5GT3C

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3C00
3AFAD 1N1JB 5CPJD 2IO5C 1BH9B 3REID 2RVQD 5DNND 3NQUB 3UTAC 4H9RA 2JSSA 3NQJB 3MVDC 3LJAA 3KUYB 1HQ3D 4ZUXB 1AOIA 5CPIC 2YFWB 4J8WC 5B24B 4YM6B 1P3PB 1P3OA 4JJNB 3C1CC 3B0DC 3MGSA 4Z66C 1P3BC 5B0ZB 5CPKD 3O62C 3AZHB 5GSUC 3RELA 5B2JA 3MGRC 2BYKB 3KWQA 4XUJB 3AZFB 1P3GC 5B24A 1P3MD 1M19C 2L5AA 4WU8A 1EQZA 1AOID 2NZDD 3X1TB 5AV6B 1B6WA 5F99B 5GXQD 4H9OB 3AZLB 1F66C 5BNXB 5B2IC 5CPJC 4KHAA 1U35C 3RELD 4J8VB 5B2JD 1KU5A 4EO5C 5E5AC 1P3KD 5B33C 5BS7A 3KWQD 3B6GA 3AV1B 1P3FD 5B0YC 4WU9D 3X1UB 5GT3C 3AZJA 3AYWB 1WWIA 5AVBA 4WU8D 1EQZD 3AZNB 1TAFB 5AY8C 3AV2A 5B32B 4Z2MH 5CPKC 5GT0A 5B31A 1KX3C 5G49A 2YFVB 3B0CW 4QLCB 3REJA 3LELB 3LJAC 1M18A 1S32A 5FUGB 3B0CT 5B40B 3B6GD 3LZ0A 3B6FA 3WAAA 4UUZB 3MGPC 3W98D 3X1VB 1P3OC 5B31G 3AZJD 1JFIA 3MGSC 3AV2D 1F1EA 2CV5B 3UTAA 4R8PA 5JRGA 5GT0D 3RELC 5B2JC 5CPIA 1B67A 4ZUXC 4J8XB 5BO0B 3A6NB 5B24C 1M18D 4Z66A 2HIOA 4JJNC 4WU8C 3B6FD 3WAAD 3W99B 4ZBJB 3WTPD 5AV5D 1H3OB 4H9NA 5GSUA 5B0ZC 3TU4B 2PYOB 1P3IB 4H9PB 3UTAD 5JRGD 3MVDD 4XUJC 1P34A 2AROB 5CPID 3UT9A 5AV9B 3REHA 4NE6A 5AV6C 4Z66D 1F66A 3AZJC 5AVBC 3MGQB 5B2IA 1ID3B 3W96A 4DRBA 3REKB 5B1LA 1BH8B 3AZLC 5AV8B 5CP6B 3O62D 1U35A 5GSUD 4YS3A 5B31C 1ULYA 3AZKB 4H9SA 3MGRD 5B33A 1WWSA 4E45A 3X1SA 4LD9B 5B0YA 3WA9A 4XZQB 4CSRB 1M19D 3REJC 1KX5B 3X1UC 1M18C 4AWLB 1S32C 3UT9D 5AY8A 3AYWC 3LZ0C 3AZNC 3MNNA 4KGCB 1F66D 1KX4A 2FJ7B 5B2ID 3W96D 1P3LB 5C3IC 1U35D 4R8PC 5JRGC 4QLCC 5E5AD 4KUDA 5B33D 5BNVB 5B0YD 3WA9D 3MGPA 1P3MB 3C1BA 5GT3D 2NZDB 2HIOC 5AY8D 2FJ7A 1N1JA 3MNND 1BH9A 1KX3D 3NQUA 3AZMB 3AZGB 3NQJA 4WZSB 3KUYA 4ZUXA 4G92B 1M1AB 3UTBB 2YFWA 2LY8A 1P3KB 4YM6A 3LJAD 1P3PA 4KUDD 1P34C 4JJNA 4J8XC 3A6NC 1ZLAB 1P3FB 3UT9C 4WU9B 3MGPD 5B0ZA 3REHC 3W99C 3WKJB 3C1BD 1P3OD 3LZ1B 3AZHA 4DRAA 3MGSD 3TU4C 3W96C 5B1LC 2BYKA 1BFMA 4XUJA 2BYMB 3AZFA 4YS3C 4J8UB 4H9SC 3KUYD 3AZEB 4ZUXD 3X1SC 3W97B 3WA9C 3X1TA 3WKJA 5B24D 5AV6A 5F99A 5DNMB 4JJND 4H9OA 3AZLA 3W98B 5BNXA 5B0ZD 3MGQC 4X23B 3MNNC 3VH5A 3AZHD 4J8VA 1KX4C 3AN2B 4XUJD 3AV1A 5AVCB 4LD9C 4XZQC 3X1UA 1A7WA 4KUDC 1TZYB 3AYWA 1KX5C 4WNNB 3AZIB 1Q9CA 3AZNA 4AWLC 1TAFA 3X1TD 3WTPE 5B32A 5AV6D 3C1BC 4X23A 5F99D 5AVBD 2HUEC 2YFVA 3WTPB 3AZLD 4Z5TB 5AV5B 3R45B 2FJ7C 2F8NB 1P3LC 4QLCA 5B31D 5BT1C 2IO5B 4J8VD 5B1MB 3LELA 5FUGA 3KUYC 5B40A 3MVDB 4UUZA 3REJD 3X1UD 5B32G 4YM6C 1P3PC 4J8WB 3X1VA 1S32D 3AYWD 3LZ0D 3AZND 4WV4B 4G91B 3C1CB 2CV5A 3B0DB 1P3BB 3AZHC 3AZGC 3VH6A 3O62B 4R8PD 4QLCD 3MGRB 4G92C 3AZFC 3KXBB 3UTBC 4J8XA 1M1AC 5BO0A 3A6NA 3LELD 1P3GB 3W99A 1M19B 1ZLAC 3X1TC 1H3OA 1P3AB 3WKJC 2NQBB 2HIOD 5F99C 3TU4A 2PYOA 3V9RB 1P3IA 5KDMB 4H9QB 4H9PA 3AFAB 5CPJB 3REIB 5JA4B 4J8VC 5DNNB 2AROA 4J8UC 5E5AB 5AV9A 3AV1C 4M6BA 1HQ3B 1P34D 3W97C 4J8XD 3A6ND 1R4VA 5DNMC 3REHD 3MGQA 3W99D 1ID3A 3REKA 5GT3B 1BH8A 5CP6A 5AV8A 5B32C 4X23C 3TU4D 4CAYB 3AZKA 2PYOD 5CPKB 1P3ID 5B1LD 4LD9A 4YS3D 4XZQA 4CSRA 1KX5A 2CWEA 2AROD 3X1SD 3LELC 4H9RB 1TZYC 5B40C 3LJAB 3AZIC 1AOIB 3X1VC 4KGCA 3MGQD 1ID3D 3REKD 1P3LA 1P3OB 1KX3A 5GXQB 4Z5TC 5CP6D 5AV8D 3MGSB 2CV5C 4HGAB 1KX4D 3AZKD 5BNVA 3RELB 5B1MC 4LD9D 5B2JB 4XZQD 1P3MA 5CHLB 3KWQB 1KX5D 2NZDA 4ZBJC 4WU8B 3VH5W 3B0BA 5GXQA 4G91C 1EQZB 3AZMA 4KGCD 3AZGA 2PYOC 2FJ7D 1P3IC 1P3LD 4NE5A 3VH5T 5BT1D 1M1AA 3UTBA 1P3KA 4KHAB 3KXBC 2AROC 1ZLAA 1P3FA 4WU9A 5AV9C 4YM6D 1P3PD 1HTAA 3LZ1A 3B6GB 1P3AC 2NQBC 1ID3C 3REKC 3AZJB 5AVBB 5CP6C 5AV8C 2BYMA 3AFAC 3AZMD 3AV2B 3AZGD 3AZKC 4J8UA 5GT0B 3REIC 2F8NK 5B31B 2RVQC 5DNNC 5G49B 3AZEA 3AZFD 1M1AD 3W97A 3UTBD 4NE3A 1HQ3C 5DNMA 1ZLAD 3REJB 3W98A 3WKJD 1M18B 1S32B 3B6FB 3LZ0B 3LZ1D 3WAAB 4KGCC 4Z2MG 3VH6W 3AN2A 1JFIB 5AVCA 5C3IB 3UTAB 4R8PB 5JRGB 3VH6T 4J8UD 1TZYA 3AZED 3AV1D 4WNNA 3AZIA 3W97D 5CPIB 1P3MC 5DNMD 1AOIC 2NZDC 3WTPA 4Z5TA 5AV5A 3R45A 5B32D 4Z66B 2F8NA 2HIOB 4X23D 5GXQC 3AZMC 4HGAC 4H9NB 5GSUB 5B1MA 3AN2D 3MVDA 5AVCD 1P3KC 4J8WA 1TZYD 5B40D 3KWQC 3AZID 1P34B 1P3FC 3C1CA 4WU9C 2F8NG 3UT9B 3X1VD 1P3BA 3REHB 3LZ1C 1EQZC 2F8NH 4E44A 4Z5TD 3O62A 2CV5D 1F66B 2F8ND 5B2IB 3W96B 3MGRA 5B1LB 3KXBA 1U35B 5B1MD 4YS3B 4EO5B 1P3GA 3AZEC 5B33B 1M19A 3X1SB 1P3AA 2NQBA 5B0YB 4J8WD 3WA9B 5BS7C 3B6GC 3V9RA 3KSYA 4NFTA 5KDMA 3C1CD 4H9QA 3W98C 3AFAA 5AY8B 1P3BD 5CPJA 3MNNB 5JA4A 3REIA 1KX3B 3AV2C 5DNNA 5GT0C 1KX4B 3AN2C 5E5AA 5AVCC 1HQ3A 3KXBD 1P3GD 5AV9D 4KUDB 5GT3A 1P3AD 2NQBD 4CAYA 3MGPB 3B6FC 3WAAC 3C1BB 5CPKA 3WTPC 2HUEB 5AV5C
