2PYOC

Drosophila nucleosome core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoC00
3X1VD 4J8UD 5E5AB 5B31A 4YM6B 5B40C 2F8ND 5B1MD 1P34C 4WU8B 5BS7C 3WTPB 1P3FB 5JA4A 3MVDD 3KUYA 4ZUXC 4Z66B 3MGQA 5CPKB 1M19D 3AZFD 3X1SD 3KXBA 3B6FA 1M18B 4X23A 1P3LB 5B0ZC 3AYWB 2FJ7B 5C3IC 5BT1C 2CV5A 3UT9A 3MGRA 2BYMB 2YFVB 3REIC 3AZNA 1P3MD 4HGAC 5AY8C 3MGSA 1AOID 3REKC 1HQ3A 4UUZB 4H9OA 1P3IA 4ZBJB 3AV2C 3LZ1A 1U35B 3WKJC 4J8WA 3LZ0C 5F99C 2CWEA 2PYOA 5E5AA 3AV1B 3MNND 3AZHC 3AZKA 1P3FA 4QLCA 3X1TB 4KGCD 5B31D 5AV9C 5DNMC 1M18A 1JFIB 3AZED 1EQZA 3KUYD 3MGPD 3LELC 4J8UB 3WTPE 4XZQA 3KXBD 3AYWA 5GSUC 4JJNA 3W96B 4YM6C 1P3KA 1TAFB 3MVDB 4WU8C 3WA9D 3AZMB 1M19B 3UTAA 3X1SB 4WU9A 4UUZA 1KX4D 3MGSD 3KWQA 5B33B 1HQ3D 1P3OB 5B32C 5CHLB 5DNND 1P3AC 4J8WD 1F66D 3X1TA 2PYOD 1P3PC 3WAAB 4QLCD 3X1VA 1KX3A 4J8UA 3AZLB 5AV8D 4J8VA 1U35C 3W99C 5AVBD 2F8NA 5B1MA 1EQZD 5AV5A 5GT3D 3O62A 1M1AD 5B24D 4NE3A 4YS3D 4XZQD 1B67A 3MVDA 5B31B 4JJND 3REJD 3AZFA 5B2ID 5JRGA 1P3KD 4G91C 3AFAD 1N1JA 3MGPB 3MGQB 3KUYB 3UTAD 2RVQD 3KXBB 4WU9D 3A6NC 1R4VA 1P3GD 1P3MA 2AROA 1AOIA 3LJAC 3W96C 3WA9B 2CV5B 3MGRB 3AZMC 1KX4B 1KX5A 3AZNB 3W97D 3MGSB 3X1SC 4R8PC 4Z5TD 2L5AA 2BYKB 3X1UD 1HQ3B 5B1LC 1S32A 2HIOC 5B33C 4H9OB 1P3BA 4WNNA 1P3OC 3B0DC 3MNNA 1KX3D 4J8WB 3B6GC 1F66B 5FUGA 4KGCA 1ID3D 4J8VD 2PYOB 4KUDD 5GT0A 5AV6D 5B0YC 5AV5D 3AZKB 3O62D 5BS7A 3AZEA 4J8XC 4QLCB 1TZYD 3MGPA 3WAAC 4ZUXA 2NZDC 5AV8B 5AVCC 3AZLC 5JRGD 1EQZB 1M1AB 3UTBC 4CAYA 4H9NA 5GXQC 4XZQB 1BH8A 3WA9A 4JJNB 3NQJB 3REJB 3TU4D 4EO5B 1KX4A 5B31C 1P3KB 2AROD 3REIA 5AY8A 5CPJD 2BYKA 3REKA 3UTAB 3AZIC 4H9PA 4WU9B 3KUYC 3MGQC 1KX5D 3KWQB 3NQUA 1P3GB 5DNNA 3AN2C 2YFWA 3B6FC 4M6BA 4X23C 4LD9C 1ZLAC 3C1CD 5CPIC 1S32D 1F66A 3LZ0A 4KHAA 1P3BD 5F99A 5CP6C 2IO5B 2NQBC 2CV5C 4Z5TB 3UT9C 3MGRC 3X1UB 3AZNC 5GT0D 3AZGC 2JSSA 5B40D 5AV8A 4XUJC 1P34D 5AVBA 5GT3A 1M1AA 3X1VB 5B24A 1KX3B 1P3IC 4ZUXD 3C1BA 4YS3A 3LZ1C 1ID3B 4J8VB 4KUDB 5BO0B 3NQJA 5AV6B 5B2IA 3REJA 5B1MB 2F8NB 2HUEB 5AV5B 3O62B 2PYOC 5E5AC 3AFAA 1F1EA 3AZKC 5B0ZD 3VH6T 3WTPC 3AZFB 1P3FC 5BT1D 4Z66C 5CPKC 5JRGB 3REID 1N1JB 5AY8D 1P3GA 4Z2MG 1M18C 3REKD 1EQZC 1P3LC 5B31G 3TU4B 4XZQC 3AYWC 3W97A 3AV2D 2AROB 1P3MB 1P3AA 1AOIB 2FJ7C 3WKJD 4Z5TA 3X1UA 3LZ0D 3KSYA 5F99D 1P3PA 3V9RA 1KX5B 3AZHD 3AZJA 4H9SA 3KWQC 4ZBJC 1S32B 4DRBA 1ID3A 1P3BB 4KUDA 5BO0A 4WNNB 1Q9CA 5DNMD 5AV6A 3W99A 3MNNB 3C1BD 3LELD 3AV1C 5FUGB 4KGCB 1TZYA 5KDMA 5GT0B 5GSUD 1BFMA 5B40B 3X1TC 1P34B 3AZEB 4YM6D 4ZUXB 3A6NA 3X1VC 1KX3C 4J8UC 3TU4A 3REHA 3RELA 3W98A 4CAYB 5B2JA 4H9NB 5B1MC 1BH8B 2HUEC 5AV5C 1HTAA 5B0ZB 3LJAA 5CPJA 5B32D 1BH9A 3MVDC 1M19C 3AZFC 3REIB 1P3AD 5AY8B 4R8PA 3REKB 4H9PB 1P3PD 3C1CA 5B1LA 3NQUB 3AZJD 5DNNB 2LY8A 2YFWB 3VH5A 3AV2B 3WKJB 3B0BA 3LZ0B 4KHAB 2AROC 5F99B 1P3MC 1AOIC 1U35D 1KU5A 3W99D 5B40A 1P34A 3AZHB 1KX5C 4J8XA 4AWLB 2NZDA 5AVCA 5AVBB 1A7WA 1S32C 5GT3B 5B24B 3VH5W 3C1BB 4YS3B 3UTBA 3MNNC 5GXQA 