5GT3C

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3C00
1BH9B 5B1LC 4KGCB 1ZLAA 4WV4B 5AVBA 4ZBJB 3LZ0D 4H9QA 2NZDD 1U35C 4Z66C 5E5AB 1ID3B 3X1SA 5CPID 3MGQC 3WKJD 1P3PD 3MGSC 1P3BD 3AZIC 3R45A 1KX5B 3AZEB 4WU9A 3RELB 3AYWC 1P3IA 4KHAB 5GT3D 5B0ZD 3REJD 2NQBA 5CP6D 3MVDA 3UT9D 4DRAA 1P3KC 3C1CC 3WAAC 4E45A 5CPJC 5B32A 5B33C 1P3FD 2YFVB 3AZJC 3TU4A 4EO5B 5BO0A 3AV2B 3W97C 5JRGA 3AFAD 3AZLA 4X23A 5DNNA 5B31C 3LELB 3AZFA 3AV1A 3NQJA 1P3LB 3V9RA 1KX3D 3W99A 4KGCC 4J8WC 5AV8B 5AVCD 5F99D 5GXQB 1S32D 4ZBJC 5B2IA 3KUYD 3AZNB 5G49B 5DNMA 3MNND 1P3AC 1U35D 1ID3C 4QLCA 1TAFA 5AVBB 3W96A 3REKA 4H9QB 3AN2A 1KX5C 4Z5TD 3AZKA 3RELC 2HIOC 3X1SB 4WU8D 2BYMB 3MGPA 3W98C 5AV5D 4J8XC 4NE3A 1P3IB 5AY8A 5B1MC 4E44A 2NQBB 3WTPE 3AZMD 2F8NH 3MVDB 3X1VA 2FJ7A 5B24A 4KUDA 3O62A 5AV9A 3AV2C 3X1TA 1P3OD 3WA9D 3MGRD 5B32B 3C1BA 3LELC 3TU4B 1KX4D 4XUJC 5BO0B 1P3LC 5JRGB 1P3MA 2AROA 3KWQD 4Z2MG 3KUYA 3AV1B 3NQJB 5AV8C 3UTBC 3V9RB 2IO5C 4YM6C 3W99B 1HQ3D 1P3AD 1ZLAC 5AVBC 2CV5D 1P3PB 5B2IB 5BT1C 4AWLB 1M18D 3B6FA 4CSRA 3X1SC 4Z2MH 1TAFB 5GSUA 3W96B 3REKB 5GT3B 3REJB 5CP6B 3AN2B 3UT9B 4HGAB 3AZKB 4WU9C 4J8VD 4J8UA 5B2JA 3WTPA 5KDMA 2NQBC 3MGPB 1M19A 4H9PB 4WZSB 3MVDC 3AZEA 1P3FB 3REHA 4KHAA 3B6GA 2L5AA 4ZUXD 5GT0D 5B32C 4G91B 5B24B 4KUDB 4JJND 3X1TB 2PYOD 2YFWA 5JRGC 3AZLC 5BNVB 4X23C 5DNNC 5BS7A 3AZFC 1S32B 2F8ND 2AROB 3W99C 3KUYB 5AV6A 1Q9CA 1AOIA 5B40A 4XZQD 1P3GD 3A6NA 5B2IC 5DNMC 4AWLC 4Z5TB 3B0DB 4QLCC 5GXQA 4WU8B 3W96C 1ULYA 3REKC 5B31G 3AZNA 3AN2C 3AZKC 3B6FB 4CSRB 5AV5B 3B0CW 5GSUB 4LD9D 4ZUXA 3MGPC 3VH5W 3AZMB 4NFTA 2BYMA 5AY8C 4J8UB 3WTPB 5B2JB 5KDMB 1M1AA 1EQZD 5B0YC 1P34D 1TZYA 3MGRB 1M19B 3X1VC 3REHB 2FJ7C 3B6GB 3AZHA 4KUDC 1KX4B 3O62C 5AV9C 3REIA 3X1TC 5BNXA 2RVQC 3C1BC 4YS3D 3KWQB 3LJAA 5CPKD 4G92B 2YFWB 1P3MC 3AZGD 3LZ1D 2AROC 4R8PD 1A7WA 2BYKA 3X1UD 5AV6B 3KXBD 1AOIB 5B40B 1F66D 3A6NB 3LZ0A 3UTAD 2NZDA 2JSSA 5B1LD 3B6FC 5CPIA 3WKJA 1P3PA 4J8VB 5GSUC 1P3BA 5E5AC 4Z66D 3VH5A 3MGQD 4J8UC 5GT3A 5B0ZA 5B2JC 3MGSD 5CP6A 4ZUXB 4NE5A 5GT0B 3B0CT 3REJA 3UT9A 3AZID 1M19C 3AZEC 5B0YD 3VH5T 3REHC 3AYWD 3B6GC 4JJNB 1M1AB 1H3OB 4H9PA 1P3FA 1TZYB 1HTAA 2LY8A 3AZHB 2HUEB 2CWEA 1P3KD 3C1CD 3AFAA 3REIB 5BNXB 5CPJD 3WAAD 5B33D 3LJAB 4EO5C 5BS7C 3AZJD 1P3GB 3W97D 5BNVA 5C3IB 1KX3A 5B31D 4DRBA 1AOIC 5B40C 5AVCA 1S32A 5F99A 5B32G 2BYKB 3MNNA 1U35A 4KGCD 4Z66A 4J8WD 5GXQC 3LZ0B 3AZNC 2NZDB 4Z5TA 5E5AD 1ID3D 4WU8A 5CPIB 3WKJB 4H9SA 1P3BB 1EQZB 1P34B 5AV5A 1KX5D 3RELD 2HIOD 4WNNB 4CAYA 5B0ZB 4NE6A 1M1AC 3AZMA 5CPJA 1TZYC 4M6BA 5B33A 3W98D 1P3IC 4J8XD 3AZHC 1P3OA 5B1MD 3REIC 3WA9A 3MGRA 3LZ1B 3LJAC 1KX4A 1BH8B 3AV2D 3AFAB 5C3IC 3KWQA 3X1UB 3TU4C 3LELD 3KXBB 4XUJD 4J8WA 4H9OA 1N1JA 1P3LD 1KX3B 3AV1C 1HQ3A 1P3AA 5AVCB 5AV8D 5F99B 3UTBD 2CV5A 3LZ0C 3MNNB 4YM6D 1M18A 1U35B 4Z66B 5CPIC 3WKJC 1ZLAD 1P3PC 5AVBD 3MGSB 5BT1D 4J8VA 3X1SD 1WWIA 5GT3C 3REJC 5CP6C 1R4VA 3UT9C 4HGAC 1JFIA 4WU9D 1P3ID 4CAYB 5GT0A 2NQBD 1P3FC 5CPJB 3MVDD 5B33B 5JA4A 4JJNA 4XUJA 1P3OB 2PYOA 1H3OA 3AFAC 3WA9B 4G91C 5B32D 5B24C 1B6WA 5JRGD 3AZLD 1KX3C 2F8NA 4X23D 3VH6W 5DNND 3AZFD 1BFMA 3AV1D 4XZQA 1P3GA 5AVCC 4J8WB 4H9OB 1N1JB 5F99C 1S32C 3B0BA 3KUYC 3MNNC 3W99D 1HQ3B 1P3AB 2CV5B 5B2ID 5DNMD 1M18B 4Z5TC 3B0DC 4WU8C 4QLCD 2HIOB 4LD9A 5FUGA 4H9SC 3W96D 3REKD 3AN2D 5AV5C 3W98B 3AZKD 4J8XB 1EQZA 5B1MB 3MGPD 3AZMC 1P34A 1JFIB 4WNNA 3WTPC 5AY8D 1P3OC 4H9RB 3WA9C 3MGRC 4H9NA 5CPKA 4YS3A 3X1VD 2FJ7D 1KX4C 5B24D 4KUDD 5JA4B 4XUJB 3O62D 5AV9D 2PYOB 3X1TD 3AZGA 3LZ1A 3KWQC 2RVQD 3C1BD 1BH8A 4R8PA 4G92C 3VH6A 3UTBB 3X1UA 1P3MD 2F8NB 2F8NK 2AROD 2IO5B 4YM6B 3KXBA 1F1EA 1HQ3C 3VH6T 1F66A 4XZQB 1ZLAB 2CV5C 3UTAA 2F8NG 5AV6C 1M18C 5B1LA 3A6NC 4UUZA 3R45B 3B6FD 4J8VC 3MGQA 4WU9B 3MGSA 5FUGB 5GSUD 4LD9B 3AZIA 5B0YA 3AYWA 4J8UD 4ZUXC 5GT0C 5B2JD 3WTPD 1M19D 3AZED 3REHD 3B6GD 4JJNC 1P3KA 3C1CA 2PYOC 3WAAA 3NQUA 4H9NB 3AZLB 5CPKB 4YS3B 4X23B 3AZJA 5DNNB 3AZFB 2HUEC 3W97A 3AZGB 5B31A 4R8PB 1WWSA 4XZQC 1P3GC 1BH9A 5AV6D 5DNMB 4KGCA 1F66B 1AOID 5B40D 4QLCB 3A6ND 3UTAB 5E5AA 5B1LB 1ID3A 5GXQD 4UUZB 4LD9C 2NZDC 3AZND 1KX5A 3RELA 2HIOA 5CHLB 3MGQB 1P3BC 5AY8B 1KU5A 1EQZC 1P34C 1B67A 3AZIB 3W98A 5B0YB 4J8XA 3X1VB 3AYWB 2FJ7B 5B0ZC 5B1MA 3O62B 5AV9B 1M1AD 5CPKC 4YS3C 1TZYD 2YFVA 3KSYA 3C1BB 3AZHD 4H9RA 5G49A 3AV2A 1P3KB 3C1CB 3REID 3AZGC 3LZ1C 3WAAB 3NQUB 1P3MB 3LELA 3LJAD 3AZJB 4R8PC 1P3LA 3W97B 3X1UC 5B31B 3KXBC 3TU4D 1F66C 5AV8A 3UTBA 3UTAC 4YM6A