chains in the Genus database with same CATH superfamily
3AFAD 1N1JB 5CPJD 2IO5C 1BH9B 3REID 2RVQD 5DNND 3NQUB 3UTAC 4H9RA 2JSSA 3NQJB 3MVDC 3LJAA 2ZY2A 3KUYB 1HQ3D 4ZUXB 1AOIA 5CPIC 2YFWB 4J8WC 2G5IC 5B24B 4YM6B 1P3PB 3A1KA 4JJNB 1P3OA 3C1CC 3B0DC 3MGSA 4Z66C 1P3BC 5B0ZB 5CPKD 3O62C 3AZHB 5GSUC 3RELA 5B2JA 3MGRC 2BYKB 3KWQA 4XUJB 3EPHA 3AZFB 1P3GC 5B24A 1P3MD 1M19C 2L5AA 4WU8A 1EQZA 1AOID 2NZDD 3X1TB 5AV6B 1B6WA 5F99B 5GXQD 4H9OB 3AZLB 1F66C 5BNXB 5B2IC 5CPJC 3F6TA 4KHAA 1U35C 3RELD 4J8VB 5B2JD 1KU5A 4EO5C 5E5AC 1P3KD 5B33C 5BS7A 3KWQD 3B6GA 3AV1B 1P3FD 5B0YC 4WU9D 3X1UB 2DQNC 3EPJA 5GT3C 3AZJA 3AYWB 1WWIA 5AVBA 4WU8D 1EQZD 3AZNB 1TAFB 5AY8C 3AV2A 5B32B 4Z2MH 5CPKC 5GT0A 3KFUG 5B31A 1KX3C 5G49A 2VQRA 2YFVB 3B0CW 4QLCB 3REJA 3LELB 3LJAC 1M18A 1S32A 5FUGB 3B0CT 5B40B 3B6GD 3LZ0A 3B6FA 3WAAA 4UUZB 3MGPC 3W98D 3X1VB 1P3OC 5B31G 3AZJD 1JFIA 3MGSC 1W2EA 3AV2D 1F1EA 2CV5B 3UTAA 4R8PA 5JRGA 5GT0D 2Y2LA 3RELC 5B2JC 5CPIA 1B67A 4ZUXC 2G5HC 4J8XB 5BO0B 3A6NB 5B24C 1M18D 3IP4C 4Z66A 2HIOA 4JJNC 4WU8C 3B6FD 3WAAD 3W99B 4ZBJB 3WTPD 5AV5D 1H3OB 4H9NA 5GSUA 5B0ZC 3TU4B 2PYOB 1P3IB 4H9PB 3UTAD 5JRGD 3MVDD 4XUJC 1P34A 2AROB 3P5JB 5CPID 3UT9A 5AV9B 3REHA 2Y2KA 4NE6A 5AV6C 4Z66D 1F66A 3AZJC 5AVBC 3MGQB 5B2IA 1ID3B 3W96A 4DRBA 3REKB 5B1LA 1BH8B 3AZLC 5AV8B 5CP6B 3O62D 1U35A 5GSUD 4YS3A 5B31C 1ULYA 3AZKB 4H9SA 3MGRD 5B33A 1WWSA 4E45A 3X1SA 4LD9B 5B0YA 3WA9A 4XZQB 4CSRB 1M19D 3REJC 1KX5B 2Y2HA 3X1UC 1M18C 4AWLB 1S32C 3UT9D 5AY8A 3AYWC 3LZ0C 3AZNC 3MNNA 4KGCB 1F66D 1KX4A 2FJ7B 5B2ID 3W96D 1P3LB 5C3IC 1U35D 4R8PC 5JRGC 4QLCC 5E5AD 4KUDA 5B33D 5BNVB 5B0YD 3WA9D 3MGPA 1P3MB 3C1BA 5GT3D 4WJ3C 2NZDB 2HIOC 5AY8D 2FJ7A 1N1JA 3MNND 1BH9A 1KX3D 2XD5A 3NQUA 3AZMB 3AZGB 3NQJA 4WZSB 3KUYA 4ZUXA 4G92B 1M1AB 3UTBB 2YFWA 2LY8A 1P3KB 4YM6A 3LJAD 1P3PA 4KUDD 1P34C 4JJNA 4J8XC 3A6NC 1ZLAB 1P3FB 3UT9C 4WU9B 3MGPD 5B0ZA 3REHC 2Y2JA 3W99C 3C1BD 3WKJB 1P3OD 3LZ1B 3AZHA 4DRAA 3MGSD 3TU4C 3W96C 5B1LC 2BYKA 1BFMA 4XUJA 2BYMB 3AZFA 4YS3C 3EPKA 4H9SC 4J8UB 3A1IA 3KUYD 3AZEB 4UPKA 4ZUXD 3X1SC 3W97B 2XD1A 3WA9C 3X1TA 3WKJA 5B24D 5AV6A 5F99A 5DNMB 4JJND 2Y2QA 4H9OA 3AZLA 3H0LC 3W98B 5BNXA 5B0ZD 3MGQC 4X23B 3MNNC 3VH5A 3AZHD 4J8VA 1KX4C 3AN2B 4XUJD 3AV1A 5AVCB 4LD9C 4XZQC 3X1UA 1A7WA 4KUDC 1TZYB 3AYWA 1KX5C 4WNNB 3AZIB 1Q9CA 3AZNA 3AL0C 4AWLC 1TAFA 3X1TD 3WTPC 5B32A 5AV6D 3C1BC 4X23A 5F99D 5AVBD 2HUEC 3FDDA 2YFVA 3WTPB 3AZLD 4Z5TB 5AV5B 3R45B 2FJ7C 2F8NB 1P3LC 4QLCA 5B31D 5BT1C 2IO5B 4J8VD 5B1MB 3LELA 2W8SA 5FUGA 3KUYC 2ZY3A 5B40A 3MVDB 4UUZA 3REJD 3X1UD 5B32G 4YM6C 1P3PC 4J8WB 3X1VA 1S32D 3AYWD 3LZ0D 3AZND 4WV4B 4G91B 3C1CB 2CV5A 3B0DB 3H0MC 1P3BB 3AZHC 3AZGC 3VH6A 3O62B 4R8PD 4QLCD 3MGRB 4G92C 3AZFC 3KXBB 3UTBC 4J8XA 1M1AC 5BO0A 3A6NA 3LELD 1P3GB 3W99A 1M19B 1ZLAC 2ZY4A 3X1TC 1H3OA 1P3AB 3WKJC 2NQBB 2HIOD 5F99C 3TU4A 2PYOA 3V9RB 1P3IA 5KDMB 4H9QB 4H9PA 3AFAB 5CPJB 3REIB 5JA4B 4J8VC 2ZM5A 5DNNB 2AROA 4J8UC 1Z2CB 5E5AB 5AV9A 3AV1C 4M6BA 1HQ3B 1P34D 3W97C 4J8XD 3A6ND 1R4VA 3H0RC 5DNMC 3REHD 3MGQA 3W99D 1ID3A 3REKA 5GT3B 1BH8A 5CP6A 5AV8A 5B32C 4X23C 3TU4D 4CAYB 3AZKA 2PYOD 5CPKB 2Y2MA 1P3ID 5B1LD 2Y2PA 4LD9A 4YS3D 4XZQA 4CSRA 1KX5A 2CWEA 2AROD 3X1SD 3LELC 4H9RB 1TZYC 5B40C 3LJAB 3AZIC 1AOIB 2Y2NA 3X1VC 4KGCA 3MGQD 1ID3D 3REKD 1P3LA 1P3OB 1KX3A 5GXQB 4Z5TC 5CP6D 5AV8D 3MGSB 2CV5C 4HGAB 1KX4D 3AZKD 5BNVA 3RELB 5B1MC 4LD9D 5B2JB 4XZQD 1P3MA 5CHLB 3KWQB 1KX5D 2NZDA 4ZBJC 3VH5W 3B0BA 4G91C 4WU8B 5GXQA 1EQZB 3AZMA 1PZRA 3AZGA 4KGCD 2PYOC 2FJ7D 1P3IC 1P3LD 4NE5A 3VH5T 5BT1D 1M1AA 3UTBA 1P3KA 4KHAB 3KXBC 2AROC 1ZLAA 1P3FA 4WU9A 5AV9C 4YM6D 1P3PD 2BG1A 1HTAA 3LZ1A 3B6GB 1P3AC 2NQBC 1ID3C 3REKC 3AZJB 5AVBB 2UWXA 5AV8C 5CP6C 2BYMA 3AFAC 3AZMD 3AV2B 3AZGD 3AZKC 4J8UA 5GT0B 3REIC 2F8NK 5B31B 2RVQC 5DNNC 5G49B 3AZEA 3AZFD 1M1AD 2Y2IA 3W97A 3UTBD 4NE3A 1HQ3C 5DNMA 1ZLAD 3REJB 2RIQA 3WKJD 1M18B 2F2AC 3W98A 1S32B 2J8PA 3B6FB 3LZ0B 3LZ1D 3WAAB 2Y2GA 4KGCC 4Z2MG 3VH6W 3AN2A 1JFIB 5AVCA 5C3IB 3UTAB 4R8PB 5JRGB 3VH6T 4J8UD 1TZYA 3AZED 3AV1D 4WNNA 2DF4C 3AZIA 3W97D 5CPIB 1P3MC 3EG5B 5DNMD 1AOIC 2NZDC 3WTPA 4Z5TA 5AV5A 2ZY5A 3R45A 5B32D 4Z66B 2F8NA 2HIOB 4X23D 5GXQC 3EPLA 3AZMC 4HGAC 4H9NB 5GSUB 5B1MA 3AN2D 3MVDA 5AVCD 1P3KC 4J8WA 1TZYD 5B40D 3KWQC 3AZID 1P34B 1P3FC 3C1CA 4WU9C 2F8NG 3UT9B 3X1VD 1P3BA 3REHB 3LZ1C 1EQZC 2F8NH 4E44A 4Z5TD 3O62A 2CV5D 1F66B 2F8ND 2JE5A 5B2IB 3W96B 3MGRA 5B1LB 3KXBA 1U35B 5B1MD 4YS3B 4EO5B 1P3GA 3AZEC 4DQYB 5B33B 1M19A 3X1SB 1P3AA 2NQBA 5B0YB 4J8WD 3WA9B 5BS7C 2Y2OA 3B6GC 3V9RA 3KSYA 4NFTA 5KDMA 3C1CD 4H9QA 3W98C 3AFAA 5AY8B 1P3BD 5CPJA 2FFFB 3MNNB 5JA4A 3REIA 1KX3B 3AV2C 5DNNA 5GT0C 1KX4B 3AN2C 5E5AA 1T3UA 5AVCC 1HQ3A 3KXBD 1P3GD 5AV9D 4KUDB 5GT3A 1P3AD 2NQBD 2JCHA 4CAYA 3MGPB 3B6FC 3WAAC 3C1BB 5CPKA 3WTPE 2HUEB 5AV5C
