5GT3C

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3C00
5CPKD 3WA9A 3MGQD 1ID3C 1EQZA 2PYOA 3KWQA 3AZGA 5AV6A 1KX5D 2YFVB 3X1UC 3AZKD 4JJNC 1KX3A 1U35B 3AZFD 1KX4A 3B0DB 4H9NA 3B6FB 5GT0A 3KXBB 3REJB 3B6GB 1N1JA 3MGPB 5BO0A 5AVCB 3LZ0C 5B1LD 3UTBA 5CPJD 3W96A 5B2JC 1M19B 1S32A 4G91C 3UT9C 4UUZB 1M18C 4R8PA 4QLCD 4HGAC 3REID 3AV2A 3WA9D 1EQZD 3AFAA 2PYOD 3WTPD 1P3AC 3KWQD 3AZGD 5CPIA 4WU8A 3R45B 3C1BB 3LELB 1AOIC 3KSYA 5B40C 1KX3D 2NQBB 3AN2B 3X1TA 4M6BA 4NE3A 3LJAB 3TU4B 3W98A 4LD9A 4KUDB 3MGQB 3KUYC 3VH6T 2FJ7A 3AZIB 3UTBD 4Z5TC 1KX5B 3W96D 3AZLC 1S32D 4G92B 3W97A 5JA4B 1P3MB 4R8PD 5GXQC 3AV2D 1P3OD 1P3KC 4XZQA 3AFAD 2CV5B 4J8VC 3AV1A 4WU9C 5CPID 2F8NG 4WU8D 1P34C 3REKC 4AWLB 3WAAC 5CP6C 1ID3A 3MGSB 5CPJB 3X1TD 1U35A 3X1UA 4KGCC 3W98D 5AY8B 4JJNA 4LD9D 3WA9B 4Z66D 2FJ7D 2PYOB 3AZGB 5AV6B 4NE5A 4H9SC 3WKJC 4DRAA 3AZJA 3REHC 3W97D 1M1AA 1KX3B 1HQ3C 1KX4B 4H9NB 1P3GC 4UUZA 1BH8A 4XZQD 5GT0B 5JRGA 3AV1D 3UT9A 5KDMA 5DNMC 1M18A 1N1JB 3R45A 3RELC 3C1BA 2HIOC 1P3AA 3UTBB 5B2IA 3AZMC 2NQBA 3W96B 1P3FC 1U35D 1S32B 1AOIA 3VH6A 5CHLB 4R8PB 3VH5A 5G49A 3AV2B 3AFAB 5CPIB 2YFWA 4WU8B 4YS3C 3MGPD 2HUEB 5AVBC 4J8UC 3AZJD 1BH9A 1M1AD 3KUYA 5AV8A 5B33A 1TZYC 3X1TB 4NFTA 1B6WA 5JRGD 1F1EA 4EO5B 4LD9B 3UT9D 3UTAC 1WWIA 2FJ7B 5GXQA 1P3KA 3C1BD 3MNNC 1P3AD 5B2ID 3AZEC 3MGSA 2NQBD 5B24B 5C3IC 3W97B 2BYMA 1AOID 3REKA 1P3LB 5CP6A 2RVQC 2CWEA 3MGRC 5BS7C 4XZQB 5AY8A 5B32G 3NQUA 4KUDD 3AV1B 3W99C 4YM6A 4ZBJB 4XUJC 3AZHC 3AZID 4KGCA 1B67A 2IO5B 1ID3B 5AV8D 5B33D 3X1VC 3C1CC 1P3MD 4H9SA 3WKJA 3X1UB 4JJNB 2CV5D 1HQ3A 5DNNA 1P3GA 5GXQD 1P3KD 4X23A 2AROC 3MGSD 3AZJB 5BNVA 5DNMA 1M1AB 3REKD 3RELA 5CP6D 2HIOA 2LY8A 2NZDC 1BH8B 3WTPE 3AZMA 3NQJA 3B0DC 4H9PA 5AY8D 3O62C 5JRGB 1P3FA 4ZUXC 4YM6D 4G91B 3UT9B 4H9RB 5KDMB 1M18B 5AV6D 5B31G 4HGAB 5B0ZC 3B6GC 4CSRA 1ZLAC 1P3AB 5B2IB 3X1SC 5AVCC 4YS3A 1KX4D 3WKJD 1AOIB 5B40B 1M19C 5GT0D 5E5AC 1HQ3D 5G49B 5DNND 2BYKA 1P3GD 1TZYA 2F8NA 3V9RA 3B0BA 2YFWB 4H9QB 4X23D 4DRBA 3VH5T 5DNMD 1BH9B 3KUYB 5B24A 5AV8B 3RELD 5B33B 5B32C 4J8WC 2HIOD 4J8XA 3AN2C 4Z5TB 3AZMD 1P3LA 5GT3C 5B0YC 4WZSB 3AZEA 1F66A 3AYWC 5AV5C 3MVDC 5CPKC 5GXQB 1P3KB 3MGRA 3AZNC 5B1MC 3A6NC 4WU9B 4YS3D 3AZHA 1KX5C 2BYMB 3REKB 5CP6B 1P3BC 3AZKC 1P3PC 3X1VA 2F8NH 3AZFC 3NQUB 2F8ND 4YM6B 4KGCB 5B24D 4J8XD 1P3LD 5B1LC 2AROA 3WKJB 3B0CT 5B31C 3LZ0A 1F66D 5B2JA 1HQ3B 2RVQD 5DNNB 1P3GB 4QLCC 5GSUC 4H9RA 3REIC 3MGRD 4CAYB 3WA9C 2NZDA 1EQZC 3O62A 3WTPC 4X23B 4ZUXA 1TAFA 3KWQC 3AZGC 1ID3D 3LZ1C 5BNVB 5DNMB 5BNXA 5B0ZA 3RELB 4Z2MG 2HIOB 5F99C 3X1UD 1P3IC 1ZLAA 5B40A 3AZMB 3X1VD 3NQJB 4JJND 4H9PB 3X1SA 1P3FB 4WNNA 4H9QA 5E5AA 4CSRB 4E45A 4YS3B 2AROD 5AVBB 4J8UB 3LZ0D 4Z5TA 1S32C 1H3OA 5B2JD 3AZLA 5B32A 4J8WA 2BYKB 1TZYB 1P3OC 2F8NB 3V9RB 1M18D 2NZDD 5GT3A 3O62D 4ZUXD 5AV5A 5CPIC 4WU8C 4J8VA 3MVDA 4WU9A 3MNNB 4J8XB 1P34A 3AZNA 5B1MA 3A6NA 5B40D 3WAAA 3AZEB 1F66B 5C3IB 3W98C 1P3BA 4LD9C 1P3PA 5E5AD 3MGRB 3AZFA 4Z66C 3W99B 3KUYD 3AZHB 1HTAA 2L5AA 4Z5TD 3W97C 5AV9C 3AZLD 4WV4B 5B32D 3REHA 3X1VB 5B1LA 4XZQC 5B31A 4CAYA 5AV5D 4J8VD 4WU9D 3MVDD 4QLCA 5GSUA 3REIA 1P34D 1WWSA 5B1MD 3A6ND 3AZND 3WTPA 3WAAD 2AROB 3LZ0B 3LZ1A 1U35C 5B2JB 1P3BD 3B6FC 5F99A 1P3IA 3KXBC 1P3PD 3REJC 4KGCD 2NZDB 3O62B 4ZUXB 1TAFB 3MGPC 5BNXB 5B0ZB 3AZJC 1M1AC 5AVBA 4J8UA 1ZLAB 3REHD 3X1SB 4WNNB 5B31D 5JRGC 5E5AB 3VH6W 5GSUD 1P3OA 3UTAA 3C1BC 3VH5W 3LELC 1JFIA 5B2IC 3MNNA 2NQBC 5BT1C 3LZ1D 2F8NK 1H3OB 3AZLB 1P3FD 5B32B 4J8WB 5F99D 1P3ID 3LJAC 3TU4C 5FUGA 5GT3B 5B0YB 4KHAA 4KUDC 3MGQC 5BS7A 3AYWB 5AV5B 4J8VB 3W99A 3AZIC 3MVDB 5CPKB 4XUJA 1P34B 5AVBD 4J8UD 3AZNB 5B1MB 4Z66A 3A6NB 5AV8C 3WAAB 5B33C 4G92C 1P3MC 3C1CA 1TZYD 1P3BB 3AZKB 5AV9A 1P3PB 2CV5C 3AZFB 3UTAD 4AWLC 3MNND 3MGSC 3AZED 5CPJC 1BFMA 3REHB 2YFVA 3B0CW 5B1LB 5AY8C 5B31B 4YM6C 2PYOC 4H9OB 3W99D 5AV6C 3B6FA 5GSUB 4QLCB 4XUJD 3KXBA 3REIB 3REJA 3AZHD 1EQZB 3WTPB 4E44A 3KWQB 3B6GA 1KX3C 3LZ1B 3MGPA 1KX4C 3C1CD 5AVCA 5GT0C 5AV9D 5F99B 1P3IB 4NE6A 1M19A 5DNNC 1Q9CA 4Z2MH 4X23C 3UTBC 3W96C 5BO0B 3LELA 4R8PC 1KU5A 3AN2A 3AV2C 5B0YA 3AFAC 3AYWA 3B6FD 3KXBD 3LJAA 3REJD 3UTAB 3TU4A 1P3OB 2HUEC 5B0ZD 5CPKA 1JFIB 3B6GD 4KUDA 3MGQA 1ZLAD 1R4VA 3AZIA 3X1SD 5AVCD 3X1TC 1KX5A 1ULYA 5FUGB 4EO5C 1M19D 3AZKA 4KHAB 5JA4A 1P3MA 2FJ7C 3W98B 4XUJB 2CV5A 4Z66B 5B24C 4J8XC 3LELD 2JSSA 4J8WD 1P3LC 3C1CB 5BT1D 3AN2D 1A7WA 1F66C 5GT3D 5B0YD 5CPJA 5AV9B 3AYWD 3AV1C 3LJAD 4ZBJC 3TU4D 4H9OA 2IO5C
