5GT3C

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3C00
5DNNB 3MGPA 4J8UB 1ULYA 3UTAD 3AZEA 5B2ID 3REIB 3AFAC 1S32B 3MVDC 5B2JA 4AWLC 5BNVB 4Z5TB 5JRGB 5B0ZC 1F66A 4JJNA 3W96C 5AV8C 3X1VB 1TZYB 3WTPC 3AZJB 3VH5A 5B33A 3WKJD 3MGQD 5B0YB 5B32G 4J8WB 1KX4B 1P3PC 3LELC 1ID3D 5B32D 4KHAB 2NZDC 4H9QA 3B6FC 3AYWC 3MNND 2BYMB 3LZ1C 4YS3C 4CAYA 5CP6D 5B31B 5DNMA 1AOIB 1M18B 3W98D 3O62A 5AY8A 4KGCB 3W99C 5B1MD 2L5AA 1JFIB 1B6WA 3REJA 3KUYD 5BO0A 3RELD 3REKB 1HQ3C 1P34C 4YM6B 3WAAA 3X1UB 5CPKC 4XZQD 1U35A 3AV2B 3AZLD 5B24A 3A6NA 3UT9C 3LZ0B 5B40B 5B1LB 5GSUA 4XUJD 4G91C 4J8VC 5AVBA 1P3KA 1M1AB 1EQZD 3B0DB 4J8XC 3VH6W 5DNNC 4J8UC 5F99D 4WU9A 5GT3A 4ZUXA 4UUZA 3AZMD 2AROA 5DNMD 1P3MA 3AZNA 3REIC 1S32C 2FJ7A 3WA9A 5JRGC 4Z5TC 1Q9CA 2F8NK 2NQBD 5AVCA 3MVDB 2RVQC 3UTBA 3X1TA 3AZHD 1TZYC 4JJNC 3X1SB 3AZJC 5AV6D 3R45B 3W96B 5AV8B 3WTPE 1HTAA 3WTPB 3NQJB 4J8WC 1KX4C 2PYOB 3AZIA 3W97D 1M19B 2BYKB 3AZGB 3LELB 5BNXB 1P3AB 1P3OD 3A6ND 4QLCD 4H9SA 5GT0A 3B6FB 5B31C 1KX5A 3NQUB 3UTAA 1AOIC 4DRBA 5B2IA 4KGCC 4E44A 3KWQA 5CPJB 3O62C 5AY8C 1P3GD 4ZUXD 3AZND 1N1JB 1P3BD 3REJC 1P3FA 2HIOB 3WKJA 4KUDD 3MGQA 3REKC 4H9OB 4WNNA 4YM6C 4LD9B 2F8ND 4H9PB 3AV2C 1KX3D 3LJAD 1P34B 4H9RB 3AZKB 5CPKB 1U35C 1ID3A 3C1BD 4HGAB 5B40C 5B1LC 5B32B 3KXBA 5B24C 3AZID 3MNNA 1BH9A 3MGSB 1ZLAB 4WU8B 1M1AC 5C3IB 5GXQD 3B0DC 1P3LD 3W98A 4G91B 5CP6B 4EO5B 5B1MA 4NFTA 5AV5C 3AFAD 5KDMB 3VH6A 1KX5D 5B0ZD 5FUGB 4WU9C 5GT3C 3MGPB 3KUYA 1P3MC 3KWQD 3AZFC 3AZEB 3WA9C 3VH5T 1B67A 3RELA 1WWIA 3X1SC 5B2JB 3REHA 1P3PD 4XZQA 1F66B 4JJNB 3AZLA 1P3FD 3B6GA 2PYOC 1M19C 1P3IA 5B33B 4XUJA 3LZ1D 5JA4A 3AZGC 1P3AC 3KXBD 1EQZA 3MGRA 4H9SC 5F99A 5GT0C 5AV9A 4H9QB 3AZMA 4CAYB 5CPJC 4X23D 5B2IC 5DNMB 2NQBA 2YFVA 3O62B 5AY8B 3TU4A 3AZHA 5AV6A 2HIOC 5FUGA 3REJB 4LD9C 3WKJC 3MGQC 3W97A 5BO0B 3REHD 5CPID 3AZKC 4HGAC 3WAAB 4Z66A 1ID3C 5B32C 3B6GD 4R8PD 5BS7A 1U35B 1P3OA 2LY8A 3AN2D 1P3ID 4QLCA 3MGSC 2YFWA 5B24B 1ZLAC 3A6NB 3MNNC 4WU8C 5DNND 4J8UD 5C3IC 5GSUB 3C1CA 5CP6C 4EO5C 1S32D 2CV5A 5AVBB 1P3KB 3MGRD 1P3GA 5AV5B 5AV9D 2RVQD 3X1VD 3MGPC 1TZYD 4WU9B 5GT3B 3AZEC 4ZUXB 1P3BA 4UUZB 3KUYC 2AROB 1P3MB 3AZNB 4KUDA 5B0YD 3AZFB 2FJ7B 1KX4D 5B2JC 3WA9B 4H9NA 3TU4D 5E5AA 2F8NA 5AVCB 3RELC 1F66C 1KX3A 3LJAA 3AV1A 3UTBB 3X1TB 3C1BA 5B33C 4XUJC 4CSRA 5B31D 1M18D 4Z66D 4G92B 5GXQA 4KGCD 1P3LA 3AFAA 3V9RA 1EQZC 1BFMA 5B0ZA 5GT0B 3C1CD 4Z2MH 1KX5B 3W96A 3AZMC 5DNMC 3UTAB 3WTPA 2CV5D 5G49A 5B2IB 3REKD 4ZBJC 3KWQB 4YM6D 3X1UD 1P3PA 3AV2D 2IO5C 5AV6C 2F8NG 2NZDA 3LZ0D 5B40D 1P3FB 3AYWA 5E5AD 3WKJB 3LZ1A 3MGQB 4WNNB 4YS3A 3WAAC 3AV1D 1WWSA 1M1AD 1ID3B 5BS7C 3A6NC 3W99A 3KXBB 5GSUC 3MNNB 1TAFA 1BH9B 2HUEB 2CWEA 3VH6T 4M6BA 4X23A 5AVBC 1P3KC 4WZSB 3W98B 3MVDD 1P3GC 1H3OA 5B1MB 1HQ3A 4ZUXC 3W96D 5AV8D 2AROC 3AZNC 3WTPD 1P3BC 2FJ7C 3KUYB 2PYOD 3UT9A 4KUDC 1F1EA 5AVCC 5CPIA 3UTBC 3X1TC 3RELB 1KX3C 3LELD 3LJAC 3REHB 1P3AD 4J8VA 1BH8A 4XZQB 4R8PA 2NZDD 3AN2A 3AZLB 4J8XA 3B6FD 3B6GB 3AYWD 3AZIC 5DNNA 4J8UA 4YS3D 1P3IB 4G92C 4XUJB 5JA4B 3REIA 5CPJD 5GXQC 1S32A 4E45A 1P3LC 5BT1C 3W99D 5BNVA 4Z5TA 5JRGA 1EQZB 3MGRB 1KX5C 3X1VA 5F99B 3UTAC 5AV9B 1TZYA 3AZJA 3AZMB 2HIOD 3KWQC 5B0YA 4LD9D 4J8WA 1KX4A 2NQBB 4ZBJB 2YFVB 1HQ3D 1P34D 3AZKD 5CPKD 4NE5A 3TU4B 4KHAA 3AZHB 2IO5B 5AV6B 1P3FC 3UT9D 3B0BA 2BYMA 3MGSD 1ZLAD 4WU8D 5B31A 3W97B 1AOIA 1M18A 4J8VD 4KGCA 4Z66B 3KXBC 4J8XD 1P3OB 4QLCB 2HUEC 2YFWB 1JFIA 3MGPD 3REID 3AZED 3C1CB 4X23C 3W98C 5JRGD 4Z5TD 5B1MC 3REKA 2CV5B 5B2JD 4YM6A 1P3GB 3X1UA 3AV2A 3AZJD 4JJND 1F66D 4WV4B 3LZ0A 5B33D 5B1LA 5B40A 4J8WD 1P3BB 4KUDB 3REHC 4H9NB 5CPIC 5E5AB 4XZQC 2F8NB 1M1AA 3AZLC 1KX3B 3LJAB 3AV1B 5B31G 1R4VA 4R8PC 3B6GC 3C1BB 3AN2C 1P3IC 5AV5A 3AZIB 2JSSA 1AOID 4CSRB 3AZFA 3B0CW 5GXQB 3O62D 5AY8D 1P3LB 3MVDA 3MGRC 3AFAB 3V9RB 5F99C 5AV9C 3X1SA 4AWLB 3R45A 3X1VC 5AV8A 5B0ZB 3REJD 3NQJA 3VH5W 2PYOA 2NQBC 1M19A 1A7WA 5B0YC 5G49B 3TU4C 2BYKA 3AZHC 3WAAD 3AZGA 3LELA 5BNXA 1P3AA 1U35D 1P3PB 4Z2MG 5B1LD 5B24D 3B6FA 4NE6A 1KU5A 2NZDB 3W97C 3NQUA 3KSYA 5GSUD 3AYWB 3LZ1B 4YS3B 2F8NH 1M18C 4Z66C 5CPJA 5AVBD 1P3OC 1P3KD 4QLCC 5AV5D 5CHLB 3W99B 4WU9D 1N1JA 5GT3D 3C1CC 2AROD 1TAFB 1P3MD 2HIOA 4NE3A 3AZFD 2FJ7D 2CV5C 4H9OA 4X23B 3WA9D 4LD9A 5AVCD 4H9PA 3X1SD 1P34A 3X1UC 1H3OB 4H9RA 3X1TD 3UTBD 3AZKA 5CPKA 1HQ3B 5B32A 1M19D 3LZ0C 3MGSA 1ZLAA 4WU8A 3UT9B 5E5AC 3AZGD 3AV1C 5CPIB 5CP6A 3C1BC 4DRAA 4J8VB 1BH8B 5BT1D 4R8PB 5KDMA 3AN2B 5GT0D 4J8XB 3B0CT