chains in the Genus database with same CATH topology
3AFAD 1N1JB 5CPJD 2IO5C 1BH9B 3REID 2RVQD 5DNND 3NQUB 3UTAC 4H9RA 2JSSA 3NQJB 3MVDC 3LJAA 2ZY2A 3KUYB 1HQ3D 4ZUXB 1AOIA 5CPIC 2YFWB 4J8WC 2G5IC 5B24B 4YM6B 1P3PB 3A1KA 4JJNB 1P3OA 3C1CC 3B0DC 3MGSA 4Z66C 1P3BC 5B0ZB 5CPKD 3O62C 3AZHB 5GSUC 3RELA 5B2JA 3MGRC 2BYKB 3KWQA 4XUJB 3EPHA 3AZFB 1P3GC 5B24A 1P3MD 1M19C 2L5AA 4WU8A 1EQZA 1AOID 2NZDD 3X1TB 5AV6B 1B6WA 5F99B 5GXQD 4H9OB 3AZLB 1F66C 5BNXB 5B2IC 5CPJC 3F6TA 4KHAA 1U35C 3RELD 4J8VB 5B2JD 1KU5A 4EO5C 5E5AC 1P3KD 5B33C 5BS7A 3KWQD 3B6GA 3AV1B 1P3FD 5B0YC 4WU9D 3X1UB 2DQNC 3EPJA 5GT3C 3AZJA 3AYWB 1WWIA 5AVBA 4WU8D 1EQZD 3AZNB 1TAFB 5AY8C 3AV2A 5B32B 4Z2MH 5CPKC 5GT0A 3KFUG 5B31A 1KX3C 5G49A 2VQRA 2YFVB 3B0CW 4QLCB 3REJA 3LELB 3LJAC 1M18A 1S32A 5FUGB 3B0CT 5B40B 3B6GD 3LZ0A 3B6FA 3WAAA 4UUZB 3MGPC 3W98D 3X1VB 1P3OC 5B31G 3AZJD 1JFIA 3MGSC 1W2EA 3AV2D 1F1EA 2CV5B 3UTAA 4R8PA 5JRGA 5GT0D 2Y2LA 3RELC 5B2JC 5CPIA 1B67A 4ZUXC 2G5HC 4J8XB 5BO0B 3A6NB 5B24C 1M18D 3IP4C 4Z66A 2HIOA 4JJNC 4WU8C 3B6FD 3WAAD 3W99B 4ZBJB 3WTPD 5AV5D 1H3OB 4H9NA 5GSUA 5B0ZC 3TU4B 2PYOB 1P3IB 4H9PB 3UTAD 5JRGD 3MVDD 4XUJC 1P34A 2AROB 3P5JB 5CPID 3UT9A 5AV9B 3REHA 2Y2KA 4NE6A 5AV6C 4Z66D 1F66A 3AZJC 5AVBC 3MGQB 5B2IA 1ID3B 3W96A 4DRBA 3REKB 5B1LA 1BH8B 3AZLC 5AV8B 5CP6B 3O62D 1U35A 5GSUD 4YS3A 5B31C 1ULYA 3AZKB 4H9SA 3MGRD 5B33A 1WWSA 4E45A 3X1SA 4LD9B 5B0YA 3WA9A 4XZQB 4CSRB 1M19D 3REJC 1KX5B 2Y2HA 3X1UC 1M18C 4AWLB 1S32C 3UT9D 5AY8A 3AYWC 3LZ0C 3AZNC 3MNNA 4KGCB 1F66D 1KX4A 2FJ7B 5B2ID 3W96D 1P3LB 5C3IC 1U35D 4R8PC 5JRGC 4QLCC 5E5AD 4KUDA 5B33D 5BNVB 5B0YD 3WA9D 3MGPA 1P3MB 3C1BA 5GT3D 4WJ3C 2NZDB 2HIOC 5AY8D 2FJ7A 1N1JA 3MNND 1BH9A 1KX3D 2XD5A 3NQUA 3AZMB 3AZGB 3NQJA 4WZSB 3KUYA 4ZUXA 4G92B 1M1AB 3UTBB 2YFWA 2LY8A 1P3KB 4YM6A 3LJAD 1P3PA 4KUDD 1P34C 4JJNA 4J8XC 3A6NC 1ZLAB 1P3FB 3UT9C 4WU9B 3MGPD 5B0ZA 3REHC 2Y2JA 3W99C 3C1BD 3WKJB 1P3OD 3LZ1B 3AZHA 4DRAA 3MGSD 3TU4C 3W96C 5B1LC 2BYKA 1BFMA 4XUJA 2BYMB 3AZFA 4YS3C 3EPKA 4H9SC 4J8UB 3A1IA 3KUYD 3AZEB 4UPKA 4ZUXD 3X1SC 3W97B 2XD1A 3WA9C 3X1TA 3WKJA 5B24D 5AV6A 5F99A 5DNMB 4JJND 2Y2QA 4H9OA 3AZLA 3H0LC 3W98B 5BNXA 5B0ZD 3MGQC 4X23B 3MNNC 3VH5A 3AZHD 4J8VA 1KX4C 3AN2B 4XUJD 3AV1A 5AVCB 4LD9C 4XZQC 3X1UA 1A7WA 4KUDC 1TZYB 3AYWA 1KX5C 4WNNB 3AZIB 1Q9CA 3AZNA 3AL0C 4AWLC 1TAFA 3X1TD 3WTPC 5B32A 5AV6D 3C1BC 4X23A 5F99D 5AVBD 2HUEC 3FDDA 2YFVA 3WTPB 3AZLD 4Z5TB 5AV5B 3R45B 2FJ7C 2F8NB 1P3LC 4QLCA 5B31D 5BT1C 2IO5B 4J8VD 5B1MB 3LELA 2W8SA 5FUGA 3KUYC 2ZY3A 5B40A 3MVDB 4UUZA 3REJD 3X1UD 5B32G 4YM6C 1P3PC 4J8WB 3X1VA 1S32D 3AYWD 3LZ0D 3AZND 4WV4B 4G91B 3C1CB 2CV5A 3B0DB 3H0MC 1P3BB 3AZHC 3AZGC 3VH6A 3O62B 4R8PD 4QLCD 3MGRB 4G92C 3AZFC 3KXBB 3UTBC 4J8XA 1M1AC 5BO0A 3A6NA 3LELD 1P3GB 3W99A 1M19B 1ZLAC 2ZY4A 3X1TC 1H3OA 1P3AB 3WKJC 2NQBB 2HIOD 5F99C 3TU4A 2PYOA 3V9RB 1P3IA 5KDMB 4H9QB 4H9PA 3AFAB 5CPJB 3REIB 5JA4B 4J8VC 2ZM5A 5DNNB 2AROA 4J8UC 1Z2CB 5E5AB 5AV9A 3AV1C 4M6BA 1HQ3B 1P34D 3W97C 4J8XD 3A6ND 1R4VA 3H0RC 5DNMC 3REHD 3MGQA 3W99D 1ID3A 3REKA 5GT3B 1BH8A 5CP6A 5AV8A 5B32C 4X23C 3TU4D 4CAYB 3AZKA 2PYOD 5CPKB 2Y2MA 1P3ID 5B1LD 2Y2PA 4LD9A 4YS3D 4XZQA 4CSRA 1KX5A 2CWEA 2AROD 3X1SD 3LELC 4H9RB 1TZYC 5B40C 3LJAB 3AZIC 1AOIB 2Y2NA 3X1VC 4KGCA 3MGQD 1ID3D 3REKD 1P3LA 1P3OB 1KX3A 5GXQB 4Z5TC 5CP6D 5AV8D 3MGSB 2CV5C 4HGAB 1KX4D 3AZKD 5BNVA 3RELB 5B1MC 4LD9D 5B2JB 4XZQD 1P3MA 5CHLB 3KWQB 1KX5D 2NZDA 4ZBJC 3VH5W 3B0BA 4G91C 4WU8B 5GXQA 1EQZB 3AZMA 1PZRA 3AZGA 4KGCD 2PYOC 2FJ7D 1P3IC 1P3LD 4NE5A 3VH5T 5BT1D 1M1AA 3UTBA 1P3KA 4KHAB 3KXBC 2AROC 1ZLAA 1P3FA 4WU9A 5AV9C 4YM6D 1P3PD 2BG1A 1HTAA 3LZ1A 3B6GB 1P3AC 2NQBC 1ID3C 3REKC 3AZJB 5AVBB 2UWXA 5AV8C 5CP6C 2BYMA 3AFAC 3AZMD 3AV2B 3AZGD 3AZKC 4J8UA 5GT0B 3REIC 2F8NK 5B31B 2RVQC 5DNNC 5G49B 3AZEA 3AZFD 1M1AD 2Y2IA 3W97A 3UTBD 4NE3A 1HQ3C 5DNMA 1ZLAD 3REJB 2RIQA 3WKJD 1M18B 2F2AC 3W98A 