chains in the Genus database with same CATH superfamily
5CPKD 3WA9A 3MGQD 1ID3C 1EQZA 2PYOA 3KWQA 3AZGA 5AV6A 2JCHA 1KX5D 2YFVB 3X1UC 3AZKD 4JJNC 1KX3A 1U35B 3AZFD 1KX4A 3B0DB 4H9NA 2VQRA 3B6FB 5GT0A 3KXBB 3REJB 3B6GB 2ZY5A 1N1JA 3MGPB 5BO0A 5AVCB 3LZ0C 5B1LD 3UTBA 5CPJD 3W96A 5B2JC 1M19B 1S32A 4G91C 2XD5A 3UT9C 4UUZB 1M18C 4R8PA 3EPKA 4QLCD 4HGAC 3REID 3AV2A 3WA9D 1EQZD 3AFAA 2PYOD 3WTPD 1P3AC 3KWQD 3AZGD 5CPIA 4WU8A 3R45B 3C1BB 3LELB 1AOIC 3KSYA 5B40C 1KX3D 2NQBB 3AN2B 2Y2LA 3X1TA 4M6BA 4NE3A 3LJAB 3TU4B 3W98A 4UPKA 4LD9A 4KUDB 3MGQB 3KUYC 3VH6T 2FJ7A 4WJ3C 3AZIB 3UTBD 4Z5TC 1KX5B 3W96D 3AZLC 1S32D 4G92B 3W97A 5JA4B 1P3MB 4R8PD 5GXQC 3AV2D 1P3OD 1P3KC 4XZQA 3AFAD 2CV5B 4J8VC 3AV1A 4WU9C 5CPID 2F8NG 4WU8D 1P34C 3REKC 4AWLB 3WAAC 5CP6C 1ID3A 3MGSB 5CPJB 3X1TD 1U35A 1T3UA 3X1UA 2G5IC 4KGCC 3W98D 5AY8B 4JJNA 4LD9D 3WA9B 4Z66D 2FJ7D 2PYOB 3AZGB 5AV6B 4NE5A 4H9SC 3WKJC 4DRAA 3AZJA 3REHC 3W97D 1M1AA 1KX3B 1HQ3C 1KX4B 4H9NB 1P3GC 4UUZA 1BH8A 4XZQD 5GT0B 5JRGA 3AV1D 3UT9A 5KDMA 5DNMC 1M18A 1N1JB 3R45A 3RELC 3C1BA 2HIOC 1P3AA 3UTBB 5B2IA 3AZMC 2NQBA 3W96B 1P3FC 1U35D 1S32B 1Z2CB 1AOIA 3VH6A 5CHLB 4R8PB 3VH5A 5G49A 3AV2B 3AFAB 5CPIB 2YFWA 4WU8B 4YS3C 3MGPD 2HUEB 5AVBC 4J8UC 3AZJD 1BH9A 1M1AD 3KUYA 5AV8A 5B33A 1TZYC 3X1TB 4NFTA 1B6WA 5JRGD 1F1EA 4EO5B 4LD9B 3UT9D 3UTAC 1WWIA 2FJ7B 5GXQA 1P3KA 3C1BD 3MNNC 1P3AD 5B2ID 3AZEC 3MGSA 2NQBD 2ZY2A 5B24B 5C3IC 3W97B 2BYMA 1AOID 3REKA 1P3LB 5CP6A 2RVQC 2CWEA 3MGRC 5BS7C 4XZQB 5AY8A 3P5JB 5B32G 3NQUA 4KUDD 3AV1B 3W99C 4YM6A 4ZBJB 4XUJC 3AZHC 3AZID 4KGCA 1B67A 2IO5B 1ID3B 5AV8D 5B33D 3X1VC 3C1CC 1P3MD 4H9SA 3WKJA 3X1UB 2Y2QA 4JJNB 2J8PA 2CV5D 1HQ3A 5DNNA 1P3GA 5GXQD 1P3KD 4X23A 2AROC 3MGSD 3AZJB 5BNVA 5DNMA 1M1AB 3REKD 3RELA 5CP6D 2HIOA 2LY8A 3EPHA 2NZDC 1BH8B 3WTPE 3AZMA 3NQJA 3B0DC 4H9PA 5AY8D 3O62C 5JRGB 1P3FA 4ZUXC 4YM6D 4G91B 3UT9B 4H9RB 5KDMB 1M18B 5AV6D 5B31G 4HGAB 5B0ZC 3B6GC 4CSRA 3EG5B 1ZLAC 1P3AB 5B2IB 2DF4C 3X1SC 5AVCC 4YS3A 1KX4D 3WKJD 1AOIB 5B40B 1M19C 5GT0D 5E5AC 1HQ3D 5G49B 5DNND 2BYKA 1P3GD 1TZYA 2F8NA 3V9RA 3B0BA 2YFWB 4H9QB 4X23D 2DQNC 4DRBA 2ZM5A 3VH5T 5DNMD 1BH9B 3KUYB 5B24A 5AV8B 3RELD 5B33B 5B32C 4J8WC 2HIOD 4J8XA 3AN2C 4Z5TB 3AZMD 1P3LA 5GT3C 5B0YC 4WZSB 3AZEA 1F66A 3AYWC 5AV5C 3EPJA 3MVDC 2Y2PA 5CPKC 5GXQB 1P3KB 3MGRA 3AZNC 5B1MC 3A6NC 2F2AC 4WU9B 4YS3D 3AZHA 1KX5C 2BYMB 3REKB 5CP6B 1P3BC 3AZKC 1P3PC 3X1VA 2F8NH 3AZFC 3NQUB 2F8ND 3KFUG 4YM6B 4KGCB 5B24D 4J8XD 1P3LD 5B1LC 2AROA 3WKJB 3B0CT 5B31C 3LZ0A 1F66D 5B2JA 1HQ3B 2RVQD 5DNNB 1P3GB 4QLCC 5GSUC 4H9RA 3REIC 3MGRD 4CAYB 3WA9C 2NZDA 1EQZC 3O62A 3WTPC 4X23B 4ZUXA 1TAFA 3KWQC 3AZGC 1ID3D 3LZ1C 5BNVB 5DNMB 5BNXA 5B0ZA 3RELB 4Z2MG 2HIOB 5F99C 3X1UD 1P3IC 1ZLAA 5B40A 3AZMB 3X1VD 3NQJB 4JJND 4H9PB 3X1SA 1P3FB 4WNNA 4H9QA 2G5HC 5E5AA 4CSRB 4E45A 4YS3B 2AROD 5AVBB 4J8UB 3LZ0D 4Z5TA 1S32C 1H3OA 5B2JD 3AZLA 5B32A 4J8WA 2BYKB 3EPLA 1TZYB 1P3OC 2F8NB 3V9RB 1M18D 2NZDD 5GT3A 3O62D 3H0RC 2Y2HA 4ZUXD 2W8SA 5AV5A 5CPIC 4WU8C 4J8VA 3MVDA 4WU9A 3MNNB 4J8XB 1P34A 3AZNA 5B1MA 3A6NA 5B40D 3WAAA 3AZEB 1F66B 5C3IB 3W98C 1P3BA 4LD9C 1P3PA 5E5AD 2Y2IA 3MGRB 3AZFA 4Z66C 3W99B 3KUYD 3AZHB 2BG1A 1HTAA 2L5AA 4Z5TD 3W97C 5AV9C 3AZLD 4WV4B 5B32D 3REHA 3X1VB 5B1LA 4XZQC 5B31A 4CAYA 5AV5D 4J8VD 4WU9D 3MVDD 4QLCA 5GSUA 3REIA 1P34D 1WWSA 5B1MD 3A6ND 3AZND 3WTPA 3WAAD 2AROB 3LZ0B 3LZ1A 1U35C 5B2JB 1P3BD 2FFFB 3B6FC 5F99A 1P3IA 3KXBC 1P3PD 3REJC 4KGCD 2NZDB 3A1KA 3O62B 1W2EA 4ZUXB 1TAFB 3IP4C 3MGPC 5BNXB 5B0ZB 3AZJC 1M1AC 5AVBA 4J8UA 1ZLAB 3REHD 3X1SB 4WNNB 3A1IA 5B31D 5JRGC 5E5AB 2Y2MA 3VH6W 5GSUD 1P3OA 3UTAA 3C1BC 3VH5W 3LELC 1JFIA 5B2IC 3MNNA 2NQBC 5BT1C 3LZ1D 2F8NK 3FDDA 1H3OB 3AZLB 1P3FD 5B32B 4J8WB 5F99D 1P3ID 3LJAC 3TU4C 5FUGA 5GT3B 5B0YB 4KHAA 4KUDC 3MGQC 5BS7A 3AYWB 5AV5B 4J8VB 3W99A 3AZIC 3MVDB 5CPKB 4XUJA 1P34B 5AVBD 4J8UD 3AZNB 5B1MB 2RIQA 3H0LC 5AV8C 4Z66A 3A6NB 4G92C 5B33C 3WAAB 1P3MC 3C1CA 1TZYD 2JE5A 1P3BB 2Y2KA 3AZKB 5AV9A 1P3PB 2CV5C 3AZFB 3UTAD 4AWLC 3MNND 3MGSC 3AZED 5CPJC 1BFMA 3REHB 2YFVA 3B0CW 5B1LB 5AY8C 5B31B 3AL0C 4YM6C 2PYOC 4H9OB 3W99D 5AV6C 3B6FA 5GSUB 4QLCB 4XUJD 3KXBA 3REIB 2ZY3A 3REJA 3AZHD 1EQZB 3WTPB 4E44A 3H0MC 3KWQB 3B6GA 1KX3C 3LZ1B 3MGPA 1KX4C 3C1CD 3F6TA 5AVCA 5GT0C 5AV9D 5F99B 1P3IB 4NE6A 1M19A 5DNNC 1Q9CA 2UWXA 4Z2MH 4X23C 3UTBC 3W96C 2XD1A 2Y2JA 5BO0B 3LELA 4R8PC 1KU5A 3AN2A 3AV2C 5B0YA 3AFAC 4DQYB 3AYWA 3B6FD 3KXBD 3LJAA 3REJD 3UTAB 3TU4A 1P3OB 2HUEC 5B0ZD 5CPKA 1JFIB 3B6GD 4KUDA 3MGQA 1ZLAD 1R4VA 3AZIA 3X1SD 5AVCD 3X1TC 1KX5A 1ULYA 5FUGB 4EO5C 1M19D 2ZY4A 3AZKA 4KHAB 5JA4A 1P3MA 2FJ7C 3W98B 4XUJB 2CV5A 4Z66B 5B24C 4J8XC 3LELD 2JSSA 4J8WD 1P3LC 3C1CB 5BT1D 3AN2D 1A7WA 1PZRA 1F66C 5B0YD 5GT3D 2Y2OA 2Y2NA 5AV9B 5CPJA 2Y2GA 3AYWD 3AV1C 3LJAD 4ZBJC 3TU4D 4H9OA 2IO5C