chains in the Genus database with same CATH superfamily
5DNNB 3MGPA 4J8UB 1ULYA 3UTAD 3AZEA 5B2ID 3REIB 3AFAC 1S32B 3MVDC 5B2JA 4AWLC 5BNVB 4Z5TB 5JRGB 5B0ZC 1F66A 4JJNA 3W96C 5AV8C 3X1VB 1TZYB 3P5JB 3WTPC 3AZJB 3VH5A 5B33A 3WKJD 3MGQD 5B0YB 5B32G 4J8WB 1KX4B 1P3PC 2Y2NA 2G5HC 3LELC 5B32D 1ID3D 4KHAB 2NZDC 4H9QA 3B6FC 3AYWC 3MNND 2BYMB 3LZ1C 4YS3C 4CAYA 5CP6D 5B31B 2Y2KA 5DNMA 1AOIB 1M18B 3W98D 3O62A 5AY8A 4KGCB 2JCHA 3W99C 5B1MD 4UPKA 2L5AA 1JFIB 1B6WA 3REJA 3KUYD 3IP4C 5BO0A 3RELD 3REKB 1HQ3C 1P34C 4YM6B 2Y2OA 3X1UB 5CPKC 4XZQD 3WAAA 1U35A 3AV2B 3AZLD 5B24A 3A6NA 3UT9C 3LZ0B 5B40B 5B1LB 5GSUA 4XUJD 2UWXA 4G91C 5AVBA 4J8VC 1P3KA 1M1AB 1EQZD 3B0DB 4J8XC 3VH6W 5DNNC 4J8UC 5F99D 4WU9A 1W2EA 5GT3A 4ZUXA 4UUZA 3AZMD 2AROA 5DNMD 1P3MA 3AZNA 3REIC 1S32C 2FJ7A 3WA9A 5JRGC 4Z5TC 1Q9CA 2F8NK 2NQBD 1Z2CB 5AVCA 3MVDB 2RVQC 3UTBA 3X1TA 3AZHD 1TZYC 4JJNC 3X1SB 3AZJC 5AV6D 3R45B 3W96B 5AV8B 3WTPE 1HTAA 3F6TA 3WTPB 2Y2HA 3NQJB 4DQYB 4J8WC 1KX4C 2PYOB 3AZIA 3W97D 1M19B 2BYKB 3AZGB 3LELB 5BNXB 1P3AB 1P3OD 3A6ND 1T3UA 4QLCD 4H9SA 5GT0A 3B6FB 5B31C 1KX5A 3NQUB 3UTAA 1AOIC 4DRBA 5B2IA 4KGCC 2ZY4A 4E44A 3KWQA 5CPJB 3O62C 5AY8C 1P3GD 4ZUXD 3AZND 1N1JB 1P3BD 3REJC 2ZY5A 1P3FA 2HIOB 3WKJA 4KUDD 3MGQA 3REKC 4H9OB 4WNNA 4YM6C 4LD9B 2F8ND 4H9PB 3AV2C 3EPHA 1KX3D 3H0LC 3LJAD 1P34B 2Y2LA 4H9RB 3AZKB 5CPKB 1U35C 1ID3A 3C1BD 4HGAB 5B40C 5B1LC 5B32B 3KXBA 3EG5B 5B24C 3AZID 3MNNA 1BH9A 3MGSB 1ZLAB 4WU8B 1M1AC 5C3IB 5GXQD 3B0DC 1P3LD 3W98A 4G91B 5CP6B 4EO5B 5B1MA 4NFTA 5AV5C 3AFAD 5KDMB 3VH6A 1KX5D 5B0ZD 5FUGB 4WU9C 3A1IA 5GT3C 3MGPB 3KUYA 1P3MC 2BG1A 3KWQD 3AZEB 3AZFC 3EPLA 3WA9C 3VH5T 1B67A 3RELA 1WWIA 3X1SC 5B2JB 3REHA 1P3PD 4XZQA 1F66B 4JJNB 3AZLA 1P3FD 3B6GA 2PYOC 1M19C 1P3IA 5B33B 4XUJA 3LZ1D 5JA4A 3AZGC 1P3AC 2DQNC 2ZM5A 2Y2JA 3KXBD 1EQZA 3MGRA 4H9SC 5F99A 5GT0C 5AV9A 4H9QB 3AZMA 4CAYB 5CPJC 4X23D 5B2IC 5DNMB 2NQBA 2YFVA 3O62B 5AY8B 2ZY3A 3TU4A 3AZHA 5AV6A 2HIOC 3REJB 4LD9C 3WKJC 3MGQC 3W97A 5BO0B 3REHD 5CPID 3AZKC 4HGAC 2Y2IA 4Z66A 3WAAB 1ID3C 5B32C 3B6GD 4R8PD 5BS7A 1U35B 1P3OA 2LY8A 3AN2D 1P3ID 4QLCA 3MGSC 2YFWA 5B24B 1ZLAC 3A6NB 3MNNC 4WU8C 5DNND 4J8UD 5C3IC 5GSUB 3C1CA 5CP6C 4EO5C 1S32D 2CV5A 5AVBB 1P3KB 3MGRD 1P3GA 5AV5B 5AV9D 2RIQA 2RVQD 2W8SA 3X1VD 3MGPC 1TZYD 4WU9B 5GT3B 3AZEC 4ZUXB 1P3BA 4UUZB 3KUYC 2AROB 1P3MB 3AZNB 4KUDA 5B0YD 3AZFB 2DF4C 2FJ7B 1KX4D 5B2JC 2F2AC 4H9NA 3WA9B 3TU4D 5E5AA 2F8NA 5AVCB 3RELC 1F66C 1KX3A 3LJAA 3AV1A 3UTBB 3X1TB 3C1BA 5B33C 4XUJC 4CSRA 5B31D 2Y2GA 1M18D 4Z66D 4G92B 5GXQA 4KGCD 1P3LA 3AFAA 3V9RA 1EQZC 2XD5A 1BFMA 5B0ZA 5GT0B 5GT0D 3C1CD 4Z2MH 1KX5B 3W96A 3AZMC 5DNMC 3EPKA 3UTAB 3WTPA 2CV5D 5G49A 5B2IB 3REKD 4ZBJC 3KWQB 4YM6D 3X1UD 1P3PA 3AV2D 2IO5C 5AV6C 2F8NG 2NZDA 3LZ0D 5B40D 1P3FB 3AYWA 5E5AD 3WKJB 3LZ1A 3MGQB 4WNNB 3H0RC 4YS3A 2FFFB 3WAAC 3AV1D 1WWSA 1M1AD 1ID3B 5BS7C 3A6NC 3W99A 3KXBB 5GSUC 3MNNB 1TAFA 1BH9B 2HUEB 2CWEA 3VH6T 3KFUG 4M6BA 4X23A 5AVBC 1P3KC 4WZSB 3W98B 3MVDD 1P3GC 1H3OA 3EPJA 5B1MB 1HQ3A 4ZUXC 3W96D 5AV8D 2AROC 3AZNC 3WTPD 1P3BC 2Y2PA 2FJ7C 3KUYB 2PYOD 3UT9A 4KUDC 1F1EA 5AVCC 5CPIA 3UTBC 3X1TC 3RELB 1KX3C 3LELD 3LJAC 3REHB 1P3AD 4J8VA 1BH8A 4XZQB 4R8PA 2NZDD 3AN2A 3AZLB 4J8XA 3B6FD 3B6GB 3AYWD 3AZIC 5DNNA 4J8UA 4YS3D 1P3IB 4G92C 4XUJB 5JA4B 3REIA 5CPJD 5GXQC 1S32A 4E45A 1P3LC 5BT1C 3W99D 5BNVA 4Z5TA 5JRGA 1EQZB 3MGRB 1KX5C 3X1VA 5F99B 3UTAC 5AV9B 1TZYA 3AZJA 3AZMB 2HIOD 3KWQC 5B0YA 4LD9D 4J8WA 1KX4A 2NQBB 4ZBJB 2YFVB 1HQ3D 1P34D 2G5IC 3AZKD 5CPKD 4NE5A 3TU4B 4KHAA 3AZHB 2IO5B 5AV6B 1P3FC 3UT9D 3B0BA 2BYMA 3MGSD 1ZLAD 4WU8D 5B31A 3W97B 1AOIA 1M18A 4J8VD 4KGCA 2JE5A 4Z66B 3KXBC 4J8XD 1P3OB 4QLCB 2HUEC 2YFWB 1JFIA 3MGPD 3H0MC 3REID 3AZED 3C1CB 4X23C 3W98C 5JRGD 4Z5TD 5B1MC 3REKA 2ZY2A 2VQRA 2CV5B 5B2JD 4YM6A 1P3GB 3X1UA 3AV2A 3AZJD 4JJND 1F66D 3A1KA 4WV4B 3LZ0A 5B33D 5B1LA 5B40A 4J8WD 1P3BB 4KUDB 3REHC 4H9NB 5CPIC 5E5AB 4XZQC 2F8NB 1M1AA 3AZLC 1KX3B 3LJAB 3AV1B 5B31G 1R4VA 4R8PC 3B6GC 3C1BB 3AN2C 1P3IC 5AV5A 3AZIB 2JSSA 1AOID 4CSRB 2Y2QA 3AZFA 3B0CW 5GXQB 3O62D 5AY8D 1P3LB 3MVDA 3MGRC 3AFAB 3V9RB 5F99C 5AV9C 3X1SA 4AWLB 3R45A 3X1VC 5AV8A 5B0ZB 3REJD 3NQJA 3VH5W 2PYOA 2NQBC 1M19A 1A7WA 5B0YC 5G49B 4WJ3C 3TU4C 2BYKA 3AZHC 3AL0C 3WAAD 3AZGA 3LELA 5BNXA 1P3AA 1U35D 1P3PB 4Z2MG 5B1LD 5B24D 3B6FA 4NE6A 1KU5A 2NZDB 3W97C 3NQUA 3KSYA 5GSUD 3AYWB 3LZ1B 4YS3B 2F8NH 3FDDA 1M18C 4Z66C 5CPJA 5AVBD 1P3OC 1P3KD 4QLCC 5AV5D 5CHLB 3W99B 4WU9D 1N1JA 5GT3D 3C1CC 2AROD 1TAFB 1P3MD 2Y2MA 2HIOA 4NE3A 3AZFD 2FJ7D 2CV5C 4H9OA 4X23B 3WA9D 4LD9A 5AVCD 4H9PA 3X1SD 1P34A 3X1UC 1H3OB 4H9RA 3X1TD 3UTBD 3AZKA 5CPKA 1HQ3B 2J8PA 5B32A 1M19D 3LZ0C 3MGSA 1ZLAA 4WU8A 3UT9B 5E5AC 1PZRA 3AZGD 3AV1C 5CPIB 5CP6A 3C1BC 2XD1A 4DRAA 4J8VB 1BH8B 5BT1D 4R8PB 5KDMA 3AN2B 5FUGA 4J8XB 3B0CT
