JCHA 3W97A 4ZUXB 1M1AD 1AOIA 2F8NB 3MGRB 3O62B 5CPID 3MGPC 5AV6B 3WA9C 4J8UC 4E45A 4G91B 3LZ1C 2ZY4A 5DNMC 2RVQD 3O62D 3EPLA 5CPIB 1P3BA 5CPIC 2Y2PA 3MVDC 1P3OC 4WU9B 1BH9A 3WA9B 1ID3A 5GXQB 3RELC 1P3MD 5CPKA 4ZUXC 5CPJB 4NE3A 3WAAC 3KUYD 5B2IB 5B31G 2IO5B 3B0BA 2NQBC 3X1TD 4H9RB 3AZGC 3REHD 2W8SA 3MGQD 5B32B 1KX4C 1P3IC 5AVBD 3B6GA 4WV4B 4Z5TD 5B1LD 4AWLB 3REKA 3X1TC 1KX3B 1P3AA 5B33C 5KDMB 1H3OB 3A6NC 1U35D 3MGSC 4CSRB 3UTBD 1P3AC 3AZEB 2YFVB 4EO5C 3WKJC 1M1AC 5CP6A 3AZLA 4Z66D 3AZIC 4X23C 1KX5C 3IP4C 4UUZA 5B32A 4J8UD 3VH6A 4WNNB 3MNNC 3B6GB 1B6WA 5AV8C 4WU8B 3WTPE 3WKJD 3MNNB 3AZNC 1P3FB 2F8NG 3UTAB 3MVDA 1P3OA 4EO5B 3W99A 5B24C 3REIB 3A6NB 4R8PA 5GSUB 1P3GC 3W99D 1BFMA 4WU8A 5FUGB 5DNMA 1P3IB 2NZDB 2ZY2A 3AZGB 1P3ID 2XD1A 4XUJB 5AV5B 3AN2C 1ZLAA 3UT9D 3B6FC 5B0YC 5AY8A 3EPHA 2DF4C 3NQUA 1N1JA 5B2IC 1EQZB 1P34C 2BYMA 4ZUXA 2ZM5A 3KXBB 4J8WA 3UTBA 2AROC 2FJ7A 1W2EA 4DRAA 5AVCB 2F8NH 5AY8D 3LJAB 4Z5TA 3NQJB 3AFAB 3UT9A 1P3IA 3B6GD 4H9OB 5AVBA 3LZ1B 3EPKA 5BT1C 4WU9A 4CAYB 4J8UB 5DNMD 3MGPB 3REHA 3MGRC 4QLCD 3LELC 3AZJB 3LZ0C 5B40C 1P3LC 3UTBB 3C1BB 1M19A 5GT0B 2BYKB 4H9RA 4Z5TB 2Y2QA 4M6BA 5AVBB 3LZ1A 1S32C 5B1MC 4YS3B 2FJ7B 1F1EA 5C3IB 3EG5B 5B32G 3MGPA 3REHB 4LD9B 1TZYA 1KU5A 3B0CT 1ZLAC 3B6FA 4ZBJC 4HGAB 3KWQB 3KUYB 2Y2NA 1A7WA 2F8NA 4QLCA 3EPJA 5B1LC 5BS7C 4J8VB 3H0LC 4WU9D 2Y2HA 1P3AD 1ID3B 3REKD 2G5HC 2XD5A 2HUEC 3AZFA 4Z66C 5GT3C 2FJ7D 1BH9B 3MGQA 5B2JB 4J8WD 3REKC 3X1TA 2YFWB 2F8ND 3F6TA 2HIOC 4ZUXD 5GT3D 3W96C 3KUYA 5DNNA 5G49B 3B6FD 3VH5W 4QLCB 4J8WC 5CPKD 1TZYD 5CP6C 3P5JB 3AZLC 3MGPD 5E5AB 1KX3A 4G92C 5B2JC 5AV9C 5KDMA 3LZ1D 3AV2B 1P3KC 5F99C 4WZSB 1P3BD 2YFWA 1M19D 4KUDB 4R8PD 3REJC 4J8VC 5DNNB 3A1KA 1M18B 3H0RC 5CPIA 3MVDD 1P3OD 2J8PA 4KHAA 4R8PC 2F2AC 3C1CD 4LD9C 3KSYA 2BG1A 1P3LD 2PYOC 5C3IC 5JA4A 4YS3C 4Z66A 3W99B 5AY8C 5GSUD 3MGQC 5BT1D 4KHAB 3X1VD 1U35A 2NZDA 2HIOA 4E44A 3LZ0B 3LELB 1ZLAD 1N1JB 2Y2OA 3X1VC 4NFTA 4WU8D 4UPKA 3AZFC 3AN2D 2YFVA 3AFAC 3LJAC 5BO0B 4J8XC 2L5AA 1F66C 5JRGA 3AV1B 3AYWB 1B67A 1P3MA 1M18C 5DNNC 3C1CB 3AZMC 1P34B 3MGSA 3REJB 3VH5A 1P3FA 3X1SB 3LZ0A 3AZHB 3WKJA 5F99B 5B0ZC 3O62A 1H3OA 5BO0A 1P3KA 4CAYA 5B32D 4J8UA 3AV2C 5AV9B 4G92B 1TZYC 2DQNC 5CP6D 3RELD 3AZLD 4KUDD 3KFUG 5CP6B 3AZLB 1P3BB 5AV6A 5B31C 3TU4A 1P3GB 4H9PB 5AV9D 5CHLB 5B40D 3AV2D 2Y2MA 2Y2KA 1JFIB 5GXQA 3REIC 5F99D 5B1LA 1P3BC 5B24A 3R45B 3X1SD 1TZYB 3AZHD 1P34A 1WWIA 5GT3B 4NE6A 3VH6T 5B0ZB 5CPKC 4WU8C 3KXBA 5B33D 3AZMB 5B2JD 1KX4A 4J8XD 1KX5B 1F66D 3AZIB 2ZY3A 2Y2LA 1M1AB 2VQRA 2NQBA 5JRGC 3AZEC 3KUYC 1ID3D 1P3AB 3WAAD 1HQ3C 4HGAC 4X23D 4XZQD 4ZBJB 4XUJA 5AV5A 1ZLAB 4H9NA 4AWLC 1ULYA 2RIQA 3WTPD 3AZFB 1KX3C 1PZRA 3X1VB 3KWQD 4CSRA 1S32B 2FJ7C 5B32C 1KX4B 5G49A 3H0MC 3V9RA 4Z5TC 2CV5D 4H9SC 1M1AA 5GT0C 1AOID 3W97D 2NQBB 5B1MA 4UUZB 1KX5A 1P3LB 4KGCA 4YS3D 3X1UA 3AZKD 5CPJC 3LELA 4JJND 3W99C 5GT0D 4YM6A 1P3PA 5CPJA 5GXQC 3REIA 2PYOB 3MVDB 1P3OB 5AV8D 3W98D 3AZJA 3AZJD 1M18D 2Y2IA 1S32A 1HQ3B 5DNMB 2G5IC 4R8PB 2AROB 5JRGB 4G91C 3AV1A 5AV6C 3KXBC 5B31A 2BYKA 3AFAD 2FFFB 3VH6W 5AVCD 3NQUB 3W96D 4H9QB 2AROD 1EQZC 1HQ3D 5E5AD 4XZQC 1BH8B 3AZEA 5CPKB 5B0YA 4YM6B 1P3PB 2CV5A 3W98B 4XUJC 5AV5C 1P3KB 3WTPC 3B6FB 3A1IA 2NZDC 2BYMB 3FDDA 3KWQA 2PYOD 1EQZD 5E5AC 5B0YD 3LJAA 4J8WB 4H9PA 5GSUC 5E5AA 4XUJD 5AV5D 2AROA 3AZGD 4X23A 1JFIA 2HIOB 5B31B 3VH5T 3UTAA 1Q9CA 5B24B 1BH8A 3REKB 2NQBD 4H9OA 5BNVB 4JJNC 3UTAC 4H9QA 2CV5B 4J8VD 1P3FC 1KX4D 3AZNB 2JE5A 4Z2MH 3A6NA 1S32D 3C1BA 5B0ZA 3MGRA 1M18A 3W98A 3AZHC 3X1SC 3C1CC 4X23B 3AYWA 5GT0A 3MNNA 3MNND 3WKJB 4LD9A 3AYWC 4LD9D 3AV1C 3AZKA 3X1UD 5BNVA 3AZID 3MGSB 3REJA 4YS3A 1F66B 3WA9A 4J8XB 5JA4B 1KX5D 3AZMD 3AZNA 5B33B 3TU4D 4DRBA 3B0CW 5BNXB 3RELA 5B0ZD 3C1BD 5B2IA 3WTPA 3TU4B 1P3GA 3B0DB 3MGSD 3UTBC 2Y2GA 3AZGA 3X1UB 5B40B 3WAAA 3MGQB 1TAFA 1P3GD 5AY8B 4NE5A 3LJAD 3UT9C 2CWEA 3RELB 1F66A 1EQZA 1Z2CB 4WU9C 5B2ID 5B33A 3KXBD 4Z2MG 1R4VA 5AVCC 3AZMA 3AZND 3WA9D 1T3UA 3REJD 1P34D 3AZIA 4H9SA 5B24D 3NQJA 2RVQC 4H9NB 3O62C 3AFAA 5F99A 3UT9B 5B31D 2HIOD 2NZDD 3AYWD 3AV1D 3X1UC 4KUDC 1TAFB 5AV6D 1P3PD 5B0YB 3B0DC 3TU4C 1P3MC 4KUDA 3MGRD 5AV8A 3AN2B 3A6ND 2Y2JA 4J8VA 1P3KD 3REID 1P3LA 4KGCB 3V9RB 3AL0C 4YM6D 1HTAA