chains in the Genus database with same CATH topology
5CPKD 3WA9A 3MGQD 1ID3C 1EQZA 2PYOA 3KWQA 3AZGA 5AV6A 2JCHA 1KX5D 2YFVB 3X1UC 3AZKD 4JJNC 1KX3A 1U35B 3AZFD 1KX4A 3B0DB 4H9NA 2VQRA 3B6FB 5GT0A 3KXBB 3REJB 3B6GB 2ZY5A 1N1JA 3MGPB 5BO0A 5AVCB 3LZ0C 5B1LD 3UTBA 5CPJD 3W96A 5B2JC 1M19B 1S32A 4G91C 2XD5A 3UT9C 4UUZB 1M18C 4R8PA 3EPKA 4QLCD 4HGAC 3REID 3AV2A 3WA9D 1EQZD 3AFAA 2PYOD 3WTPD 1P3AC 3KWQD 3AZGD 5CPIA 4WU8A 3R45B 3C1BB 3LELB 1AOIC 3KSYA 5B40C 1KX3D 2NQBB 3AN2B 2Y2LA 3X1TA 4M6BA 4NE3A 3LJAB 3TU4B 3W98A 4UPKA 4LD9A 4KUDB 3MGQB 3KUYC 3VH6T 2FJ7A 4WJ3C 3AZIB 3UTBD 4Z5TC 1KX5B 3W96D 3AZLC 1S32D 4G92B 3W97A 5JA4B 1P3MB 4R8PD 5GXQC 3AV2D 1P3OD 1P3KC 4XZQA 3AFAD 2CV5B 4J8VC 3AV1A 4WU9C 5CPID 2F8NG 4WU8D 1P34C 3REKC 4AWLB 3WAAC 5CP6C 1ID3A 3MGSB 5CPJB 3X1TD 1U35A 1T3UA 3X1UA 2G5IC 4KGCC 3W98D 5AY8B 4JJNA 4LD9D 3WA9B 4Z66D 2FJ7D 2PYOB 3AZGB 5AV6B 4NE5A 4H9SC 3WKJC 4DRAA 3AZJA 3REHC 3W97D 1M1AA 1KX3B 1HQ3C 1KX4B 4H9NB 1P3GC 4UUZA 1BH8A 4XZQD 5GT0B 5JRGA 3AV1D 3UT9A 5KDMA 5DNMC 1M18A 1N1JB 3R45A 3RELC 3C1BA 2HIOC 1P3AA 3UTBB 5B2IA 3AZMC 2NQBA 3W96B 1P3FC 1U35D 1S32B 1Z2CB 1AOIA 3VH6A 5CHLB 4R8PB 3VH5A 5G49A 3AV2B 3AFAB 5CPIB 2YFWA 4WU8B 4YS3C 3MGPD 2HUEB 5AVBC 4J8UC 3AZJD 1BH9A 1M1AD 3KUYA 5AV8A 5B33A 1TZYC 3X1TB 4NFTA 1B6WA 5JRGD 1F1EA 4EO5B 4LD9B 3UT9D 3UTAC 1WWIA 2FJ7B 5GXQA 1P3KA 3C1BD 3MNNC 1P3AD 5B2ID 3AZEC 3MGSA 2NQBD 2ZY2A 5B24B 5C3IC 3W97B 2BYMA 1AOID 3REKA 1P3LB 5CP6A 2RVQC 2CWEA 3MGRC 5BS7C 4XZQB 5AY8A 3P5JB 5B32G 3NQUA 4KUDD 3AV1B 3W99C 4YM6A 4ZBJB 4XUJC 3AZHC 3AZID 4KGCA 1B67A 2IO5B 1ID3B 5AV8D 5B33D 3X1VC 3C1CC 1P3MD 4H9SA 3WKJA 3X1UB 2Y2QA 4JJNB 2J8PA 2CV5D 1HQ3A 5DNNA 1P3GA 5GXQD 1P3KD 4X23A 2AROC 3MGSD 3AZJB 5BNVA 5DNMA 1M1AB 3REKD 3RELA 5CP6D 2HIOA 2LY8A 3EPHA 2NZDC 1BH8B 3WTPE 3AZMA 3NQJA 3B0DC 4H9PA 5AY8D 3O62C 5JRGB 1P3FA 4ZUXC 4YM6D 4G91B 3UT9B 4H9RB 5KDMB 1M18B 5AV6D 5B31G 4HGAB 5B0ZC 3B6GC 4CSRA 3EG5B 1ZLAC 1P3AB 5B2IB 2DF4C 3X1SC 5AVCC 4YS3A 1KX4D 3WKJD 1AOIB 5B40B 1M19C 5GT0D 5E5AC 1HQ3D 5G49B 5DNND 2BYKA 1P3GD 1TZYA 2F8NA 3V9RA 3B0BA 2YFWB 4H9QB 4X23D 2DQNC 4DRBA 2ZM5A 3VH5T 5DNMD 1BH9B 3KUYB 5B24A 5AV8B 3RELD 5B33B 5B32C 4J8WC 2HIOD 4J8XA 3AN2C 4Z5TB 3AZMD 1P3LA 5GT3C 5B0YC 4WZSB 3AZEA 1F66A 3AYWC 5AV5C 3EPJA 3MVDC 2Y2PA 5CPKC 5GXQB 1P3KB 3MGRA 3AZNC 5B1MC 3A6NC 2F2AC 4WU9B 4YS3D 3AZHA 1KX5C 2BYMB 3REKB 5CP6B 1P3BC 3AZKC 1P3PC 3X1VA 2F8NH 3AZFC 3NQUB 2F8ND 3KFUG 4YM6B 4KGCB 5B24D 4J8XD 1P3LD 5B1LC 2AROA 3WKJB 3B0CT 5B31C 3LZ0A 1F66D 5B2JA 1HQ3B 2RVQD 5DNNB 1P3GB 4QLCC 5GSUC 4H9RA 3REIC 3MGRD 4CAYB 3WA9C 2NZDA 1EQZC 3O62A 3WTPC 4X23B 4ZUXA 1TAFA 3KWQC 3AZGC 1ID3D 3LZ1C 5BNVB 5DNMB 5BNXA 5B0ZA 3RELB 4Z2MG 2HIOB 5F99C 3X1UD 1P3IC 1ZLAA 5B40A 3AZMB 3X1VD 3NQJB 4JJND 4H9PB 3X1SA 1P3FB 4WNNA 4H9QA 2G5HC 5E5AA 4CSRB 4E45A 4YS3B 2AROD 5AVBB 4J8UB 3LZ0D 4Z5TA 1S32C 1H3OA 5B2JD 3AZLA 5B32A 4J8WA 2BYKB 3EPLA 1TZYB 1P3OC 2F8NB 3V9RB 1M18D 2NZDD 5GT3A 3O62D 3H0RC 2Y2HA 4ZUXD 2W8SA 5AV5A 5CPIC 4WU8C 4J8VA 3MVDA 4WU9A 3MNNB 4J8XB 1P34A 3AZNA 5B1MA 3A6NA 5B40D 3WAAA 3AZEB 1F66B 5C3IB 3W98C 1P3BA 4LD9C 1P3PA 5E5AD 2Y2IA 3MGRB 3AZFA 4Z66C 3W99B 3KUYD 3AZHB 2BG1A 1HTAA 2L5AA 4Z5TD 3W97C 5AV9C 3AZLD 4WV4B 5B32D 3REHA 3X1VB 5B1LA 4XZQC 5B31A 4CAYA 5AV5D 4J8VD 4WU9D 3MVDD 4QLCA 5GSUA 3REIA 1P34D 1WWSA 5B1MD 3A6ND 3AZND 3WTPA 3WAAD 2AROB 3LZ0B 3LZ1A 1U35C 5B2JB 1P3BD 2FFFB 3B6FC 5F99A 1P3IA 3KXBC 1P3PD 3REJC 4KGCD 2NZDB 3A1KA 3O62B 1W2EA 4ZUXB 1TAFB 3IP4C 3MGPC 5BNXB 5B0ZB 3AZJC 1M1AC 5AVBA 4J8UA 1ZLAB 3REHD 3X1SB 4WNNB 3A1IA 5B31D 5JRGC 5E5AB 2Y2MA 3VH6W 5GSUD 1P3OA 3UTAA 3C1BC 3VH5W 3LELC 1JFIA 5B2IC 3MNNA 2NQBC 5BT1C 3LZ1D 2F8NK 3FDDA 1H3OB 3AZLB 1P3FD 5B32B 4J8WB 5F99D 1P3ID 3LJAC 3TU4C 5FUGA 5GT3B 5B0YB 4KHAA 4KUDC 3MGQC 5BS7A 3AYWB 5AV5B 4J8VB 3W99A 3AZIC 3MVDB 5CPKB 4XUJA 1P34B 5AVBD 4J8UD 3AZNB 5B1MB 2RIQA 3H0LC 5AV8C 4Z66A 