chains in the Genus database with same CATH topology
5DNNB 3MGPA 4J8UB 1ULYA 3UTAD 3AZEA 5B2ID 3REIB 3AFAC 1S32B 3MVDC 5B2JA 4AWLC 5BNVB 4Z5TB 5JRGB 5B0ZC 1F66A 4JJNA 3W96C 5AV8C 3X1VB 1TZYB 3P5JB 3WTPC 3AZJB 3VH5A 5B33A 3WKJD 3MGQD 5B0YB 5B32G 4J8WB 1KX4B 1P3PC 2Y2NA 2G5HC 3LELC 5B32D 1ID3D 4KHAB 2NZDC 4H9QA 3B6FC 3AYWC 3MNND 2BYMB 3LZ1C 4YS3C 4CAYA 5CP6D 5B31B 2Y2KA 5DNMA 1AOIB 1M18B 3W98D 3O62A 5AY8A 4KGCB 2JCHA 3W99C 5B1MD 4UPKA 2L5AA 1JFIB 1B6WA 3REJA 3KUYD 3IP4C 5BO0A 3RELD 3REKB 1HQ3C 1P34C 4YM6B 2Y2OA 3X1UB 5CPKC 4XZQD 3WAAA 1U35A 3AV2B 3AZLD 5B24A 3A6NA 3UT9C 3LZ0B 5B40B 5B1LB 5GSUA 4XUJD 2UWXA 4G91C 5AVBA 4J8VC 1P3KA 1M1AB 1EQZD 3B0DB 4J8XC 3VH6W 5DNNC 4J8UC 5F99D 4WU9A 1W2EA 5GT3A 4ZUXA 4UUZA 3AZMD 2AROA 5DNMD 1P3MA 3AZNA 3REIC 1S32C 2FJ7A 3WA9A 5JRGC 4Z5TC 1Q9CA 2F8NK 2NQBD 1Z2CB 5AVCA 3MVDB 2RVQC 3UTBA 3X1TA 3AZHD 1TZYC 4JJNC 3X1SB 3AZJC 5AV6D 3R45B 3W96B 5AV8B 3WTPE 1HTAA 3F6TA 3WTPB 2Y2HA 3NQJB 4DQYB 4J8WC 1KX4C 2PYOB 3AZIA 3W97D 1M19B 2BYKB 3AZGB 3LELB 5BNXB 1P3AB 1P3OD 3A6ND 1T3UA 4QLCD 4H9SA 5GT0A 3B6FB 5B31C 1KX5A 3NQUB 3UTAA 1AOIC 4DRBA 5B2IA 4KGCC 2ZY4A 4E44A 3KWQA 5CPJB 3O62C 5AY8C 1P3GD 4ZUXD 3AZND 1N1JB 1P3BD 3REJC 2ZY5A 1P3FA 2HIOB 3WKJA 4KUDD 3MGQA 3REKC 4H9OB 4WNNA 4YM6C 4LD9B 2F8ND 4H9PB 3AV2C 3EPHA 1KX3D 3H0LC 3LJAD 1P34B 2Y2LA 4H9RB 3AZKB 5CPKB 1U35C 1ID3A 3C1BD 4HGAB 5B40C 5B1LC 5B32B 3KXBA 3EG5B 5B24C 3AZID 3MNNA 1BH9A 3MGSB 1ZLAB 4WU8B 1M1AC 5C3IB 5GXQD 3B0DC 1P3LD 3W98A 4G91B 5CP6B 4EO5B 5B1MA 4NFTA 5AV5C 3AFAD 5KDMB 3VH6A 1KX5D 5B0ZD 5FUGB 4WU9C 3A1IA 5GT3C 3MGPB 3KUYA 1P3MC 2BG1A 3KWQD 3AZEB 3AZFC 3EPLA 3WA9C 3VH5T 1B67A 3RELA 1WWIA 3X1SC 5B2JB 3REHA 1P3PD 4XZQA 1F66B 4JJNB 3AZLA 1P3FD 3B6GA 2PYOC 1M19C 1P3IA 5B33B 4XUJA 3LZ1D 5JA4A 3AZGC 1P3AC 2DQNC 2ZM5A 2Y2JA 3KXBD 1EQZA 3MGRA 4H9SC 5F99A 5GT0C 5AV9A 4H9QB 3AZMA 4CAYB 5CPJC 4X23D 5B2IC 5DNMB 2NQBA 2YFVA 3O62B 5AY8B 2ZY3A 3TU4A 3AZHA 5AV6A 2HIOC 3REJB 4LD9C 3WKJC 3MGQC 3W97A 5BO0B 3REHD 5CPID 3AZKC 4HGAC 2Y2IA 4Z66A 3WAAB 1ID3C 5B32C 3B6GD 4R8PD 5BS7A 1U35B 1P3OA 2LY8A 3AN2D 1P3ID 4QLCA 3MGSC 2YFWA 5B24B 1ZLAC 3A6NB 3MNNC 4WU8C 5DNND 4J8UD 5C3IC 5GSUB 3C1CA 5CP6C 4EO5C 1S32D 2CV5A 5AVBB 1P3KB 3MGRD 1P3GA 5AV5B 5AV9D 2RIQA 2RVQD 2W8SA 3X1VD 3MGPC 1TZYD 4WU9B 5GT3B 3AZEC 4ZUXB 1P3BA 4UUZB 3KUYC 2AROB 1P3MB 3AZNB 4KUDA 5B0YD 3AZFB 2DF4C 2FJ7B 1KX4D 5B2JC 2F2AC 4H9NA 3WA9B 3TU4D 5E5AA 2F8NA 5AVCB 3RELC 1F66C 1KX3A 3LJAA 3AV1A 3UTBB 3X1TB 3C1BA 5B33C 4XUJC 4CSRA 5B31D 2Y2GA 1M18D 4Z66D 4G92B 5GXQA 4KGCD 1P3LA 3AFAA 3V9RA 1EQZC 2XD5A 1BFMA 5B0ZA 5GT0B 5GT0D 3C1CD 4Z2MH 1KX5B 3W96A 3AZMC 5DNMC 3EPKA 3UTAB 3WTPA 2CV5D 5G49A 5B2IB 3REKD 4ZBJC 3KWQB 4YM6D 3X1UD 1P3PA 3AV2D 2IO5C 5AV6C 2F8NG 2NZDA 3LZ0D 5B40D 1P3FB 3AYWA 5E5AD 3WKJB 3LZ1A 3MGQB 4WNNB 3H0RC 4YS3A 2FFFB 3WAAC 3AV1D 1WWSA 1M1AD 1ID3B 5BS7C 3A6NC 3W99A 3KXBB 5GSUC 3MNNB 1TAFA 1BH9B 2HUEB 2CWEA 3VH6T 3KFUG 4M6BA 4X23A 5AVBC 1P3KC 4WZSB 3W98B 3MVDD 1P3GC 1H3OA 3EPJA 5B1MB 1HQ3A 4ZUXC 3W96D 5AV8D 2AROC 3AZNC 3WTPD 1P3BC 2Y2PA 2FJ7C 3KUYB 2PYOD 3UT9A 4KUDC 1F1EA 5AVCC 5CPIA 3UTBC 3X1TC 3RELB 1KX3C 3LELD 3LJAC 3REHB 1P3AD 4J8VA 1BH8A 4XZQB 4R8PA 2NZDD 3AN2A 3AZLB 4J8XA 3B6FD 3B6GB 3AYWD 3AZIC 5DNNA 4J8UA 4YS3D 1P3IB 4G92C 4XUJB 5JA4B 3REIA 5CPJD 5GXQC 1S32A 4E45A 1P3LC 5BT1C 3W99D 5BNVA 4Z5TA 5JRGA 1EQZB 3MGRB 1KX5C 3X1VA 5F99B 3UTAC 5AV9B 1TZYA 3AZJA 3AZMB 2HIOD 3KWQC 5B0YA 4LD9D 4J8WA 1KX4A 2NQBB 4ZBJB 2YFVB 1HQ3D 1P34D 2G5IC 3AZKD 5CPKD 4NE5A 3TU4B 4KHAA 3AZHB 2IO5B 5AV6B 1P3FC 3UT9D 3B0BA 2BYMA 3MGSD 1ZLAD 4WU8D 5B31A 3W97B 1AOIA 1M18A 4J8VD 4KGCA 2JE5A 4Z66B 3KXBC 4J8XD 1P3OB 4QLCB 2HUEC 2YFWB 1JFIA 3MGPD 3H0MC 3REID 3AZED 3C1CB 4X23C 3W98C 5JRGD 4Z5TD 5B1MC 3REKA 2ZY2A 2VQRA 2CV5B 5B2JD 4YM6A 1P3GB 3X1UA 3AV2A 3AZJD 4JJND 1F66D 3A1KA 4WV4B 3LZ0A 5B33D 5B1LA 5B40A 4J8WD 1P3BB 4KUDB 3REHC 4H9NB 