5B0ZA 3A6ND 3VH5T 5GSUB 5B2IB 3REHD 3RELD 3W98D 4KGCC 5B2JD 5GT0C 3AFAB 5BNVB 4H9QA 3LJAD 3W96D 3AZEC 3AZIA 3MGPC 3AZMD 2F8NG 3KXBC 4R8PD 3AN2A 3AV2A 4LD9A 3WKJA 1ZLAA 5BNXA 5B1LD 5B32B 5CPIA 2HIOD 5B33D 4NE6A 3VH6A 4E45A 5CP6A 3WA9C 1P3OD 3W97B 1P3AB 4CSRA 3AZHA 4NE5A 2NQBA 3B6GD 5G49A 1KX4C 3B0CW 3MGSC 1P3PB 3V9RB 3AZGA 5B0YD 3B0CT 1HQ3C 5AV9A 4XUJA 5DNMA 3AZJB 4G92B 4J8XD 1H3OB 4Z2MH 3LELA 3WAAD 5DNNC 2NZDD 5AVCD 4WV4B 4J8WC 5GSUA 3W99B 3AZLD 1F66C 3VH6W 3UTBD 4YM6A 5BNVA 1TZYB 5GXQD 1ULYA 5KDMB 4WU8A 3WTPA 4QLCC 4AWLC 4Z66A 5CPKA 4G91B 5AV8C 5AVBC 5GT3C 4WZSB 3A6NB 3AZID 5B24C 1P3LA 1M1AC 5B32A 3MGQD 4YS3C 3C1BC 3REHB 3RELB 3W98B 3B6FD 3AN2D 5B2JB 4JJNC 3REJC 4X23D 5B2IC 2FJ7A 4EO5C 4LD9D 1ZLAD 3LJAB 5CPJB 5CPID 2BYMA 1BH9B 2YFVA 1P3KC 3AFAC 5CP6D 3UTAC 2RVQC 4WU9C 2NQBD 2CV5D 4R8PB 3UT9D 3MGRD 1H3OA 3AZND 3C1CB 1P3GC 5B1LB 3AZGD 2HIOB 5AV9D 4XUJD 1U35A 3B0DB 4DRAA 1P3ID 3B6GB 2IO5C 3W97C 3AV1A 3LZ1D 4Z5TC 1WWIA 3X1UC 5B0YB 1B6WA 5E5AD 4J8XB 4WU8D 3AZKD 3AZJC 4G92C 3WTPD 1JFIA 2NZDB 1P3FD 4H9SC 5AVCB 3R45B 4Z66D 5CPKD 1ID3C 4J8VC 4KUDC 1M18D 4H9RB 3UTBB 5AV6C 5GXQB 3O62C 1P3LD 3W96A 4E44A 5C3IB 1TAFA 1TZYC 3AYWD 2F8NK 3AZMA 1M19A 2FJ7D 4HGAB 4H9QB 3X1SA 5JRGC 5JA4B 3AZIB 4NFTA 2HIOA 5B33A 3B6FB 3AN2B 1P3OA 3TU4C 4X23B 3REHC 4LD9B 3RELC 3W98C 1ZLAB 5BNXB 3KWQD 3B6GA 5CPIB 5B2JC 1WWSA 5CP6B 5CPJC 5B0YA 4CSRB 2NQBB 3UT9B 5G49B 3AV1D 3WAAA 3AZGB 5B32G 5AV9B 3X1TD 4XUJB 3R45A 5DNMB 3C1CC 3AZLA 2F8NH 1P3BC 3LELB 4H9RA 1P3IB 3LZ1B
chains in the Genus database with same CATH superfamily
3X1VD 4J8UD 5E5AB 5B31A 4YM6B 5B40C 2F8ND 5B1MD 1P34C 4WU8B 5BS7C 3WTPB 1P3FB 5JA4A 3MVDD 3KUYA 4ZUXC 4Z66B 3MGQA 5CPKB 1M19D 3AZFD 3X1SD 3KXBA 3B6FA 1M18B 4X23A 2ZY3A 1P3LB 5B0ZC 3AYWB 2FJ7B 5C3IC 5BT1C 2CV5A 3UT9A 3MGRA 2BYMB 2YFVB 3REIC 3AZNA 1P3MD 4HGAC 5AY8C 3MGSA 1AOID 3REKC 1HQ3A 4UUZB 4H9OA 2G5IC 1P3IA 4ZBJB 3AV2C 3LZ1A 1U35B 3WKJC 4J8WA 2XD5A 3LZ0C 5F99C 2CWEA 2PYOA 5E5AA 3AV1B 3MNND 3AZHC 3AZKA 1P3FA 4QLCA 3X1TB 4KGCD 5B31D 5AV9C 3EPJA 5DNMC 1M18A 1JFIB 3AZED 1EQZA 3KUYD 3MGPD 3LELC 4J8UB 3WTPE 4XZQA 3KXBD 3AYWA 5GSUC 4JJNA 2FFFB 3W96B 4YM6C 1P3KA 1TAFB 3MVDB 4WU8C 3WA9D 3AZMB 1M19B 3UTAA 3X1SB 4WU9A 4UUZA 1KX4D 3MGSD 3KWQA 5B33B 1HQ3D 1P3OB 5B32C 2Y2PA 5CHLB 5DNND 2BG1A 1P3AC 4J8WD 4UPKA 1T3UA 1F66D 3X1TA 2ZY4A 2PYOD 1P3PC 3WAAB 2Y2GA 4QLCD 3X1VA 1KX3A 4J8UA 3AZLB 5AV8D 4J8VA 1U35C 3W99C 5AVBD 2F8NA 5B1MA 1EQZD 5AV5A 5GT3D 3O62A 1M1AD 5B24D 2ZY2A 4NE3A 4YS3D 4XZQD 1B67A 3MVDA 5B31B 4JJND 3REJD 3AZFA 5B2ID 5JRGA 1P3KD 4G91C 3AFAD 1N1JA 3MGPB 3MGQB 3KUYB 3UTAD 2RVQD 3KXBB 4WU9D 3A6NC 1R4VA 2DF4C 1P3GD 1P3MA 2AROA 1AOIA 3LJAC 3W96C 3WA9B 3H0RC 2CV5B 3MGRB 2Y2HA 3AZMC 1KX4B 1KX5A 3AZNB 3W97D 3MGSB 3X1SC 4R8PC 2Y2OA 4Z5TD 2L5AA 2BYKB 3X1UD 1HQ3B 5B1LC 1S32A 2HIOC 5B33C 4H9OB 1P3BA 4WNNA 1P3OC 3EPHA 3B0DC 3MNNA 1KX3D 4J8WB 3B6GC 1F66B 5FUGA 4KGCA 3F6TA 4J8VD 1ID3D 2PYOB 