chains in the Genus database with same CATH topology
1M19C 2LY8A 4QLCC 3LELD 5FUGA 3LZ0D 3R45A 2UWXA 3C1CA 3UTAD 1AOIC 1P3FD 3W97C 5BS7A 3W96B 2JSSA 5B1MD 2ZY5A 3AZKC 5JRGD 2PYOA 4DQYB 1U35C 4Z66B 2HUEB 4WNNA 5AV8B 3AN2A 3B6GC 3AZED 1ID3C 1HQ3A 1U35B 2F8NK 4XZQA 3W96A 5AVCA 5B1LB 4JJNB 2CV5C 1KX3D 3AZKB 3KWQC 5DNND 4J8XA 3X1VA 5B2JA 5GT3A 1AOIB 3W97B 3X1TB 5BNXA 5GSUA 1M19B 3REHC 1WWSA 4KGCC 5B1MB 5AVBC 5CPJD 3WTPB 3AZFD 3W98C 3X1SA 4JJNA 3AZHA 1P3MB 4YM6C 1P3PC 2IO5C 4WJ3C 5GXQD 4XZQB 3C1BC 4KGCD 3AV2A 5B40A 3WAAB 5AV9A 3AZJC 2JCHA 3W97A 4ZUXB 1M1AD 1AOIA 2F8NB 3MGRB 3O62B 5CPID 3MGPC 5AV6B 3WA9C 4J8UC 4E45A 4G91B 3LZ1C 2ZY4A 5DNMC 2RVQD 3O62D 3EPLA 5CPIB 1P3BA 5CPIC 2Y2PA 3MVDC 1P3OC 4WU9B 1BH9A 3WA9B 1ID3A 5GXQB 3RELC 1P3MD 5CPKA 4ZUXC 5CPJB 4NE3A 3WAAC 3KUYD 5B2IB 5B31G 2IO5B 3B0BA 2NQBC 3X1TD 4H9RB 3AZGC 3REHD 2W8SA 3MGQD 5B32B 1KX4C 1P3IC 5AVBD 3B6GA 4WV4B 4Z5TD 5B1LD 4AWLB 3REKA 3X1TC 1KX3B 1P3AA 5B33C 5KDMB 1H3OB 3A6NC 1U35D 3MGSC 4CSRB 3UTBD 1P3AC 3AZEB 2YFVB 4EO5C 3WKJC 1M1AC 5CP6A 3AZLA 4Z66D 3AZIC 4X23C 1KX5C 3IP4C 4UUZA 5B32A 4J8UD 3VH6A 4WNNB 3MNNC 3B6GB 1B6WA 5AV8C 4WU8B 3WTPE 3WKJD 3MNNB 3AZNC 1P3FB 2F8NG 3UTAB 3MVDA 1P3OA 4EO5B 3W99A 5B24C 3REIB 3A6NB 4R8PA 5GSUB 1P3GC 3W99D 1BFMA 4WU8A 5FUGB 5DNMA 1P3IB 2NZDB 2ZY2A 3AZGB 1P3ID 2XD1A 4XUJB 5AV5B 3AN2C 1ZLAA 3UT9D 3B6FC 5B0YC 5AY8A 3EPHA 2DF4C 3NQUA 1N1JA 5B2IC 1EQZB 1P34C 2BYMA 4ZUXA 2ZM5A 3KXBB 4J8WA 3UTBA 2AROC 2FJ7A 1W2EA 4DRAA 5AVCB 2F8NH 5AY8D 3LJAB 4Z5TA 3NQJB 3AFAB 3UT9A 1P3IA 3B6GD 4H9OB 5AVBA 3LZ1B 3EPKA 5BT1C 4WU9A 4CAYB 4J8UB 5DNMD 3MGPB 3REHA 3MGRC 4QLCD 3LELC 3AZJB 3LZ0C 5B40C 1P3LC 3UTBB 3C1BB 1M19A 5GT0B 2BYKB 4H9RA 4Z5TB 2Y2QA 4M6BA 5AVBB 3LZ1A 1S32C 5B1MC 4YS3B 2FJ7B 1F1EA 5C3IB 3EG5B 5B32G 3MGPA 3REHB 4LD9B 1TZYA 1KU5A 3B0CT 1ZLAC 3B6FA 4ZBJC 4HGAB 3KWQB 3KUYB 2Y2NA 1A7WA 2F8NA 4QLCA 3EPJA 5B1LC 5BS7C 4J8VB 3H0LC 4WU9D 2Y2HA 1P3AD 1ID3B 3REKD 2G5HC 2XD5A 2HUEC 3AZFA 4Z66C 5GT3C 2FJ7D 1BH9B 3MGQA 5B2JB 4J8WD 3REKC 3X1TA 2YFWB 2F8ND 3F6TA 2HIOC 4ZUXD 5GT3D 3W96C 3KUYA 5DNNA 5G49B 3B6FD 3VH5W 4QLCB 4J8WC 5CPKD 1TZYD 5CP6C 3P5JB 3AZLC 3MGPD 5E5AB 1KX3A 4G92C 5B2JC 5AV9C 5KDMA 3LZ1D 3AV2B 1P3KC 5F99C 4WZSB 1P3BD 2YFWA 1M19D 4KUDB 4R8PD 3REJC 4J8VC 5DNNB 3A1KA 1M18B 3H0RC 5CPIA 3MVDD 1P3OD 2J8PA 4KHAA 4R8PC 2F2AC 3C1CD 4LD9C 3KSYA 2BG1A 1P3LD 2PYOC 5C3IC 5JA4A 4YS3C 4Z66A 3W99B 5AY8C 5GSUD 3MGQC 5BT1D 4KHAB 3X1VD 1U35A 2NZDA 2HIOA 4E44A 3LZ0B 3LELB 1ZLAD 1N1JB 2Y2OA 3X1VC 4NFTA 4WU8D 4UPKA 3AZFC 3AN2D 2YFVA 3AFAC 3LJAC 5BO0B 4J8XC 2L5AA 1F66C 5JRGA 3AV1B 3AYWB 1B67A 1P3MA 1M18C 5DNNC 3C1CB 3AZMC 1P34B 3MGSA 3REJB 3VH5A 1P3FA 3X1SB 3LZ0A 3AZHB 3WKJA 5F99B 5B0ZC 3O62A 1H3OA 5BO0A 1P3KA 4CAYA 5B32D 4J8UA 3AV2C 5AV9B 4G92B 1TZYC 2DQNC 5CP6D 3RELD 3AZLD 4KUDD 3KFUG 5CP6B 3AZLB 1P3BB 5AV6A 5B31C 3TU4A 1P3GB 4H9PB 5AV9D 5CHLB 5B40D 3AV2D 2Y2MA 2Y2KA 1JFIB 5GXQA 3REIC 5F99D 5B1LA 1P3BC 5B24A 3R45B 3X1SD 1TZYB 3AZHD 1P34A 1WWIA 5GT3B 4NE6A 3VH6T 5B0ZB 5CPKC 4WU8C 3KXBA 5B33D 3AZMB 5B2JD 1KX4A 4J8XD 1KX5B 1F66D 3AZIB 2ZY3A 2Y2LA 1M1AB 2VQRA 2NQBA 5JRGC 3AZEC 3KUYC 1ID3D 1P3AB 3WAAD 1HQ3C 4HGAC 4X23D 4XZQD 4ZBJB 4XUJA 5AV5A 1ZLAB 4H9NA 4AWLC 1ULYA 2RIQA 3WTPD 3AZFB 1KX3C 1PZRA 3X1VB 3KWQD 