3A6NB 4G92C 5B33C 3WAAB 1P3MC 3C1CA 1TZYD 2JE5A 1P3BB 2Y2KA 3AZKB 5AV9A 1P3PB 2CV5C 3AZFB 3UTAD 4AWLC 3MNND 3MGSC 3AZED 5CPJC 1BFMA 3REHB 2YFVA 3B0CW 5B1LB 5AY8C 5B31B 3AL0C 4YM6C 2PYOC 4H9OB 3W99D 5AV6C 3B6FA 5GSUB 4QLCB 4XUJD 3KXBA 3REIB 2ZY3A 3REJA 3AZHD 1EQZB 3WTPB 4E44A 3H0MC 3KWQB 3B6GA 1KX3C 3LZ1B 3MGPA 1KX4C 3C1CD 3F6TA 5AVCA 5GT0C 5AV9D 5F99B 1P3IB 4NE6A 1M19A 5DNNC 1Q9CA 2UWXA 4Z2MH 4X23C 3UTBC 3W96C 2XD1A 2Y2JA 5BO0B 3LELA 4R8PC 1KU5A 3AN2A 3AV2C 5B0YA 3AFAC 4DQYB 3AYWA 3B6FD 3KXBD 3LJAA 3REJD 3UTAB 3TU4A 1P3OB 2HUEC 5B0ZD 5CPKA 1JFIB 3B6GD 4KUDA 3MGQA 1ZLAD 1R4VA 3AZIA 3X1SD 5AVCD 3X1TC 1KX5A 1ULYA 5FUGB 4EO5C 1M19D 2ZY4A 3AZKA 4KHAB 5JA4A 1P3MA 2FJ7C 3W98B 4XUJB 2CV5A 4Z66B 5B24C 4J8XC 3LELD 2JSSA 4J8WD 1P3LC 3C1CB 5BT1D 3AN2D 1A7WA 1PZRA 1F66C 5B0YD 5GT3D 2Y2OA 2Y2NA 5AV9B 5CPJA 2Y2GA 3AYWD 3AV1C 3LJAD 4ZBJC 3TU4D 4H9OA 2IO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPK D;  3WA9 A;  3MGQ D;  1ID3 C;  1EQZ A;  2PYO A;  3KWQ A;  3AZG A;  5AV6 A;  1KX5 D;  2YFV B;  3X1U C;  3AZK D;  4JJN C;  1KX3 A;  1U35 B;  3AZF D;  1KX4 A;  3B0D B;  4H9N A;  3B6F B;  5GT0 A;  3KXB B;  3REJ B;  3B6G B;  1N1J A;  3MGP B;  5BO0 A;  5AVC B;  3LZ0 C;  5B1L D;  3UTB A;  5CPJ D;  3W96 A;  5B2J C;  1M19 B;  1S32 A;  4G91 C;  3UT9 C;  4UUZ B;  1M18 C;  4R8P A;  4QLC D;  4HGA C;  3REI D;  3AV2 A;  3WA9 D;  1EQZ D;  3AFA A;  2PYO D;  3WTP D;  1P3A C;  3KWQ D;  3AZG D;  5CPI A;  4WU8 A;  3R45 B;  3C1B B;  3LEL B;  1AOI C;  3KSY A;  5B40 C;  1KX3 D;  2NQB B;  3AN2 B;  3X1T A;  4M6B A;  4NE3 A;  3LJA B;  3TU4 B;  3W98 A;  4LD9 A;  4KUD B;  3MGQ B;  3KUY C;  3VH6 T;  2FJ7 A;  3AZI B;  3UTB D;  4Z5T C;  1KX5 B;  3W96 D;  3AZL C;  1S32 D;  4G92 B;  3W97 A;  5JA4 B;  1P3M B;  4R8P D;  5GXQ C;  3AV2 D;  1P3O D;  1P3K C;  4XZQ A;  3AFA D;  2CV5 B;  4J8V C;  3AV1 A;  4WU9 C;  5CPI D;  2F8N G;  4WU8 D;  1P34 C;  3REK C;  4AWL B;  3WAA C;  5CP6 C;  1ID3 A;  3MGS B;  5CPJ B;  3X1T D;  1U35 A;  3X1U A;  4KGC C;  3W98 D;  5AY8 B;  4JJN A;  4LD9 D;  3WA9 B;  4Z66 D;  2FJ7 D;  2PYO B;  3AZG B;  5AV6 B;  4NE5 A;  4H9S C;  3WKJ C;  4DRA A;  3AZJ A;  3REH C;  3W97 D;  1M1A A;  1KX3 B;  1HQ3 C;  1KX4 B;  4H9N B;  1P3G C;  4UUZ A;  1BH8 A;  4XZQ D;  5GT0 B;  5JRG A;  3AV1 D;  3UT9 A;  5KDM A;  5DNM C;  1M18 A;  1N1J B;  3R45 A;  3REL C;  3C1B A;  2HIO C;  1P3A A;  3UTB B;  5B2I A;  3AZM C;  2NQB A;  3W96 B;  1P3F C;  1U35 D;  1S32 B;  1AOI A;  3VH6 A;  5CHL B;  4R8P B;  3VH5 A;  5G49 A;  3AV2 B;  3AFA B;  5CPI B;  2YFW A;  4WU8 B;  4YS3 C;  3MGP D;  2HUE B;  5AVB C;  4J8U C;  3AZJ D;  1BH9 A;  1M1A D;  3KUY A;  5AV8 A;  5B33 A;  1TZY C;  3X1T B;  4NFT A;  1B6W A;  5JRG D;  1F1E A;  4EO5 B;  4LD9 B;  3UT9 D;  3UTA C;  1WWI A;  2FJ7 B;  5GXQ A;  1P3K A;  3C1B D;  3MNN C;  1P3A D;  5B2I D;  3AZE C;  3MGS A;  2NQB D;  5B24 B;  5C3I C;  3W97 B;  2BYM A;  1AOI D;  3REK A;  1P3L B;  5CP6 A;  2RVQ C;  2CWE A;  3MGR C;  5BS7 C;  4XZQ B;  5AY8 A;  5B32 G;  3NQU A;  4KUD D;  3AV1 B;  3W99 C;  4YM6 A;  4ZBJ B;  4XUJ C;  3AZH C;  3AZI D;  4KGC A;  1B67 A;  2IO5 B;  1ID3 B;  5AV8 D;  5B33 D;  3X1V C;  3C1C C;  1P3M D;  4H9S A;  3WKJ A;  3X1U B;  4JJN B;  2CV5 D;  1HQ3 A;  5DNN A;  1P3G A;  5GXQ D;  1P3K D;  4X23 A;  2ARO C;  3MGS D;  3AZJ B;  5BNV A;  5DNM A;  1M1A B;  3REK D;  3REL A;  5CP6 D;  2HIO A;  2LY8 A;  2NZD C;  1BH8 B;  3WTP E;  3AZM A;  3NQJ A;  3B0D C;  4H9P A;  5AY8 D;  3O62 C;  5JRG B;  1P3F A;  4ZUX C;  4YM6 D;  4G91 B;  3UT9 B;  4H9R B;  5KDM B;  1M18 B;  5AV6 D;  5B31 G;  4HGA B;  5B0Z C;  3B6G C;  4CSR A;  1ZLA C;  1P3A B;  5B2I B;  3X1S C;  5AVC C;  4YS3 A;  1KX4 D;  3WKJ D;  1AOI B;  5B40 B;  1M19 C;  5GT0 D;  5E5A C;  1HQ3 D;  5G49 B;  5DNN D;  2BYK A;  1P3G D;  1TZY A;  2F8N A;  3V9R A;  3B0B A;  2YFW B;  4H9Q B;  4X23 D;  4DRB A;  3VH5 T;  5DNM D;  1BH9 B;  3KUY B;  5B24 A;  5AV8 B;  3REL D;  5B33 B;  5B32 C;  4J8W C;  2HIO D;  4J8X A;  3AN2 C;  4Z5T B;  3AZM D;  1P3L A;  5GT3 C;  5B0Y C;  4WZS B;  3AZE A;  1F66 A;  3AYW C;  5AV5 C;  3MVD C;  5CPK C;  5GXQ B;  1P3K B;  3MGR A;  3AZN C;  5B1M C;  3A6N C;  4WU9 B;  4YS3 D;  3AZH A;  1KX5 C;  2BYM B;  3REK B;  5CP6 B;  1P3B C;  3AZK C;  1P3P C;  3X1V A;  2F8N H;  3AZF C;  3NQU B;  2F8N D;  4YM6 B;  4KGC B;  5B24 D;  4J8X D;  1P3L D;  5B1L C;  2ARO A;  3WKJ B;  3B0C T;  5B31 C;  3LZ0 A;  1F66 D;  5B2J A;  1HQ3 B;  2RVQ D;  5DNN B;  1P3G B;  4QLC C;  5GSU C;  4H9R A;  3REI C;  3MGR D;  4CAY B;  3WA9 C;  2NZD A;  1EQZ C;  3O62 A;  3WTP C;  4X23 B;  4ZUX A;  1TAF A;  3KWQ C;  3AZG C;  1ID3 D;  3LZ1 C;  5BNV B;  5DNM B;  5BNX A;  5B0Z A;  3REL B;  4Z2M G;  2HIO B;  5F99 C;  3X1U D;  1P3I C;  1ZLA A;  5B40 A;  3AZM B;  3X1V D;  3NQJ B;  4JJN D;  4H9P B;  3X1S A;  1P3F B;  4WNN A;  4H9Q A;  5E5A A;  4CSR B;  4E45 A;  4YS3 B;  2ARO D;  5AVB B;  4J8U B;  3LZ0 D;  4Z5T A;  1S32 C;  1H3O A;  5B2J D;  3AZL A;  5B32 A;  4J8W A;  2BYK B;  1TZY B;  1P3O C;  2F8N B;  3V9R B;  1M18 D;  2NZD D;  5GT3 A;  3O62 D;  4ZUX D;  5AV5 A;  5CPI C;  4WU8 C;  4J8V A;  3MVD A;  4WU9 A;  3MNN B;  4J8X B;  1P34 A;  3AZN A;  5B1M A;  3A6N A;  5B40 D;  3WAA A;  3AZE B;  1F66 B;  5C3I B;  3W98 C;  1P3B A;  4LD9 C;  1P3P A;  5E5A D;  3MGR B;  3AZF A;  4Z66 C;  3W99 B;  3KUY D;  3AZH B;  1HTA A;  2L5A A;  4Z5T D;  3W97 C;  5AV9 C;  3AZL D;  4WV4 B;  5B32 D;  3REH A;  3X1V B;  5B1L A;  4XZQ C;  5B31 A;  4CAY A;  5AV5 D;  4J8V D;  4WU9 D;  3MVD D;  4QLC A;  5GSU A;  3REI A;  1P34 D;  1WWS A;  5B1M D;  3A6N D;  3AZN D;  3WTP A;  3WAA D;  2ARO B;  3LZ0 B;  3LZ1 A;  1U35 C;  5B2J B;  1P3B D;  3B6F C;  5F99 A;  1P3I A;  3KXB C;  1P3P D;  3REJ C;  4KGC D;  2NZD B;  3O62 B;  4ZUX B;  1TAF B;  3MGP C;  5BNX B;  5B0Z B;  3AZJ C;  1M1A C;  5AVB A;  4J8U A;  1ZLA B;  3REH D;  3X1S B;  4WNN B;  5B31 D;  5JRG C;  5E5A B;  3VH6 W;  5GSU D;  1P3O A;  3UTA A;  3C1B C;  3VH5 W;  3LEL C;  1JFI A;  5B2I C;  3MNN A;  2NQB C;  5BT1 C;  3LZ1 D;  2F8N K;  1H3O B;  3AZL B;  1P3F D;  5B32 B;  4J8W B;  5F99 D;  1P3I D;  3LJA C;  3TU4 C;  5FUG A;  5GT3 B;  5B0Y B;  4KHA A;  4KUD C;  3MGQ C;  5BS7 A;  3AYW B;  5AV5 B;  4J8V B;  3W99 A;  3AZI C;  3MVD B;  5CPK B;  4XUJ A;  1P34 B;  5AVB D;  4J8U D;  3AZN B;  5B1M B;  4Z66 A;  3A6N B;  5AV8 C;  3WAA B;  5B33 C;  4G92 C;  1P3M C;  3C1C A;  1TZY D;  1P3B B;  3AZK B;  5AV9 A;  1P3P B;  2CV5 C;  3AZF B;  3UTA D;  4AWL C;  3MNN D;  3MGS C;  3AZE D;  5CPJ C;  1BFM A;  3REH B;  2YFV A;  3B0C W;  5B1L B;  5AY8 C;  5B31 B;  4YM6 C;  2PYO C;  4H9O B;  3W99 D;  5AV6 C;  3B6F A;  5GSU B;  4QLC B;  4XUJ D;  3KXB A;  3REI B;  3REJ A;  3AZH D;  1EQZ B;  3WTP B;  4E44 A;  3KWQ B;  3B6G A;  1KX3 C;  3LZ1 B;  3MGP A;  1KX4 C;  3C1C D;  5AVC A;  5GT0 C;  5AV9 D;  5F99 B;  1P3I B;  4NE6 A;  1M19 A;  5DNN C;  1Q9C A;  4Z2M H;  4X23 C;  3UTB C;  3W96 C;  5BO0 B;  3LEL A;  4R8P C;  1KU5 A;  3AN2 A;  3AV2 C;  5B0Y A;  3AFA C;  3AYW A;  3B6F D;  3KXB D;  3LJA A;  3REJ D;  3UTA B;  3TU4 A;  1P3O B;  2HUE C;  5B0Z D;  5CPK A;  1JFI B;  3B6G D;  4KUD A;  3MGQ A;  1ZLA D;  1R4V A;  3AZI A;  3X1S D;  5AVC D;  3X1T C;  1KX5 A;  1ULY A;  5FUG B;  4EO5 C;  1M19 D;  3AZK A;  4KHA B;  5JA4 A;  1P3M A;  2FJ7 C;  3W98 B;  4XUJ B;  2CV5 A;  4Z66 B;  5B24 C;  4J8X C;  3LEL D;  2JSS A;  4J8W D;  1P3L C;  3C1C B;  5BT1 D;  3AN2 D;  1A7W A;  1F66 C;  5GT3 D;  5B0Y D;  5CPJ A;  5AV9 B;  3AYW D;  3AV1 C;  3LJA D;  4ZBJ C;  3TU4 D;  4H9O A;  2IO5 C; 
#chains in the Genus database with same CATH topology
 5CPK D;  3WA9 A;  3MGQ D;  1ID3 C;  1EQZ A;  2PYO A;  3KWQ A;  3AZG A;  5AV6 A;  2JCH A;  1KX5 D;  2YFV B;  3X1U C;  3AZK D;  4JJN C;  1KX3 A;  1U35 B;  3AZF D;  1KX4 A;  3B0D B;  4H9N A;  2VQR A;  3B6F B;  5GT0 A;  3KXB B;  3REJ B;  3B6G B;  2ZY5 A;  1N1J A;  3MGP B;  5BO0 A;  5AVC B;  3LZ0 C;  5B1L D;  3UTB A;  5CPJ D;  3W96 A;  5B2J C;  1M19 B;  1S32 A;  4G91 C;  2XD5 A;  3UT9 C;  4UUZ B;  1M18 C;  4R8P A;  3EPK A;  4QLC D;  4HGA C;  3REI D;  3AV2 A;  3WA9 D;  1EQZ D;  3AFA A;  2PYO D;  3WTP D;  1P3A C;  3KWQ D;  3AZG D;  5CPI A;  4WU8 A;  3R45 B;  3C1B B;  3LEL B;  1AOI C;  3KSY A;  5B40 C;  1KX3 D;  2NQB B;  3AN2 B;  2Y2L A;  3X1T A;  4M6B A;  4NE3 A;  3LJA B;  3TU4 B;  3W98 A;  4UPK A;  4LD9 A;  4KUD B;  3MGQ B;  3KUY C;  3VH6 T;  2FJ7 A;  4WJ3 C;  3AZI B;  3UTB D;  4Z5T C;  1KX5 B;  3W96 D;  3AZL C;  1S32 D;  4G92 B;  3W97 A;  5JA4 B;  1P3M B;  4R8P D;  5GXQ C;  3AV2 D;  1P3O D;  1P3K C;  4XZQ A;  3AFA D;  2CV5 B;  4J8V C;  3AV1 A;  4WU9 C;  5CPI D;  2F8N G;  4WU8 D;  1P34 C;  3REK C;  4AWL B;  3WAA C;  5CP6 C;  1ID3 A;  3MGS B;  5CPJ B;  3X1T D;  1U35 A;  1T3U A;  3X1U A;  2G5I C;  4KGC C;  