5CPIC 5E5AB 4XZQC 2F8NB 1M1AA 3AZLC 1KX3B 3LJAB 3AV1B 5B31G 1R4VA 4R8PC 3B6GC 3C1BB 3AN2C 1P3IC 5AV5A 3AZIB 2JSSA 1AOID 4CSRB 2Y2QA 3AZFA 3B0CW 5GXQB 3O62D 5AY8D 1P3LB 3MVDA 3MGRC 3AFAB 3V9RB 5F99C 5AV9C 3X1SA 4AWLB 3R45A 3X1VC 5AV8A 5B0ZB 3REJD 3NQJA 3VH5W 2PYOA 2NQBC 1M19A 1A7WA 5B0YC 5G49B 4WJ3C 3TU4C 2BYKA 3AZHC 3AL0C 3WAAD 3AZGA 3LELA 5BNXA 1P3AA 1U35D 1P3PB 4Z2MG 5B1LD 5B24D 3B6FA 4NE6A 1KU5A 2NZDB 3W97C 3NQUA 3KSYA 5GSUD 3AYWB 3LZ1B 4YS3B 2F8NH 3FDDA 1M18C 4Z66C 5CPJA 5AVBD 1P3OC 1P3KD 4QLCC 5AV5D 5CHLB 3W99B 4WU9D 1N1JA 5GT3D 3C1CC 2AROD 1TAFB 1P3MD 2Y2MA 2HIOA 4NE3A 3AZFD 2FJ7D 2CV5C 4H9OA 4X23B 3WA9D 4LD9A 5AVCD 4H9PA 3X1SD 1P34A 3X1UC 1H3OB 4H9RA 3X1TD 3UTBD 3AZKA 5CPKA 1HQ3B 2J8PA 5B32A 1M19D 3LZ0C 3MGSA 1ZLAA 4WU8A 3UT9B 5E5AC 1PZRA 3AZGD 3AV1C 5CPIB 5CP6A 3C1BC 2XD1A 4DRAA 4J8VB 1BH8B 5BT1D 4R8PB 5KDMA 3AN2B 5FUGA 4J8XB 3B0CT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN B;  3MGP A;  4J8U B;  1ULY A;  3UTA D;  3AZE A;  5B2I D;  3REI B;  3AFA C;  1S32 B;  3MVD C;  5B2J A;  4AWL C;  5BNV B;  4Z5T B;  5JRG B;  5B0Z C;  1F66 A;  4JJN A;  3W96 C;  5AV8 C;  3X1V B;  1TZY B;  3WTP C;  3AZJ B;  3VH5 A;  5B33 A;  3WKJ D;  3MGQ D;  5B0Y B;  5B32 G;  4J8W B;  1KX4 B;  1P3P C;  3LEL C;  1ID3 D;  5B32 D;  4KHA B;  2NZD C;  4H9Q A;  3B6F C;  3AYW C;  3MNN D;  2BYM B;  3LZ1 C;  4YS3 C;  4CAY A;  5CP6 D;  5B31 B;  5DNM A;  1AOI B;  1M18 B;  3W98 D;  3O62 A;  5AY8 A;  4KGC B;  3W99 C;  5B1M D;  2L5A A;  1JFI B;  1B6W A;  3REJ A;  3KUY D;  5BO0 A;  3REL D;  3REK B;  1HQ3 C;  1P34 C;  4YM6 B;  3WAA A;  3X1U B;  5CPK C;  4XZQ D;  1U35 A;  3AV2 B;  3AZL D;  5B24 A;  3A6N A;  3UT9 C;  3LZ0 B;  5B40 B;  5B1L B;  5GSU A;  4XUJ D;  4G91 C;  4J8V C;  5AVB A;  1P3K A;  1M1A B;  1EQZ D;  3B0D B;  4J8X C;  3VH6 W;  5DNN C;  4J8U C;  5F99 D;  4WU9 A;  5GT3 A;  4ZUX A;  4UUZ A;  3AZM D;  2ARO A;  5DNM D;  1P3M A;  3AZN A;  3REI C;  1S32 C;  2FJ7 A;  3WA9 A;  5JRG C;  4Z5T C;  1Q9C A;  2F8N K;  2NQB D;  5AVC A;  3MVD B;  2RVQ C;  3UTB A;  3X1T A;  3AZH D;  1TZY C;  4JJN C;  3X1S B;  3AZJ C;  5AV6 D;  3R45 B;  3W96 B;  5AV8 B;  3WTP E;  1HTA A;  3WTP B;  3NQJ B;  4J8W C;  1KX4 C;  2PYO B;  3AZI A;  3W97 D;  1M19 B;  2BYK B;  3AZG B;  3LEL B;  5BNX B;  1P3A B;  1P3O D;  3A6N D;  4QLC D;  4H9S A;  5GT0 A;  3B6F B;  5B31 C;  1KX5 A;  3NQU B;  3UTA A;  1AOI C;  4DRB A;  5B2I A;  4KGC C;  4E44 A;  3KWQ A;  5CPJ B;  3O62 C;  5AY8 C;  1P3G D;  4ZUX D;  3AZN D;  1N1J B;  1P3B D;  3REJ C;  1P3F A;  2HIO B;  3WKJ A;  4KUD D;  3MGQ A;  3REK C;  4H9O B;  4WNN A;  4YM6 C;  4LD9 B;  2F8N D;  4H9P B;  3AV2 C;  1KX3 D;  3LJA D;  1P34 B;  4H9R B;  3AZK B;  5CPK B;  1U35 C;  1ID3 A;  3C1B D;  4HGA B;  5B40 C;  5B1L C;  5B32 B;  3KXB A;  5B24 C;  3AZI D;  3MNN A;  1BH9 A;  3MGS B;  1ZLA B;  4WU8 B;  1M1A C;  5C3I B;  5GXQ D;  3B0D C;  1P3L D;  3W98 A;  4G91 B;  5CP6 B;  4EO5 B;  5B1M A;  4NFT A;  5AV5 C;  3AFA D;  5KDM B;  3VH6 A;  1KX5 D;  5B0Z D;  5FUG B;  4WU9 C;  5GT3 C;  3MGP B;  3KUY A;  1P3M C;  3KWQ D;  3AZF C;  3AZE B;  3WA9 C;  3VH5 T;  1B67 A;  3REL A;  1WWI A;  3X1S C;  5B2J B;  3REH A;  1P3P D;  4XZQ A;  1F66 B;  4JJN B;  3AZL A;  1P3F D;  3B6G A;  2PYO C;  1M19 C;  1P3I A;  5B33 B;  4XUJ A;  3LZ1 D;  5JA4 A;  3AZG C;  1P3A C;  3KXB D;  1EQZ A;  3MGR A;  4H9S C;  5F99 A;  5GT0 C;  5AV9 A;  4H9Q B;  3AZM A;  4CAY B;  5CPJ C;  4X23 D;  5B2I C;  5DNM B;  2NQB A;  2YFV A;  3O62 B;  5AY8 B;  3TU4 A;  3AZH A;  5AV6 A;  2HIO C;  5FUG A;  3REJ B;  4LD9 C;  3WKJ C;  3MGQ C;  3W97 A;  5BO0 B;  3REH D;  5CPI D;  3AZK C;  4HGA C;  3WAA B;  4Z66 A;  1ID3 C;  5B32 C;  3B6G D;  4R8P D;  5BS7 A;  1U35 B;  1P3O A;  2LY8 A;  3AN2 D;  1P3I D;  4QLC A;  3MGS C;  2YFW A;  5B24 B;  1ZLA C;  3A6N B;  3MNN C;  4WU8 C;  5DNN D;  4J8U D;  5C3I C;  5GSU B;  3C1C A;  5CP6 C;  4EO5 C;  1S32 D;  2CV5 A;  5AVB B;  1P3K B;  3MGR D;  1P3G A;  5AV5 B;  5AV9 D;  2RVQ D;  3X1V D;  3MGP C;  1TZY D;  4WU9 B;  5GT3 B;  3AZE C;  4ZUX B;  1P3B A;  4UUZ B;  3KUY C;  2ARO B;  1P3M B;  3AZN B;  4KUD A;  5B0Y D;  3AZF B;  2FJ7 B;  1KX4 D;  5B2J C;  3WA9 B;  4H9N A;  3TU4 D;  5E5A A;  2F8N A;  5AVC B;  3REL C;  1F66 C;  1KX3 A;  3LJA A;  3AV1 A;  3UTB B;  3X1T B;  3C1B A;  5B33 C;  4XUJ C;  4CSR A;  5B31 D;  1M18 D;  4Z66 D;  4G92 B;  5GXQ A;  4KGC