4CSRA 1S32B 2FJ7C 5B32C 1KX4B 5G49A 3H0MC 3V9RA 4Z5TC 2CV5D 4H9SC 1M1AA 5GT0C 1AOID 3W97D 2NQBB 5B1MA 4UUZB 1KX5A 1P3LB 4KGCA 4YS3D 3X1UA 3AZKD 5CPJC 3LELA 4JJND 3W99C 5GT0D 4YM6A 1P3PA 5CPJA 5GXQC 3REIA 2PYOB 3MVDB 1P3OB 5AV8D 3W98D 3AZJA 3AZJD 1M18D 2Y2IA 1S32A 1HQ3B 5DNMB 2G5IC 4R8PB 2AROB 5JRGB 4G91C 3AV1A 5AV6C 3KXBC 5B31A 2BYKA 3AFAD 2FFFB 3VH6W 5AVCD 3NQUB 3W96D 4H9QB 2AROD 1EQZC 1HQ3D 5E5AD 4XZQC 1BH8B 3AZEA 5CPKB 5B0YA 4YM6B 1P3PB 2CV5A 3W98B 4XUJC 5AV5C 1P3KB 3WTPC 3B6FB 3A1IA 2NZDC 2BYMB 3FDDA 3KWQA 2PYOD 1EQZD 5E5AC 5B0YD 3LJAA 4J8WB 4H9PA 5GSUC 5E5AA 4XUJD 5AV5D 2AROA 3AZGD 4X23A 1JFIA 2HIOB 5B31B 3VH5T 3UTAA 1Q9CA 5B24B 1BH8A 3REKB 2NQBD 4H9OA 5BNVB 4JJNC 3UTAC 4H9QA 2CV5B 4J8VD 1P3FC 1KX4D 3AZNB 2JE5A 4Z2MH 3A6NA 1S32D 3C1BA 5B0ZA 3MGRA 1M18A 3W98A 3AZHC 3X1SC 3C1CC 4X23B 3AYWA 5GT0A 3MNNA 3MNND 3WKJB 4LD9A 3AYWC 4LD9D 3AV1C 3AZKA 3X1UD 5BNVA 3AZID 3MGSB 3REJA 4YS3A 1F66B 3WA9A 4J8XB 5JA4B 1KX5D 3AZMD 3AZNA 5B33B 3TU4D 4DRBA 3B0CW 5BNXB 3RELA 5B0ZD 3C1BD 5B2IA 3WTPA 3TU4B 1P3GA 3B0DB 3MGSD 3UTBC 2Y2GA 3AZGA 3X1UB 5B40B 3WAAA 3MGQB 1TAFA 1P3GD 5AY8B 4NE5A 3LJAD 3UT9C 2CWEA 3RELB 1F66A 1EQZA 1Z2CB 4WU9C 5B2ID 5B33A 3KXBD 4Z2MG 1R4VA 5AVCC 3AZMA 3AZND 3WA9D 1T3UA 3REJD 1P34D 3AZIA 4H9SA 5B24D 3NQJA 2RVQC 4H9NB 3O62C 3AFAA 5F99A 3UT9B 5B31D 2HIOD 2NZDD 3AYWD 3AV1D 3X1UC 4KUDC 1TAFB 5AV6D 1P3PD 5B0YB 3B0DC 3TU4C 1P3MC 4KUDA 3MGRD 5AV8A 3AN2B 3A6ND 2Y2JA 4J8VA 1P3KD 3REID 1P3LA 4KGCB 3V9RB 3AL0C 4YM6D 1HTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 C;  2LY8 A;  4QLC C;  3LEL D;  5FUG A;  3LZ0 D;  3R45 A;  3UTA D;  3C1C A;  1AOI C;  1P3F D;  3W97 C;  5BS7 A;  3W96 B;  2JSS A;  5B1M D;  3AZK C;  5JRG D;  2PYO A;  1U35 C;  4Z66 B;  2HUE B;  4WNN A;  5AV8 B;  3AN2 A;  3B6G C;  3AZE D;  1ID3 C;  1HQ3 A;  1U35 B;  2F8N K;  4XZQ A;  3W96 A;  5AVC A;  5B1L B;  4JJN B;  2CV5 C;  1KX3 D;  3AZK B;  3KWQ C;  5DNN D;  4J8X A;  3X1V A;  5B2J A;  5GT3 A;  1AOI B;  3W97 B;  3X1T B;  5BNX A;  5GSU A;  1M19 B;  3REH C;  1WWS A;  4KGC C;  5B1M B;  5AVB C;  5CPJ D;  3WTP B;  3AZF D;  3W98 C;  3X1S A;  4JJN A;  3AZH A;  1P3M B;  4YM6 C;  1P3P C;  2IO5 C;  5GXQ D;  4XZQ B;  3C1B C;  4KGC D;  3AV2 A;  5B40 A;  3WAA B;  5AV9 A;  3AZJ C;  3W97 A;  4ZUX B;  1M1A D;  1AOI A;  2F8N B;  3MGR B;  3O62 B;  5CPI D;  3MGP C;  5AV6 B;  3WA9 C;  4J8U C;  4E45 A;  4G91 B;  3LZ1 C;  5DNM C;  2RVQ D;  3O62 D;  5CPI B;  1P3B A;  5CPI C;  3MVD C;  1P3O C;  4WU9 B;  1BH9 A;  3WA9 B;  1ID3 A;  5GXQ B;  3REL C;  1P3M D;  5CPK A;  4ZUX C;  5CPJ B;  4NE3 A;  3WAA C;  3KUY D;  5B2I B;  5B31 G;  2IO5 B;  3B0B A;  2NQB C;  3X1T D;  4H9R B;  3AZG C;  3REH D;  3MGQ D;  5B32 B;  1KX4 C;  1P3I C;  5AVB D;  3B6G A;  4WV4 B;  4Z5T D;  5B1L D;  4AWL B;  3REK A;  3X1T C;  1KX3 B;  1P3A A;  5B33 C;  5KDM B;  3A6N C;  1H3O B;  1U35 D;  3MGS C;  4CSR B;  3UTB D;  1P3A C;  3AZE B;  2YFV B;  4EO5 C;  3WKJ C;  1M1A C;  5CP6 A;  3AZL A;  4Z66 D;  3AZI C;  4X23 C;  1KX5 C;  4UUZ A;  5B32 A;  4J8U D;  3VH6 A;  4WNN B;  3MNN C;  3B6G B;  1B6W A;  5AV8 C;  4WU8 B;  3WTP E;  3WKJ D;  3MNN B;  3AZN C;  1P3F B;  2F8N G;  3UTA B;  3MVD A;  1P3O A;  4EO5 B;  3W99 A;  5B24 C;  3REI B;  3A6N B;  4R8P A;  5GSU B;  1P3G C;  3W99 D;  1BFM A;  4WU8 A;  5FUG B;  5DNM A;  1P3I B;  2NZD B;  3AZG B;  1P3I D;  4XUJ B;  5AV5 B;  3AN2 C;  1ZLA A;  3B6F C;  3UT9 D;  5B0Y C;  5AY8 A;  3NQU A;  1N1J A;  5B2I C;  1EQZ B;  1P34 C;  2BYM A;  4ZUX A;  3KXB B;  4J8W A;  3UTB A;  2ARO C;  2FJ7 A;  4DRA A;  5AVC B;  2F8N H;  5AY8 D;  3LJA B;  4Z5T A;  3NQJ B;  3AFA B;  3UT9 A;  1P3I A;  3B6G D;  4H9O B;  5AVB A;  3LZ1 B;  5BT1 C;  4WU9 A;  4CAY B;  4J8U B;  5DNM D;  3MGP B;  3REH