4KUDD 5GT0A 5AV6D 5B0YC 5AV5D 3AZKB 3O62D 5BS7A 3AZEA 4J8XC 4QLCB 1TZYD 3MGPA 3WAAC 4ZUXA 2ZY5A 2NZDC 5AV8B 5AVCC 3AZLC 5JRGD 1EQZB 1M1AB 3UTBC 4CAYA 4H9NA 5GXQC 4XZQB 1BH8A 3WA9A 4JJNB 3NQJB 3REJB 3TU4D 4EO5B 1KX4A 5B31C 1P3KB 2AROD 3REIA 5AY8A 5CPJD 2BYKA 3REKA 3UTAB 3AZIC 4H9PA 4WU9B 3KUYC 3MGQC 1KX5D 3KWQB 2JE5A 3NQUA 1P3GB 5DNNA 3AN2C 2YFWA 3B6FC 4M6BA 4X23C 4LD9C 1ZLAC 4DQYB 3C1CD 5CPIC 1S32D 1F66A 3LZ0A 4KHAA 1P3BD 5F99A 5CP6C 2IO5B 2NQBC 2CV5C 4Z5TB 3UT9C 3MGRC 3X1UB 3AZNC 5GT0D 3AZGC 2JSSA 5B40D 5AV8A 4XUJC 1P34D 5AVBA 5GT3A 1M1AA 3X1VB 5B24A 1KX3B 1P3IC 4ZUXD 3C1BA 4YS3A 3LZ1C 1ID3B 4J8VB 2JCHA 4KUDB 5BO0B 3NQJA 5AV6B 5B2IA 3REJA 5B1MB 2F8NB 2HUEB 5AV5B 3O62B 3KFUG 2PYOC 5E5AC 2Y2NA 3AFAA 1F1EA 3AZKC 5B0ZD 3VH6T 3WTPC 3AZFB 1P3FC 5BT1D 4Z66C 5CPKC 5JRGB 3REID 1N1JB 2RIQA 5AY8D 4Z2MG 1P3GA 1M18C 3REKD 1EQZC 1P3LC 5B31G 3TU4B 4XZQC 3AYWC 3W97A 3AV2D 2AROB 1P3MB 1P3AA 1AOIB 2FJ7C 3WKJD 4Z5TA 3X1UA 3LZ0D 3KSYA 5F99D 1P3PA 3V9RA 1KX5B 3AZHD 3AZJA 4H9SA 3KWQC 4ZBJC 1S32B 4DRBA 1ID3A 1P3BB 4KUDA 5BO0A 4WNNB 1Q9CA 5DNMD 5AV6A 3W99A 3MNNB 3C1BD 3LELD 3AV1C 5FUGB 4KGCB 1TZYA 2Y2QA 5KDMA 5GT0B 5GSUD 1BFMA 5B40B 3X1TC 1P34B 3AZEB 4YM6D 4ZUXB 3EPLA 3H0MC 3X1VC 3A6NA 4J8UC 3TU4A 1KX3C 3REHA 3RELA 3W98A 4CAYB 5B2JA 4H9NB 5B1MC 1BH8B 2HUEC 5AV5C 1HTAA 5B0ZB 3LJAA 5CPJA 5B32D 1BH9A 3MVDC 1M19C 3AZFC 2F2AC 3REIB 1P3AD 5AY8B 4R8PA 3REKB 4H9PB 1P3PD 3C1CA 5B1LA 2Y2MA 3NQUB 3AZJD 5DNNB 2LY8A 2YFWB 3VH5A 3AV2B 3WKJB 3B0BA 2DQNC 3LZ0B 4KHAB 2AROC 5F99B 1P3MC 1AOIC 1U35D 1KU5A 3W99D 5B40A 1P34A 3AZHB 3IP4C 1KX5C 4J8XA 4AWLB 2NZDA 5AVCA 5AVBB 1PZRA 1A7WA 3P5JB 1S32C 5GT3B 2ZM5A 5B24B 3VH5W 3C1BB 4YS3B 3UTBA 3MNNC 5GXQA 5B0ZA 3A6ND 3VH5T 5GSUB 5B2IB 3REHD 1W2EA 3RELD 3W98D 4KGCC 5B2JD 5GT0C 3AFAB 5BNVB 3EPKA 4H9QA 3LJAD 3W96D 3AZEC 3AZIA 3MGPC 3AZMD 2F8NG 3KXBC 3A1KA 4R8PD 3AN2A 3AV2A 4LD9A 3WKJA 2Y2KA 5BNXA 1ZLAA 5B1LD 5B32B 5CPIA 2HIOD 2UWXA 5B33D 4NE6A 3VH6A 2XD1A 5CP6A 4E45A 3WA9C 1P3OD 3W97B 1P3AB 4CSRA 3AZHA 3A1IA 4NE5A 2NQBA 3B6GD 1Z2CB 5G49A 1KX4C 3B0CW 3MGSC 1P3PB 3V9RB 3AZGA 5B0YD 3B0CT 1HQ3C 2Y2IA 4XUJA 5DNMA 5AV9A 3AZJB 4G92B 4J8XD 1H3OB 4Z2MH 3LELA 3WAAD 5DNNC 2NZDD 5AVCD 4WV4B 4J8WC 5GSUA 3W99B 3AZLD 1F66C 3VH6W 3UTBD 4YM6A 5BNVA 1TZYB 5GXQD 1ULYA 5KDMB 4WU8A 3WTPA 4QLCC 4AWLC 4Z66A 5CPKA 4G91B 5AV8C 2VQRA 2Y2LA 4WJ3C 3AL0C 5AVBC 5GT3C 4WZSB 3A6NB 3AZID 5B24C 2Y2JA 1P3LA 1M1AC 5B32A 3MGQD 4YS3C 3C1BC 3REHB 3RELB 3W98B 3B6FD 3AN2D 5B2JB 4JJNC 3REJC 4X23D 5B2IC 2FJ7A 4EO5C 4LD9D 1ZLAD 3LJAB 5CPJB 3EG5B 5CPID 2BYMA 1BH9B 2YFVA 1P3KC 3AFAC 5CP6D 3UTAC 2RVQC 4WU9C 2G5HC 2CV5D 2NQBD 4R8PB 3UT9D 3MGRD 1H3OA 3AZND 3C1CB 1P3GC 5B1LB 3AZGD 2HIOB 5AV9D 4XUJD 1U35A 2J8PA 3B0DB 4DRAA 1P3ID 3B6GB 2IO5C 3W97C 3AV1A 3LZ1D 4Z5TC 1WWIA 3X1UC 5B0YB 1B6WA 5E5AD 4J8XB 4WU8D 3AZKD 3AZJC 4G92C 3WTPD 1JFIA 2NZDB 1P3FD 4H9SC 5AVCB 3R45B 4Z66D 5CPKD 1ID3C 4J8VC 4KUDC 1M18D 4H9RB 3UTBB 5AV6C 5GXQB 3O62C 1P3LD 3W96A 4E44A 5C3IB 1TAFA 1TZYC 3AYWD 2F8NK 3AZMA 1M19A 2FJ7D 4HGAB 4H9QB 3X1SA 5JRGC 5JA4B 3AZIB 4NFTA 2HIOA 5B33A 3B6FB 3AN2B 1P3OA 3TU4C 4X23B 3REHC 4LD9B 3RELC 3W98C 1ZLAB 5BNXB 3KWQD 3B6GA 5CPIB 5B2JC 1WWSA 5CP6B 5CPJC 5B0YA 4CSRB 2W8SA 2NQBB 3FDDA 3UT9B 5G49B 3AV1D 3WAAA 3AZGB 5B32G 5AV9B 3H0LC 4XUJB 3R45A 3X1TD 5DNMB 3C1CC 3AZLA 2F8NH 1P3BC 3LELB 4H9RA 1P3IB 3LZ1B
chains in the Genus database with same CATH topology
3X1VD 4J8UD 5E5AB 5B31A 4YM6B 5B40C 2F8ND 5B1MD 1P34C 4WU8B 5BS7C 3WTPB 1P3FB 5JA4A 3MVDD 3KUYA 4ZUXC 4Z66B 3MGQA 5CPKB 1M19D 3AZFD 3X1SD 3KXBA 3B6FA 1M18B 4X23A 2ZY3A 1P3LB 5B0ZC 3AYWB 2FJ7B 5C3IC 5BT1C 2CV5A 3UT9A 3MGRA 2BYMB 2YFVB 3REIC 3AZNA 1P3MD 4HGAC 5AY8C 3MGSA 1AOID 3REKC 1HQ3A 4UUZB 4H9OA 2G5IC 1P3IA 4ZBJB 3AV2C 3LZ1A 1U35B 3WKJC 4J8WA 2XD5A 3LZ0C 5F99C 2CWEA 2PYOA 5E5AA 3AV1B 3MNND 3AZHC 3AZKA 1P3FA 4QLCA 3X1TB 4KGCD 5B31D 5AV9C 3EPJA 5DNMC 1M18A 1JFIB 3AZED 1EQZA 3KUYD 3MGPD 3LELC 4J8UB 3WTPE 4XZQA 3KXBD 3AYWA 5GSUC 4JJNA 2FFFB 3W96B 4YM6C 1P3KA 1TAFB 3MVDB 4WU8C 3WA9D 3AZMB 1M19B 3UTAA 3X1SB 4WU9A 4UUZA 1KX4D 3MGSD 3KWQA 5B33B 1HQ3D 1P3OB 5B32C 2Y2PA 5CHLB 5DNND 2BG1A 1P3AC 4J8WD 4UPKA 1T3UA 1F66D 3X1TA 2ZY4A 2PYOD 1P3PC 3WAAB 2Y2GA 4QLCD 3X1VA 1KX3A 4J8UA 3AZLB 5AV8D 4J8VA 1U35C 3W99C 5AVBD 2F8NA 5B1MA 1EQZD 5AV5A 5GT3D 3O62A 1M1AD 5B24D 2ZY2A 4NE3A 4YS3D 4XZQD 1B67A 3MVDA 5B31B 4JJND 3REJD 3AZFA 5B2ID 5JRGA 1P3KD 4G91C 3AFAD 1N1JA 3MGPB 3MGQB 3KUYB 3UTAD 2RVQD 3KXBB 4WU9D 3A6NC 1R4VA 2DF4C 1P3GD 1P3MA 2AROA 1AOIA 3LJAC 3W96C 3WA9B 3H0RC 2CV5B 3MGRB 2Y2HA 3AZMC 1KX4B 1KX5A 3AZNB 3W97D 3MGSB 3X1SC 4R8PC 2Y2OA 4Z5TD 2L5AA 2BYKB 3X1UD 1HQ3B 5B1LC 1S32A 2HIOC 5B33C 4H9OB 1P3BA 4WNNA 1P3OC 3EPHA 3B0DC 3MNNA 1KX3D 4J8WB 3B6GC 1F66B 5FUGA 4KGCA 3F6TA 4J8VD 1ID3D 2PYOB 4KUDD 5GT0A 5AV6D 5B0YC 5AV5D 3AZKB 3O62D 5BS7A 3AZEA 4J8XC 4QLCB 1TZYD 3MGPA 3WAAC 4ZUXA 2ZY5A 2NZDC 5AV8B 5AVCC 3AZLC 5JRGD 1EQZB 1M1AB 3UTBC 4CAYA 4H9NA 5GXQC 4XZQB 1BH8A 3WA9A 4JJNB 3NQJB 3REJB 3TU4D 4EO5B 1KX4A 5B31C 1P3KB 2AROD 3REIA 5AY8A 5CPJD 2BYKA 3REKA 3UTAB 3AZIC 4H9PA 4WU9B 3KUYC 3MGQC 1KX5D 3KWQB 2JE5A 3NQUA 1P3GB 5DNNA 3AN2C 2YFWA 3B6FC 4M6BA 4X23C 4LD9C 1ZLAC 4DQYB 3C1CD 5CPIC 1S32D 1F66A 3LZ0A 4KHAA 1P3BD 5F99A 5CP6C 2IO5B 2NQBC 2CV5C 4Z5TB 3UT9C 3MGRC 3X1UB 3AZNC 5GT0D 3AZGC 2JSSA 5B40D 5AV8A 4XUJC 1P34D 5AVBA 5GT3A 1M1AA 3X1VB 5B24A 1KX3B 1P3IC 4ZUXD 3C1BA 4YS3A 3LZ1C 1ID3B 4J8VB 2JCHA 4KUDB 5BO0B 3NQJA 5AV6B 5B2IA 3REJA 5B1MB 2F8NB 2HUEB 5AV5B 3O62B 3KFUG 2PYOC 5E5AC 2Y2NA 3AFAA 1F1EA 3AZKC 5B0ZD 3VH6T 3WTPC 3AZFB 1P3FC 5BT1D 4Z66C 5CPKC 5JRGB 3REID 1N1JB 2RIQA 5AY8D 4Z2MG 1P3GA 1M18C 3REKD 1EQZC 1P3LC 5B31G 3TU4B 4XZQC 3AYWC 3W97A 3AV2D 2AROB 1P3MB 1P3AA 1AOIB 2FJ7C 3WKJD 4Z5TA 3X1UA 3LZ0D 3KSYA 5F99D 1P3PA 3V9RA 1KX5B 3AZHD 3AZJA 4H9SA 3KWQC 4ZBJC 1S32B 4DRBA 1ID3A 1P3BB 4KUDA 5BO0A 4WNNB 1Q9CA 5DNMD 5AV6A 3W99A 3MNNB 3C1BD 