D;  1P3L A;  3AFA A;  3V9R A;  1EQZ C;  1BFM A;  5B0Z A;  5GT0 B;  3C1C D;  4Z2M H;  1KX5 B;  3W96 A;  3AZM C;  5DNM C;  3UTA B;  3WTP A;  2CV5 D;  5G49 A;  5B2I B;  3REK D;  4ZBJ C;  3KWQ B;  4YM6 D;  3X1U D;  1P3P A;  3AV2 D;  2IO5 C;  5AV6 C;  2F8N G;  2NZD A;  3LZ0 D;  5B40 D;  1P3F B;  3AYW A;  5E5A D;  3WKJ B;  3LZ1 A;  3MGQ B;  4WNN B;  4YS3 A;  3WAA C;  3AV1 D;  1WWS A;  1M1A D;  1ID3 B;  5BS7 C;  3A6N C;  3W99 A;  3KXB B;  5GSU C;  3MNN B;  1TAF A;  1BH9 B;  2HUE B;  2CWE A;  3VH6 T;  4M6B A;  4X23 A;  5AVB C;  1P3K C;  4WZS B;  3W98 B;  3MVD D;  1P3G C;  1H3O A;  5B1M B;  1HQ3 A;  4ZUX C;  3W96 D;  5AV8 D;  2ARO C;  3AZN C;  3WTP D;  1P3B C;  2FJ7 C;  3KUY B;  2PYO D;  3UT9 A;  4KUD C;  1F1E A;  5AVC C;  5CPI A;  3UTB C;  3X1T C;  3REL B;  1KX3 C;  3LEL D;  3LJA C;  3REH B;  1P3A D;  4J8V A;  1BH8 A;  4XZQ B;  4R8P A;  2NZD D;  3AN2 A;  3AZL B;  4J8X A;  3B6F D;  3B6G B;  3AYW D;  3AZI C;  5DNN A;  4J8U A;  4YS3 D;  1P3I B;  4G92 C;  4XUJ B;  5JA4 B;  3REI A;  5CPJ D;  5GXQ C;  1S32 A;  4E45 A;  1P3L C;  5BT1 C;  3W99 D;  5BNV A;  4Z5T A;  5JRG A;  1EQZ B;  3MGR B;  1KX5 C;  3X1V A;  5F99 B;  3UTA C;  5AV9 B;  1TZY A;  3AZJ A;  3AZM B;  2HIO D;  3KWQ C;  5B0Y A;  4LD9 D;  4J8W A;  1KX4 A;  2NQB B;  4ZBJ B;  2YFV B;  1HQ3 D;  1P34 D;  3AZK D;  5CPK D;  4NE5 A;  3TU4 B;  4KHA A;  3AZH B;  2IO5 B;  5AV6 B;  1P3F C;  3UT9 D;  3B0B A;  2BYM A;  3MGS D;  1ZLA D;  4WU8 D;  5B31 A;  3W97 B;  1AOI A;  1M18 A;  4J8V D;  4KGC A;  4Z66 B;  3KXB C;  4J8X D;  1P3O B;  4QLC B;  2HUE C;  2YFW B;  1JFI A;  3MGP D;  3REI D;  3AZE D;  3C1C B;  4X23 C;  3W98 C;  5JRG D;  4Z5T D;  5B1M C;  3REK A;  2CV5 B;  5B2J D;  4YM6 A;  1P3G B;  3X1U A;  3AV2 A;  3AZJ D;  4JJN D;  1F66 D;  4WV4 B;  3LZ0 A;  5B33 D;  5B1L A;  5B40 A;  4J8W D;  1P3B B;  4KUD B;  3REH C;  4H9N B;  5CPI C;  5E5A B;  4XZQ C;  2F8N B;  1M1A A;  3AZL C;  1KX3 B;  3LJA B;  3AV1 B;  5B31 G;  1R4V A;  4R8P C;  3B6G C;  3C1B B;  3AN2 C;  1P3I C;  5AV5 A;  3AZI B;  2JSS A;  1AOI D;  4CSR B;  3AZF A;  3B0C W;  5GXQ B;  3O62 D;  5AY8 D;  1P3L B;  3MVD A;  3MGR C;  3AFA B;  3V9R B;  5F99 C;  5AV9 C;  3X1S A;  4AWL B;  3R45 A;  3X1V C;  5AV8 A;  5B0Z B;  3REJ D;  3NQJ A;  3VH5 W;  2PYO A;  2NQB C;  1M19 A;  1A7W A;  5B0Y C;  5G49 B;  3TU4 C;  2BYK A;  3AZH C;  3WAA D;  3AZG A;  3LEL A;  5BNX A;  1P3A A;  1U35 D;  1P3P B;  4Z2M G;  5B1L D;  5B24 D;  3B6F A;  4NE6 A;  1KU5 A;  2NZD B;  3W97 C;  3NQU A;  3KSY A;  5GSU D;  3AYW B;  3LZ1 B;  4YS3 B;  2F8N H;  1M18 C;  4Z66 C;  5CPJ A;  5AVB D;  1P3O C;  1P3K D;  4QLC C;  5AV5 D;  5CHL B;  3W99 B;  4WU9 D;  1N1J A;  5GT3 D;  3C1C C;  2ARO D;  1TAF B;  1P3M D;  2HIO A;  4NE3 A;  3AZF D;  2FJ7 D;  2CV5 C;  4H9O A;  4X23 B;  3WA9 D;  4LD9 A;  5AVC D;  4H9P A;  3X1S D;  1P34 A;  3X1U C;  1H3O B;  4H9R A;  3X1T D;  3UTB D;  3AZK A;  5CPK A;  1HQ3 B;  5B32 A;  1M19 D;  3LZ0 C;  3MGS A;  1ZLA A;  4WU8 A;  3UT9 B;  5E5A C;  3AZG D;  3AV1 C;  5CPI B;  5CP6 A;  3C1B C;  4DRA A;  4J8V B;  1BH8 B;  5BT1 D;  4R8P B;  5KDM A;  3AN2 B;  5GT0 D;  4J8X B;  3B0C T; 
#chains in the Genus database with same CATH topology
 5DNN B;  3MGP A;  4J8U B;  1ULY A;  3UTA D;  3AZE A;  5B2I D;  3REI B;  3AFA C;  1S32 B;  3MVD C;  5B2J A;  4AWL C;  5BNV B;  4Z5T B;  5JRG B;  5B0Z C;  1F66 A;  4JJN A;  3W96 C;  5AV8 C;  3X1V B;  1TZY B;  3P5J B;  3WTP C;  3AZJ B;  3VH5 A;  5B33 A;  3WKJ D;  3MGQ D;  5B0Y B;  5B32 G;  4J8W B;  1KX4 B;  1P3P C;  2Y2N A;  2G5H C;  3LEL C;  5B32 D;  1ID3 D;  4KHA B;  2NZD C;  4H9Q A;  3B6F C;  3AYW C;  3MNN D;  2BYM B;  3LZ1 C;  4YS3 C;  4CAY A;  5CP6 D;  5B31 B;  2Y2K A;  5DNM A;  1AOI B;  1M18 B;  3W98 D;  3O62 A;  5AY8 A;  4KGC B;  2JCH A;  3W99 C;  5B1M D;  4UPK A;  2L5A A;  1JFI B;  1B6W A;  3REJ A;  3KUY D;  3IP4 C;  5BO0 A;  3REL D;  3REK B;  1HQ3 C;  1P34 C;  4YM6 B;  2Y2O A;  3X1U B;  5CPK C;  4XZQ D;  3WAA A;  1U35 A;  3AV2 B;  3AZL D;  5B24 A;  3A6N A;  3UT9 C;  3LZ0 B;  5B40 B;  5B1L B;  5GSU A;  4XUJ D;  2UWX A;  4G91 C;  5AVB A;  4J8V C;  1P3K A;  1M1A B;  1EQZ D;  3B0D B;  4J8X C;  3VH6 W;  5DNN C;  4J8U C;  5F99 D;  4WU9 A;  1W2E A;  5GT3 A;  4ZUX A;  4UUZ A;  3AZM D;  2ARO A;  5DNM D;  1P3M A;  3AZN A;  3REI C;  1S32 C;  2FJ7 A;  3WA9 A;  5JRG C;  4Z5T C;  1Q9C A;  2F8N K;  2NQB D;  