A;  3MGR C;  4QLC D;  3LEL C;  3AZJ B;  3LZ0 C;  5B40 C;  1P3L C;  3UTB B;  3C1B B;  1M19 A;  5GT0 B;  2BYK B;  4H9R A;  4Z5T B;  4M6B A;  5AVB B;  3LZ1 A;  1S32 C;  5B1M C;  4YS3 B;  2FJ7 B;  1F1E A;  5C3I B;  5B32 G;  3MGP A;  3REH B;  4LD9 B;  1TZY A;  1KU5 A;  3B0C T;  1ZLA C;  3B6F A;  4ZBJ C;  4HGA B;  3KWQ B;  3KUY B;  1A7W A;  2F8N A;  4QLC A;  5B1L C;  5BS7 C;  4J8V B;  4WU9 D;  1P3A D;  1ID3 B;  3REK D;  2HUE C;  3AZF A;  4Z66 C;  5GT3 C;  2FJ7 D;  1BH9 B;  3MGQ A;  5B2J B;  4J8W D;  3REK C;  3X1T A;  2YFW B;  2F8N D;  4ZUX D;  2HIO C;  5GT3 D;  3W96 C;  3KUY A;  5DNN A;  5G49 B;  3B6F D;  3VH5 W;  4QLC B;  4J8W C;  5CPK D;  1TZY D;  5CP6 C;  3AZL C;  3MGP D;  5E5A B;  1KX3 A;  4G92 C;  5B2J C;  5AV9 C;  5KDM A;  3LZ1 D;  3AV2 B;  1P3K C;  5F99 C;  4WZS B;  1P3B D;  2YFW A;  1M19 D;  4KUD B;  4R8P D;  3REJ C;  4J8V C;  5DNN B;  1M18 B;  5CPI A;  3MVD D;  1P3O D;  4KHA A;  4R8P C;  3C1C D;  4LD9 C;  3KSY A;  1P3L D;  2PYO C;  5C3I C;  5JA4 A;  4YS3 C;  4Z66 A;  3W99 B;  5AY8 C;  5GSU D;  3MGQ C;  5BT1 D;  4KHA B;  3X1V D;  1U35 A;  2NZD A;  2HIO A;  4E44 A;  3LZ0 B;  3LEL B;  1ZLA D;  1N1J B;  3X1V C;  4NFT A;  4WU8 D;  3AZF C;  3AN2 D;  2YFV A;  3AFA C;  3LJA C;  5BO0 B;  4J8X C;  2L5A A;  1F66 C;  5JRG A;  3AV1 B;  3AYW B;  1B67 A;  1P3M A;  1M18 C;  5DNN C;  3C1C B;  3AZM C;  1P34 B;  3MGS A;  3REJ B;  3VH5 A;  1P3F A;  3X1S B;  3LZ0 A;  3AZH B;  3WKJ A;  5F99 B;  5B0Z C;  3O62 A;  1H3O A;  5BO0 A;  1P3K A;  4CAY A;  5B32 D;  4J8U A;  3AV2 C;  5AV9 B;  4G92 B;  1TZY C;  5CP6 D;  3AZL D;  3REL D;  4KUD D;  5CP6 B;  3AZL B;  1P3B B;  5AV6 A;  5B31 C;  3TU4 A;  1P3G B;  4H9P B;  5AV9 D;  5CHL B;  5B40 D;  3AV2 D;  1JFI B;  5GXQ A;  3REI C;  5F99 D;  5B1L A;  1P3B C;  5B24 A;  3R45 B;  3X1S D;  1TZY B;  3AZH D;  1P34 A;  1WWI A;  5GT3 B;  4NE6 A;  3VH6 T;  5B0Z B;  5CPK C;  4WU8 C;  3KXB A;  5B33 D;  3AZM B;  5B2J D;  1KX4 A;  4J8X D;  1KX5 B;  1F66 D;  3AZI B;  1M1A B;  2NQB A;  5JRG C;  3AZE C;  3KUY C;  1ID3 D;  1P3A B;  3WAA D;  1HQ3 C;  4HGA C;  4X23 D;  4XZQ D;  4ZBJ B;  4XUJ A;  5AV5 A;  1ZLA B;  4H9N A;  4AWL C;  1ULY A;  3AZF B;  3WTP D;  1KX3 C;  3X1V B;  3KWQ D;  4CSR A;  1S32 B;  2FJ7 C;  5B32 C;  1KX4 B;  5G49 A;  3V9R A;  2CV5 D;  4Z5T C;  4H9S C;  1M1A A;  5GT0 C;  1AOI D;  3W97 D;  2NQB B;  5B1M A;  4UUZ B;  1KX5 A;  1P3L B;  4KGC A;  4YS3 D;  3X1U A;  3AZK D;  5CPJ C;  3LEL A;  4JJN D;  3W99 C;  5GT0 D;  4YM6 A;  1P3P A;  5CPJ A;  5GXQ C;  3REI A;  2PYO B;  3MVD B;  1P3O B;  5AV8 D;  3W98 D;  3AZJ A;  3AZJ D;  1M18 D;  1S32 A;  1HQ3 B;  5DNM B;  4R8P B;  2ARO B;  5JRG B;  4G91 C;  3AV1 A;  5AV6 C;  3KXB C;  5B31 A;  2BYK A;  3AFA D;  3VH6 W;  5AVC D;  3NQU B;  3W96 D;  4H9Q B;  2ARO D;  1EQZ C;  1HQ3 D;  5E5A D;  4XZQ C;  1BH8 B;  3AZE A;  5CPK B;  5B0Y A;  4YM6 B;  1P3P B;  2CV5 A;  3W98 B;  4XUJ C;  5AV5 C;  1P3K B;  3WTP C;  3B6F B;  2NZD C;  2BYM B;  3KWQ A;  2PYO D;  1EQZ D;  5E5A C;  5B0Y D;  3LJA A;  4J8W B;  4H9P A;  5GSU C;  5E5A A;  4XUJ D;  5AV5 D;  2ARO A;  3AZG D;  4X23 A;  1JFI A;  2HIO B;  5B31 B;  3VH5 T;  3UTA A;  1Q9C A;  5B24 B;  1BH8 A;  3REK B;  2NQB D;  4H9O A;  5BNV B;  4JJN C;  3UTA C;  4H9Q A;  2CV5 B;  4J8V D;  1P3F C;  1KX4 D;  3AZN B;  1S32 D;  4Z2M H;  3A6N A;  3C1B A;  5B0Z A;  3MGR A;  1M18 A;  3W98 A;  3AZH C;  3X1S C;  3C1C C;  4X23 B;  3AYW A;  5GT0 A;  3MNN A;  3MNN D;  3WKJ B;  4LD9 A;  3AYW C;  4LD9 D;  3AV1 C;  3AZK A;  3X1U D;  5BNV A;  3AZI D;  3MGS B;  3REJ A;  4YS3 A;  1F66 B;  3WA9 A;  4J8X B;  5JA4 B;  1KX5 D;  3AZM D;  3AZN A;  5B33 B;  3TU4 D;  4DRB A;  3B0C W;  5BNX B;  3REL A;  5B0Z D;  3C1B D;  5B2I A;  3WTP A;  3TU4 B;  1P3G