3W98 D;  5AY8 B;  4JJN A;  4LD9 D;  3WA9 B;  4Z66 D;  2FJ7 D;  2PYO B;  3AZG B;  5AV6 B;  4NE5 A;  4H9S C;  3WKJ C;  4DRA A;  3AZJ A;  3REH C;  3W97 D;  1M1A A;  1KX3 B;  1HQ3 C;  1KX4 B;  4H9N B;  1P3G C;  4UUZ A;  1BH8 A;  4XZQ D;  5GT0 B;  5JRG A;  3AV1 D;  3UT9 A;  5KDM A;  5DNM C;  1M18 A;  1N1J B;  3R45 A;  3REL C;  3C1B A;  2HIO C;  1P3A A;  3UTB B;  5B2I A;  3AZM C;  2NQB A;  3W96 B;  1P3F C;  1U35 D;  1S32 B;  1Z2C B;  1AOI A;  3VH6 A;  5CHL B;  4R8P B;  3VH5 A;  5G49 A;  3AV2 B;  3AFA B;  5CPI B;  2YFW A;  4WU8 B;  4YS3 C;  3MGP D;  2HUE B;  5AVB C;  4J8U C;  3AZJ D;  1BH9 A;  1M1A D;  3KUY A;  5AV8 A;  5B33 A;  1TZY C;  3X1T B;  4NFT A;  1B6W A;  5JRG D;  1F1E A;  4EO5 B;  4LD9 B;  3UT9 D;  3UTA C;  1WWI A;  2FJ7 B;  5GXQ A;  1P3K A;  3C1B D;  3MNN C;  1P3A D;  5B2I D;  3AZE C;  3MGS A;  2NQB D;  2ZY2 A;  5B24 B;  5C3I C;  3W97 B;  2BYM A;  1AOI D;  3REK A;  1P3L B;  5CP6 A;  2RVQ C;  2CWE A;  3MGR C;  5BS7 C;  4XZQ B;  5AY8 A;  3P5J B;  5B32 G;  3NQU A;  4KUD D;  3AV1 B;  3W99 C;  4YM6 A;  4ZBJ B;  4XUJ C;  3AZH C;  3AZI D;  4KGC A;  1B67 A;  2IO5 B;  1ID3 B;  5AV8 D;  5B33 D;  3X1V C;  3C1C C;  1P3M D;  4H9S A;  3WKJ A;  3X1U B;  2Y2Q A;  4JJN B;  2J8P A;  2CV5 D;  1HQ3 A;  5DNN A;  1P3G A;  5GXQ D;  1P3K D;  4X23 A;  2ARO C;  3MGS D;  3AZJ B;  5BNV A;  5DNM A;  1M1A B;  3REK D;  3REL A;  5CP6 D;  2HIO A;  2LY8 A;  3EPH A;  2NZD C;  1BH8 B;  3WTP E;  3AZM A;  3NQJ A;  3B0D C;  4H9P A;  5AY8 D;  3O62 C;  5JRG B;  1P3F A;  4ZUX C;  4YM6 D;  4G91 B;  3UT9 B;  4H9R B;  5KDM B;  1M18 B;  5AV6 D;  5B31 G;  4HGA B;  5B0Z C;  3B6G C;  4CSR A;  3EG5 B;  1ZLA C;  1P3A B;  5B2I B;  2DF4 C;  3X1S C;  5AVC C;  4YS3 A;  1KX4 D;  3WKJ D;  1AOI B;  5B40 B;  1M19 C;  5GT0 D;  5E5A C;  1HQ3 D;  5G49 B;  5DNN D;  2BYK A;  1P3G D;  1TZY A;  2F8N A;  3V9R A;  3B0B A;  2YFW B;  4H9Q B;  4X23 D;  2DQN C;  4DRB A;  2ZM5 A;  3VH5 T;  5DNM D;  1BH9 B;  3KUY B;  5B24 A;  5AV8 B;  3REL D;  5B33 B;  5B32 C;  4J8W C;  2HIO D;  4J8X A;  3AN2 C;  4Z5T B;  3AZM D;  1P3L A;  5GT3 C;  5B0Y C;  4WZS B;  3AZE A;  1F66 A;  3AYW C;  5AV5 C;  3EPJ A;  3MVD C;  2Y2P A;  5CPK C;  5GXQ B;  1P3K B;  3MGR A;  3AZN C;  5B1M C;  3A6N C;  2F2A C;  4WU9 B;  4YS3 D;  3AZH A;  1KX5 C;  2BYM B;  3REK B;  5CP6 B;  1P3B C;  3AZK C;  1P3P C;  3X1V A;  2F8N H;  3AZF C;  3NQU B;  2F8N D;  3KFU G;  4YM6 B;  4KGC B;  5B24 D;  4J8X D;  1P3L D;  5B1L C;  2ARO A;  3WKJ B;  3B0C T;  5B31 C;  3LZ0 A;  1F66 D;  5B2J A;  1HQ3 B;  2RVQ D;  5DNN B;  1P3G B;  4QLC C;  5GSU C;  4H9R A;  3REI C;  3MGR D;  4CAY B;  3WA9 C;  2NZD A;  1EQZ C;  3O62 A;  3WTP C;  4X23 B;  4ZUX A;  1TAF A;  3KWQ C;  3AZG C;  1ID3 D;  3LZ1 C;  5BNV B;  5DNM B;  5BNX A;  5B0Z A;  3REL B;  4Z2M G;  2HIO B;  5F99 C;  3X1U D;  1P3I C;  1ZLA A;  5B40 A;  3AZM B;  3X1V D;  3NQJ B;  4JJN D;  4H9P B;  3X1S A;  1P3F B;  4WNN A;  4H9Q A;  2G5H C;  5E5A A;  4CSR B;  4E45 A;  4YS3 B;  2ARO D;  5AVB B;  4J8U B;  3LZ0 D;  4Z5T A;  1S32 C;  1H3O A;  5B2J D;  3AZL A;  5B32 A;  4J8W A;  2BYK B;  3EPL A;  1TZY B;  1P3O C;  2F8N B;  3V9R B;  1M18 D;  2NZD D;  5GT3 A;  3O62 D;  3H0R C;  2Y2H A;  4ZUX D;  2W8S A;  5AV5 A;  5CPI C;  4WU8 C;  4J8V A;  3MVD A;  4WU9 A;  3MNN B;  4J8X B;  1P34 A;  3AZN A;  5B1M A;  3A6N A;  5B40 D;  3WAA A;  3AZE B;  1F66 B;  5C3I B;  3W98 C;  1P3B A;  4LD9 C;  1P3P A;  5E5A D;  2Y2I A;  3MGR B;  3AZF A;  4Z66 C;  3W99 B;  3KUY D;  3AZH B;  2BG1 A;  1HTA A;  2L5A A;  4Z5T D;  3W97 C;  5AV9 C;  3AZL D;  4WV4 B;  5B32 D;  3REH A;  3X1V B;  5B1L A;  4XZQ C;  5B31 A;  4CAY A;  5AV5 D;  4J8V D;  4WU9 D;  3MVD D;  4QLC A;  5GSU A;  3REI A;  1P34 D;  1WWS A;  5B1M D;  3A6N D;  3AZN D;  3WTP A;  3WAA D;  2ARO B;  3LZ0 B;  3LZ1 A;  1U35 C;  5B2J B;  1P3B D;  2FFF B;  3B6F C;  5F99 A;  1P3I A;  3KXB C;  1P3P D;  3REJ C;  4KGC D;  2NZD B;  3A1K A;  3O62 B;  1W2E A;  4ZUX B;  1TAF B;  3IP4 C;  3MGP C;  5BNX B;  5B0Z B;  3AZJ C;  1M1A C;  5AVB A;  4J8U A;  1ZLA B;  3REH D;  3X1S B;  4WNN B;  3A1I A;  5B31 D;  5JRG C;  5E5A B;  2Y2M A;  3VH6 W;  5GSU D;  1P3O A;  3UTA A;  3C1B C;  3VH5 W;  3LEL C;  1JFI A;  5B2I C;  3MNN A;  2NQB C;  5BT1 C;  3LZ1 D;  2F8N K;  3FDD A;  1H3O B;  3AZL B;  1P3F D;  5B32 B;  4J8W B;  5F99 D;  1P3I D;  3LJA C;  3TU4 C;  5FUG A;  5GT3 B;  5B0Y