chains in the Genus database with same CATH superfamily
1BH9B 5B1LC 4KGCB 1ZLAA 4WV4B 5AVBA 4ZBJB 3LZ0D 4H9QA 2NZDD 1U35C 4Z66C 5E5AB 1ID3B 3A1KA 3X1SA 5CPID 3MGQC 3WKJD 1P3PD 3MGSC 1P3BD 3AZIC 3R45A 1KX5B 3AZEB 4WU9A 3RELB 3AYWC 1P3IA 4KHAB 5GT3D 5B0ZD 3REJD 2NQBA 5CP6D 3MVDA 3UT9D 4DRAA 1T3UA 1P3KC 3C1CC 3WAAC 4E45A 5CPJC 5B32A 5B33C 1P3FD 2YFVB 3AZJC 3TU4A 4EO5B 2Y2HA 5BO0A 3AV2B 3W97C 5JRGA 3AFAD 3AZLA 4X23A 5DNNA 5B31C 3LELB 3AZFA 3AV1A 3NQJA 1P3LB 3V9RA 1KX3D 3W99A 4KGCC 4J8WC 2Y2GA 5AV8B 5F99D 5GXQB 5AVCD 1S32D 4ZBJC 5B2IA 2DQNC 3KUYD 3KFUG 3AZNB 5G49B 5DNMA 3MNND 1P3AC 2RIQA 1U35D 1ID3C 4QLCA 1TAFA 2JE5A 5AVBB 3W96A 3REKA 4H9QB 3AN2A 1KX5C 4Z5TD 3AZKA 3RELC 2HIOC 3X1SB 2DF4C 4WU8D 2BYMB 3MGPA 2JCHA 3W98C 5AV5D 4J8XC 4NE3A 1P3IB 5AY8A 5B1MC 4E44A 2NQBB 3WTPE 3AZMD 2F8NH 3MVDB 3X1VA 2FJ7A 5B24A 4KUDA 3O62A 5AV9A 3AV2C 3X1TA 1P3OD 3WA9D 3MGRD 5B32B 3C1BA 3LELC 3TU4B 1KX4D 4XUJC 5BO0B 1P3LC 5JRGB 1P3MA 2AROA 3KWQD 4Z2MG 3KUYA 3AV1B 2Y2IA 3NQJB 5AV8C 3UTBC 3V9RB 2IO5C 4YM6C 3W99B 2Y2JA 1HQ3D 1P3AD 1ZLAC 5AVBC 2CV5D 1P3PB 5B2IB 5BT1C 4AWLB 1M18D 3B6FA 4CSRA 3X1SC 4Z2MH 1TAFB 2UWXA 5GSUA 3W96B 3REKB 5GT3B 3REJB 5CP6B 3AN2B 2Y2KA 3UT9B 4HGAB 3AZKB 2ZY4A 2VQRA 4WU9C 4J8VD 4J8UA 2XD5A 5B2JA 3WTPA 5KDMA 2NQBC 3MGPB 1M19A 4H9PB 4WZSB 3MVDC 3AZEA 1P3FB 3REHA 4KHAA 3B6GA 2L5AA 4ZUXD 5GT0D 5B32C 4G91B 5B24B 4KUDB 4JJND 3X1TB 2PYOD 2YFWA 5JRGC 3AZLC 3EPJA 5BNVB 4X23C 5DNNC 5BS7A 3AZFC 1S32B 2F8ND 2AROB 3W99C 3KUYB 5AV6A 1Q9CA 1AOIA 5B40A 4XZQD 1P3GD 3A6NA 2ZY3A 2Y2OA 5B2IC 5DNMC 4AWLC 4Z5TB 3B0DB 4QLCC 5GXQA 2J8PA 4WU8B 3W96C 1ULYA 3REKC 5B31G 3AZNA 3AN2C 3AZKC 3B6FB 4CSRB 5AV5B 3B0CW 5GSUB 4LD9D 4ZUXA 3MGPC 3VH5W 3AZMB 4NFTA 3F6TA 2BYMA 5AY8C 4J8UB 3WTPB 5B2JB 5KDMB 1M1AA 1EQZD 5B0YC 1P34D 1TZYA 3MGRB 1M19B 3X1VC 3REHB 2FJ7C 3B6GB 3AZHA 4KUDC 1KX4B 3O62C 5AV9C 3REIA 3X1TC 5BNXA 2RVQC 3C1BC 4YS3D 3KWQB 3LJAA 5CPKD 4G92B 2YFWB 1P3MC 3AZGD 3LZ1D 2AROC 4R8PD 1A7WA 2Y2NA 2BYKA 3X1UD 5AV6B 3KXBD 4YM6A 1AOIB 5B40B 1F66D 3A6NB 3LZ0A 3UTAD 2NZDA 2JSSA 5B1LD 3IP4C 3B6FC 5CPIA 2FFFB 3WKJA 1P3PA 4J8VB 5GSUC 1P3BA 5E5AC 4Z66D 3VH5A 3MGQD 4J8UC 5GT3A 5B0ZA 5B2JC 3MGSD 5CP6A 4ZUXB 4NE5A 5GT0B 3B0CT 3REJA 3UT9A 3AZID 1M19C 3AZEC 5B0YD 3VH5T 3REHC 3AYWD 3B6GC 4JJNB 1M1AB 1H3OB 4H9PA 1P3FA 1TZYB 1HTAA 2LY8A 3AZHB 2HUEB 2CWEA 1P3KD 3C1CD 3AFAA 3REIB 5BNXB 5CPJD 3WAAD 5B33D 3LJAB 4EO5C 5BS7C 3AZJD 1P3GB 3W97D 5BNVA 5C3IB 1KX3A 5B31D 4DRBA 1AOIC 5B40C 5AVCA 2Y2MA 5F99A 1S32A 3AL0C 5B32G 2BYKB 3MNNA 1U35A 4KGCD 4Z66A 4J8WD 5GXQC 3LZ0B 3AZNC 2NZDB 3FDDA 4Z5TA 5E5AD 1ID3D 4WU8A 5CPIB 3WKJB 3EPLA 4H9SA 1P3BB 1EQZB 1P34B 5AV5A 1KX5D 3RELD 2HIOD 4WNNB 4CAYA 5B0ZB 4NE6A 1M1AC 3AZMA 5CPJA 1TZYC 4M6BA 5B33A 3W98D 1P3IC 2F2AC 4J8XD 2Y2QA 3AZHC 1P3OA 5B1MD 3REIC 3WA9A 3MGRA 3LZ1B 3LJAC 1KX4A 1BH8B 3AV2D 3AFAB 5C3IC 3KWQA 3EPKA 3X1UB 3TU4C 3LELD 3KXBB 4XUJD 4J8WA 4H9OA 1N1JA 1P3LD 4WJ3C 1KX3B 3AV1C 1HQ3A 1P3AA 5AVCB 5AV8D 5F99B 3UTBD 2CV5A 3LZ0C 3MNNB 4YM6D 1M18A 1U35B 4Z66B 1Z2CB 5CPIC 3WKJC 1ZLAD 1P3PC 5AVBD 3MGSB 5BT1D 4J8VA 3X1SD 1WWIA 5GT3C 3REJC 5CP6C 1R4VA 3UT9C 4HGAC 1JFIA 4WU9D 1P3ID 4CAYB 5GT0A 2NQBD 1P3FC 5CPJB 3MVDD 5B33B 5JA4A 4JJNA 4XUJA 1P3OB 2PYOA 1H3OA 3AFAC 3WA9B 4G91C 3H0LC 5B32D 5B24C 1B6WA 5JRGD 3AZLD 1KX3C 2F8NA 4X23D 3VH6W 5DNND 3AZFD 1BFMA 3AV1D 4XZQA 1P3GA 5AVCC 4J8WB 4H9OB 1N1JB 5F99C 1S32C 3B0BA 3KUYC 3MNNC 3W99D 1HQ3B 1P3AB 2ZY2A 2CV5B 5B2ID 5DNMD 1M18B 4Z5TC 3B0DC 4WU8C 4QLCD 2HIOB 4LD9A 5FUGA 4H9SC 3W96D 3REKD 4UPKA 3AN2D 5AV5C 3W98B 3AZKD 4J8XB 1EQZA 5B1MB 3MGPD 3AZMC 1P34A 1JFIB 4WNNA 3WTPC 5AY8D 1P3OC 4H9RB 3WA9C 3MGRC 4H9NA 5CPKA 4YS3A 3X1VD 2FJ7D 1KX4C 5B24D 4KUDD 5JA4B 3H0RC 4XUJB 3O62D 5AV9D 2PYOB 3X1TD 3AZGA 3LZ1A 3KWQC 2RVQD 3C1BD 1BH8A 4R8PA 4G92C 3VH6A 3UTBB 3X1UA 1P3MD 2F8NB 2F8NK 2AROD 2IO5B 4YM6B 3KXBA 1F1EA 1HQ3C 3VH6T 1F66A 4XZQB 1ZLAB 2CV5C 3UTAA 2F8NG 5AV6C 2Y2PA 1M18C 5B1LA 3A6NC 4UUZA 3R45B 3B6FD 4J8VC 3MGQA 4WU9B 3MGSA 5FUGB 5GSUD 4LD9B 3AZIA 5B0YA 3AYWA 4J8UD 4ZUXC 5GT0C 5B2JD 3WTPD 1M19D 3P5JB 3AZED 3REHD 3B6GD 4JJNC 1P3KA 3C1CA 2PYOC 3WAAA 3NQUA 4H9NB 2G5HC 3AZLB 4YS3B 5CPKB 4X23B 3AZJA 5DNNB 3AZFB 2HUEC 3W97A 2ZM5A 3AZGB 5B31A 2ZY5A 4R8PB 1WWSA 4XZQC 1P3GC 1BH9A 5AV6D 5DNMB 4KGCA 1F66B 1AOID 5B40D 4QLCB 3A6ND 3UTAB 1W2EA 5E5AA 5B1LB 1ID3A 5GXQD 4UUZB 4LD9C 2NZDC 4DQYB 3AZND 2W8SA 1KX5A 3RELA 2G5IC 2HIOA 5CHLB 3MGQB 1P3BC 5AY8B 1KU5A 1EQZC 1P34C 1B67A 3AZIB 3W98A 5B0YB 4J8XA 3X1VB 3AYWB 2FJ7B 5B0ZC 5B1MA 3O62B 5AV9B 1M1AD 1PZRA 5CPKC 3A1IA 1TZYD 2YFVA 3KSYA 4YS3C 3C1BB 3EG5B 3AZHD 4H9RA 3AV2A 1P3KB 3C1CB 3REID 3AZGC 3LZ1C 3WAAB 3NQUB 1P3MB 2Y2LA 3LELA 3LJAD 3AZJB 4R8PC 3EPHA 1P3LA 3W97B 3X1UC 2XD1A 5B31B 3KXBC 3TU4D 3H0MC 1F66C 5AV8A 3UTBA 3UTAC 2BG1A 5G49A