A;  3B0D B;  3MGS D;  3UTB C;  3AZG A;  3X1U B;  5B40 B;  3WAA A;  3MGQ B;  1TAF A;  1P3G D;  5AY8 B;  4NE5 A;  3LJA D;  3UT9 C;  2CWE A;  3REL B;  1F66 A;  1EQZ A;  4WU9 C;  5B2I D;  5B33 A;  3KXB D;  4Z2M G;  1R4V A;  5AVC C;  3AZM A;  3AZN D;  3WA9 D;  3REJ D;  1P34 D;  3AZI A;  4H9S A;  5B24 D;  3AFA A;  3O62 C;  3NQJ A;  2RVQ C;  4H9N B;  5F99 A;  3UT9 B;  5B31 D;  2HIO D;  2NZD D;  3AYW D;  3AV1 D;  3X1U C;  4KUD C;  1TAF B;  5AV6 D;  1P3P D;  5B0Y B;  3B0D C;  3TU4 C;  1P3M C;  4KUD A;  3MGR D;  5AV8 A;  3AN2 B;  3A6N D;  4J8V A;  1P3K D;  3REI D;  1P3L A;  4KGC B;  3V9R B;  4YM6 D;  1HTA A; 
#chains in the Genus database with same CATH topology
 1M19 C;  2LY8 A;  4QLC C;  3LEL D;  5FUG A;  3LZ0 D;  3R45 A;  2UWX A;  3C1C A;  3UTA D;  1AOI C;  1P3F D;  3W97 C;  5BS7 A;  3W96 B;  2JSS A;  5B1M D;  2ZY5 A;  3AZK C;  5JRG D;  2PYO A;  4DQY B;  1U35 C;  4Z66 B;  2HUE B;  4WNN A;  5AV8 B;  3AN2 A;  3B6G C;  3AZE D;  1ID3 C;  1HQ3 A;  1U35 B;  2F8N K;  4XZQ A;  3W96 A;  5AVC A;  5B1L B;  4JJN B;  2CV5 C;  1KX3 D;  3AZK B;  3KWQ C;  5DNN D;  4J8X A;  3X1V A;  5B2J A;  5GT3 A;  1AOI B;  3W97 B;  3X1T B;  5BNX A;  5GSU A;  1M19 B;  3REH C;  1WWS A;  4KGC C;  5B1M B;  5AVB C;  5CPJ D;  3WTP B;  3AZF D;  3W98 C;  3X1S A;  4JJN A;  3AZH A;  1P3M B;  4YM6 C;  1P3P C;  2IO5 C;  4WJ3 C;  5GXQ D;  4XZQ B;  3C1B C;  4KGC D;  3AV2 A;  5B40 A;  3WAA B;  5AV9 A;  3AZJ C;  2JCH A;  3W97 A;  4ZUX B;  1M1A D;  1AOI A;  2F8N B;  3MGR B;  3O62 B;  5CPI D;  3MGP C;  5AV6 B;  3WA9 C;  4J8U C;  4E45 A;  4G91 B;  3LZ1 C;  2ZY4 A;  5DNM C;  2RVQ D;  3O62 D;  3EPL A;  5CPI B;  1P3B A;  5CPI C;  2Y2P A;  3MVD C;  1P3O C;  4WU9 B;  1BH9 A;  3WA9 B;  1ID3 A;  5GXQ B;  3REL C;  1P3M D;  5CPK A;  4ZUX C;  5CPJ B;  4NE3 A;  3WAA C;  3KUY D;  5B2I B;  5B31 G;  2IO5 B;  3B0B A;  2NQB C;  3X1T D;  4H9R B;  3AZG C;  3REH D;  2W8S A;  3MGQ D;  5B32 B;  1KX4 C;  1P3I C;  5AVB D;  3B6G A;  4WV4 B;  4Z5T D;  5B1L D;  4AWL B;  3REK A;  3X1T C;  1KX3 B;  1P3A A;  5B33 C;  5KDM B;  1H3O B;  3A6N C;  1U35 D;  3MGS C;  4CSR B;  3UTB D;  1P3A C;  3AZE B;  2YFV B;  4EO5 C;  3WKJ C;  1M1A C;  5CP6 A;  3AZL A;  4Z66 D;  3AZI C;  4X23 C;  1KX5 C;  3IP4 C;  4UUZ A;  5B32 A;  4J8U D;  3VH6 A;  4WNN B;  3MNN C;  3B6G B;  1B6W A;  5AV8 C;  4WU8 B;  3WTP E;  3WKJ D;  3MNN B;  3AZN C;  1P3F B;  2F8N G;  3UTA B;  3MVD A;  1P3O A;  4EO5 B;  3W99 A;  5B24 C;  3REI B;  3A6N B;  4R8P A;  5GSU B;  1P3G C;  3W99 D;  1BFM A;  4WU8 A;  5FUG B;  5DNM A;  1P3I B;  2NZD B;  2ZY2 A;  3AZG B;  1P3I D;  2XD1 A;  4XUJ B;  5AV5 B;  3AN2 C;  1ZLA A;  3UT9 D;  3B6F C;  5B0Y C;  5AY8 A;  3EPH A;  2DF4 C;  3NQU A;  1N1J A;  5B2I C;  1EQZ B;  1P34 C;  2BYM A;  4ZUX A;  2ZM5 A;  3KXB B;  4J8W A;  3UTB A;  2ARO C;  2FJ7 A;  1W2E A;  4DRA A;  5AVC B;  2F8N H;  5AY8 D;  3LJA B;  4Z5T A;  3NQJ B;  3AFA B;  3UT9 A;  1P3I A;  3B6G D;  4H9O B;  5AVB A;  3LZ1 B;  3EPK A;  5BT1 C;  4WU9 A;  4CAY B;  4J8U B;  5DNM D;  3MGP B;  3REH A;  3MGR C;  4QLC D;  3LEL C;  3AZJ B;  3LZ0 C;  5B40 C;  1P3L C;  3UTB B;  3C1B B;  1M19 A;  5GT0 B;  2BYK B;  4H9R A;  4Z5T B;  2Y2Q A;  4M6B A;  5AVB B;  3LZ1 A;  1S32 C;  5B1M C;  4YS3 B;  2FJ7 B;  1F1E A;  5C3I B;  3EG5 B;  5B32 G;  3MGP A;  3REH B;  4LD9 B;  1TZY A;  1KU5 A;  3B0C T;  1ZLA C;  3B6F A;  4ZBJ C;  4HGA B;  3KWQ B;  3KUY B;  2Y2N A;  1A7W A;  2F8N A;  4QLC A;  3EPJ A;  5B1L C;  5BS7 C;  4J8V B;  3H0L C;  4WU9 D;  2Y2H A;  1P3A D;  1ID3 B;  3REK D;  2G5H C;  2XD5 A;  2HUE C;  3AZF A;  4Z66 C;  5GT3 C;  2FJ7 D;  1BH9 B;  3MGQ A;  5B2J B;  4J8W D;  3REK C;  3X1T A;  2YFW B;  2F8N D;  3F6T A;  2HIO C;  4ZUX D;  5GT3 D;  3W96 C;  3KUY A;  5DNN A;  