1Z2C B;  5AVC A;  3MVD B;  2RVQ C;  3UTB A;  3X1T A;  3AZH D;  1TZY C;  4JJN C;  3X1S B;  3AZJ C;  5AV6 D;  3R45 B;  3W96 B;  5AV8 B;  3WTP E;  1HTA A;  3F6T A;  3WTP B;  2Y2H A;  3NQJ B;  4DQY B;  4J8W C;  1KX4 C;  2PYO B;  3AZI A;  3W97 D;  1M19 B;  2BYK B;  3AZG B;  3LEL B;  5BNX B;  1P3A B;  1P3O D;  3A6N D;  1T3U A;  4QLC D;  4H9S A;  5GT0 A;  3B6F B;  5B31 C;  1KX5 A;  3NQU B;  3UTA A;  1AOI C;  4DRB A;  5B2I A;  4KGC C;  2ZY4 A;  4E44 A;  3KWQ A;  5CPJ B;  3O62 C;  5AY8 C;  1P3G D;  4ZUX D;  3AZN D;  1N1J B;  1P3B D;  3REJ C;  2ZY5 A;  1P3F A;  2HIO B;  3WKJ A;  4KUD D;  3MGQ A;  3REK C;  4H9O B;  4WNN A;  4YM6 C;  4LD9 B;  2F8N D;  4H9P B;  3AV2 C;  3EPH A;  1KX3 D;  3H0L C;  3LJA D;  1P34 B;  2Y2L A;  4H9R B;  3AZK B;  5CPK B;  1U35 C;  1ID3 A;  3C1B D;  4HGA B;  5B40 C;  5B1L C;  5B32 B;  3KXB A;  3EG5 B;  5B24 C;  3AZI D;  3MNN A;  1BH9 A;  3MGS B;  1ZLA B;  4WU8 B;  1M1A C;  5C3I B;  5GXQ D;  3B0D C;  1P3L D;  3W98 A;  4G91 B;  5CP6 B;  4EO5 B;  5B1M A;  4NFT A;  5AV5 C;  3AFA D;  5KDM B;  3VH6 A;  1KX5 D;  5B0Z D;  5FUG B;  4WU9 C;  3A1I A;  5GT3 C;  3MGP B;  3KUY A;  1P3M C;  2BG1 A;  3KWQ D;  3AZE B;  3AZF C;  3EPL A;  3WA9 C;  3VH5 T;  1B67 A;  3REL A;  1WWI A;  3X1S C;  5B2J B;  3REH A;  1P3P D;  4XZQ A;  1F66 B;  4JJN B;  3AZL A;  1P3F D;  3B6G A;  2PYO C;  1M19 C;  1P3I A;  5B33 B;  4XUJ A;  3LZ1 D;  5JA4 A;  3AZG C;  1P3A C;  2DQN C;  2ZM5 A;  2Y2J A;  3KXB D;  1EQZ A;  3MGR A;  4H9S C;  5F99 A;  5GT0 C;  5AV9 A;  4H9Q B;  3AZM A;  4CAY B;  5CPJ C;  4X23 D;  5B2I C;  5DNM B;  2NQB A;  2YFV A;  3O62 B;  5AY8 B;  2ZY3 A;  3TU4 A;  3AZH A;  5AV6 A;  2HIO C;  3REJ B;  4LD9 C;  3WKJ C;  3MGQ C;  3W97 A;  5BO0 B;  3REH D;  5CPI D;  3AZK C;  4HGA C;  2Y2I A;  4Z66 A;  3WAA B;  1ID3 C;  5B32 C;  3B6G D;  4R8P D;  5BS7 A;  1U35 B;  1P3O A;  2LY8 A;  3AN2 D;  1P3I D;  4QLC A;  3MGS C;  2YFW A;  5B24 B;  1ZLA C;  3A6N B;  3MNN C;  4WU8 C;  5DNN D;  4J8U D;  5C3I C;  5GSU B;  3C1C A;  5CP6 C;  4EO5 C;  1S32 D;  2CV5 A;  5AVB B;  1P3K B;  3MGR D;  1P3G A;  5AV5 B;  5AV9 D;  2RIQ A;  2RVQ D;  2W8S A;  3X1V D;  3MGP C;  1TZY D;  4WU9 B;  5GT3 B;  3AZE C;  4ZUX B;  1P3B A;  4UUZ B;  3KUY C;  2ARO B;  1P3M B;  3AZN B;  4KUD A;  5B0Y D;  3AZF B;  2DF4 C;  2FJ7 B;  1KX4 D;  5B2J C;  2F2A C;  4H9N A;  3WA9 B;  3TU4 D;  5E5A A;  2F8N A;  5AVC B;  3REL C;  1F66 C;  1KX3 A;  3LJA A;  3AV1 A;  3UTB B;  3X1T B;  3C1B A;  5B33 C;  4XUJ C;  4CSR A;  5B31 D;  2Y2G A;  1M18 D;  4Z66 D;  4G92 B;  5GXQ A;  4KGC D;  1P3L A;  3AFA A;  3V9R A;  1EQZ C;  2XD5 A;  1BFM A;  5B0Z A;  5GT0 B;  5GT0 D;  3C1C D;  4Z2M H;  1KX5 B;  3W96 A;  3AZM C;  5DNM C;  3EPK A;  3UTA B;  3WTP A;  2CV5 D;  5G49 A;  5B2I B;  3REK D;  4ZBJ C;  3KWQ B;  4YM6 D;  3X1U D;  1P3P A;  3AV2 D;  2IO5 C;  5AV6 C;  2F8N G;  2NZD A;  3LZ0 D;  5B40 D;  1P3F B;  3AYW A;  5E5A D;  3WKJ B;  3LZ1 A;  3MGQ B;  4WNN B;  3H0R C;  4YS3 A;  2FFF B;  3WAA C;  3AV1 D;  1WWS A;  1M1A D;  1ID3 B;  5BS7 C;  3A6N C;  3W99 A;  3KXB B;  5GSU C;  3MNN B;  1TAF A;  1BH9 B;  2HUE B;  2CWE A;  3VH6 T;  3KFU G;  4M6B A;  4X23 A;  5AVB C;  1P3K C;  4WZS B;  3W98 B;  3MVD D;  1P3G C;  1H3O A;  3EPJ A;  5B1M B;  1HQ3 A;  4ZUX C;  3W96 D;  5AV8 D;  2ARO C;  3AZN C;  3WTP D;  1P3B C;  2Y2P A;  2FJ7 C;  3KUY B;  2PYO D;  3UT9 A;  4KUD C;  1F1E A;  5AVC C;  5CPI A;  3UTB C;  3X1T C;  3REL B;  1KX3 C;  3LEL D;  3LJA C;  3REH B;  1P3A D;  4J8V A;  1BH8 A;  4XZQ B;  4R8P A;  2NZD D;  3AN2 A;  3AZL B;  4J8X A;  3B6F D;  3B6G B;  3AYW D;  3AZI C;  5DNN A;  4J8U A;  4YS3 D;  1P3I B;  4G92 C;  4XUJ B;  5JA4 B;  3REI A;  5CPJ D;  5GXQ C;  1S32 A;  4E45 A;  1P3L C;  5BT1 C;  3W99 D;  5BNV A;  4Z5T A;  5JRG A;  1EQZ B;  3MGR B;  1KX5 C;  3X1V A;  5F99 B;  3UTA C;  5AV9 B;  1TZY A;  3AZJ A;  3AZM B;  2HIO D;  3KWQ C;  5B0Y A;  4LD9 D;  4J8W A;  1KX4 A;  2NQB B;  4ZBJ B;  2YFV B;  1HQ3 D;  1P34 D;  2G5I C;  3AZK D;  5CPK D;  4NE5 A;  3TU4 B;  4KHA A;  3AZH B;  2IO5 B;  5AV6 B;  1P3F C;  3UT9 D;  3B0B A;  2BYM A;  3MGS D;  1ZLA D;  4WU8 D;  5B31 A;  3W97 B;  1AOI A;  1M18 A;  4J8V D;  4KGC A;  2JE5 A;  4Z66 B;  3KXB C;  4J8X D;  1P3O B;  4QLC B;  2HUE C;  2YFW B;  1JFI A;  3MGP D;  3H0M C;  3REI D;  3AZE D;  3C1C B;  4X23 C;  3W98 C;  5JRG D;  4Z5T D;  5B1M C;  3REK A;  2ZY2 