1S32B 2J8PA 3B6FB 3LZ0B 3LZ1D 3WAAB 2Y2GA 4KGCC 4Z2MG 3VH6W 3AN2A 1JFIB 5AVCA 5C3IB 3UTAB 4R8PB 5JRGB 3VH6T 4J8UD 1TZYA 3AZED 3AV1D 4WNNA 2DF4C 3AZIA 3W97D 5CPIB 1P3MC 3EG5B 5DNMD 1AOIC 2NZDC 3WTPA 4Z5TA 5AV5A 2ZY5A 3R45A 5B32D 4Z66B 2F8NA 2HIOB 4X23D 5GXQC 3EPLA 3AZMC 4HGAC 4H9NB 5GSUB 5B1MA 3AN2D 3MVDA 5AVCD 1P3KC 4J8WA 1TZYD 5B40D 3KWQC 3AZID 1P34B 1P3FC 3C1CA 4WU9C 2F8NG 3UT9B 3X1VD 1P3BA 3REHB 3LZ1C 1EQZC 2F8NH 4E44A 4Z5TD 3O62A 2CV5D 1F66B 2F8ND 2JE5A 5B2IB 3W96B 3MGRA 5B1LB 3KXBA 1U35B 5B1MD 4YS3B 4EO5B 1P3GA 3AZEC 4DQYB 5B33B 1M19A 3X1SB 1P3AA 2NQBA 5B0YB 4J8WD 3WA9B 5BS7C 2Y2OA 3B6GC 3V9RA 3KSYA 4NFTA 5KDMA 3C1CD 4H9QA 3W98C 3AFAA 5AY8B 1P3BD 5CPJA 2FFFB 3MNNB 5JA4A 3REIA 1KX3B 3AV2C 5DNNA 5GT0C 1KX4B 3AN2C 5E5AA 1T3UA 5AVCC 1HQ3A 3KXBD 1P3GD 5AV9D 4KUDB 5GT3A 1P3AD 2NQBD 2JCHA 4CAYA 3MGPB 3B6FC 3WAAC 3C1BB 5CPKA 3WTPE 2HUEB 5AV5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA D;  1N1J B;  5CPJ D;  2IO5 C;  1BH9 B;  3REI D;  2RVQ D;  5DNN D;  3NQU B;  3UTA C;  4H9R A;  2JSS A;  3NQJ B;  3MVD C;  3LJA A;  3KUY B;  1HQ3 D;  4ZUX B;  1AOI A;  5CPI C;  2YFW B;  4J8W C;  5B24 B;  4YM6 B;  1P3P B;  1P3O A;  4JJN B;  3C1C C;  3B0D C;  3MGS A;  4Z66 C;  1P3B C;  5B0Z B;  5CPK D;  3O62 C;  3AZH B;  5GSU C;  3REL A;  5B2J A;  3MGR C;  2BYK B;  3KWQ A;  4XUJ B;  3AZF B;  1P3G C;  5B24 A;  1P3M D;  1M19 C;  2L5A A;  4WU8 A;  1EQZ A;  1AOI D;  2NZD D;  3X1T B;  5AV6 B;  1B6W A;  5F99 B;  5GXQ D;  4H9O B;  3AZL B;  1F66 C;  5BNX B;  5B2I C;  5CPJ C;  4KHA A;  1U35 C;  3REL D;  4J8V B;  5B2J D;  1KU5 A;  4EO5 C;  5E5A C;  1P3K D;  5B33 C;  5BS7 A;  3KWQ D;  3B6G A;  3AV1 B;  1P3F D;  5B0Y C;  4WU9 D;  3X1U B;  5GT3 C;  3AZJ A;  3AYW B;  1WWI A;  5AVB A;  4WU8 D;  1EQZ D;  3AZN B;  1TAF B;  5AY8 C;  3AV2 A;  5B32 B;  4Z2M H;  5CPK C;  5GT0 A;  5B31 A;  1KX3 C;  5G49 A;  2YFV B;  3B0C W;  4QLC B;  3REJ A;  3LEL B;  3LJA C;  1M18 A;  1S32 A;  5FUG B;  3B0C T;  5B40 B;  3B6G D;  3LZ0 A;  3B6F A;  3WAA A;  4UUZ B;  3MGP C;  3W98 D;  3X1V B;  1P3O C;  5B31 G;  3AZJ D;  1JFI A;  3MGS C;  3AV2 D;  1F1E A;  2CV5 B;  3UTA A;  4R8P A;  5JRG A;  5GT0 D;  3REL C;  5B2J C;  5CPI A;  1B67 A;  4ZUX C;  4J8X B;  5BO0 B;  3A6N B;  5B24 C;  1M18 D;  4Z66 A;  2HIO A;  4JJN C;  4WU8 C;  3B6F D;  3WAA D;  3W99 B;  4ZBJ B;  3WTP D;  5AV5 D;  1H3O B;  4H9N A;  5GSU A;  5B0Z C;  3TU4 B;  2PYO B;  1P3I B;  4H9P B;  3UTA D;  5JRG D;  3MVD D;  4XUJ C;  1P34 A;  2ARO B;  5CPI D;  3UT9 A;  5AV9 B;  3REH A;  4NE6 A;  5AV6 C;  4Z66 D;  1F66 A;  3AZJ C;  5AVB C;  3MGQ B;  5B2I A;  1ID3 B;  3W96 A;  4DRB A;  3REK B;  5B1L A;  1BH8 B;  3AZL C;  5AV8 B;  5CP6 B;  3O62 D;  1U35 A;  5GSU D;  4YS3 A;  5B31 C;  1ULY A;  3AZK B;  4H9S A;  3MGR D;  5B33 A;  1WWS A;  4E45 A;  3X1S A;  4LD9 B;  5B0Y A;  3WA9 A;  4XZQ B;  4CSR B;  1M19 D;  3REJ C;  1KX5 B;  3X1U C;  1M18 C;  4AWL B;  1S32 C;  3UT9 D;  5AY8 A;  3AYW C;  3LZ0 C;  3AZN C;  3MNN A;  4KGC B;  1F66 D;  1KX4 A;  2FJ7 B;  5B2I D;  3W96 D;  1P3L B;  5C3I C;  1U35 D;  4R8P C;  5JRG C;  4QLC C;  5E5A D;  4KUD A;  5B33 D;  5BNV B;  5B0Y D;  3WA9 D;  3MGP A;  1P3M B;  3C1B A;  5GT3 D;  2NZD B;  2HIO C;  5AY8 D;  2FJ7 A;  1N1J A;  3MNN D;  1BH9 A;  1KX3 D;  3NQU A;  3AZM B;  3AZG B;  3NQJ A;  4WZS B;  3KUY A;  4ZUX A;  4G92 B;  1M1A B;  3UTB B;  2YFW A;  2LY8 A;  1P3K B;  4YM6 A;  3LJA D;  1P3P A;  4KUD D;  1P34 C;  4JJN A;  4J8X C;  3A6N C;  1ZLA B;  1P3F B;  3UT9 C;  4WU9 B;  3MGP D;  5B0Z A;  3REH C;  3W99 C;  3WKJ B;  3C1B D;  1P3O D;  3LZ1 B;  3AZH A;  4DRA A;  3MGS D;  3TU4 C;  3W96 C;  5B1L C;  2BYK A;  1BFM A;  4XUJ A;  2BYM B;  3AZF A;  4YS3 C;  4J8U B;  4H9S C;  3KUY D;  3AZE B;  4ZUX D;  3X1S C;  3W97 B;  3WA9 C;  3X1T A;  3WKJ A;  5B24 D;  5AV6 A;  5F99 A;  5DNM B;  4JJN D;  4H9O A;  3AZL A;  3W98 B;  5BNX A;  5B0Z D;  3MGQ C;  4X23 B;  3MNN C;  3VH5 A;  3AZH D;  4J8V A;  1KX4 C;  3AN2 B;  4XUJ D;  3AV1 A;  5AVC B;  4LD9 C;  4XZQ C;  3X1U A;  1A7W A;  4KUD C;  1TZY B;  3AYW A;  1KX5 C;  4WNN B;  3AZI B;  1Q9C A;  3AZN A;  4AWL C;  1TAF A;  3X1T D;  3WTP E;  5B32 A;  5AV6 D;  3C1B C;  4X23 A;  5F99 D;  5AVB D;  2HUE C;  2YFV A;  3WTP B;  3AZL D;  4Z5T B;  5AV5 B;  3R45 B;  2FJ7 C;  2F8N B;  1P3L C;  4QLC A;  5B31 D;  5BT1 C;  2IO5 B;  4J8V D;  5B1M B;  3LEL A;  5FUG