chains in the Genus database with same CATH topology
1BH9B 5B1LC 4KGCB 1ZLAA 4WV4B 5AVBA 4ZBJB 3LZ0D 4H9QA 2NZDD 1U35C 4Z66C 5E5AB 1ID3B 3A1KA 3X1SA 5CPID 3MGQC 3WKJD 1P3PD 3MGSC 1P3BD 3AZIC 3R45A 1KX5B 3AZEB 4WU9A 3RELB 3AYWC 1P3IA 4KHAB 5GT3D 5B0ZD 3REJD 2NQBA 5CP6D 3MVDA 3UT9D 4DRAA 1T3UA 1P3KC 3C1CC 3WAAC 4E45A 5CPJC 5B32A 5B33C 1P3FD 2YFVB 3AZJC 3TU4A 4EO5B 2Y2HA 5BO0A 3AV2B 3W97C 5JRGA 3AFAD 3AZLA 4X23A 5DNNA 5B31C 3LELB 3AZFA 3AV1A 3NQJA 1P3LB 3V9RA 1KX3D 3W99A 4KGCC 4J8WC 2Y2GA 5AV8B 5F99D 5GXQB 5AVCD 1S32D 4ZBJC 5B2IA 2DQNC 3KUYD 3KFUG 3AZNB 5G49B 5DNMA 3MNND 1P3AC 2RIQA 1U35D 1ID3C 4QLCA 1TAFA 2JE5A 5AVBB 3W96A 3REKA 4H9QB 3AN2A 1KX5C 4Z5TD 3AZKA 3RELC 2HIOC 3X1SB 2DF4C 4WU8D 2BYMB 3MGPA 2JCHA 3W98C 5AV5D 4J8XC 4NE3A 1P3IB 5AY8A 5B1MC 4E44A 2NQBB 3WTPE 3AZMD 2F8NH 3MVDB 3X1VA 2FJ7A 5B24A 4KUDA 3O62A 5AV9A 3AV2C 3X1TA 1P3OD 3WA9D 3MGRD 5B32B 3C1BA 3LELC 3TU4B 1KX4D 4XUJC 5BO0B 1P3LC 5JRGB 1P3MA 2AROA 3KWQD 4Z2MG 3KUYA 3AV1B 2Y2IA 3NQJB 5AV8C 3UTBC 3V9RB 2IO5C 4YM6C 3W99B 2Y2JA 1HQ3D 1P3AD 1ZLAC 5AVBC 2CV5D 1P3PB 5B2IB 5BT1C 4AWLB 1M18D 3B6FA 4CSRA 3X1SC 4Z2MH 1TAFB 2UWXA 5GSUA 3W96B 3REKB 5GT3B 3REJB 5CP6B 3AN2B 2Y2KA 3UT9B 4HGAB 3AZKB 2ZY4A 2VQRA 4WU9C 4J8VD 4J8UA 2XD5A 5B2JA 3WTPA 5KDMA 2NQBC 3MGPB 1M19A 4H9PB 4WZSB 3MVDC 3AZEA 1P3FB 3REHA 4KHAA 3B6GA 2L5AA 4ZUXD 5GT0D 5B32C 4G91B 5B24B 4KUDB 4JJND 3X1TB 2PYOD 2YFWA 5JRGC 3AZLC 3EPJA 5BNVB 4X23C 5DNNC 5BS7A 3AZFC 1S32B 2F8ND 2AROB 3W99C 3KUYB 5AV6A 1Q9CA 1AOIA 5B40A 4XZQD 1P3GD 3A6NA 2ZY3A 2Y2OA 5B2IC 5DNMC 4AWLC 4Z5TB 3B0DB 4QLCC 5GXQA 2J8PA 4WU8B 3W96C 1ULYA 3REKC 5B31G 3AZNA 3AN2C 3AZKC 3B6FB 4CSRB 5AV5B 3B0CW 5GSUB 4LD9D 4ZUXA 3MGPC 3VH5W 3AZMB 4NFTA 3F6TA 2BYMA 5AY8C 4J8UB 3WTPB 5B2JB 5KDMB 1M1AA 1EQZD 5B0YC 1P34D 1TZYA 3MGRB 1M19B 3X1VC 3REHB 2FJ7C 3B6GB 3AZHA 4KUDC 1KX4B 3O62C 5AV9C 3REIA 3X1TC 5BNXA 2RVQC 3C1BC 4YS3D 3KWQB 3LJAA 5CPKD 4G92B 2YFWB 1P3MC 3AZGD 3LZ1D 2AROC 4R8PD 1A7WA 2Y2NA 2BYKA 3X1UD 5AV6B 3KXBD 4YM6A 1AOIB 5B40B 1F66D 3A6NB 3LZ0A 3UTAD 2NZDA 2JSSA 5B1LD 3IP4C 3B6FC 5CPIA 2FFFB 3WKJA 1P3PA 4J8VB 5GSUC 1P3BA 5E5AC 4Z66D 3VH5A 3MGQD 4J8UC 5GT3A 5B0ZA 5B2JC 3MGSD 5CP6A 4ZUXB 4NE5A 5GT0B 3B0CT 3REJA 3UT9A 3AZID 1M19C 3AZEC 5B0YD 3VH5T 3REHC 3AYWD 3B6GC 4JJNB 1M1AB 1H3OB 4H9PA 1P3FA 1TZYB 1HTAA 2LY8A 3AZHB 2HUEB 2CWEA 1P3KD 3C1CD 3AFAA 3REIB 5BNXB 5CPJD 3WAAD 5B33D 3LJAB 4EO5C 5BS7C 3AZJD 1P3GB 3W97D 5BNVA 5C3IB 1KX3A 5B31D 4DRBA 1AOIC 5B40C 5AVCA 2Y2MA 5F99A 1S32A 3AL0C 5B32G 2BYKB 3MNNA 1U35A 4KGCD 4Z66A 4J8WD 5GXQC 3LZ0B 3AZNC 2NZDB 3FDDA 4Z5TA 5E5AD 1ID3D 4WU8A 5CPIB 3WKJB 3EPLA 4H9SA 1P3BB 1EQZB 1P34B 5AV5A 1KX5D 3RELD 2HIOD 4WNNB 4CAYA 5B0ZB 4NE6A 1M1AC 3AZMA 5CPJA 1TZYC 4M6BA 5B33A 3W98D 1P3IC 2F2AC 4J8XD 2Y2QA 3AZHC 1P3OA 5B1MD 3REIC 3WA9A 3MGRA 3LZ1B 3LJAC 1KX4A 1BH8B 3AV2D 3AFAB 5C3IC 3KWQA 3EPKA 3X1UB 3TU4C 3LELD 3KXBB 4XUJD 4J8WA 4H9OA 1N1JA 1P3LD 4WJ3C 1KX3B 3AV1C 1HQ3A 1P3AA 5AVCB 5AV8D 5F99B 3UTBD 2CV5A 3LZ0C 3MNNB 4YM6D 1M18A 1U35B 4Z66B 1Z2CB 5CPIC 3WKJC 1ZLAD 1P3PC 5AVBD 3MGSB 5BT1D 4J8VA 3X1SD 1WWIA 5GT3C 3REJC 5CP6C 1R4VA 3UT9C 4HGAC 1JFIA 4WU9D 1P3ID 4CAYB 5GT0A 2NQBD 1P3FC 5CPJB 3MVDD 5B33B 5JA4A 4JJNA 4XUJA 1P3OB 2PYOA 1H3OA 3AFAC 3WA9B 4G91C 3H0LC 5B32D 5B24C 1B6WA 5JRGD 3AZLD 1KX3C 2F8NA 4X23D 3VH6W 5DNND 3AZFD 1BFMA 3AV1D 4XZQA 1P3GA 5AVCC 4J8WB 4H9OB 1N1JB 5F99C 1S32C 3B0BA 3KUYC 3MNNC 3W99D 1HQ3B 1P3AB 2ZY2A 2CV5B 5B2ID 5DNMD 1M18B 4Z5TC 3B0DC 4WU8C 4QLCD 2HIOB 4LD9A 5FUGA 4H9SC 3W96D 3REKD 4UPKA 3AN2D 5AV5C 3W98B 3AZKD 4J8XB 1EQZA 5B1MB 3MGPD 3AZMC 1P34A 1JFIB 4WNNA 3WTPC 5AY8D 1P3OC 4H9RB 3WA9C 3MGRC 4H9NA 5CPKA 4YS3A 3X1VD 2FJ7D 1KX4C 5B24D 4KUDD 5JA4B 3H0RC 4XUJB 3O62D 5AV9D 2PYOB 3X1TD 3AZGA 3LZ1A 3KWQC 2RVQD 3C1BD 1BH8A 4R8PA 4G92C 3VH6A 3UTBB 3X1UA 1P3MD 2F8NB 2F8NK 2AROD 2IO5B 4YM6B 3KXBA 1F1EA 1HQ3C 3VH6T 1F66A 4XZQB 