5G49 B;  3B6F D;  3VH5 W;  4QLC B;  4J8W C;  5CPK D;  1TZY D;  5CP6 C;  3P5J B;  3AZL C;  3MGP D;  5E5A B;  1KX3 A;  4G92 C;  5B2J C;  5AV9 C;  5KDM A;  3LZ1 D;  3AV2 B;  1P3K C;  5F99 C;  4WZS B;  1P3B D;  2YFW A;  1M19 D;  4KUD B;  4R8P D;  3REJ C;  4J8V C;  5DNN B;  3A1K A;  1M18 B;  3H0R C;  5CPI A;  3MVD D;  1P3O D;  2J8P A;  4KHA A;  4R8P C;  2F2A C;  3C1C D;  4LD9 C;  3KSY A;  2BG1 A;  1P3L D;  2PYO C;  5C3I C;  5JA4 A;  4YS3 C;  4Z66 A;  3W99 B;  5AY8 C;  5GSU D;  3MGQ C;  5BT1 D;  4KHA B;  3X1V D;  1U35 A;  2NZD A;  2HIO A;  4E44 A;  3LZ0 B;  3LEL B;  1ZLA D;  1N1J B;  2Y2O A;  3X1V C;  4NFT A;  4WU8 D;  4UPK A;  3AZF C;  3AN2 D;  2YFV A;  3AFA C;  3LJA C;  5BO0 B;  4J8X C;  2L5A A;  1F66 C;  5JRG A;  3AV1 B;  3AYW B;  1B67 A;  1P3M A;  1M18 C;  5DNN C;  3C1C B;  3AZM C;  1P34 B;  3MGS A;  3REJ B;  3VH5 A;  1P3F A;  3X1S B;  3LZ0 A;  3AZH B;  3WKJ A;  5F99 B;  5B0Z C;  3O62 A;  1H3O A;  5BO0 A;  1P3K A;  4CAY A;  5B32 D;  4J8U A;  3AV2 C;  5AV9 B;  4G92 B;  1TZY C;  2DQN C;  5CP6 D;  3REL D;  3AZL D;  4KUD D;  3KFU G;  5CP6 B;  3AZL B;  1P3B B;  5AV6 A;  5B31 C;  3TU4 A;  1P3G B;  4H9P B;  5AV9 D;  5CHL B;  5B40 D;  3AV2 D;  2Y2M A;  2Y2K A;  1JFI B;  5GXQ A;  3REI C;  5F99 D;  5B1L A;  1P3B C;  5B24 A;  3R45 B;  3X1S D;  1TZY B;  3AZH D;  1P34 A;  1WWI A;  5GT3 B;  4NE6 A;  3VH6 T;  5B0Z B;  5CPK C;  4WU8 C;  3KXB A;  5B33 D;  3AZM B;  5B2J D;  1KX4 A;  4J8X D;  1KX5 B;  1F66 D;  3AZI B;  2ZY3 A;  2Y2L A;  1M1A B;  2VQR A;  2NQB A;  5JRG C;  3AZE C;  3KUY C;  1ID3 D;  1P3A B;  3WAA D;  1HQ3 C;  4HGA C;  4X23 D;  4XZQ D;  4ZBJ B;  4XUJ A;  5AV5 A;  1ZLA B;  4H9N A;  4AWL C;  1ULY A;  2RIQ A;  3WTP D;  3AZF B;  1KX3 C;  1PZR A;  3X1V B;  3KWQ D;  4CSR A;  1S32 B;  2FJ7 C;  5B32 C;  1KX4 B;  5G49 A;  3H0M C;  3V9R A;  4Z5T C;  2CV5 D;  4H9S C;  1M1A A;  5GT0 C;  1AOI D;  3W97 D;  2NQB B;  5B1M A;  4UUZ B;  1KX5 A;  1P3L B;  4KGC A;  4YS3 D;  3X1U A;  3AZK D;  5CPJ C;  3LEL A;  4JJN D;  3W99 C;  5GT0 D;  4YM6 A;  1P3P A;  5CPJ A;  5GXQ C;  3REI A;  2PYO B;  3MVD B;  1P3O B;  5AV8 D;  3W98 D;  3AZJ A;  3AZJ D;  1M18 D;  2Y2I A;  1S32 A;  1HQ3 B;  5DNM B;  2G5I C;  4R8P B;  2ARO B;  5JRG B;  4G91 C;  3AV1 A;  5AV6 C;  3KXB C;  5B31 A;  2BYK A;  3AFA D;  2FFF B;  3VH6 W;  5AVC D;  3NQU B;  3W96 D;  4H9Q B;  2ARO D;  1EQZ C;  1HQ3 D;  5E5A D;  4XZQ C;  1BH8 B;  3AZE A;  5CPK B;  5B0Y A;  4YM6 B;  1P3P B;  2CV5 A;  3W98 B;  4XUJ C;  5AV5 C;  1P3K B;  3WTP C;  3B6F B;  3A1I A;  2NZD C;  2BYM B;  3FDD A;  3KWQ A;  2PYO D;  1EQZ D;  5E5A C;  5B0Y D;  3LJA A;  4J8W B;  4H9P A;  5GSU C;  5E5A A;  4XUJ D;  5AV5 D;  2ARO A;  3AZG D;  4X23 A;  1JFI A;  2HIO B;  5B31 B;  3VH5 T;  3UTA A;  1Q9C A;  5B24 B;  1BH8 A;  3REK B;  2NQB D;  4H9O A;  5BNV B;  4JJN C;  3UTA C;  4H9Q A;  2CV5 B;  4J8V D;  1P3F C;  1KX4 D;  3AZN B;  2JE5 A;  4Z2M H;  3A6N A;  1S32 D;  3C1B A;  5B0Z A;  3MGR A;  1M18 A;  3W98 A;  3AZH C;  3X1S C;  3C1C C;  4X23 B;  3AYW A;  5GT0 A;  3MNN A;  3MNN D;  3WKJ B;  4LD9 A;  3AYW C;  4LD9 D;  3AV1 C;  3AZK A;  3X1U D;  5BNV A;  3AZI D;  3MGS B;  3REJ A;  4YS3 A;  1F66 B;  3WA9 A;  4J8X B;  5JA4 B;  1KX5 D;  3AZM D;  3AZN A;  5B33 B;  3TU4 D;  4DRB A;  3B0C W;  5BNX B;  3REL A;  5B0Z D;  3C1B D;  5B2I A;  3WTP A;  3TU4 B;  1P3G A;  3B0D B;  3MGS D;  3UTB C;  2Y2G A;  3AZG A;  3X1U B;  5B40 B;  3WAA A;  3MGQ B;  1TAF A;  1P3G D;  5AY8 B;  4NE5 A;  3LJA D;  3UT9 C;  2CWE A;  3REL B;  1F66 A;  1EQZ A;  1Z2C B;  4WU9 C;  5B2I D;  5B33 A;  3KXB D;  4Z2M G;  1R4V A;  5AVC C;  3AZM A;  3AZN D;  3WA9 D;  1T3U A;  3REJ D;  1P34 D;  3AZI A;  4H9S A;  5B24 D;  3NQJ A;  2RVQ C;  4H9N B;  3O62 C;  3AFA A;  5F99 A;  3UT9 B;  5B31 D;  2HIO D;  2NZD D;  3AYW D;  3AV1 D;  3X1U C;  4KUD C;  1TAF B;  5AV6 D;  1P3P D;  5B0Y B;  3B0D C;  3TU4 C;  1P3M C;  4KUD A;  3MGR D;  5AV8 A;  3AN2 B;  3A6N D;  2Y2J A;  4J8V A;  1P3K D;  3REI D;  1P3L A;  4KGC B;  3V9R B;  3AL0 C;  4YM6 D;  1HTA A; 