A;  3KUY C;  5B40 A;  3MVD B;  4UUZ A;  3REJ D;  3X1U D;  5B32 G;  4YM6 C;  1P3P C;  4J8W B;  3X1V A;  1S32 D;  3AYW D;  3LZ0 D;  3AZN D;  4WV4 B;  4G91 B;  3C1C B;  2CV5 A;  3B0D B;  1P3B B;  3AZH C;  3AZG C;  3VH6 A;  3O62 B;  4R8P D;  4QLC D;  3MGR B;  4G92 C;  3AZF C;  3KXB B;  3UTB C;  4J8X A;  1M1A C;  5BO0 A;  3A6N A;  3LEL D;  1P3G B;  3W99 A;  1M19 B;  1ZLA C;  3X1T C;  1H3O A;  1P3A B;  3WKJ C;  2NQB B;  2HIO D;  5F99 C;  3TU4 A;  2PYO A;  3V9R B;  1P3I A;  5KDM B;  4H9Q B;  4H9P A;  3AFA B;  5CPJ B;  3REI B;  5JA4 B;  4J8V C;  5DNN B;  2ARO A;  4J8U C;  5E5A B;  5AV9 A;  3AV1 C;  4M6B A;  1HQ3 B;  1P34 D;  3W97 C;  4J8X D;  3A6N D;  1R4V A;  5DNM C;  3REH D;  3MGQ A;  3W99 D;  1ID3 A;  3REK A;  5GT3 B;  1BH8 A;  5CP6 A;  5AV8 A;  5B32 C;  4X23 C;  3TU4 D;  4CAY B;  3AZK A;  2PYO D;  5CPK B;  1P3I D;  5B1L D;  4LD9 A;  4YS3 D;  4XZQ A;  4CSR A;  1KX5 A;  2CWE A;  2ARO D;  3X1S D;  3LEL C;  4H9R B;  1TZY C;  5B40 C;  3LJA B;  3AZI C;  1AOI B;  3X1V C;  4KGC A;  3MGQ D;  1ID3 D;  3REK D;  1P3L A;  1P3O B;  1KX3 A;  5GXQ B;  4Z5T C;  5CP6 D;  5AV8 D;  3MGS B;  2CV5 C;  4HGA B;  1KX4 D;  3AZK D;  5BNV A;  3REL B;  5B1M C;  4LD9 D;  5B2J B;  4XZQ D;  1P3M A;  5CHL B;  3KWQ B;  1KX5 D;  2NZD A;  4ZBJ C;  4WU8 B;  3VH5 W;  3B0B A;  5GXQ A;  4G91 C;  1EQZ B;  3AZM A;  4KGC D;  3AZG A;  2PYO C;  2FJ7 D;  1P3I C;  1P3L D;  4NE5 A;  3VH5 T;  5BT1 D;  1M1A A;  3UTB A;  1P3K A;  4KHA B;  3KXB C;  2ARO C;  1ZLA A;  1P3F A;  4WU9 A;  5AV9 C;  4YM6 D;  1P3P D;  1HTA A;  3LZ1 A;  3B6G B;  1P3A C;  2NQB C;  1ID3 C;  3REK C;  3AZJ B;  5AVB B;  5CP6 C;  5AV8 C;  2BYM A;  3AFA C;  3AZM D;  3AV2 B;  3AZG D;  3AZK C;  4J8U A;  5GT0 B;  3REI C;  2F8N K;  5B31 B;  2RVQ C;  5DNN C;  5G49 B;  3AZE A;  3AZF D;  1M1A D;  3W97 A;  3UTB D;  4NE3 A;  1HQ3 C;  5DNM A;  1ZLA D;  3REJ B;  3W98 A;  3WKJ D;  1M18 B;  1S32 B;  3B6F B;  3LZ0 B;  3LZ1 D;  3WAA B;  4KGC C;  4Z2M G;  3VH6 W;  3AN2 A;  1JFI B;  5AVC A;  5C3I B;  3UTA B;  4R8P B;  5JRG B;  3VH6 T;  4J8U D;  1TZY A;  3AZE D;  3AV1 D;  4WNN A;  3AZI A;  3W97 D;  5CPI B;  1P3M C;  5DNM D;  1AOI C;  2NZD C;  3WTP A;  4Z5T A;  5AV5 A;  3R45 A;  5B32 D;  4Z66 B;  2F8N A;  2HIO B;  4X23 D;  5GXQ C;  3AZM C;  4HGA C;  4H9N B;  5GSU B;  5B1M A;  3AN2 D;  3MVD A;  5AVC D;  1P3K C;  4J8W A;  1TZY D;  5B40 D;  3KWQ C;  3AZI D;  1P34 B;  1P3F C;  3C1C A;  4WU9 C;  2F8N G;  3UT9 B;  3X1V D;  1P3B A;  3REH B;  3LZ1 C;  1EQZ C;  2F8N H;  4E44 A;  4Z5T D;  3O62 A;  2CV5 D;  1F66 B;  2F8N D;  5B2I B;  3W96 B;  3MGR A;  5B1L B;  3KXB A;  1U35 B;  5B1M D;  4YS3 B;  4EO5 B;  1P3G A;  3AZE C;  5B33 B;  1M19 A;  3X1S B;  1P3A A;  2NQB A;  5B0Y B;  4J8W D;  3WA9 B;  5BS7 C;  3B6G C;  3V9R A;  3KSY A;  4NFT A;  5KDM A;  3C1C D;  4H9Q A;  3W98 C;  3AFA A;  5AY8 B;  1P3B D;  5CPJ A;  3MNN B;  5JA4 A;  3REI A;  1KX3 B;  3AV2 C;  5DNN A;  5GT0 C;  1KX4 B;  3AN2 C;  5E5A A;  5AVC C;  1HQ3 A;  3KXB D;  1P3G D;  5AV9 D;  4KUD B;  5GT3 A;  1P3A D;  2NQB D;  4CAY A;  3MGP B;  3B6F C;  3WAA C;  3C1B B;  5CPK A;  3WTP C;  2HUE B;  5AV5 C; 
#chains in the Genus database with same CATH topology
 3AFA D;  1N1J B;  5CPJ D;  2IO5 C;  1BH9 B;  3REI D;  2RVQ D;  5DNN D;  3NQU B;  3UTA C;  4H9R A;  2JSS A;  3NQJ B;  3MVD C;  3LJA A;  2ZY2 A;  3KUY B;  1HQ3 D;  4ZUX B;  1AOI A;  5CPI C;  2YFW B;  4J8W C;  2G5I C;  5B24 B;  4YM6 B;  1P3P B;  3A1K A;  4JJN B;  1P3O A;  3C1C C;  3B0D C;  3MGS A;  4Z66 C;  1P3B C;  5B0Z B;  5CPK D;  3O62 C;  3AZH B;  5GSU C;  3REL A;  5B2J A;  3MGR C;  2BYK B;  3KWQ A;  4XUJ B;  3EPH A;  3AZF B;  1P3G C;  5B24 A;  1P3M D;  1M19 C;  2L5A A;  4WU8 A;  1EQZ A;  1AOI D;  2NZD D;  3X1T B;  5AV6 B;  1B6W A;  5F99 B;  5GXQ D;  4H9O B;  3AZL B;  1F66 C;  5BNX B;  5B2I C;  5CPJ C;  3F6T A;  4KHA A;  1U35 C;  3REL D;  4J8V B;  5B2J D;  1KU5 A;  4EO5 C;  5E5A C;  1P3K D;  5B33 C;  5BS7 A;  3KWQ D;  3B6G A;  3AV1 B;  1P3F D;  5B0Y C;  4WU9 D;  3X1U B;  2DQN C;  3EPJ A;  5GT3 C;  3AZJ A;  3AYW B;  1WWI A;  5AVB A;  4WU8 D;  1EQZ D;  3AZN B;  1TAF B;  5AY8 C;  3AV2 A;  5B32 B;  4Z2M H;  5CPK C;  5GT0 A;  3KFU G;  5B31 A;  1KX3 C;  5G49 A;  2VQR A;  2YFV B;  3B0C W;  4QLC B;  3REJ A;  3LEL B;  3LJA C;  1M18 A;  1S32 A;  5FUG B;  3B0C T;  5B40 B;  3B6G D;  3LZ0 A;  3B6F A;  3WAA A;  