1ZLAB 2CV5C 3UTAA 2F8NG 5AV6C 2Y2PA 1M18C 5B1LA 3A6NC 4UUZA 3R45B 3B6FD 4J8VC 3MGQA 4WU9B 3MGSA 5FUGB 5GSUD 4LD9B 3AZIA 5B0YA 3AYWA 4J8UD 4ZUXC 5GT0C 5B2JD 3WTPD 1M19D 3P5JB 3AZED 3REHD 3B6GD 4JJNC 1P3KA 3C1CA 2PYOC 3WAAA 3NQUA 4H9NB 2G5HC 3AZLB 4YS3B 5CPKB 4X23B 3AZJA 5DNNB 3AZFB 2HUEC 3W97A 2ZM5A 3AZGB 5B31A 2ZY5A 4R8PB 1WWSA 4XZQC 1P3GC 1BH9A 5AV6D 5DNMB 4KGCA 1F66B 1AOID 5B40D 4QLCB 3A6ND 3UTAB 1W2EA 5E5AA 5B1LB 1ID3A 5GXQD 4UUZB 4LD9C 2NZDC 4DQYB 3AZND 2W8SA 1KX5A 3RELA 2G5IC 2HIOA 5CHLB 3MGQB 1P3BC 5AY8B 1KU5A 1EQZC 1P34C 1B67A 3AZIB 3W98A 5B0YB 4J8XA 3X1VB 3AYWB 2FJ7B 5B0ZC 5B1MA 3O62B 5AV9B 1M1AD 1PZRA 5CPKC 3A1IA 1TZYD 2YFVA 3KSYA 4YS3C 3C1BB 3EG5B 3AZHD 4H9RA 3AV2A 1P3KB 3C1CB 3REID 3AZGC 3LZ1C 3WAAB 3NQUB 1P3MB 2Y2LA 3LELA 3LJAD 3AZJB 4R8PC 3EPHA 1P3LA 3W97B 3X1UC 2XD1A 5B31B 3KXBC 3TU4D 3H0MC 1F66C 5AV8A 3UTBA 3UTAC 2BG1A 5G49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH9 B;  5B1L C;  4KGC B;  1ZLA A;  4WV4 B;  5AVB A;  4ZBJ B;  3LZ0 D;  4H9Q A;  2NZD D;  1U35 C;  4Z66 C;  5E5A B;  1ID3 B;  3X1S A;  5CPI D;  3MGQ C;  3WKJ D;  1P3P D;  3MGS C;  1P3B D;  3AZI C;  3R45 A;  1KX5 B;  3AZE B;  4WU9 A;  3REL B;  3AYW C;  1P3I A;  4KHA B;  5GT3 D;  5B0Z D;  3REJ D;  2NQB A;  5CP6 D;  3MVD A;  3UT9 D;  4DRA A;  1P3K C;  3C1C C;  3WAA C;  4E45 A;  5CPJ C;  5B32 A;  5B33 C;  1P3F D;  2YFV B;  3AZJ C;  3TU4 A;  4EO5 B;  5BO0 A;  3AV2 B;  3W97 C;  5JRG A;  3AFA D;  3AZL A;  4X23 A;  5DNN A;  5B31 C;  3LEL B;  3AZF A;  3AV1 A;  3NQJ A;  1P3L B;  3V9R A;  1KX3 D;  3W99 A;  4KGC C;  4J8W C;  5AV8 B;  5AVC D;  5F99 D;  5GXQ B;  1S32 D;  4ZBJ C;  5B2I A;  3KUY D;  3AZN B;  5G49 B;  5DNM A;  3MNN D;  1P3A C;  1U35 D;  1ID3 C;  4QLC A;  1TAF A;  5AVB B;  3W96 A;  3REK A;  4H9Q B;  3AN2 A;  1KX5 C;  4Z5T D;  3AZK A;  3REL C;  2HIO C;  3X1S B;  4WU8 D;  2BYM B;  3MGP A;  3W98 C;  5AV5 D;  4J8X C;  4NE3 A;  1P3I B;  5AY8 A;  5B1M C;  4E44 A;  2NQB B;  3WTP E;  3AZM D;  2F8N H;  3MVD B;  3X1V A;  2FJ7 A;  5B24 A;  4KUD A;  3O62 A;  5AV9 A;  3AV2 C;  3X1T A;  1P3O D;  3WA9 D;  3MGR D;  5B32 B;  3C1B A;  3LEL C;  3TU4 B;  1KX4 D;  4XUJ C;  5BO0 B;  1P3L C;  5JRG B;  1P3M A;  2ARO A;  3KWQ D;  4Z2M G;  3KUY A;  3AV1 B;  3NQJ B;  5AV8 C;  3UTB C;  3V9R B;  2IO5 C;  4YM6 C;  3W99 B;  1HQ3 D;  1P3A D;  1ZLA C;  5AVB C;  2CV5 D;  1P3P B;  5B2I B;  5BT1 C;  4AWL B;  1M18 D;  3B6F A;  4CSR A;  3X1S C;  4Z2M H;  1TAF B;  5GSU A;  3W96 B;  3REK B;  5GT3 B;  3REJ B;  5CP6 B;  3AN2 B;  3UT9 B;  4HGA B;  3AZK B;  4WU9 C;  4J8V D;  4J8U A;  5B2J A;  3WTP A;  5KDM A;  2NQB C;  3MGP B;  1M19 A;  4H9P B;  4WZS B;  3MVD C;  3AZE A;  1P3F B;  3REH A;  4KHA A;  3B6G A;  2L5A A;  4ZUX D;  5GT0 D;  5B32 C;  4G91 B;  5B24 B;  4KUD B;  4JJN D;  3X1T B;  2PYO D;  2YFW A;  5JRG C;  3AZL C;  5BNV B;  4X23 C;  5DNN C;  5BS7 A;  3AZF C;  1S32 B;  2F8N D;  2ARO B;  3W99 C;  3KUY B;  5AV6 A;  1Q9C A;  1AOI A;  5B40 A;  4XZQ D;  1P3G D;  3A6N A;  5B2I C;  5DNM C;  4AWL C;  4Z5T B;  3B0D B;  4QLC C;  5GXQ A;  4WU8 B;  3W96 C;  1ULY A;  3REK C;  5B31 G;  3AZN A;  3AN2 C;  3AZK C;  3B6F B;  4CSR B;  5AV5 B;  3B0C W;  5GSU B;  4LD9 D;  4ZUX A;  3MGP C;  3VH5 W;  3AZM B;  4NFT A;  2BYM A;  5AY8 C;  4J8U B;  3WTP B;  5B2J B;  5KDM B;  1M1A A;  1EQZ D;  5B0Y C;  1P34 D;  1TZY A;  3MGR B;  1M19 B;  3X1V C;  3REH B;  2FJ7 C;  3B6G B;  3AZH A;  4KUD C;  1KX4 B;  3O62 C;  5AV9 C;  3REI A;  3X1T C;  5BNX A;  2RVQ C;  3C1B C;  4YS3 D;  3KWQ B;  3LJA A;  5CPK D;  4G92 B;  2YFW B;  1P3M C;  3AZG D;  3LZ1 D;  2ARO C;  4R8P D;  1A7W A;  2BYK A;  3X1U D;  5AV6 B;  3KXB D;  1AOI B;  5B40 B;  1F66 D;  3A6N B;  3LZ0 A;  3UTA D;  2NZD A;  2JSS A;  5B1L D;  3B6F C;  5CPI A;  3WKJ A;  1P3P A;  4J8V B;  5GSU C;  1P3B A;  5E5A C;  4Z66 D;  3VH5 A;  3MGQ D;  4J8U C;  5GT3 A;  5B0Z A;  5B2J C;  3MGS D;  5CP6 A;  4ZUX B;  4NE5 A;  5GT0 B;  3B0C T;  3REJ A;  3UT9 A;  3AZI D;  1M19 C;  3AZE C;  5B0Y D;  3VH5 T;  3REH C;  3AYW D;  3B6G C;  4JJN B;  1M1A B;  1H3O B;  4H9P A;  1P3F A;  1TZY B;  1HTA A;  2LY8 A;  3AZH B;  2HUE B;  2CWE A;  1P3K D;  3C1C D;  3AFA A;  3REI B;  5BNX B;  5CPJ D;  3WAA D;  5B33 D;  3LJA B;  4EO5 C;  5BS7 C;  3AZJ D;  1P3G B;  3W97 D;  5BNV A;  5C3I B;  1KX3 A;  5B31 D;  4DRB A;  1AOI C;  5B40 C;  5AVC A;  1S32 A;  5F99 A;  5B32 