#chains in the Genus database with same CATH homology
 1M19 C;  2LY8 A;  4QLC C;  3LEL D;  5FUG A;  3LZ0 D;  3R45 A;  2UWX A;  3C1C A;  3UTA D;  1AOI C;  1P3F D;  3W97 C;  5BS7 A;  3W96 B;  2JSS A;  5B1M D;  2ZY5 A;  3AZK C;  5JRG D;  2PYO A;  4DQY B;  1U35 C;  4Z66 B;  2HUE B;  4WNN A;  5AV8 B;  3AN2 A;  3B6G C;  3AZE D;  1ID3 C;  1HQ3 A;  1U35 B;  2F8N K;  4XZQ A;  3W96 A;  5AVC A;  5B1L B;  4JJN B;  2CV5 C;  1KX3 D;  3AZK B;  3KWQ C;  5DNN D;  4J8X A;  3X1V A;  5B2J A;  5GT3 A;  1AOI B;  3W97 B;  3X1T B;  5BNX A;  5GSU A;  1M19 B;  3REH C;  1WWS A;  4KGC C;  5B1M B;  5AVB C;  5CPJ D;  3WTP B;  3AZF D;  3W98 C;  3X1S A;  4JJN A;  3AZH A;  1P3M B;  4YM6 C;  1P3P C;  2IO5 C;  4WJ3 C;  5GXQ D;  4XZQ B;  3C1B C;  4KGC D;  3AV2 A;  5B40 A;  3WAA B;  5AV9 A;  3AZJ C;  2JCH A;  3W97 A;  4ZUX B;  1M1A D;  1AOI A;  2F8N B;  3MGR B;  3O62 B;  5CPI D;  3MGP C;  5AV6 B;  3WA9 C;  4J8U C;  4E45 A;  4G91 B;  3LZ1 C;  2ZY4 A;  5DNM C;  2RVQ D;  3O62 D;  3EPL A;  5CPI B;  1P3B A;  5CPI C;  2Y2P A;  3MVD C;  1P3O C;  4WU9 B;  1BH9 A;  3WA9 B;  1ID3 A;  5GXQ B;  3REL C;  1P3M D;  5CPK A;  4ZUX C;  5CPJ B;  4NE3 A;  3WAA C;  3KUY D;  5B2I B;  5B31 G;  2IO5 B;  3B0B A;  2NQB C;  3X1T D;  4H9R B;  3AZG C;  3REH D;  2W8S A;  3MGQ D;  5B32 B;  1KX4 C;  1P3I C;  5AVB D;  3B6G A;  4WV4 B;  4Z5T D;  5B1L D;  4AWL B;  3REK A;  3X1T C;  1KX3 B;  1P3A A;  5B33 C;  5KDM B;  1H3O B;  3A6N C;  1U35 D;  3MGS C;  4CSR B;  3UTB D;  1P3A C;  3AZE B;  2YFV B;  4EO5 C;  3WKJ C;  1M1A C;  5CP6 A;  3AZL A;  4Z66 D;  3AZI C;  4X23 C;  1KX5 C;  3IP4 C;  4UUZ A;  5B32 A;  4J8U D;  3VH6 A;  4WNN B;  3MNN C;  3B6G B;  1B6W A;  5AV8 C;  4WU8 B;  3WTP E;  3WKJ D;  3MNN B;  3AZN C;  1P3F B;  2F8N G;  3UTA B;  3MVD A;  1P3O A;  4EO5 B;  3W99 A;  5B24 C;  3REI B;  3A6N B;  4R8P A;  5GSU B;  1P3G C;  3W99 D;  1BFM A;  4WU8 A;  5FUG B;  5DNM A;  1P3I B;  2NZD B;  2ZY2 A;  3AZG B;  1P3I D;  2XD1 A;  4XUJ B;  5AV5 B;  3AN2 C;  1ZLA A;  3UT9 D;  3B6F C;  5B0Y C;  5AY8 A;  3EPH A;  2DF4 C;  3NQU A;  1N1J A;  5B2I C;  1EQZ B;  1P34 C;  2BYM A;  4ZUX A;  2ZM5 A;  3KXB B;  4J8W A;  3UTB A;  2ARO C;  2FJ7 A;  1W2E A;  4DRA A;  5AVC B;  2F8N H;  5AY8 D;  3LJA B;  4Z5T A;  3NQJ B;  3AFA B;  3UT9 A;  1P3I A;  3B6G D;  4H9O B;  5AVB A;  3LZ1 B;  3EPK A;  5BT1 C;  4WU9 A;  4CAY B;  4J8U B;  5DNM D;  3MGP B;  3REH A;  3MGR C;  4QLC D;  3LEL C;  3AZJ B;  3LZ0 C;  5B40 C;  1P3L C;  3UTB B;  3C1B B;  1M19 A;  5GT0 B;  2BYK B;  4H9R A;  4Z5T B;  2Y2Q A;  4M6B A;  5AVB B;  3LZ1 A;  1S32 C;  5B1M C;  4YS3 B;  2FJ7 B;  1F1E A;  5C3I B;  3EG5 B;  5B32 G;  3MGP A;  3REH B;  4LD9 B;  1TZY A;  1KU5 A;  3B0C T;  1ZLA C;  3B6F A;  4ZBJ C;  4HGA B;  3KWQ B;  3KUY B;  2Y2N A;  1A7W A;  2F8N A;  4QLC A;  3EPJ A;  5B1L C;  5BS7 C;  4J8V B;  3H0L C;  4WU9 D;  2Y2H A;  1P3A D;  1ID3 B;  3REK D;  2G5H C;  2XD5 A;  2HUE C;  3AZF A;  4Z66 C;  5GT3 C;  2FJ7 D;  1BH9 B;  3MGQ A;  5B2J B;  4J8W D;  3REK C;  3X1T A;  2YFW B;  2F8N D;  3F6T A;  2HIO C;  4ZUX D;  5GT3 D;  3W96 C;  3KUY A;  5DNN A;  5G49 B;  3B6F D;  3VH5 W;  4QLC B;  4J8W C;  5CPK D;  1TZY D;  5CP6 C;  3P5J B;  3AZL C;  3MGP D;  5E5A B;  1KX3 A;  4G92 C;  5B2J C;  5AV9 C;  5KDM A;  3LZ1 D;  3AV2 B;  1P3K C;  5F99 C;  4WZS B;  1P3B D;  2YFW A;  1M19 D;  4KUD B;  4R8P D;  3REJ C;  4J8V C;  5DNN B;  3A1K A;  1M18 B;  3H0R C;  5CPI A;  3MVD D;  1P3O D;  