4UUZ B;  3MGP C;  3W98 D;  3X1V B;  1P3O C;  5B31 G;  3AZJ D;  1JFI A;  3MGS C;  1W2E A;  3AV2 D;  1F1E A;  2CV5 B;  3UTA A;  4R8P A;  5JRG A;  5GT0 D;  2Y2L A;  3REL C;  5B2J C;  5CPI A;  1B67 A;  4ZUX C;  2G5H C;  4J8X B;  5BO0 B;  3A6N B;  5B24 C;  1M18 D;  3IP4 C;  4Z66 A;  2HIO A;  4JJN C;  4WU8 C;  3B6F D;  3WAA D;  3W99 B;  4ZBJ B;  3WTP D;  5AV5 D;  1H3O B;  4H9N A;  5GSU A;  5B0Z C;  3TU4 B;  2PYO B;  1P3I B;  4H9P B;  3UTA D;  5JRG D;  3MVD D;  4XUJ C;  1P34 A;  2ARO B;  3P5J B;  5CPI D;  3UT9 A;  5AV9 B;  3REH A;  2Y2K A;  4NE6 A;  5AV6 C;  4Z66 D;  1F66 A;  3AZJ C;  5AVB C;  3MGQ B;  5B2I A;  1ID3 B;  3W96 A;  4DRB A;  3REK B;  5B1L A;  1BH8 B;  3AZL C;  5AV8 B;  5CP6 B;  3O62 D;  1U35 A;  5GSU D;  4YS3 A;  5B31 C;  1ULY A;  3AZK B;  4H9S A;  3MGR D;  5B33 A;  1WWS A;  4E45 A;  3X1S A;  4LD9 B;  5B0Y A;  3WA9 A;  4XZQ B;  4CSR B;  1M19 D;  3REJ C;  1KX5 B;  2Y2H A;  3X1U C;  1M18 C;  4AWL B;  1S32 C;  3UT9 D;  5AY8 A;  3AYW C;  3LZ0 C;  3AZN C;  3MNN A;  4KGC B;  1F66 D;  1KX4 A;  2FJ7 B;  5B2I D;  3W96 D;  1P3L B;  5C3I C;  1U35 D;  4R8P C;  5JRG C;  4QLC C;  5E5A D;  4KUD A;  5B33 D;  5BNV B;  5B0Y D;  3WA9 D;  3MGP A;  1P3M B;  3C1B A;  5GT3 D;  4WJ3 C;  2NZD B;  2HIO C;  5AY8 D;  2FJ7 A;  1N1J A;  3MNN D;  1BH9 A;  1KX3 D;  2XD5 A;  3NQU A;  3AZM B;  3AZG B;  3NQJ A;  4WZS B;  3KUY A;  4ZUX A;  4G92 B;  1M1A B;  3UTB B;  2YFW A;  2LY8 A;  1P3K B;  4YM6 A;  3LJA D;  1P3P A;  4KUD D;  1P34 C;  4JJN A;  4J8X C;  3A6N C;  1ZLA B;  1P3F B;  3UT9 C;  4WU9 B;  3MGP D;  5B0Z A;  3REH C;  2Y2J A;  3W99 C;  3C1B D;  3WKJ B;  1P3O D;  3LZ1 B;  3AZH A;  4DRA A;  3MGS D;  3TU4 C;  3W96 C;  5B1L C;  2BYK A;  1BFM A;  4XUJ A;  2BYM B;  3AZF A;  4YS3 C;  3EPK A;  4H9S C;  4J8U B;  3A1I A;  3KUY D;  3AZE B;  4UPK A;  4ZUX D;  3X1S C;  3W97 B;  2XD1 A;  3WA9 C;  3X1T A;  3WKJ A;  5B24 D;  5AV6 A;  5F99 A;  5DNM B;  4JJN D;  2Y2Q A;  4H9O A;  3AZL A;  3H0L C;  3W98 B;  5BNX A;  5B0Z D;  3MGQ C;  4X23 B;  3MNN C;  3VH5 A;  3AZH D;  4J8V A;  1KX4 C;  3AN2 B;  4XUJ D;  3AV1 A;  5AVC B;  4LD9 C;  4XZQ C;  3X1U A;  1A7W A;  4KUD C;  1TZY B;  3AYW A;  1KX5 C;  4WNN B;  3AZI B;  1Q9C A;  3AZN A;  3AL0 C;  4AWL C;  1TAF A;  3X1T D;  3WTP C;  5B32 A;  5AV6 D;  3C1B C;  4X23 A;  5F99 D;  5AVB D;  2HUE C;  3FDD A;  2YFV A;  3WTP B;  3AZL D;  4Z5T B;  5AV5 B;  3R45 B;  2FJ7 C;  2F8N B;  1P3L C;  4QLC A;  5B31 D;  5BT1 C;  2IO5 B;  4J8V D;  5B1M B;  3LEL A;  2W8S A;  5FUG A;  3KUY C;  2ZY3 A;  5B40 A;  3MVD B;  4UUZ A;  3REJ D;  3X1U D;  5B32 G;  4YM6 C;  1P3P C;  4J8W B;  3X1V A;  1S32 D;  3AYW D;  3LZ0 D;  3AZN D;  4WV4 B;  4G91 B;  3C1C B;  2CV5 A;  3B0D B;  3H0M C;  1P3B B;  3AZH C;  3AZG C;  3VH6 A;  3O62 B;  4R8P D;  4QLC D;  3MGR B;  4G92 C;  3AZF C;  3KXB B;  3UTB C;  4J8X A;  1M1A C;  5BO0 A;  3A6N A;  3LEL D;  1P3G B;  3W99 A;  1M19 B;  1ZLA C;  2ZY4 A;  3X1T C;  1H3O A;  1P3A B;  3WKJ C;  2NQB B;  2HIO D;  5F99 C;  3TU4 A;  2PYO A;  3V9R B;  1P3I A;  5KDM B;  4H9Q B;  4H9P A;  3AFA B;  5CPJ B;  3REI B;  5JA4 B;  4J8V C;  2ZM5 A;  5DNN B;  2ARO A;  4J8U C;  1Z2C B;  5E5A B;  5AV9 A;  3AV1 C;  4M6B A;  1HQ3 B;  1P34 D;  3W97 C;  4J8X D;  3A6N D;  1R4V A;  3H0R C;  5DNM C;  3REH D;  3MGQ A;  3W99 D;  1ID3 A;  3REK A;  5GT3 B;  1BH8 A;  5CP6 A;  5AV8 A;  5B32 C;  4X23 C;  3TU4 D;  4CAY B;  3AZK A;  2PYO D;  5CPK B;  2Y2M A;  1P3I D;  5B1L D;  2Y2P A;  4LD9 A;  4YS3 D;  4XZQ A;  4CSR A;  1KX5 A;  2CWE A;  2ARO D;  3X1S D;  3LEL C;  4H9R B;  1TZY C;  5B40 C;  3LJA B;  3AZI C;  1AOI B;  2Y2N A;  3X1V C;  4KGC A;  3MGQ D;  1ID3 D;  3REK D;  1P3L A;  1P3O B;  1KX3 A;  5GXQ B;  4Z5T C;  5CP6 D;  5AV8 D;  3MGS B;  2CV5 C;  4HGA B;  1KX4 D;  3AZK D;  5BNV A;  3REL B;  5B1M C;  4LD9 D;  5B2J B;  4XZQ D;  1P3M A;  5CHL B;  3KWQ B;  1KX5 D;  2NZD A;  4ZBJ C;  3VH5 W;  3B0B A;  4G91 C;  4WU8 B;  5GXQ A;  1EQZ B;  3AZM A;  1PZR A;  3AZG A;  4KGC D;  2PYO C;  2FJ7 D;  1P3I C;  1P3L D;  4NE5 A;  3VH5 T;  5BT1 D;  1M1A A;  3UTB A;  1P3K A;  4KHA B;  3KXB C;  2ARO C;  1ZLA A;  1P3F A;  4WU9 A;  5AV9 C;  4YM6 D;  1P3P D;  2BG1 A;  1HTA A;  3LZ1 A;  3B6G B;  1P3A C;  2NQB C;  1ID3 C;  3REK C;  3AZJ B;  5AVB B;  2UWX A;  5AV8 C;  5CP6 C;  2BYM A;  3AFA C;  3AZM D;  3AV2 B;  3AZG D;  3AZK C;  4J8U A;  5GT0 B;  3REI