G;  2BYK B;  3MNN A;  1U35 A;  4KGC D;  4Z66 A;  4J8W D;  5GXQ C;  3LZ0 B;  3AZN C;  2NZD B;  4Z5T A;  5E5A D;  1ID3 D;  4WU8 A;  5CPI B;  3WKJ B;  4H9S A;  1P3B B;  1EQZ B;  1P34 B;  5AV5 A;  1KX5 D;  3REL D;  2HIO D;  4WNN B;  4CAY A;  5B0Z B;  4NE6 A;  1M1A C;  3AZM A;  5CPJ A;  1TZY C;  4M6B A;  5B33 A;  3W98 D;  1P3I C;  4J8X D;  3AZH C;  1P3O A;  5B1M D;  3REI C;  3WA9 A;  3MGR A;  3LZ1 B;  3LJA C;  1KX4 A;  1BH8 B;  3AV2 D;  3AFA B;  5C3I C;  3KWQ A;  3X1U B;  3TU4 C;  3LEL D;  3KXB B;  4XUJ D;  4J8W A;  4H9O A;  1N1J A;  1P3L D;  1KX3 B;  3AV1 C;  1HQ3 A;  1P3A A;  5AVC B;  5AV8 D;  5F99 B;  3UTB D;  2CV5 A;  3LZ0 C;  3MNN B;  4YM6 D;  1M18 A;  1U35 B;  4Z66 B;  5CPI C;  3WKJ C;  1ZLA D;  1P3P C;  5AVB D;  3MGS B;  5BT1 D;  4J8V A;  3X1S D;  1WWI A;  5GT3 C;  3REJ C;  5CP6 C;  1R4V A;  3UT9 C;  4HGA C;  1JFI A;  4WU9 D;  1P3I D;  4CAY B;  5GT0 A;  2NQB D;  1P3F C;  5CPJ B;  3MVD D;  5B33 B;  5JA4 A;  4JJN A;  4XUJ A;  1P3O B;  2PYO A;  1H3O A;  3AFA C;  3WA9 B;  4G91 C;  5B32 D;  5B24 C;  1B6W A;  5JRG D;  3AZL D;  1KX3 C;  2F8N A;  4X23 D;  3VH6 W;  5DNN D;  3AZF D;  1BFM A;  3AV1 D;  4XZQ A;  1P3G A;  5AVC C;  4J8W B;  4H9O B;  1N1J B;  5F99 C;  1S32 C;  3B0B A;  3KUY C;  3MNN C;  3W99 D;  1HQ3 B;  1P3A B;  2CV5 B;  5B2I D;  5DNM D;  1M18 B;  4Z5T C;  3B0D C;  4WU8 C;  4QLC D;  2HIO B;  4LD9 A;  5FUG A;  4H9S C;  3W96 D;  3REK D;  3AN2 D;  5AV5 C;  3W98 B;  3AZK D;  4J8X B;  1EQZ A;  5B1M B;  3MGP D;  3AZM C;  1P34 A;  1JFI B;  4WNN A;  3WTP C;  5AY8 D;  1P3O C;  4H9R B;  3WA9 C;  3MGR C;  4H9N A;  5CPK A;  4YS3 A;  3X1V D;  2FJ7 D;  1KX4 C;  5B24 D;  4KUD D;  5JA4 B;  4XUJ B;  3O62 D;  5AV9 D;  2PYO B;  3X1T D;  3AZG A;  3LZ1 A;  3KWQ C;  2RVQ D;  3C1B D;  1BH8 A;  4R8P A;  4G92 C;  3VH6 A;  3UTB B;  3X1U A;  1P3M D;  2F8N B;  2F8N K;  2ARO D;  2IO5 B;  4YM6 B;  3KXB A;  1F1E A;  1HQ3 C;  3VH6 T;  1F66 A;  4XZQ B;  1ZLA B;  2CV5 C;  3UTA A;  2F8N G;  5AV6 C;  1M18 C;  5B1L A;  3A6N C;  4UUZ A;  3R45 B;  3B6F D;  4J8V C;  3MGQ A;  4WU9 B;  3MGS A;  5FUG B;  5GSU D;  4LD9 B;  3AZI A;  5B0Y A;  3AYW A;  4J8U D;  4ZUX C;  5GT0 C;  5B2J D;  3WTP D;  1M19 D;  3AZE D;  3REH D;  3B6G D;  4JJN C;  1P3K A;  3C1C A;  2PYO C;  3WAA A;  3NQU A;  4H9N B;  3AZL B;  5CPK B;  4YS3 B;  4X23 B;  3AZJ A;  5DNN B;  3AZF B;  2HUE C;  3W97 A;  3AZG B;  5B31 A;  4R8P B;  1WWS A;  4XZQ C;  1P3G C;  1BH9 A;  5AV6 D;  5DNM B;  4KGC A;  1F66 B;  1AOI D;  5B40 D;  4QLC B;  3A6N D;  3UTA B;  5E5A A;  5B1L B;  1ID3 A;  5GXQ D;  4UUZ B;  4LD9 C;  2NZD C;  3AZN D;  1KX5 A;  3REL A;  2HIO A;  5CHL B;  3MGQ B;  1P3B C;  5AY8 B;  1KU5 A;  1EQZ C;  1P34 C;  1B67 A;  3AZI B;  3W98 A;  5B0Y B;  4J8X A;  3X1V B;  3AYW B;  2FJ7 B;  5B0Z C;  5B1M A;  3O62 B;  5AV9 B;  1M1A D;  5CPK C;  4YS3 C;  1TZY D;  2YFV A;  3KSY A;  3C1B B;  3AZH D;  4H9R A;  5G49 A;  3AV2 A;  1P3K B;  3C1C B;  3REI D;  3AZG C;  3LZ1 C;  3WAA B;  3NQU B;  1P3M B;  3LEL A;  3LJA D;  3AZJ B;  4R8P C;  1P3L A;  3W97 B;  3X1U C;  5B31 B;  3KXB C;  3TU4 D;  1F66 C;  5AV8 A;  3UTB A;  3UTA C;  4YM6 A; 
#chains in the Genus database with same CATH topology
 1BH9 B;  5B1L C;  4KGC B;  1ZLA A;  4WV4 B;  5AVB A;  4ZBJ B;  3LZ0 D;  4H9Q A;  2NZD D;  1U35 C;  4Z66 C;  5E5A B;  1ID3 B;  3A1K A;  3X1S A;  5CPI D;  3MGQ C;  3WKJ D;  1P3P D;  3MGS C;  1P3B D;  3AZI C;  3R45 A;  1KX5 B;  3AZE B;  4WU9 A;  3REL B;  3AYW C;  1P3I A;  4KHA B;  5GT3 D;  5B0Z D;  3REJ D;  2NQB A;  5CP6 D;  3MVD A;  3UT9 D;  4DRA A;  1T3U A;  1P3K C;  3C1C C;  3WAA C;  4E45 A;  5CPJ C;  5B32 A;  5B33 C;  1P3F D;  2YFV B;  3AZJ C;  3TU4 A;  4EO5 B;  2Y2H A;  5BO0 A;  3AV2 B;  3W97 C;  5JRG A;  3AFA D;  3AZL A;  4X23 A;  5DNN A;  5B31 C;  3LEL B;  3AZF A;  3AV1 A;  3NQJ A;  1P3L B;  3V9R A;  1KX3 D;  3W99 A;  4KGC C;  4J8W C;  2Y2G A;  5AV8 B;  5F99 D;  5GXQ B;  5AVC D;  1S32 D;  4ZBJ C;  5B2I A;  2DQN C;  3KUY D;  3KFU G;  3AZN B;  5G49 B;  5DNM A;  3MNN D;  1P3A C;  2RIQ A;  1U35 D;  1ID3 C;  4QLC A;  1TAF A;  2JE5 A;  5AVB B;  3W96 A;  3REK A;  4H9Q B;  3AN2 A;  1KX5 C;  4Z5T D;  3AZK A;  3REL C;  2HIO C;  3X1S B;  2DF4 C;  4WU8 D;  2BYM B;  3MGP A;  2JCH A;  3W98 C;  5AV5 D;  4J8X C;  4NE3 A;  1P3I B;  5AY8 A;  5B1M C;  4E44 A;  2NQB B;  3WTP E;  3AZM D;  2F8N H;  3MVD B;  3X1V A;  