3LELD 3AV1C 5FUGB 4KGCB 1TZYA 2Y2QA 5KDMA 5GT0B 5GSUD 1BFMA 5B40B 3X1TC 1P34B 3AZEB 4YM6D 4ZUXB 3EPLA 3H0MC 3X1VC 3A6NA 4J8UC 3TU4A 1KX3C 3REHA 3RELA 3W98A 4CAYB 5B2JA 4H9NB 5B1MC 1BH8B 2HUEC 5AV5C 1HTAA 5B0ZB 3LJAA 5CPJA 5B32D 1BH9A 3MVDC 1M19C 3AZFC 2F2AC 3REIB 1P3AD 5AY8B 4R8PA 3REKB 4H9PB 1P3PD 3C1CA 5B1LA 2Y2MA 3NQUB 3AZJD 5DNNB 2LY8A 2YFWB 3VH5A 3AV2B 3WKJB 3B0BA 2DQNC 3LZ0B 4KHAB 2AROC 5F99B 1P3MC 1AOIC 1U35D 1KU5A 3W99D 5B40A 1P34A 3AZHB 3IP4C 1KX5C 4J8XA 4AWLB 2NZDA 5AVCA 5AVBB 1PZRA 1A7WA 3P5JB 1S32C 5GT3B 2ZM5A 5B24B 3VH5W 3C1BB 4YS3B 3UTBA 3MNNC 5GXQA 5B0ZA 3A6ND 3VH5T 5GSUB 5B2IB 3REHD 1W2EA 3RELD 3W98D 4KGCC 5B2JD 5GT0C 3AFAB 5BNVB 3EPKA 4H9QA 3LJAD 3W96D 3AZEC 3AZIA 3MGPC 3AZMD 2F8NG 3KXBC 3A1KA 4R8PD 3AN2A 3AV2A 4LD9A 3WKJA 2Y2KA 5BNXA 1ZLAA 5B1LD 5B32B 5CPIA 2HIOD 2UWXA 5B33D 4NE6A 3VH6A 2XD1A 5CP6A 4E45A 3WA9C 1P3OD 3W97B 1P3AB 4CSRA 3AZHA 3A1IA 4NE5A 2NQBA 3B6GD 1Z2CB 5G49A 1KX4C 3B0CW 3MGSC 1P3PB 3V9RB 3AZGA 5B0YD 3B0CT 1HQ3C 2Y2IA 4XUJA 5DNMA 5AV9A 3AZJB 4G92B 4J8XD 1H3OB 4Z2MH 3LELA 3WAAD 5DNNC 2NZDD 5AVCD 4WV4B 4J8WC 5GSUA 3W99B 3AZLD 1F66C 3VH6W 3UTBD 4YM6A 5BNVA 1TZYB 5GXQD 1ULYA 5KDMB 4WU8A 3WTPA 4QLCC 4AWLC 4Z66A 5CPKA 4G91B 5AV8C 2VQRA 2Y2LA 4WJ3C 3AL0C 5AVBC 5GT3C 4WZSB 3A6NB 3AZID 5B24C 2Y2JA 1P3LA 1M1AC 5B32A 3MGQD 4YS3C 3C1BC 3REHB 3RELB 3W98B 3B6FD 3AN2D 5B2JB 4JJNC 3REJC 4X23D 5B2IC 2FJ7A 4EO5C 4LD9D 1ZLAD 3LJAB 5CPJB 3EG5B 5CPID 2BYMA 1BH9B 2YFVA 1P3KC 3AFAC 5CP6D 3UTAC 2RVQC 4WU9C 2G5HC 2CV5D 2NQBD 4R8PB 3UT9D 3MGRD 1H3OA 3AZND 3C1CB 1P3GC 5B1LB 3AZGD 2HIOB 5AV9D 4XUJD 1U35A 2J8PA 3B0DB 4DRAA 1P3ID 3B6GB 2IO5C 3W97C 3AV1A 3LZ1D 4Z5TC 1WWIA 3X1UC 5B0YB 1B6WA 5E5AD 4J8XB 4WU8D 3AZKD 3AZJC 4G92C 3WTPD 1JFIA 2NZDB 1P3FD 4H9SC 5AVCB 3R45B 4Z66D 5CPKD 1ID3C 4J8VC 4KUDC 1M18D 4H9RB 3UTBB 5AV6C 5GXQB 3O62C 1P3LD 3W96A 4E44A 5C3IB 1TAFA 1TZYC 3AYWD 2F8NK 3AZMA 1M19A 2FJ7D 4HGAB 4H9QB 3X1SA 5JRGC 5JA4B 3AZIB 4NFTA 2HIOA 5B33A 3B6FB 3AN2B 1P3OA 3TU4C 4X23B 3REHC 4LD9B 3RELC 3W98C 1ZLAB 5BNXB 3KWQD 3B6GA 5CPIB 5B2JC 1WWSA 5CP6B 5CPJC 5B0YA 4CSRB 2W8SA 2NQBB 3FDDA 3UT9B 5G49B 3AV1D 3WAAA 3AZGB 5B32G 5AV9B 3H0LC 4XUJB 3R45A 3X1TD 5DNMB 3C1CC 3AZLA 2F8NH 1P3BC 3LELB 4H9RA 1P3IB 3LZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V D;  4J8U D;  5E5A B;  5B31 A;  4YM6 B;  5B40 C;  2F8N D;  5B1M D;  1P34 C;  4WU8 B;  5BS7 C;  3WTP B;  1P3F B;  5JA4 A;  3MVD D;  3KUY A;  4ZUX C;  4Z66 B;  3MGQ A;  5CPK B;  1M19 D;  3AZF D;  3X1S D;  3KXB A;  3B6F A;  1M18 B;  4X23 A;  1P3L B;  5B0Z C;  3AYW B;  2FJ7 B;  5C3I C;  5BT1 C;  2CV5 A;  3UT9 A;  3MGR A;  2BYM B;  2YFV B;  3REI C;  3AZN A;  1P3M D;  4HGA C;  5AY8 C;  3MGS A;  1AOI D;  3REK C;  1HQ3 A;  4UUZ B;  4H9O A;  1P3I A;  4ZBJ B;  3AV2 C;  3LZ1 A;  1U35 B;  3WKJ C;  4J8W A;  3LZ0 C;  5F99 C;  2CWE A;  2PYO A;  5E5A A;  3AV1 B;  3MNN D;  3AZH C;  3AZK A;  1P3F A;  4QLC A;  3X1T B;  4KGC D;  