B;  4KHA A;  4KUD C;  3MGQ C;  5BS7 A;  3AYW B;  5AV5 B;  4J8V B;  3W99 A;  3AZI C;  3MVD B;  5CPK B;  4XUJ A;  1P34 B;  5AVB D;  4J8U D;  3AZN B;  5B1M B;  2RIQ A;  3H0L C;  5AV8 C;  4Z66 A;  3A6N B;  4G92 C;  5B33 C;  3WAA B;  1P3M C;  3C1C A;  1TZY D;  2JE5 A;  1P3B B;  2Y2K A;  3AZK B;  5AV9 A;  1P3P B;  2CV5 C;  3AZF B;  3UTA D;  4AWL C;  3MNN D;  3MGS C;  3AZE D;  5CPJ C;  1BFM A;  3REH B;  2YFV A;  3B0C W;  5B1L B;  5AY8 C;  5B31 B;  3AL0 C;  4YM6 C;  2PYO C;  4H9O B;  3W99 D;  5AV6 C;  3B6F A;  5GSU B;  4QLC B;  4XUJ D;  3KXB A;  3REI B;  2ZY3 A;  3REJ A;  3AZH D;  1EQZ B;  3WTP B;  4E44 A;  3H0M C;  3KWQ B;  3B6G A;  1KX3 C;  3LZ1 B;  3MGP A;  1KX4 C;  3C1C D;  3F6T A;  5AVC A;  5GT0 C;  5AV9 D;  5F99 B;  1P3I B;  4NE6 A;  1M19 A;  5DNN C;  1Q9C A;  2UWX A;  4Z2M H;  4X23 C;  3UTB C;  3W96 C;  2XD1 A;  2Y2J A;  5BO0 B;  3LEL A;  4R8P C;  1KU5 A;  3AN2 A;  3AV2 C;  5B0Y A;  3AFA C;  4DQY B;  3AYW A;  3B6F D;  3KXB D;  3LJA A;  3REJ D;  3UTA B;  3TU4 A;  1P3O B;  2HUE C;  5B0Z D;  5CPK A;  1JFI B;  3B6G D;  4KUD A;  3MGQ A;  1ZLA D;  1R4V A;  3AZI A;  3X1S D;  5AVC D;  3X1T C;  1KX5 A;  1ULY A;  5FUG B;  4EO5 C;  1M19 D;  2ZY4 A;  3AZK A;  4KHA B;  5JA4 A;  1P3M A;  2FJ7 C;  3W98 B;  4XUJ B;  2CV5 A;  4Z66 B;  5B24 C;  4J8X C;  3LEL D;  2JSS A;  4J8W D;  1P3L C;  3C1C B;  5BT1 D;  3AN2 D;  1A7W A;  1PZR A;  1F66 C;  5B0Y D;  5GT3 D;  2Y2O A;  2Y2N A;  5AV9 B;  5CPJ A;  2Y2G A;  3AYW D;  3AV1 C;  3LJA D;  4ZBJ C;  3TU4 D;  4H9O A;  2IO5 C; 
#chains in the Genus database with same CATH homology
 5CPK D;  3WA9 A;  3MGQ D;  1ID3 C;  1EQZ A;  2PYO A;  3KWQ A;  3AZG A;  5AV6 A;  2JCH A;  1KX5 D;  2YFV B;  3X1U C;  3AZK D;  4JJN C;  1KX3 A;  1U35 B;  3AZF D;  1KX4 A;  3B0D B;  4H9N A;  2VQR A;  3B6F B;  5GT0 A;  3KXB B;  3REJ B;  3B6G B;  2ZY5 A;  1N1J A;  3MGP B;  5BO0 A;  5AVC B;  3LZ0 C;  5B1L D;  3UTB A;  5CPJ D;  3W96 A;  5B2J C;  1M19 B;  1S32 A;  4G91 C;  2XD5 A;  3UT9 C;  4UUZ B;  1M18 C;  4R8P A;  3EPK A;  4QLC D;  4HGA C;  3REI D;  3AV2 A;  3WA9 D;  1EQZ D;  3AFA A;  2PYO D;  3WTP D;  1P3A C;  3KWQ D;  3AZG D;  5CPI A;  4WU8 A;  3R45 B;  3C1B B;  3LEL B;  1AOI C;  3KSY A;  5B40 C;  1KX3 D;  2NQB B;  3AN2 B;  2Y2L A;  3X1T A;  4M6B A;  4NE3 A;  3LJA B;  3TU4 B;  3W98 A;  4UPK A;  4LD9 A;  4KUD B;  3MGQ B;  3KUY C;  3VH6 T;  2FJ7 A;  4WJ3 C;  3AZI B;  3UTB D;  4Z5T C;  1KX5 B;  3W96 D;  3AZL C;  1S32 D;  4G92 B;  3W97 A;  5JA4 B;  1P3M B;  4R8P D;  5GXQ C;  3AV2 D;  1P3O D;  1P3K C;  4XZQ A;  3AFA D;  2CV5 B;  4J8V C;  3AV1 A;  4WU9 C;  5CPI D;  2F8N G;  4WU8 D;  1P34 C;  3REK C;  4AWL B;  3WAA C;  5CP6 C;  1ID3 A;  3MGS B;  5CPJ B;  3X1T D;  1U35 A;  1T3U A;  3X1U A;  2G5I C;  4KGC C;  3W98 D;  5AY8 B;  4JJN A;  4LD9 D;  3WA9 B;  4Z66 D;  2FJ7 D;  2PYO B;  3AZG B;  5AV6 B;  4NE5 A;  4H9S C;  3WKJ C;  4DRA A;  3AZJ A;  3REH C;  3W97 D;  1M1A A;  1KX3 B;  1HQ3 C;  1KX4 B;  4H9N B;  1P3G C;  4UUZ A;  1BH8 A;  4XZQ D;  5GT0 B;  5JRG A;  3AV1 D;  3UT9 A;  5KDM A;  5DNM C;  1M18 A;  1N1J B;  3R45 A;  3REL C;  3C1B A;  2HIO C;  1P3A A;  3UTB B;  5B2I A;  3AZM C;  2NQB A;  3W96 B;  1P3F C;  1U35 D;  1S32 B;  1Z2C B;  1AOI A;  3VH6 A;  5CHL B;  4R8P B;  3VH5 A;  5G49 A;  3AV2 B;  3AFA B;  5CPI B;  2YFW A;  4WU8 B;  4YS3 C;  3MGP D;  2HUE B;  5AVB C;  4J8U C;  3AZJ D;  1BH9 A;  1M1A D;  3KUY A;  5AV8 A;  5B33 A;  1TZY C;  3X1T B;  4NFT A;  1B6W A;  5JRG D;  1F1E A;  4EO5 B;  4LD9 B;  3UT9 D;  3UTA C;  1WWI A;  2FJ7 B;  5GXQ A;  1P3K A;  3C1B D;  3MNN C;  1P3A D;  5B2I D;  3AZE C;  3MGS A;  2NQB D;  2ZY2 A;  5B24 B;  5C3I C;  3W97 B;  2BYM A;  1AOI D;  3REK A;  1P3L B;  5CP6 A;  2RVQ C;  2CWE A;  3MGR C;  5BS7 C;  4XZQ B;  5AY8 A;  3P5J B;  5B32 G;  3NQU A;  4KUD D;  3AV1 B;  3W99 C;  4YM6 A;  4ZBJ B;  4XUJ C;  3AZH C;  3AZI D;  4KGC A;  1B67 A;  2IO5 B;  1ID3 B;  5AV8 D;  5B33 D;  3X1V C;  3C1C C;  1P3M D;  4H9S A;  3WKJ A;  3X1U B;  2Y2Q A;  4JJN B;  2J8P A;  2CV5 D;  1HQ3 A;  5DNN A;  1P3G A;  5GXQ D;  1P3K D;  4X23 A;  2ARO C;  3MGS D;  3AZJ B;  5BNV A;  5DNM A;  1M1A B;  3REK D;  3REL A;  5CP6 D;  2HIO A;  2LY8 A;  3EPH A;  2NZD C;  1BH8 B;  3WTP E;  3AZM A;  3NQJ A;  3B0D C;  4H9P A;  5AY8 D;  3O62 C;  5JRG B;  1P3F A;  4ZUX C;  4YM6 D;  4G91 B;  3UT9 B;  4H9R B;  5KDM B;  1M18 B;  