2FJ7 A;  5B24 A;  4KUD A;  3O62 A;  5AV9 A;  3AV2 C;  3X1T A;  1P3O D;  3WA9 D;  3MGR D;  5B32 B;  3C1B A;  3LEL C;  3TU4 B;  1KX4 D;  4XUJ C;  5BO0 B;  1P3L C;  5JRG B;  1P3M A;  2ARO A;  3KWQ D;  4Z2M G;  3KUY A;  3AV1 B;  2Y2I A;  3NQJ B;  5AV8 C;  3UTB C;  3V9R B;  2IO5 C;  4YM6 C;  3W99 B;  2Y2J A;  1HQ3 D;  1P3A D;  1ZLA C;  5AVB C;  2CV5 D;  1P3P B;  5B2I B;  5BT1 C;  4AWL B;  1M18 D;  3B6F A;  4CSR A;  3X1S C;  4Z2M H;  1TAF B;  2UWX A;  5GSU A;  3W96 B;  3REK B;  5GT3 B;  3REJ B;  5CP6 B;  3AN2 B;  2Y2K A;  3UT9 B;  4HGA B;  3AZK B;  2ZY4 A;  2VQR A;  4WU9 C;  4J8V D;  4J8U A;  2XD5 A;  5B2J A;  3WTP A;  5KDM A;  2NQB C;  3MGP B;  1M19 A;  4H9P B;  4WZS B;  3MVD C;  3AZE A;  1P3F B;  3REH A;  4KHA A;  3B6G A;  2L5A A;  4ZUX D;  5GT0 D;  5B32 C;  4G91 B;  5B24 B;  4KUD B;  4JJN D;  3X1T B;  2PYO D;  2YFW A;  5JRG C;  3AZL C;  3EPJ A;  5BNV B;  4X23 C;  5DNN C;  5BS7 A;  3AZF C;  1S32 B;  2F8N D;  2ARO B;  3W99 C;  3KUY B;  5AV6 A;  1Q9C A;  1AOI A;  5B40 A;  4XZQ D;  1P3G D;  3A6N A;  2ZY3 A;  2Y2O A;  5B2I C;  5DNM C;  4AWL C;  4Z5T B;  3B0D B;  4QLC C;  5GXQ A;  2J8P A;  4WU8 B;  3W96 C;  1ULY A;  3REK C;  5B31 G;  3AZN A;  3AN2 C;  3AZK C;  3B6F B;  4CSR B;  5AV5 B;  3B0C W;  5GSU B;  4LD9 D;  4ZUX A;  3MGP C;  3VH5 W;  3AZM B;  4NFT A;  3F6T A;  2BYM A;  5AY8 C;  4J8U B;  3WTP B;  5B2J B;  5KDM B;  1M1A A;  1EQZ D;  5B0Y C;  1P34 D;  1TZY A;  3MGR B;  1M19 B;  3X1V C;  3REH B;  2FJ7 C;  3B6G B;  3AZH A;  4KUD C;  1KX4 B;  3O62 C;  5AV9 C;  3REI A;  3X1T C;  5BNX A;  2RVQ C;  3C1B C;  4YS3 D;  3KWQ B;  3LJA A;  5CPK D;  4G92 B;  2YFW B;  1P3M C;  3AZG D;  3LZ1 D;  2ARO C;  4R8P D;  1A7W A;  2Y2N A;  2BYK A;  3X1U D;  5AV6 B;  3KXB D;  4YM6 A;  1AOI B;  5B40 B;  1F66 D;  3A6N B;  3LZ0 A;  3UTA D;  2NZD A;  2JSS A;  5B1L D;  3IP4 C;  3B6F C;  5CPI A;  2FFF B;  3WKJ A;  1P3P A;  4J8V B;  5GSU C;  1P3B A;  5E5A C;  4Z66 D;  3VH5 A;  3MGQ D;  4J8U C;  5GT3 A;  5B0Z A;  5B2J C;  3MGS D;  5CP6 A;  4ZUX B;  4NE5 A;  5GT0 B;  3B0C T;  3REJ A;  3UT9 A;  3AZI D;  1M19 C;  3AZE C;  5B0Y D;  3VH5 T;  3REH C;  3AYW D;  3B6G C;  4JJN B;  1M1A B;  1H3O B;  4H9P A;  1P3F A;  1TZY B;  1HTA A;  2LY8 A;  3AZH B;  2HUE B;  2CWE A;  1P3K D;  3C1C D;  3AFA A;  3REI B;  5BNX B;  5CPJ D;  3WAA D;  5B33 D;  3LJA B;  4EO5 C;  5BS7 C;  3AZJ D;  1P3G B;  3W97 D;  5BNV A;  5C3I B;  1KX3 A;  5B31 D;  4DRB A;  1AOI C;  5B40 C;  5AVC A;  2Y2M A;  5F99 A;  1S32 A;  3AL0 C;  5B32 G;  2BYK B;  3MNN A;  1U35 A;  4KGC D;  4Z66 A;  4J8W D;  5GXQ C;  3LZ0 B;  3AZN C;  2NZD B;  3FDD A;  4Z5T A;  5E5A D;  1ID3 D;  4WU8 A;  5CPI B;  3WKJ B;  3EPL A;  4H9S A;  1P3B B;  1EQZ B;  1P34 B;  5AV5 A;  1KX5 D;  3REL D;  2HIO D;  4WNN B;  4CAY A;  5B0Z B;  4NE6 A;  1M1A C;  3AZM A;  5CPJ A;  1TZY C;  4M6B A;  5B33 A;  3W98 D;  1P3I C;  2F2A C;  4J8X D;  2Y2Q A;  3AZH C;  1P3O A;  5B1M D;  3REI C;  3WA9 A;  3MGR A;  3LZ1 B;  3LJA C;  1KX4 A;  1BH8 B;  3AV2 D;  3AFA B;  5C3I C;  3KWQ A;  3EPK A;  3X1U B;  3TU4 C;  3LEL D;  3KXB B;  4XUJ D;  4J8W A;  4H9O A;  1N1J A;  1P3L D;  4WJ3 C;  1KX3 B;  3AV1 C;  1HQ3 A;  1P3A A;  5AVC B;  5AV8 D;  5F99 B;  3UTB D;  2CV5 A;  3LZ0 C;  3MNN B;  4YM6 D;  1M18 A;  1U35 B;  4Z66 B;  1Z2C B;  5CPI C;  3WKJ C;  1ZLA D;  1P3P C;  5AVB D;  3MGS B;  5BT1 D;  4J8V A;  3X1S D;  1WWI A;  5GT3 C;  3REJ C;  5CP6 C;  1R4V A;  3UT9 C;  4HGA C;  1JFI A;  4WU9 D;  1P3I D;  4CAY B;  5GT0 A;  2NQB D;  1P3F C;  5CPJ B;  3MVD D;  5B33 B;  5JA4 A;  4JJN A;  4XUJ A;  1P3O B;  2PYO A;  1H3O A;  3AFA C;  3WA9 B;  4G91 C;  3H0L C;  5B32 D;  5B24 C;  1B6W A;  5JRG D;  3AZL D;  1KX3 C;  2F8N A;  4X23 D;  3VH6 W;  5DNN D;  3AZF D;  1BFM A;  3AV1 D;  4XZQ A;  1P3G A;  5AVC C;  4J8W B;  4H9O B;  1N1J B;  5F99 C;  1S32 C;  3B0B A;  3KUY C;  3MNN C;  3W99 D;  1HQ3 B;  1P3A B;  2ZY2 A;  2CV5 B;  5B2I D;  5DNM D;  1M18 B;  4Z5T C;  3B0D C;  4WU8 C;  4QLC D;  2HIO B;  4LD9 A;  5FUG A;  4H9S C;  3W96 D;  3REK D;  4UPK A;  3AN2 D;  5AV5 C;  3W98 B;  3AZK D;  4J8X B;  1EQZ A;  5B1M B;  3MGP D;  3AZM C;  1P34 A;  1JFI B;  4WNN A;  3WTP C;  5AY8 D;  1P3O C;  4H9R B;  3WA9 C;  3MGR C;  4H9N A;  5CPK A;  4YS3 A;  3X1V D;  2FJ7 D;  1KX4 C;  5B24 D;  4KUD D;  5JA4 B;  3H0R C;  4XUJ B;  3O62 D;  5AV9 D;  2PYO B;  3X1T D;  3AZG A;  3LZ1 