5B31 D;  5AV9 C;  5DNM C;  1M18 A;  1JFI B;  3AZE D;  1EQZ A;  3KUY D;  3MGP D;  3LEL C;  4J8U B;  3WTP E;  4XZQ A;  3KXB D;  3AYW A;  5GSU C;  4JJN A;  3W96 B;  4YM6 C;  1P3K A;  1TAF B;  3MVD B;  4WU8 C;  3WA9 D;  3AZM B;  1M19 B;  3UTA A;  3X1S B;  4WU9 A;  4UUZ A;  1KX4 D;  3MGS D;  3KWQ A;  5B33 B;  1HQ3 D;  1P3O B;  5B32 C;  5CHL B;  5DNN D;  1P3A C;  4J8W D;  1F66 D;  3X1T A;  2PYO D;  1P3P C;  3WAA B;  4QLC D;  3X1V A;  1KX3 A;  4J8U A;  3AZL B;  5AV8 D;  4J8V A;  1U35 C;  3W99 C;  5AVB D;  2F8N A;  5B1M A;  1EQZ D;  5AV5 A;  5GT3 D;  3O62 A;  1M1A D;  5B24 D;  4NE3 A;  4YS3 D;  4XZQ D;  1B67 A;  3MVD A;  5B31 B;  4JJN D;  3REJ D;  3AZF A;  5B2I D;  5JRG A;  1P3K D;  4G91 C;  3AFA D;  1N1J A;  3MGP B;  3MGQ B;  3KUY B;  3UTA D;  2RVQ D;  3KXB B;  4WU9 D;  3A6N C;  1R4V A;  1P3G D;  1P3M A;  2ARO A;  1AOI A;  3LJA C;  3W96 C;  3WA9 B;  2CV5 B;  3MGR B;  3AZM C;  1KX4 B;  1KX5 A;  3AZN B;  3W97 D;  3MGS B;  3X1S C;  4R8P C;  4Z5T D;  2L5A A;  2BYK B;  3X1U D;  1HQ3 B;  5B1L C;  1S32 A;  2HIO C;  5B33 C;  4H9O B;  1P3B A;  4WNN A;  1P3O C;  3B0D C;  3MNN A;  1KX3 D;  4J8W B;  3B6G C;  1F66 B;  5FUG A;  4KGC A;  1ID3 D;  4J8V D;  2PYO B;  4KUD D;  5GT0 A;  5AV6 D;  5B0Y C;  5AV5 D;  3AZK B;  3O62 D;  5BS7 A;  3AZE A;  4J8X C;  4QLC B;  1TZY D;  3MGP A;  3WAA C;  4ZUX A;  2NZD C;  5AV8 B;  5AVC C;  3AZL C;  5JRG D;  1EQZ B;  1M1A B;  3UTB C;  4CAY A;  4H9N A;  5GXQ C;  4XZQ B;  1BH8 A;  3WA9 A;  4JJN B;  3NQJ B;  3REJ B;  3TU4 D;  4EO5 B;  1KX4 A;  5B31 C;  1P3K B;  2ARO D;  3REI A;  5AY8 A;  5CPJ D;  2BYK A;  3REK A;  3UTA B;  3AZI C;  4H9P A;  4WU9 B;  3KUY C;  3MGQ C;  1KX5 D;  3KWQ B;  3NQU A;  1P3G B;  5DNN A;  3AN2 C;  2YFW A;  3B6F C;  4M6B A;  4X23 C;  4LD9 C;  1ZLA C;  3C1C D;  5CPI C;  1S32 D;  1F66 A;  3LZ0 A;  4KHA A;  1P3B D;  5F99 A;  5CP6 C;  2IO5 B;  2NQB C;  2CV5 C;  4Z5T B;  3UT9 C;  3MGR C;  3X1U B;  3AZN C;  5GT0 D;  3AZG C;  2JSS A;  5B40 D;  5AV8 A;  4XUJ C;  1P34 D;  5AVB A;  5GT3 A;  1M1A A;  3X1V B;  5B24 A;  1KX3 B;  1P3I C;  4ZUX D;  3C1B A;  4YS3 A;  3LZ1 C;  1ID3 B;  4J8V B;  4KUD B;  5BO0 B;  3NQJ A;  5AV6 B;  5B2I A;  3REJ A;  5B1M B;  2F8N B;  2HUE B;  5AV5 B;  3O62 B;  2PYO C;  5E5A C;  3AFA A;  1F1E A;  3AZK C;  5B0Z D;  3VH6 T;  3WTP C;  3AZF B;  1P3F C;  5BT1 D;  4Z66 C;  5CPK C;  5JRG B;  3REI D;  1N1J B;  5AY8 D;  1P3G A;  4Z2M G;  1M18 C;  3REK D;  1EQZ C;  1P3L C;  5B31 G;  3TU4 B;  4XZQ C;  3AYW C;  3W97 A;  3AV2 D;  2ARO B;  1P3M B;  1P3A A;  1AOI B;  2FJ7 C;  3WKJ D;  4Z5T A;  3X1U A;  3LZ0 D;  3KSY A;  5F99 D;  1P3P A;  3V9R A;  1KX5 B;  3AZH D;  3AZJ A;  4H9S A;  3KWQ C;  4ZBJ C;  1S32 B;  4DRB A;  1ID3 A;  1P3B B;  4KUD A;  5BO0 A;  4WNN B;  1Q9C A;  5DNM D;  5AV6 A;  3W99 A;  3MNN B;  3C1B D;  3LEL D;  3AV1 C;  5FUG B;  4KGC B;  1TZY A;  5KDM A;  5GT0 B;  5GSU D;  1BFM A;  5B40 B;  3X1T C;  1P34 B;  3AZE B;  