5AV6 D;  5B31 G;  4HGA B;  5B0Z C;  3B6G C;  4CSR A;  3EG5 B;  1ZLA C;  1P3A B;  5B2I B;  2DF4 C;  3X1S C;  5AVC C;  4YS3 A;  1KX4 D;  3WKJ D;  1AOI B;  5B40 B;  1M19 C;  5GT0 D;  5E5A C;  1HQ3 D;  5G49 B;  5DNN D;  2BYK A;  1P3G D;  1TZY A;  2F8N A;  3V9R A;  3B0B A;  2YFW B;  4H9Q B;  4X23 D;  2DQN C;  4DRB A;  2ZM5 A;  3VH5 T;  5DNM D;  1BH9 B;  3KUY B;  5B24 A;  5AV8 B;  3REL D;  5B33 B;  5B32 C;  4J8W C;  2HIO D;  4J8X A;  3AN2 C;  4Z5T B;  3AZM D;  1P3L A;  5GT3 C;  5B0Y C;  4WZS B;  3AZE A;  1F66 A;  3AYW C;  5AV5 C;  3EPJ A;  3MVD C;  2Y2P A;  5CPK C;  5GXQ B;  1P3K B;  3MGR A;  3AZN C;  5B1M C;  3A6N C;  2F2A C;  4WU9 B;  4YS3 D;  3AZH A;  1KX5 C;  2BYM B;  3REK B;  5CP6 B;  1P3B C;  3AZK C;  1P3P C;  3X1V A;  2F8N H;  3AZF C;  3NQU B;  2F8N D;  3KFU G;  4YM6 B;  4KGC B;  5B24 D;  4J8X D;  1P3L D;  5B1L C;  2ARO A;  3WKJ B;  3B0C T;  5B31 C;  3LZ0 A;  1F66 D;  5B2J A;  1HQ3 B;  2RVQ D;  5DNN B;  1P3G B;  4QLC C;  5GSU C;  4H9R A;  3REI C;  3MGR D;  4CAY B;  3WA9 C;  2NZD A;  1EQZ C;  3O62 A;  3WTP C;  4X23 B;  4ZUX A;  1TAF A;  3KWQ C;  3AZG C;  1ID3 D;  3LZ1 C;  5BNV B;  5DNM B;  5BNX A;  5B0Z A;  3REL B;  4Z2M G;  2HIO B;  5F99 C;  3X1U D;  1P3I C;  1ZLA A;  5B40 A;  3AZM B;  3X1V D;  3NQJ B;  4JJN D;  4H9P B;  3X1S A;  1P3F B;  4WNN A;  4H9Q A;  2G5H C;  5E5A A;  4CSR B;  4E45 A;  4YS3 B;  2ARO D;  5AVB B;  4J8U B;  3LZ0 D;  4Z5T A;  1S32 C;  1H3O A;  5B2J D;  3AZL A;  5B32 A;  4J8W A;  2BYK B;  3EPL A;  1TZY B;  1P3O C;  2F8N B;  3V9R B;  1M18 D;  2NZD D;  5GT3 A;  3O62 D;  3H0R C;  2Y2H A;  4ZUX D;  2W8S A;  5AV5 A;  5CPI C;  4WU8 C;  4J8V A;  3MVD A;  4WU9 A;  3MNN B;  4J8X B;  1P34 A;  3AZN A;  5B1M A;  3A6N A;  5B40 D;  3WAA A;  3AZE B;  1F66 B;  5C3I B;  3W98 C;  1P3B A;  4LD9 C;  1P3P A;  5E5A D;  2Y2I A;  3MGR B;  3AZF A;  4Z66 C;  3W99 B;  3KUY D;  3AZH B;  2BG1 A;  1HTA A;  2L5A A;  4Z5T D;  3W97 C;  5AV9 C;  3AZL D;  4WV4 B;  5B32 D;  3REH A;  3X1V B;  5B1L A;  4XZQ C;  5B31 A;  4CAY A;  5AV5 D;  4J8V D;  4WU9 D;  3MVD D;  4QLC A;  5GSU A;  3REI A;  1P34 D;  1WWS A;  5B1M D;  3A6N D;  3AZN D;  3WTP A;  3WAA D;  2ARO B;  3LZ0 B;  3LZ1 A;  1U35 C;  5B2J B;  1P3B D;  2FFF B;  3B6F C;  5F99 A;  1P3I A;  3KXB C;  1P3P D;  3REJ C;  4KGC D;  2NZD B;  3A1K A;  3O62 B;  1W2E A;  4ZUX B;  1TAF B;  3IP4 C;  3MGP C;  5BNX B;  5B0Z B;  3AZJ C;  1M1A C;  5AVB A;  4J8U A;  1ZLA B;  3REH D;  3X1S B;  4WNN B;  3A1I A;  5B31 D;  5JRG C;  5E5A B;  2Y2M A;  3VH6 W;  5GSU D;  1P3O A;  3UTA A;  3C1B C;  3VH5 W;  3LEL C;  1JFI A;  5B2I C;  3MNN A;  2NQB C;  5BT1 C;  3LZ1 D;  2F8N K;  3FDD A;  1H3O B;  3AZL B;  1P3F D;  5B32 B;  4J8W B;  5F99 D;  1P3I D;  3LJA C;  3TU4 C;  5FUG A;  5GT3 B;  5B0Y B;  4KHA A;  4KUD C;  3MGQ C;  5BS7 A;  3AYW B;  5AV5 B;  4J8V B;  3W99 A;  3AZI C;  3MVD B;  5CPK B;  4XUJ A;  1P34 B;  5AVB D;  4J8U D;  3AZN B;  5B1M B;  2RIQ A;  3H0L C;  5AV8 C;  4Z66 A;  3A6N B;  4G92 C;  5B33 C;  3WAA B;  1P3M C;  3C1C A;  1TZY D;  2JE5 A;  1P3B B;  2Y2K A;  3AZK B;  5AV9 A;  1P3P B;  2CV5 C;  3AZF B;  3UTA D;  4AWL C;  3MNN D;  3MGS C;  3AZE D;  5CPJ C;  1BFM A;  3REH B;  2YFV A;  3B0C W;  5B1L B;  5AY8 C;  5B31 B;  3AL0 C;  4YM6 C;  2PYO C;  4H9O B;  3W99 D;  5AV6 C;  3B6F A;  5GSU B;  4QLC B;  4XUJ D;  3KXB A;  3REI B;  2ZY3 A;  3REJ A;  3AZH D;  1EQZ B;  3WTP B;  4E44 A;  3H0M C;  3KWQ B;  3B6G A;  1KX3 C;  3LZ1 B;  3MGP A;  1KX4 C;  3C1C D;  3F6T A;  5AVC A;  5GT0 C;  5AV9 D;  5F99 B;  1P3I B;  4NE6 A;  1M19 A;  5DNN C;  1Q9C A;  2UWX A;  4Z2M H;  4X23 C;  3UTB C;  3W96 C;  2XD1 A;  2Y2J A;  5BO0 B;  3LEL A;  4R8P C;  1KU5 A;  3AN2 A;  3AV2 C;  5B0Y A;  3AFA C;  4DQY B;  3AYW A;  3B6F D;  3KXB D;  3LJA A;  3REJ D;  3UTA B;  3TU4 A;  1P3O B;  2HUE C;  5B0Z D;  5CPK A;  1JFI B;  3B6G D;  4KUD A;  3MGQ A;  1ZLA D;  1R4V A;  3AZI A;  3X1S D;  5AVC D;  3X1T C;  1KX5 A;  1ULY A;  5FUG B;  4EO5 C;  1M19 D;  2ZY4 A;  3AZK A;  4KHA B;  5JA4 A;  1P3M A;  2FJ7 C;  3W98 B;  4XUJ B;  2CV5 A;  4Z66 B;  5B24 C;  4J8X C;  3LEL D;  2JSS A;  4J8W D;  1P3L C;  3C1C B;  5BT1 D;  3AN2 D;  1A7W A;  1PZR A;  1F66 C;  5B0Y D;  5GT3 D;  2Y2O A;  2Y2N A;  5AV9 B;  5CPJ A;  2Y2G A;  3AYW D;  3AV1 C;  3LJA D;  4ZBJ C;  3TU4 D;  4H9O A;  2IO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...