A;  3KWQ C;  2RVQ D;  3C1B D;  1BH8 A;  4R8P A;  4G92 C;  3VH6 A;  3UTB B;  3X1U A;  1P3M D;  2F8N B;  2F8N K;  2ARO D;  2IO5 B;  4YM6 B;  3KXB A;  1F1E A;  1HQ3 C;  3VH6 T;  1F66 A;  4XZQ B;  1ZLA B;  2CV5 C;  3UTA A;  2F8N G;  5AV6 C;  2Y2P A;  1M18 C;  5B1L A;  3A6N C;  4UUZ A;  3R45 B;  3B6F D;  4J8V C;  3MGQ A;  4WU9 B;  3MGS A;  5FUG B;  5GSU D;  4LD9 B;  3AZI A;  5B0Y A;  3AYW A;  4J8U D;  4ZUX C;  5GT0 C;  5B2J D;  3WTP D;  1M19 D;  3P5J B;  3AZE D;  3REH D;  3B6G D;  4JJN C;  1P3K A;  3C1C A;  2PYO C;  3WAA A;  3NQU A;  4H9N B;  2G5H C;  3AZL B;  4YS3 B;  5CPK B;  4X23 B;  3AZJ A;  5DNN B;  3AZF B;  2HUE C;  3W97 A;  2ZM5 A;  3AZG B;  5B31 A;  2ZY5 A;  4R8P B;  1WWS A;  4XZQ C;  1P3G C;  1BH9 A;  5AV6 D;  5DNM B;  4KGC A;  1F66 B;  1AOI D;  5B40 D;  4QLC B;  3A6N D;  3UTA B;  1W2E A;  5E5A A;  5B1L B;  1ID3 A;  5GXQ D;  4UUZ B;  4LD9 C;  2NZD C;  4DQY B;  3AZN D;  2W8S A;  1KX5 A;  3REL A;  2G5I C;  2HIO A;  5CHL B;  3MGQ B;  1P3B C;  5AY8 B;  1KU5 A;  1EQZ C;  1P34 C;  1B67 A;  3AZI B;  3W98 A;  5B0Y B;  4J8X A;  3X1V B;  3AYW B;  2FJ7 B;  5B0Z C;  5B1M A;  3O62 B;  5AV9 B;  1M1A D;  1PZR A;  5CPK C;  3A1I A;  1TZY D;  2YFV A;  3KSY A;  4YS3 C;  3C1B B;  3EG5 B;  3AZH D;  4H9R A;  3AV2 A;  1P3K B;  3C1C B;  3REI D;  3AZG C;  3LZ1 C;  3WAA B;  3NQU B;  1P3M B;  2Y2L A;  3LEL A;  3LJA D;  3AZJ B;  4R8P C;  3EPH A;  1P3L A;  3W97 B;  3X1U C;  2XD1 A;  5B31 B;  3KXB C;  3TU4 D;  3H0M C;  1F66 C;  5AV8 A;  3UTB A;  3UTA C;  2BG1 A;  5G49 A; 
#chains in the Genus database with same CATH homology
 1BH9 B;  5B1L C;  4KGC B;  1ZLA A;  4WV4 B;  5AVB A;  4ZBJ B;  3LZ0 D;  4H9Q A;  2NZD D;  1U35 C;  4Z66 C;  5E5A B;  1ID3 B;  3A1K A;  3X1S A;  5CPI D;  3MGQ C;  3WKJ D;  1P3P D;  3MGS C;  1P3B D;  3AZI C;  3R45 A;  1KX5 B;  3AZE B;  4WU9 A;  3REL B;  3AYW C;  1P3I A;  4KHA B;  5GT3 D;  5B0Z D;  3REJ D;  2NQB A;  5CP6 D;  3MVD A;  3UT9 D;  4DRA A;  1T3U A;  1P3K C;  3C1C C;  3WAA C;  4E45 A;  5CPJ C;  5B32 A;  5B33 C;  1P3F D;  2YFV B;  3AZJ C;  3TU4 A;  4EO5 B;  2Y2H A;  5BO0 A;  3AV2 B;  3W97 C;  5JRG A;  3AFA D;  3AZL A;  4X23 A;  5DNN A;  5B31 C;  3LEL B;  3AZF A;  3AV1 A;  3NQJ A;  1P3L B;  3V9R A;  1KX3 D;  3W99 A;  4KGC C;  4J8W C;  2Y2G A;  5AV8 B;  5F99 D;  5GXQ B;  5AVC D;  1S32 D;  4ZBJ C;  5B2I A;  2DQN C;  3KUY D;  3KFU G;  3AZN B;  5G49 B;  5DNM A;  3MNN D;  1P3A C;  2RIQ A;  1U35 D;  1ID3 C;  4QLC A;  1TAF A;  2JE5 A;  5AVB B;  3W96 A;  3REK A;  4H9Q B;  3AN2 A;  1KX5 C;  4Z5T D;  3AZK A;  3REL C;  2HIO C;  3X1S B;  2DF4 C;  4WU8 D;  2BYM B;  3MGP A;  2JCH A;  3W98 C;  5AV5 D;  4J8X C;  4NE3 A;  1P3I B;  5AY8 A;  5B1M C;  4E44 A;  2NQB B;  3WTP E;  3AZM D;  2F8N H;  3MVD B;  3X1V A;  2FJ7 A;  5B24 A;  4KUD A;  3O62 A;  5AV9 A;  3AV2 C;  3X1T A;  1P3O D;  3WA9 D;  3MGR D;  5B32 B;  3C1B A;  3LEL C;  3TU4 B;  1KX4 D;  4XUJ C;  5BO0 B;  1P3L C;  5JRG B;  1P3M A;  2ARO A;  3KWQ D;  4Z2M G;  3KUY A;  3AV1 B;  2Y2I A;  3NQJ B;  5AV8 C;  3UTB C;  3V9R B;  2IO5 C;  4YM6 C;  3W99 B;  2Y2J A;  1HQ3 D;  1P3A D;  1ZLA C;  5AVB C;  2CV5 D;  1P3P B;  5B2I B;  5BT1 C;  4AWL B;  1M18 D;  3B6F A;  4CSR A;  3X1S C;  4Z2M H;  1TAF B;  2UWX A;  5GSU A;  3W96 B;  3REK B;  5GT3 B;  3REJ B;  5CP6 B;  3AN2 B;  2Y2K A;  3UT9 B;  4HGA B;  3AZK B;  2ZY4 A;  2VQR A;  4WU9 C;  4J8V D;  4J8U A;  2XD5 A;  5B2J A;  3WTP A;  5KDM A;  2NQB C;  3MGP B;  1M19 A;  4H9P B;  4WZS B;  3MVD C;  3AZE A;  1P3F B;  3REH A;  4KHA A;  3B6G A;  2L5A A;  4ZUX D;  5GT0 D;  5B32 C;  4G91 B;  5B24 B;  4KUD B;  4JJN D;  3X1T B;  2PYO D;  2YFW A;  5JRG C;  3AZL C;  3EPJ A;  5BNV B;  4X23 C;  5DNN C;  5BS7 A;  3AZF C;  1S32 B;  2F8N D;  2ARO B;  3W99 C;  3KUY B;  5AV6 A;  1Q9C A;  1AOI A;  5B40 A;  4XZQ D;  1P3G D;  3A6N A;  2ZY3 A;  2Y2O A;  5B2I C;  5DNM C;  4AWL C;  4Z5T B;  3B0D B;  4QLC C;  5GXQ A;  2J8P A;  4WU8 B;  3W96 C;  1ULY A;  3REK C;  5B31 G;  3AZN A;  3AN2 C;  3AZK C;  3B6F B;  4CSR B;  5AV5 B;  3B0C W;  5GSU B;  4LD9 D;  4ZUX A;  3MGP C;  3VH5 W;  3AZM B;  4NFT A;  3F6T A;  2BYM A;  5AY8 C;  4J8U B;  3WTP B;  5B2J B;  5KDM B;  1M1A A;  1EQZ D;  5B0Y C;  1P34 D;  1TZY A;  3MGR B;  1M19 B;  3X1V C;  3REH B;  2FJ7 C;  3B6G B;  3AZH A;  4KUD C;  1KX4 B;  3O62 C;  5AV9 C;  3REI A;  3X1T C;  5BNX A;  2RVQ C;  3C1B C;  