4YM6 D;  4ZUX B;  3A6N A;  3X1V C;  1KX3 C;  4J8U C;  3TU4 A;  3REH A;  3REL A;  3W98 A;  4CAY B;  5B2J A;  4H9N B;  5B1M C;  1BH8 B;  2HUE C;  5AV5 C;  1HTA A;  5B0Z B;  3LJA A;  5CPJ A;  5B32 D;  1BH9 A;  3MVD C;  1M19 C;  3AZF C;  3REI B;  1P3A D;  5AY8 B;  4R8P A;  3REK B;  4H9P B;  1P3P D;  3C1C A;  5B1L A;  3NQU B;  3AZJ D;  5DNN B;  2LY8 A;  2YFW B;  3VH5 A;  3AV2 B;  3WKJ B;  3B0B A;  3LZ0 B;  4KHA B;  2ARO C;  5F99 B;  1P3M C;  1AOI C;  1U35 D;  1KU5 A;  3W99 D;  5B40 A;  1P34 A;  3AZH B;  1KX5 C;  4J8X A;  4AWL B;  2NZD A;  5AVC A;  5AVB B;  1A7W A;  1S32 C;  5GT3 B;  5B24 B;  3VH5 W;  3C1B B;  4YS3 B;  3UTB A;  3MNN C;  5GXQ A;  5B0Z A;  3A6N D;  3VH5 T;  5GSU B;  5B2I B;  3REH D;  3REL D;  3W98 D;  4KGC C;  5B2J D;  5GT0 C;  3AFA B;  5BNV B;  4H9Q A;  3LJA D;  3W96 D;  3AZE C;  3AZI A;  3MGP C;  3AZM D;  2F8N G;  3KXB C;  4R8P D;  3AN2 A;  3AV2 A;  4LD9 A;  3WKJ A;  1ZLA A;  5BNX A;  5B1L D;  5B32 B;  5CPI A;  2HIO D;  5B33 D;  4NE6 A;  3VH6 A;  4E45 A;  5CP6 A;  3WA9 C;  1P3O D;  3W97 B;  1P3A B;  4CSR A;  3AZH A;  4NE5 A;  2NQB A;  3B6G D;  5G49 A;  1KX4 C;  3B0C W;  3MGS C;  1P3P B;  3V9R B;  3AZG A;  5B0Y D;  3B0C T;  1HQ3 C;  5AV9 A;  4XUJ A;  5DNM A;  3AZJ B;  4G92 B;  4J8X D;  1H3O B;  4Z2M H;  3LEL A;  3WAA D;  5DNN C;  2NZD D;  5AVC D;  4WV4 B;  4J8W C;  5GSU A;  3W99 B;  3AZL D;  1F66 C;  3VH6 W;  3UTB D;  4YM6 A;  5BNV A;  1TZY B;  5GXQ D;  1ULY A;  5KDM B;  4WU8 A;  3WTP A;  4QLC C;  4AWL C;  4Z66 A;  5CPK A;  4G91 B;  5AV8 C;  5AVB C;  5GT3 C;  4WZS B;  3A6N B;  3AZI D;  5B24 C;  1P3L A;  1M1A C;  5B32 A;  3MGQ D;  4YS3 C;  3C1B C;  3REH B;  3REL B;  3W98 B;  3B6F D;  3AN2 D;  5B2J B;  4JJN C;  3REJ C;  4X23 D;  5B2I C;  2FJ7 A;  4EO5 C;  4LD9 D;  1ZLA D;  3LJA B;  5CPJ B;  5CPI D;  2BYM A;  1BH9 B;  2YFV A;  1P3K C;  3AFA C;  5CP6 D;  3UTA C;  2RVQ C;  4WU9 C;  2NQB D;  2CV5 D;  4R8P B;  3UT9 D;  3MGR D;  1H3O A;  3AZN D;  3C1C B;  1P3G C;  5B1L B;  3AZG D;  2HIO B;  5AV9 D;  4XUJ D;  1U35 A;  3B0D B;  4DRA A;  1P3I D;  3B6G B;  2IO5 C;  3W97 C;  3AV1 A;  3LZ1 D;  4Z5T C;  1WWI A;  3X1U C;  5B0Y B;  1B6W A;  5E5A D;  4J8X B;  4WU8 D;  3AZK D;  3AZJ C;  4G92 C;  3WTP D;  1JFI A;  2NZD B;  1P3F D;  4H9S C;  5AVC B;  3R45 B;  4Z66 D;  5CPK D;  1ID3 C;  4J8V C;  4KUD C;  1M18 D;  4H9R B;  3UTB B;  5AV6 C;  5GXQ B;  3O62 C;  1P3L D;  3W96 A;  4E44 A;  5C3I B;  1TAF A;  1TZY C;  3AYW D;  2F8N K;  3AZM A;  1M19 A;  2FJ7 D;  4HGA B;  4H9Q B;  3X1S A;  5JRG C;  5JA4 B;  3AZI B;  4NFT A;  2HIO A;  5B33 A;  3B6F B;  3AN2 B;  1P3O A;  3TU4 C;  4X23 B;  3REH C;  4LD9 B;  3REL C;  3W98 C;  1ZLA B;  5BNX B;  3KWQ D;  3B6G A;  5CPI B;  5B2J C;  1WWS A;  5CP6 B;  5CPJ C;  5B0Y A;  4CSR B;  2NQB B;  3UT9 B;  5G49 B;  3AV1 D;  3WAA A;  3AZG B;  5B32 G;  5AV9 B;  3X1T D;  4XUJ B;  3R45 A;  5DNM B;  3C1C C;  3AZL A;  2F8N H;  1P3B C;  3LEL B;  4H9R A;  1P3I B;  3LZ1 B; 