2J8P A;  4KHA A;  4R8P C;  2F2A C;  3C1C D;  4LD9 C;  3KSY A;  2BG1 A;  1P3L D;  2PYO C;  5C3I C;  5JA4 A;  4YS3 C;  4Z66 A;  3W99 B;  5AY8 C;  5GSU D;  3MGQ C;  5BT1 D;  4KHA B;  3X1V D;  1U35 A;  2NZD A;  2HIO A;  4E44 A;  3LZ0 B;  3LEL B;  1ZLA D;  1N1J B;  2Y2O A;  3X1V C;  4NFT A;  4WU8 D;  4UPK A;  3AZF C;  3AN2 D;  2YFV A;  3AFA C;  3LJA C;  5BO0 B;  4J8X C;  2L5A A;  1F66 C;  5JRG A;  3AV1 B;  3AYW B;  1B67 A;  1P3M A;  1M18 C;  5DNN C;  3C1C B;  3AZM C;  1P34 B;  3MGS A;  3REJ B;  3VH5 A;  1P3F A;  3X1S B;  3LZ0 A;  3AZH B;  3WKJ A;  5F99 B;  5B0Z C;  3O62 A;  1H3O A;  5BO0 A;  1P3K A;  4CAY A;  5B32 D;  4J8U A;  3AV2 C;  5AV9 B;  4G92 B;  1TZY C;  2DQN C;  5CP6 D;  3REL D;  3AZL D;  4KUD D;  3KFU G;  5CP6 B;  3AZL B;  1P3B B;  5AV6 A;  5B31 C;  3TU4 A;  1P3G B;  4H9P B;  5AV9 D;  5CHL B;  5B40 D;  3AV2 D;  2Y2M A;  2Y2K A;  1JFI B;  5GXQ A;  3REI C;  5F99 D;  5B1L A;  1P3B C;  5B24 A;  3R45 B;  3X1S D;  1TZY B;  3AZH D;  1P34 A;  1WWI A;  5GT3 B;  4NE6 A;  3VH6 T;  5B0Z B;  5CPK C;  4WU8 C;  3KXB A;  5B33 D;  3AZM B;  5B2J D;  1KX4 A;  4J8X D;  1KX5 B;  1F66 D;  3AZI B;  2ZY3 A;  2Y2L A;  1M1A B;  2VQR A;  2NQB A;  5JRG C;  3AZE C;  3KUY C;  1ID3 D;  1P3A B;  3WAA D;  1HQ3 C;  4HGA C;  4X23 D;  4XZQ D;  4ZBJ B;  4XUJ A;  5AV5 A;  1ZLA B;  4H9N A;  4AWL C;  1ULY A;  2RIQ A;  3WTP D;  3AZF B;  1KX3 C;  1PZR A;  3X1V B;  3KWQ D;  4CSR A;  1S32 B;  2FJ7 C;  5B32 C;  1KX4 B;  5G49 A;  3H0M C;  3V9R A;  4Z5T C;  2CV5 D;  4H9S C;  1M1A A;  5GT0 C;  1AOI D;  3W97 D;  2NQB B;  5B1M A;  4UUZ B;  1KX5 A;  1P3L B;  4KGC A;  4YS3 D;  3X1U A;  3AZK D;  5CPJ C;  3LEL A;  4JJN D;  3W99 C;  5GT0 D;  4YM6 A;  1P3P A;  5CPJ A;  5GXQ C;  3REI A;  2PYO B;  3MVD B;  1P3O B;  5AV8 D;  3W98 D;  3AZJ A;  3AZJ D;  1M18 D;  2Y2I A;  1S32 A;  1HQ3 B;  5DNM B;  2G5I C;  4R8P B;  2ARO B;  5JRG B;  4G91 C;  3AV1 A;  5AV6 C;  3KXB C;  5B31 A;  2BYK A;  3AFA D;  2FFF B;  3VH6 W;  5AVC D;  3NQU B;  3W96 D;  4H9Q B;  2ARO D;  1EQZ C;  1HQ3 D;  5E5A D;  4XZQ C;  1BH8 B;  3AZE A;  5CPK B;  5B0Y A;  4YM6 B;  1P3P B;  2CV5 A;  3W98 B;  4XUJ C;  5AV5 C;  1P3K B;  3WTP C;  3B6F B;  3A1I A;  2NZD C;  2BYM B;  3FDD A;  3KWQ A;  2PYO D;  1EQZ D;  5E5A C;  5B0Y D;  3LJA A;  4J8W B;  4H9P A;  5GSU C;  5E5A A;  4XUJ D;  5AV5 D;  2ARO A;  3AZG D;  4X23 A;  1JFI A;  2HIO B;  5B31 B;  3VH5 T;  3UTA A;  1Q9C A;  5B24 B;  1BH8 A;  3REK B;  2NQB D;  4H9O A;  5BNV B;  4JJN C;  3UTA C;  4H9Q A;  2CV5 B;  4J8V D;  1P3F C;  1KX4 D;  3AZN B;  2JE5 A;  4Z2M H;  3A6N A;  1S32 D;  3C1B A;  5B0Z A;  3MGR A;  1M18 A;  3W98 A;  3AZH C;  3X1S C;  3C1C C;  4X23 B;  3AYW A;  5GT0 A;  3MNN A;  3MNN D;  3WKJ B;  4LD9 A;  3AYW C;  4LD9 D;  3AV1 C;  3AZK A;  3X1U D;  5BNV A;  3AZI D;  3MGS B;  3REJ A;  4YS3 A;  1F66 B;  3WA9 A;  4J8X B;  5JA4 B;  1KX5 D;  3AZM D;  3AZN A;  5B33 B;  3TU4 D;  4DRB A;  3B0C W;  5BNX B;  3REL A;  5B0Z D;  3C1B D;  5B2I A;  3WTP A;  3TU4 B;  1P3G A;  3B0D B;  3MGS D;  3UTB C;  2Y2G A;  3AZG A;  3X1U B;  5B40 B;  3WAA A;  3MGQ B;  1TAF A;  1P3G D;  5AY8 B;  4NE5 A;  3LJA D;  3UT9 C;  2CWE A;  3REL B;  1F66 A;  1EQZ A;  1Z2C B;  4WU9 C;  5B2I D;  5B33 A;  3KXB D;  4Z2M G;  1R4V A;  5AVC C;  3AZM A;  3AZN D;  3WA9 D;  1T3U A;  3REJ D;  1P34 D;  3AZI A;  4H9S A;  5B24 D;  3NQJ A;  2RVQ C;  4H9N B;  3O62 C;  3AFA A;  5F99 A;  3UT9 B;  5B31 D;  2HIO D;  2NZD D;  3AYW D;  3AV1 D;  3X1U C;  4KUD C;  1TAF B;  5AV6 D;  1P3P D;  5B0Y B;  3B0D C;  3TU4 C;  1P3M C;  4KUD A;  3MGR D;  5AV8 A;  3AN2 B;  3A6N D;  2Y2J A;  4J8V A;  1P3K D;  3REI D;  1P3L A;  4KGC B;  3V9R B;  3AL0 C;  4YM6 D;  1HTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...