C;  2F8N K;  5B31 B;  2RVQ C;  5DNN C;  5G49 B;  3AZE A;  3AZF D;  1M1A D;  2Y2I A;  3W97 A;  3UTB D;  4NE3 A;  1HQ3 C;  5DNM A;  1ZLA D;  3REJ B;  2RIQ A;  3WKJ D;  1M18 B;  2F2A C;  3W98 A;  1S32 B;  2J8P A;  3B6F B;  3LZ0 B;  3LZ1 D;  3WAA B;  2Y2G A;  4KGC C;  4Z2M G;  3VH6 W;  3AN2 A;  1JFI B;  5AVC A;  5C3I B;  3UTA B;  4R8P B;  5JRG B;  3VH6 T;  4J8U D;  1TZY A;  3AZE D;  3AV1 D;  4WNN A;  2DF4 C;  3AZI A;  3W97 D;  5CPI B;  1P3M C;  3EG5 B;  5DNM D;  1AOI C;  2NZD C;  3WTP A;  4Z5T A;  5AV5 A;  2ZY5 A;  3R45 A;  5B32 D;  4Z66 B;  2F8N A;  2HIO B;  4X23 D;  5GXQ C;  3EPL A;  3AZM C;  4HGA C;  4H9N B;  5GSU B;  5B1M A;  3AN2 D;  3MVD A;  5AVC D;  1P3K C;  4J8W A;  1TZY D;  5B40 D;  3KWQ C;  3AZI D;  1P34 B;  1P3F C;  3C1C A;  4WU9 C;  2F8N G;  3UT9 B;  3X1V D;  1P3B A;  3REH B;  3LZ1 C;  1EQZ C;  2F8N H;  4E44 A;  4Z5T D;  3O62 A;  2CV5 D;  1F66 B;  2F8N D;  2JE5 A;  5B2I B;  3W96 B;  3MGR A;  5B1L B;  3KXB A;  1U35 B;  5B1M D;  4YS3 B;  4EO5 B;  1P3G A;  3AZE C;  4DQY B;  5B33 B;  1M19 A;  3X1S B;  1P3A A;  2NQB A;  5B0Y B;  4J8W D;  3WA9 B;  5BS7 C;  2Y2O A;  3B6G C;  3V9R A;  3KSY A;  4NFT A;  5KDM A;  3C1C D;  4H9Q A;  3W98 C;  3AFA A;  5AY8 B;  1P3B D;  5CPJ A;  2FFF B;  3MNN B;  5JA4 A;  3REI A;  1KX3 B;  3AV2 C;  5DNN A;  5GT0 C;  1KX4 B;  3AN2 C;  5E5A A;  1T3U A;  5AVC C;  1HQ3 A;  3KXB D;  1P3G D;  5AV9 D;  4KUD B;  5GT3 A;  1P3A D;  2NQB D;  2JCH A;  4CAY A;  3MGP B;  3B6F C;  3WAA C;  3C1B B;  5CPK A;  3WTP E;  2HUE B;  5AV5 C; 
#chains in the Genus database with same CATH homology
 3AFA D;  1N1J B;  5CPJ D;  2IO5 C;  1BH9 B;  3REI D;  2RVQ D;  5DNN D;  3NQU B;  3UTA C;  4H9R A;  2JSS A;  3NQJ B;  3MVD C;  3LJA A;  2ZY2 A;  3KUY B;  1HQ3 D;  4ZUX B;  1AOI A;  5CPI C;  2YFW B;  4J8W C;  2G5I C;  5B24 B;  4YM6 B;  1P3P B;  3A1K A;  4JJN B;  1P3O A;  3C1C C;  3B0D C;  3MGS A;  4Z66 C;  1P3B C;  5B0Z B;  5CPK D;  3O62 C;  3AZH B;  5GSU C;  3REL A;  5B2J A;  3MGR C;  2BYK B;  3KWQ A;  4XUJ B;  3EPH A;  3AZF B;  1P3G C;  5B24 A;  1P3M D;  1M19 C;  2L5A A;  4WU8 A;  1EQZ A;  1AOI D;  2NZD D;  3X1T B;  5AV6 B;  1B6W A;  5F99 B;  5GXQ D;  4H9O B;  3AZL B;  1F66 C;  5BNX B;  5B2I C;  5CPJ C;  3F6T A;  4KHA A;  1U35 C;  3REL D;  4J8V B;  5B2J D;  1KU5 A;  4EO5 C;  5E5A C;  1P3K D;  5B33 C;  5BS7 A;  3KWQ D;  3B6G A;  3AV1 B;  1P3F D;  5B0Y C;  4WU9 D;  3X1U B;  2DQN C;  3EPJ A;  5GT3 C;  3AZJ A;  3AYW B;  1WWI A;  5AVB A;  4WU8 D;  1EQZ D;  3AZN B;  1TAF B;  5AY8 C;  3AV2 A;  5B32 B;  4Z2M H;  5CPK C;  5GT0 A;  3KFU G;  5B31 A;  1KX3 C;  5G49 A;  2VQR A;  2YFV B;  3B0C W;  4QLC B;  3REJ A;  3LEL B;  3LJA C;  1M18 A;  1S32 A;  5FUG B;  3B0C T;  5B40 B;  3B6G D;  3LZ0 A;  3B6F A;  3WAA A;  4UUZ B;  3MGP C;  3W98 D;  3X1V B;  1P3O C;  5B31 G;  3AZJ D;  1JFI A;  3MGS C;  1W2E A;  3AV2 D;  1F1E A;  2CV5 B;  3UTA A;  4R8P A;  5JRG A;  5GT0 D;  2Y2L A;  3REL C;  5B2J C;  5CPI A;  1B67 A;  4ZUX C;  2G5H C;  4J8X B;  5BO0 B;  3A6N B;  5B24 C;  1M18 D;  3IP4 C;  4Z66 A;  2HIO A;  4JJN C;  4WU8 C;  3B6F D;  3WAA D;  3W99 B;  4ZBJ B;  3WTP D;  5AV5 D;  1H3O B;  4H9N A;  5GSU A;  5B0Z C;  3TU4 B;  2PYO B;  1P3I B;  4H9P B;  3UTA D;  5JRG D;  3MVD D;  4XUJ C;  1P34 A;  2ARO B;  3P5J B;  5CPI D;  3UT9 A;  5AV9 B;  3REH A;  2Y2K A;  4NE6 A;  5AV6 C;  4Z66 D;  1F66 A;  3AZJ C;  5AVB C;  3MGQ B;  5B2I A;  1ID3 B;  3W96 A;  4DRB A;  3REK B;  5B1L A;  1BH8 B;  3AZL C;  5AV8 B;  5CP6 B;  3O62 D;  1U35 A;  5GSU D;  4YS3 A;  5B31 C;  1ULY A;  3AZK B;  4H9S A;  3MGR D;  5B33 A;  1WWS A;  4E45 A;  3X1S A;  4LD9 B;  5B0Y A;  3WA9 A;  4XZQ B;  4CSR B;  1M19 D;  3REJ C;  1KX5 B;  2Y2H A;  3X1U C;  1M18 C;  4AWL B;  1S32 C;  3UT9 D;  5AY8 A;  3AYW C;  3LZ0 C;  3AZN C;  3MNN A;  4KGC B;  1F66 D;  1KX4 A;  2FJ7 B;  5B2I D;  3W96 D;  1P3L B;  5C3I C;  1U35 D;  4R8P C;  5JRG C;  4QLC C;  5E5A D;  4KUD A;  5B33 D;  5BNV B;  5B0Y D;  3WA9 D;  3MGP A;  1P3M B;  3C1B A;  5GT3 D;  4WJ3 C;  2NZD B;  2HIO C;  5AY8 D;  2FJ7 A;  1N1J A;  3MNN D;  1BH9 A;  1KX3 D;  2XD5 A;  3NQU A;  3AZM B;  3AZG B;  3NQJ A;  4WZS B;  3KUY A;  4ZUX A;  4G92 B;  1M1A B;  3UTB B;  2YFW A;  2LY8 A;  1P3K B;  4YM6 A;  3LJA D;  1P3P A;  4KUD D;  1P34 C;  4JJN A;  4J8X C;  3A6N C;  1ZLA B;  1P3F B;  3UT9 C;  4WU9 B;  3MGP D;  5B0Z A;  3REH C;  