A;  2VQR A;  2CV5 B;  5B2J D;  4YM6 A;  1P3G B;  3X1U A;  3AV2 A;  3AZJ D;  4JJN D;  1F66 D;  3A1K A;  4WV4 B;  3LZ0 A;  5B33 D;  5B1L A;  5B40 A;  4J8W D;  1P3B B;  4KUD B;  3REH C;  4H9N B;  5CPI C;  5E5A B;  4XZQ C;  2F8N B;  1M1A A;  3AZL C;  1KX3 B;  3LJA B;  3AV1 B;  5B31 G;  1R4V A;  4R8P C;  3B6G C;  3C1B B;  3AN2 C;  1P3I C;  5AV5 A;  3AZI B;  2JSS A;  1AOI D;  4CSR B;  2Y2Q A;  3AZF A;  3B0C W;  5GXQ B;  3O62 D;  5AY8 D;  1P3L B;  3MVD A;  3MGR C;  3AFA B;  3V9R B;  5F99 C;  5AV9 C;  3X1S A;  4AWL B;  3R45 A;  3X1V C;  5AV8 A;  5B0Z B;  3REJ D;  3NQJ A;  3VH5 W;  2PYO A;  2NQB C;  1M19 A;  1A7W A;  5B0Y C;  5G49 B;  4WJ3 C;  3TU4 C;  2BYK A;  3AZH C;  3AL0 C;  3WAA D;  3AZG A;  3LEL A;  5BNX A;  1P3A A;  1U35 D;  1P3P B;  4Z2M G;  5B1L D;  5B24 D;  3B6F A;  4NE6 A;  1KU5 A;  2NZD B;  3W97 C;  3NQU A;  3KSY A;  5GSU D;  3AYW B;  3LZ1 B;  4YS3 B;  2F8N H;  3FDD A;  1M18 C;  4Z66 C;  5CPJ A;  5AVB D;  1P3O C;  1P3K D;  4QLC C;  5AV5 D;  5CHL B;  3W99 B;  4WU9 D;  1N1J A;  5GT3 D;  3C1C C;  2ARO D;  1TAF B;  1P3M D;  2Y2M A;  2HIO A;  4NE3 A;  3AZF D;  2FJ7 D;  2CV5 C;  4H9O A;  4X23 B;  3WA9 D;  4LD9 A;  5AVC D;  4H9P A;  3X1S D;  1P34 A;  3X1U C;  1H3O B;  4H9R A;  3X1T D;  3UTB D;  3AZK A;  5CPK A;  1HQ3 B;  2J8P A;  5B32 A;  1M19 D;  3LZ0 C;  3MGS A;  1ZLA A;  4WU8 A;  3UT9 B;  5E5A C;  1PZR A;  3AZG D;  3AV1 C;  5CPI B;  5CP6 A;  3C1B C;  2XD1 A;  4DRA A;  4J8V B;  1BH8 B;  5BT1 D;  4R8P B;  5KDM A;  3AN2 B;  5FUG A;  4J8X B;  3B0C T; 
#chains in the Genus database with same CATH homology
 5DNN B;  3MGP A;  4J8U B;  1ULY A;  3UTA D;  3AZE A;  5B2I D;  3REI B;  3AFA C;  1S32 B;  3MVD C;  5B2J A;  4AWL C;  5BNV B;  4Z5T B;  5JRG B;  5B0Z C;  1F66 A;  4JJN A;  3W96 C;  5AV8 C;  3X1V B;  1TZY B;  3P5J B;  3WTP C;  3AZJ B;  3VH5 A;  5B33 A;  3WKJ D;  3MGQ D;  5B0Y B;  5B32 G;  4J8W B;  1KX4 B;  1P3P C;  2Y2N A;  2G5H C;  3LEL C;  5B32 D;  1ID3 D;  4KHA B;  2NZD C;  4H9Q A;  3B6F C;  3AYW C;  3MNN D;  2BYM B;  3LZ1 C;  4YS3 C;  4CAY A;  5CP6 D;  5B31 B;  2Y2K A;  5DNM A;  1AOI B;  1M18 B;  3W98 D;  3O62 A;  5AY8 A;  4KGC B;  2JCH A;  3W99 C;  5B1M D;  4UPK A;  2L5A A;  1JFI B;  1B6W A;  3REJ A;  3KUY D;  3IP4 C;  5BO0 A;  3REL D;  3REK B;  1HQ3 C;  1P34 C;  4YM6 B;  2Y2O A;  3X1U B;  5CPK C;  4XZQ D;  3WAA A;  1U35 A;  3AV2 B;  3AZL D;  5B24 A;  3A6N A;  3UT9 C;  3LZ0 B;  5B40 B;  5B1L B;  5GSU A;  4XUJ D;  2UWX A;  4G91 C;  5AVB A;  4J8V C;  1P3K A;  1M1A B;  1EQZ D;  3B0D B;  4J8X C;  3VH6 W;  5DNN C;  4J8U C;  5F99 D;  4WU9 A;  1W2E A;  5GT3 A;  4ZUX A;  4UUZ A;  3AZM D;  2ARO A;  5DNM D;  1P3M A;  3AZN A;  3REI C;  1S32 C;  2FJ7 A;  3WA9 A;  5JRG C;  4Z5T C;  1Q9C A;  2F8N K;  2NQB D;  1Z2C B;  5AVC A;  3MVD B;  2RVQ C;  3UTB A;  3X1T A;  3AZH D;  1TZY C;  4JJN C;  3X1S B;  3AZJ C;  5AV6 D;  3R45 B;  3W96 B;  5AV8 B;  3WTP E;  1HTA A;  3F6T A;  3WTP B;  2Y2H A;  3NQJ B;  4DQY B;  4J8W C;  1KX4 C;  2PYO B;  3AZI A;  3W97 D;  1M19 B;  2BYK B;  3AZG B;  3LEL B;  5BNX B;  1P3A B;  1P3O D;  3A6N D;  1T3U A;  4QLC D;  4H9S A;  5GT0 A;  3B6F B;  5B31 C;  1KX5 A;  3NQU B;  3UTA A;  1AOI C;  4DRB A;  5B2I A;  4KGC C;  2ZY4 A;  4E44 A;  3KWQ A;  5CPJ B;  3O62 C;  5AY8 C;  1P3G D;  4ZUX D;  3AZN D;  1N1J B;  1P3B D;  3REJ C;  2ZY5 A;  1P3F A;  2HIO B;  3WKJ A;  4KUD D;  3MGQ A;  3REK C;  4H9O B;  4WNN A;  4YM6 C;  4LD9 B;  2F8N D;  4H9P B;  3AV2 C;  3EPH A;  1KX3 D;  3H0L C;  3LJA D;  1P34 B;  2Y2L A;  4H9R B;  3AZK B;  5CPK B;  1U35 C;  1ID3 A;  3C1B D;  4HGA B;  5B40 C;  5B1L C;  5B32 B;  3KXB A;  3EG5 B;  5B24 C;  3AZI D;  3MNN A;  1BH9 A;  3MGS B;  1ZLA B;  4WU8 B;  1M1A C;  5C3I B;  5GXQ D;  3B0D C;  1P3L D;  3W98 A;  4G91 B;  5CP6 B;  4EO5 B;  5B1M A;  4NFT A;  5AV5 C;  3AFA D;  5KDM B;  3VH6 A;  1KX5 D;  5B0Z D;  5FUG B;  4WU9 C;  3A1I A;  5GT3 C;  3MGP B;  3KUY A;  1P3M C;  2BG1 A;  3KWQ D;  3AZE B;  3AZF C;  3EPL A;  3WA9 C;  3VH5 T;  1B67 A;  3REL A;  1WWI A;  3X1S C;  5B2J B;  3REH A;  1P3P D;  4XZQ A;  1F66 B;  4JJN B;  3AZL A;  1P3F D;  3B6G A;  2PYO C;  1M19 C;  1P3I A;  5B33 B;  4XUJ A;  3LZ1 D;  5JA4 A;  3AZG C;  1P3A C;  2DQN C;  2ZM5 A;  2Y2J A;  3KXB D;  1EQZ A;  3MGR A;  4H9S C;  5F99 A;  5GT0 C;  5AV9 A;  4H9Q B;  3AZM A;  4CAY B;  5CPJ C;  4X23 D;  5B2I C;  5DNM B;  