4YS3 D;  3KWQ B;  3LJA A;  5CPK D;  4G92 B;  2YFW B;  1P3M C;  3AZG D;  3LZ1 D;  2ARO C;  4R8P D;  1A7W A;  2Y2N A;  2BYK A;  3X1U D;  5AV6 B;  3KXB D;  4YM6 A;  1AOI B;  5B40 B;  1F66 D;  3A6N B;  3LZ0 A;  3UTA D;  2NZD A;  2JSS A;  5B1L D;  3IP4 C;  3B6F C;  5CPI A;  2FFF B;  3WKJ A;  1P3P A;  4J8V B;  5GSU C;  1P3B A;  5E5A C;  4Z66 D;  3VH5 A;  3MGQ D;  4J8U C;  5GT3 A;  5B0Z A;  5B2J C;  3MGS D;  5CP6 A;  4ZUX B;  4NE5 A;  5GT0 B;  3B0C T;  3REJ A;  3UT9 A;  3AZI D;  1M19 C;  3AZE C;  5B0Y D;  3VH5 T;  3REH C;  3AYW D;  3B6G C;  4JJN B;  1M1A B;  1H3O B;  4H9P A;  1P3F A;  1TZY B;  1HTA A;  2LY8 A;  3AZH B;  2HUE B;  2CWE A;  1P3K D;  3C1C D;  3AFA A;  3REI B;  5BNX B;  5CPJ D;  3WAA D;  5B33 D;  3LJA B;  4EO5 C;  5BS7 C;  3AZJ D;  1P3G B;  3W97 D;  5BNV A;  5C3I B;  1KX3 A;  5B31 D;  4DRB A;  1AOI C;  5B40 C;  5AVC A;  2Y2M A;  5F99 A;  1S32 A;  3AL0 C;  5B32 G;  2BYK B;  3MNN A;  1U35 A;  4KGC D;  4Z66 A;  4J8W D;  5GXQ C;  3LZ0 B;  3AZN C;  2NZD B;  3FDD A;  4Z5T A;  5E5A D;  1ID3 D;  4WU8 A;  5CPI B;  3WKJ B;  3EPL A;  4H9S A;  1P3B B;  1EQZ B;  1P34 B;  5AV5 A;  1KX5 D;  3REL D;  2HIO D;  4WNN B;  4CAY A;  5B0Z B;  4NE6 A;  1M1A C;  3AZM A;  5CPJ A;  1TZY C;  4M6B A;  5B33 A;  3W98 D;  1P3I C;  2F2A C;  4J8X D;  2Y2Q A;  3AZH C;  1P3O A;  5B1M D;  3REI C;  3WA9 A;  3MGR A;  3LZ1 B;  3LJA C;  1KX4 A;  1BH8 B;  3AV2 D;  3AFA B;  5C3I C;  3KWQ A;  3EPK A;  3X1U B;  3TU4 C;  3LEL D;  3KXB B;  4XUJ D;  4J8W A;  4H9O A;  1N1J A;  1P3L D;  4WJ3 C;  1KX3 B;  3AV1 C;  1HQ3 A;  1P3A A;  5AVC B;  5AV8 D;  5F99 B;  3UTB D;  2CV5 A;  3LZ0 C;  3MNN B;  4YM6 D;  1M18 A;  1U35 B;  4Z66 B;  1Z2C B;  5CPI C;  3WKJ C;  1ZLA D;  1P3P C;  5AVB D;  3MGS B;  5BT1 D;  4J8V A;  3X1S D;  1WWI A;  5GT3 C;  3REJ C;  5CP6 C;  1R4V A;  3UT9 C;  4HGA C;  1JFI A;  4WU9 D;  1P3I D;  4CAY B;  5GT0 A;  2NQB D;  1P3F C;  5CPJ B;  3MVD D;  5B33 B;  5JA4 A;  4JJN A;  4XUJ A;  1P3O B;  2PYO A;  1H3O A;  3AFA C;  3WA9 B;  4G91 C;  3H0L C;  5B32 D;  5B24 C;  1B6W A;  5JRG D;  3AZL D;  1KX3 C;  2F8N A;  4X23 D;  3VH6 W;  5DNN D;  3AZF D;  1BFM A;  3AV1 D;  4XZQ A;  1P3G A;  5AVC C;  4J8W B;  4H9O B;  1N1J B;  5F99 C;  1S32 C;  3B0B A;  3KUY C;  3MNN C;  3W99 D;  1HQ3 B;  1P3A B;  2ZY2 A;  2CV5 B;  5B2I D;  5DNM D;  1M18 B;  4Z5T C;  3B0D C;  4WU8 C;  4QLC D;  2HIO B;  4LD9 A;  5FUG A;  4H9S C;  3W96 D;  3REK D;  4UPK A;  3AN2 D;  5AV5 C;  3W98 B;  3AZK D;  4J8X B;  1EQZ A;  5B1M B;  3MGP D;  3AZM C;  1P34 A;  1JFI B;  4WNN A;  3WTP C;  5AY8 D;  1P3O C;  4H9R B;  3WA9 C;  3MGR C;  4H9N A;  5CPK A;  4YS3 A;  3X1V D;  2FJ7 D;  1KX4 C;  5B24 D;  4KUD D;  5JA4 B;  3H0R C;  4XUJ B;  3O62 D;  5AV9 D;  2PYO B;  3X1T D;  3AZG A;  3LZ1 A;  3KWQ C;  2RVQ D;  3C1B D;  1BH8 A;  4R8P A;  4G92 C;  3VH6 A;  3UTB B;  3X1U A;  1P3M D;  2F8N B;  2F8N K;  2ARO D;  2IO5 B;  4YM6 B;  3KXB A;  1F1E A;  1HQ3 C;  3VH6 T;  1F66 A;  4XZQ B;  1ZLA B;  2CV5 C;  3UTA A;  2F8N G;  5AV6 C;  2Y2P A;  1M18 C;  5B1L A;  3A6N C;  4UUZ A;  3R45 B;  3B6F D;  4J8V C;  3MGQ A;  4WU9 B;  3MGS A;  5FUG B;  5GSU D;  4LD9 B;  3AZI A;  5B0Y A;  3AYW A;  4J8U D;  4ZUX C;  5GT0 C;  5B2J D;  3WTP D;  1M19 D;  3P5J B;  3AZE D;  3REH D;  3B6G D;  4JJN C;  1P3K A;  3C1C A;  2PYO C;  3WAA A;  3NQU A;  4H9N B;  2G5H C;  3AZL B;  4YS3 B;  5CPK B;  4X23 B;  3AZJ A;  5DNN B;  3AZF B;  2HUE C;  3W97 A;  2ZM5 A;  3AZG B;  5B31 A;  2ZY5 A;  4R8P B;  1WWS A;  4XZQ C;  1P3G C;  1BH9 A;  5AV6 D;  5DNM B;  4KGC A;  1F66 B;  1AOI D;  5B40 D;  4QLC B;  3A6N D;  3UTA B;  1W2E A;  5E5A A;  5B1L B;  1ID3 A;  5GXQ D;  4UUZ B;  4LD9 C;  2NZD C;  4DQY B;  3AZN D;  2W8S A;  1KX5 A;  3REL A;  2G5I C;  2HIO A;  5CHL B;  3MGQ B;  1P3B C;  5AY8 B;  1KU5 A;  1EQZ C;  1P34 C;  1B67 A;  3AZI B;  3W98 A;  5B0Y B;  4J8X A;  3X1V B;  3AYW B;  2FJ7 B;  5B0Z C;  5B1M A;  3O62 B;  5AV9 B;  1M1A D;  1PZR A;  5CPK C;  3A1I A;  1TZY D;  2YFV A;  3KSY A;  4YS3 C;  3C1B B;  3EG5 B;  3AZH D;  4H9R A;  3AV2 A;  1P3K B;  3C1C B;  3REI D;  3AZG C;  3LZ1 C;  3WAA B;  3NQU B;  1P3M B;  2Y2L A;  3LEL A;  3LJA D;  3AZJ B;  4R8P C;  3EPH A;  1P3L A;  3W97 B;  3X1U C;  2XD1 A;  5B31 B;  3KXB C;  3TU4 D;  3H0M C;  1F66 C;  5AV8 A;  3UTB A;  3UTA C;  2BG1 A;  5G49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...