2Y2J A;  3W99 C;  3C1B D;  3WKJ B;  1P3O D;  3LZ1 B;  3AZH A;  4DRA A;  3MGS D;  3TU4 C;  3W96 C;  5B1L C;  2BYK A;  1BFM A;  4XUJ A;  2BYM B;  3AZF A;  4YS3 C;  3EPK A;  4H9S C;  4J8U B;  3A1I A;  3KUY D;  3AZE B;  4UPK A;  4ZUX D;  3X1S C;  3W97 B;  2XD1 A;  3WA9 C;  3X1T A;  3WKJ A;  5B24 D;  5AV6 A;  5F99 A;  5DNM B;  4JJN D;  2Y2Q A;  4H9O A;  3AZL A;  3H0L C;  3W98 B;  5BNX A;  5B0Z D;  3MGQ C;  4X23 B;  3MNN C;  3VH5 A;  3AZH D;  4J8V A;  1KX4 C;  3AN2 B;  4XUJ D;  3AV1 A;  5AVC B;  4LD9 C;  4XZQ C;  3X1U A;  1A7W A;  4KUD C;  1TZY B;  3AYW A;  1KX5 C;  4WNN B;  3AZI B;  1Q9C A;  3AZN A;  3AL0 C;  4AWL C;  1TAF A;  3X1T D;  3WTP C;  5B32 A;  5AV6 D;  3C1B C;  4X23 A;  5F99 D;  5AVB D;  2HUE C;  3FDD A;  2YFV A;  3WTP B;  3AZL D;  4Z5T B;  5AV5 B;  3R45 B;  2FJ7 C;  2F8N B;  1P3L C;  4QLC A;  5B31 D;  5BT1 C;  2IO5 B;  4J8V D;  5B1M B;  3LEL A;  2W8S A;  5FUG A;  3KUY C;  2ZY3 A;  5B40 A;  3MVD B;  4UUZ A;  3REJ D;  3X1U D;  5B32 G;  4YM6 C;  1P3P C;  4J8W B;  3X1V A;  1S32 D;  3AYW D;  3LZ0 D;  3AZN D;  4WV4 B;  4G91 B;  3C1C B;  2CV5 A;  3B0D B;  3H0M C;  1P3B B;  3AZH C;  3AZG C;  3VH6 A;  3O62 B;  4R8P D;  4QLC D;  3MGR B;  4G92 C;  3AZF C;  3KXB B;  3UTB C;  4J8X A;  1M1A C;  5BO0 A;  3A6N A;  3LEL D;  1P3G B;  3W99 A;  1M19 B;  1ZLA C;  2ZY4 A;  3X1T C;  1H3O A;  1P3A B;  3WKJ C;  2NQB B;  2HIO D;  5F99 C;  3TU4 A;  2PYO A;  3V9R B;  1P3I A;  5KDM B;  4H9Q B;  4H9P A;  3AFA B;  5CPJ B;  3REI B;  5JA4 B;  4J8V C;  2ZM5 A;  5DNN B;  2ARO A;  4J8U C;  1Z2C B;  5E5A B;  5AV9 A;  3AV1 C;  4M6B A;  1HQ3 B;  1P34 D;  3W97 C;  4J8X D;  3A6N D;  1R4V A;  3H0R C;  5DNM C;  3REH D;  3MGQ A;  3W99 D;  1ID3 A;  3REK A;  5GT3 B;  1BH8 A;  5CP6 A;  5AV8 A;  5B32 C;  4X23 C;  3TU4 D;  4CAY B;  3AZK A;  2PYO D;  5CPK B;  2Y2M A;  1P3I D;  5B1L D;  2Y2P A;  4LD9 A;  4YS3 D;  4XZQ A;  4CSR A;  1KX5 A;  2CWE A;  2ARO D;  3X1S D;  3LEL C;  4H9R B;  1TZY C;  5B40 C;  3LJA B;  3AZI C;  1AOI B;  2Y2N A;  3X1V C;  4KGC A;  3MGQ D;  1ID3 D;  3REK D;  1P3L A;  1P3O B;  1KX3 A;  5GXQ B;  4Z5T C;  5CP6 D;  5AV8 D;  3MGS B;  2CV5 C;  4HGA B;  1KX4 D;  3AZK D;  5BNV A;  3REL B;  5B1M C;  4LD9 D;  5B2J B;  4XZQ D;  1P3M A;  5CHL B;  3KWQ B;  1KX5 D;  2NZD A;  4ZBJ C;  3VH5 W;  3B0B A;  4G91 C;  4WU8 B;  5GXQ A;  1EQZ B;  3AZM A;  1PZR A;  3AZG A;  4KGC D;  2PYO C;  2FJ7 D;  1P3I C;  1P3L D;  4NE5 A;  3VH5 T;  5BT1 D;  1M1A A;  3UTB A;  1P3K A;  4KHA B;  3KXB C;  2ARO C;  1ZLA A;  1P3F A;  4WU9 A;  5AV9 C;  4YM6 D;  1P3P D;  2BG1 A;  1HTA A;  3LZ1 A;  3B6G B;  1P3A C;  2NQB C;  1ID3 C;  3REK C;  3AZJ B;  5AVB B;  2UWX A;  5AV8 C;  5CP6 C;  2BYM A;  3AFA C;  3AZM D;  3AV2 B;  3AZG D;  3AZK C;  4J8U A;  5GT0 B;  3REI C;  2F8N K;  5B31 B;  2RVQ C;  5DNN C;  5G49 B;  3AZE A;  3AZF D;  1M1A D;  2Y2I A;  3W97 A;  3UTB D;  4NE3 A;  1HQ3 C;  5DNM A;  1ZLA D;  3REJ B;  2RIQ A;  3WKJ D;  1M18 B;  2F2A C;  3W98 A;  1S32 B;  2J8P A;  3B6F B;  3LZ0 B;  3LZ1 D;  3WAA B;  2Y2G A;  4KGC C;  4Z2M G;  3VH6 W;  3AN2 A;  1JFI B;  5AVC A;  5C3I B;  3UTA B;  4R8P B;  5JRG B;  3VH6 T;  4J8U D;  1TZY A;  3AZE D;  3AV1 D;  4WNN A;  2DF4 C;  3AZI A;  3W97 D;  5CPI B;  1P3M C;  3EG5 B;  5DNM D;  1AOI C;  2NZD C;  3WTP A;  4Z5T A;  5AV5 A;  2ZY5 A;  3R45 A;  5B32 D;  4Z66 B;  2F8N A;  2HIO B;  4X23 D;  5GXQ C;  3EPL A;  3AZM C;  4HGA C;  4H9N B;  5GSU B;  5B1M A;  3AN2 D;  3MVD A;  5AVC D;  1P3K C;  4J8W A;  1TZY D;  5B40 D;  3KWQ C;  3AZI D;  1P34 B;  1P3F C;  3C1C A;  4WU9 C;  2F8N G;  3UT9 B;  3X1V D;  1P3B A;  3REH B;  3LZ1 C;  1EQZ C;  2F8N H;  4E44 A;  4Z5T D;  3O62 A;  2CV5 D;  1F66 B;  2F8N D;  2JE5 A;  5B2I B;  3W96 B;  3MGR A;  5B1L B;  3KXB A;  1U35 B;  5B1M D;  4YS3 B;  4EO5 B;  1P3G A;  3AZE C;  4DQY B;  5B33 B;  1M19 A;  3X1S B;  1P3A A;  2NQB A;  5B0Y B;  4J8W D;  3WA9 B;  5BS7 C;  2Y2O A;  3B6G C;  3V9R A;  3KSY A;  4NFT A;  5KDM A;  3C1C D;  4H9Q A;  3W98 C;  3AFA A;  5AY8 B;  1P3B D;  5CPJ A;  2FFF B;  3MNN B;  5JA4 A;  3REI A;  1KX3 B;  3AV2 C;  5DNN A;  5GT0 C;  1KX4 B;  3AN2 C;  5E5A A;  1T3U A;  5AVC C;  1HQ3 A;  3KXB D;  1P3G D;  5AV9 D;  4KUD B;  5GT3 A;  1P3A D;  2NQB D;  2JCH A;  4CAY A;  3MGP B;  3B6F C;  3WAA C;  3C1B B;  5CPK A;  3WTP E;  2HUE B;  5AV5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...