2NQB A;  2YFV A;  3O62 B;  5AY8 B;  2ZY3 A;  3TU4 A;  3AZH A;  5AV6 A;  2HIO C;  3REJ B;  4LD9 C;  3WKJ C;  3MGQ C;  3W97 A;  5BO0 B;  3REH D;  5CPI D;  3AZK C;  4HGA C;  2Y2I A;  4Z66 A;  3WAA B;  1ID3 C;  5B32 C;  3B6G D;  4R8P D;  5BS7 A;  1U35 B;  1P3O A;  2LY8 A;  3AN2 D;  1P3I D;  4QLC A;  3MGS C;  2YFW A;  5B24 B;  1ZLA C;  3A6N B;  3MNN C;  4WU8 C;  5DNN D;  4J8U D;  5C3I C;  5GSU B;  3C1C A;  5CP6 C;  4EO5 C;  1S32 D;  2CV5 A;  5AVB B;  1P3K B;  3MGR D;  1P3G A;  5AV5 B;  5AV9 D;  2RIQ A;  2RVQ D;  2W8S A;  3X1V D;  3MGP C;  1TZY D;  4WU9 B;  5GT3 B;  3AZE C;  4ZUX B;  1P3B A;  4UUZ B;  3KUY C;  2ARO B;  1P3M B;  3AZN B;  4KUD A;  5B0Y D;  3AZF B;  2DF4 C;  2FJ7 B;  1KX4 D;  5B2J C;  2F2A C;  4H9N A;  3WA9 B;  3TU4 D;  5E5A A;  2F8N A;  5AVC B;  3REL C;  1F66 C;  1KX3 A;  3LJA A;  3AV1 A;  3UTB B;  3X1T B;  3C1B A;  5B33 C;  4XUJ C;  4CSR A;  5B31 D;  2Y2G A;  1M18 D;  4Z66 D;  4G92 B;  5GXQ A;  4KGC D;  1P3L A;  3AFA A;  3V9R A;  1EQZ C;  2XD5 A;  1BFM A;  5B0Z A;  5GT0 B;  5GT0 D;  3C1C D;  4Z2M H;  1KX5 B;  3W96 A;  3AZM C;  5DNM C;  3EPK A;  3UTA B;  3WTP A;  2CV5 D;  5G49 A;  5B2I B;  3REK D;  4ZBJ C;  3KWQ B;  4YM6 D;  3X1U D;  1P3P A;  3AV2 D;  2IO5 C;  5AV6 C;  2F8N G;  2NZD A;  3LZ0 D;  5B40 D;  1P3F B;  3AYW A;  5E5A D;  3WKJ B;  3LZ1 A;  3MGQ B;  4WNN B;  3H0R C;  4YS3 A;  2FFF B;  3WAA C;  3AV1 D;  1WWS A;  1M1A D;  1ID3 B;  5BS7 C;  3A6N C;  3W99 A;  3KXB B;  5GSU C;  3MNN B;  1TAF A;  1BH9 B;  2HUE B;  2CWE A;  3VH6 T;  3KFU G;  4M6B A;  4X23 A;  5AVB C;  1P3K C;  4WZS B;  3W98 B;  3MVD D;  1P3G C;  1H3O A;  3EPJ A;  5B1M B;  1HQ3 A;  4ZUX C;  3W96 D;  5AV8 D;  2ARO C;  3AZN C;  3WTP D;  1P3B C;  2Y2P A;  2FJ7 C;  3KUY B;  2PYO D;  3UT9 A;  4KUD C;  1F1E A;  5AVC C;  5CPI A;  3UTB C;  3X1T C;  3REL B;  1KX3 C;  3LEL D;  3LJA C;  3REH B;  1P3A D;  4J8V A;  1BH8 A;  4XZQ B;  4R8P A;  2NZD D;  3AN2 A;  3AZL B;  4J8X A;  3B6F D;  3B6G B;  3AYW D;  3AZI C;  5DNN A;  4J8U A;  4YS3 D;  1P3I B;  4G92 C;  4XUJ B;  5JA4 B;  3REI A;  5CPJ D;  5GXQ C;  1S32 A;  4E45 A;  1P3L C;  5BT1 C;  3W99 D;  5BNV A;  4Z5T A;  5JRG A;  1EQZ B;  3MGR B;  1KX5 C;  3X1V A;  5F99 B;  3UTA C;  5AV9 B;  1TZY A;  3AZJ A;  3AZM B;  2HIO D;  3KWQ C;  5B0Y A;  4LD9 D;  4J8W A;  1KX4 A;  2NQB B;  4ZBJ B;  2YFV B;  1HQ3 D;  1P34 D;  2G5I C;  3AZK D;  5CPK D;  4NE5 A;  3TU4 B;  4KHA A;  3AZH B;  2IO5 B;  5AV6 B;  1P3F C;  3UT9 D;  3B0B A;  2BYM A;  3MGS D;  1ZLA D;  4WU8 D;  5B31 A;  3W97 B;  1AOI A;  1M18 A;  4J8V D;  4KGC A;  2JE5 A;  4Z66 B;  3KXB C;  4J8X D;  1P3O B;  4QLC B;  2HUE C;  2YFW B;  1JFI A;  3MGP D;  3H0M C;  3REI D;  3AZE D;  3C1C B;  4X23 C;  3W98 C;  5JRG D;  4Z5T D;  5B1M C;  3REK A;  2ZY2 A;  2VQR A;  2CV5 B;  5B2J D;  4YM6 A;  1P3G B;  3X1U A;  3AV2 A;  3AZJ D;  4JJN D;  1F66 D;  3A1K A;  4WV4 B;  3LZ0 A;  5B33 D;  5B1L A;  5B40 A;  4J8W D;  1P3B B;  4KUD B;  3REH C;  4H9N B;  5CPI C;  5E5A B;  4XZQ C;  2F8N B;  1M1A A;  3AZL C;  1KX3 B;  3LJA B;  3AV1 B;  5B31 G;  1R4V A;  4R8P C;  3B6G C;  3C1B B;  3AN2 C;  1P3I C;  5AV5 A;  3AZI B;  2JSS A;  1AOI D;  4CSR B;  2Y2Q A;  3AZF A;  3B0C W;  5GXQ B;  3O62 D;  5AY8 D;  1P3L B;  3MVD A;  3MGR C;  3AFA B;  3V9R B;  5F99 C;  5AV9 C;  3X1S A;  4AWL B;  3R45 A;  3X1V C;  5AV8 A;  5B0Z B;  3REJ D;  3NQJ A;  3VH5 W;  2PYO A;  2NQB C;  1M19 A;  1A7W A;  5B0Y C;  5G49 B;  4WJ3 C;  3TU4 C;  2BYK A;  3AZH C;  3AL0 C;  3WAA D;  3AZG A;  3LEL A;  5BNX A;  1P3A A;  1U35 D;  1P3P B;  4Z2M G;  5B1L D;  5B24 D;  3B6F A;  4NE6 A;  1KU5 A;  2NZD B;  3W97 C;  3NQU A;  3KSY A;  5GSU D;  3AYW B;  3LZ1 B;  4YS3 B;  2F8N H;  3FDD A;  1M18 C;  4Z66 C;  5CPJ A;  5AVB D;  1P3O C;  1P3K D;  4QLC C;  5AV5 D;  5CHL B;  3W99 B;  4WU9 D;  1N1J A;  5GT3 D;  3C1C C;  2ARO D;  1TAF B;  1P3M D;  2Y2M A;  2HIO A;  4NE3 A;  3AZF D;  2FJ7 D;  2CV5 C;  4H9O A;  4X23 B;  3WA9 D;  4LD9 A;  5AVC D;  4H9P A;  3X1S D;  1P34 A;  3X1U C;  1H3O B;  4H9R A;  3X1T D;  3UTB D;  3AZK A;  5CPK A;  1HQ3 B;  2J8P A;  5B32 A;  1M19 D;  3LZ0 C;  3MGS A;  1ZLA A;  4WU8 A;  3UT9 B;  5E5A C;  1PZR A;  3AZG D;  3AV1 C;  5CPI B;  5CP6 A;  3C1B C;  2XD1 A;  4DRA A;  4J8V B;  1BH8 B;  5BT1 D;  4R8P B;  5KDM A;  3AN2 B;  5FUG A;  4J8X B;  3B0C T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...