#chains in the Genus database with same CATH topology
 3X1V D;  4J8U D;  5E5A B;  5B31 A;  4YM6 B;  5B40 C;  2F8N D;  5B1M D;  1P34 C;  4WU8 B;  5BS7 C;  3WTP B;  1P3F B;  5JA4 A;  3MVD D;  3KUY A;  4ZUX C;  4Z66 B;  3MGQ A;  5CPK B;  1M19 D;  3AZF D;  3X1S D;  3KXB A;  3B6F A;  1M18 B;  4X23 A;  2ZY3 A;  1P3L B;  5B0Z C;  3AYW B;  2FJ7 B;  5C3I C;  5BT1 C;  2CV5 A;  3UT9 A;  3MGR A;  2BYM B;  2YFV B;  3REI C;  3AZN A;  1P3M D;  4HGA C;  5AY8 C;  3MGS A;  1AOI D;  3REK C;  1HQ3 A;  4UUZ B;  4H9O A;  2G5I C;  1P3I A;  4ZBJ B;  3AV2 C;  3LZ1 A;  1U35 B;  3WKJ C;  4J8W A;  2XD5 A;  3LZ0 C;  5F99 C;  2CWE A;  2PYO A;  5E5A A;  3AV1 B;  3MNN D;  3AZH C;  3AZK A;  1P3F A;  4QLC A;  3X1T B;  4KGC D;  5B31 D;  5AV9 C;  3EPJ A;  5DNM C;  1M18 A;  1JFI B;  3AZE D;  1EQZ A;  3KUY D;  3MGP D;  3LEL C;  4J8U B;  3WTP E;  4XZQ A;  3KXB D;  3AYW A;  5GSU C;  4JJN A;  2FFF B;  3W96 B;  4YM6 C;  1P3K A;  1TAF B;  3MVD B;  4WU8 C;  3WA9 D;  3AZM B;  1M19 B;  3UTA A;  3X1S B;  4WU9 A;  4UUZ A;  1KX4 D;  3MGS D;  3KWQ A;  5B33 B;  1HQ3 D;  1P3O B;  5B32 C;  2Y2P A;  5CHL B;  5DNN D;  2BG1 A;  1P3A C;  4J8W D;  4UPK A;  1T3U A;  1F66 D;  3X1T A;  2ZY4 A;  2PYO D;  1P3P C;  3WAA B;  2Y2G A;  4QLC D;  3X1V A;  1KX3 A;  4J8U A;  3AZL B;  5AV8 D;  4J8V A;  1U35 C;  3W99 C;  5AVB D;  2F8N A;  5B1M A;  1EQZ D;  5AV5 A;  5GT3 D;  3O62 A;  1M1A D;  5B24 D;  2ZY2 A;  4NE3 A;  4YS3 D;  4XZQ D;  1B67 A;  3MVD A;  5B31 B;  4JJN D;  3REJ D;  3AZF A;  5B2I D;  5JRG A;  1P3K D;  4G91 C;  3AFA D;  1N1J A;  3MGP B;  3MGQ B;  3KUY B;  3UTA D;  2RVQ D;  3KXB B;  4WU9 D;  3A6N C;  1R4V A;  2DF4 C;  1P3G D;  1P3M A;  2ARO A;  1AOI A;  3LJA C;  3W96 C;  3WA9 B;  3H0R C;  2CV5 B;  3MGR B;  2Y2H A;  3AZM C;  1KX4 B;  1KX5 A;  3AZN B;  3W97 D;  3MGS B;  3X1S C;  4R8P C;  2Y2O A;  4Z5T D;  2L5A A;  2BYK B;  3X1U D;  1HQ3 B;  5B1L C;  1S32 A;  2HIO C;  5B33 C;  4H9O B;  1P3B A;  4WNN A;  1P3O C;  3EPH A;  3B0D C;  3MNN A;  1KX3 D;  4J8W B;  3B6G C;  1F66 B;  5FUG A;  4KGC A;  3F6T A;  4J8V D;  1ID3 D;  2PYO B;  4KUD D;  5GT0 A;  5AV6 D;  5B0Y C;  5AV5 D;  3AZK B;  3O62 D;  5BS7 A;  3AZE A;  4J8X C;  4QLC B;  1TZY D;  3MGP A;  3WAA C;  4ZUX A;  2ZY5 A;  2NZD C;  5AV8 B;  5AVC C;  3AZL C;  5JRG D;  1EQZ B;  1M1A B;  3UTB C;  4CAY A;  4H9N A;  5GXQ C;  4XZQ B;  1BH8 A;  3WA9 A;  4JJN B;  3NQJ B;  3REJ B;  3TU4 D;  4EO5 B;  1KX4 A;  5B31 C;  1P3K B;  2ARO D;  3REI A;  5AY8 A;  5CPJ D;  2BYK A;  3REK A;  3UTA B;  3AZI C;  4H9P A;  4WU9 B;  3KUY C;  3MGQ C;  1KX5 D;  3KWQ B;  2JE5 A;  3NQU A;  1P3G B;  5DNN A;  3AN2 C;  2YFW A;  3B6F C;  4M6B A;  4X23 C;  4LD9 C;  1ZLA C;  4DQY B;  3C1C D;  5CPI C;  1S32 D;  1F66 A;  3LZ0 A;  4KHA A;  1P3B D;  5F99 A;  5CP6 C;  2IO5 B;  2NQB C;  2CV5 C;  4Z5T B;  3UT9 C;  3MGR C;  3X1U B;  3AZN C;  5GT0 D;  3AZG C;  2JSS A;  5B40 D;  5AV8 A;  4XUJ C;  1P34 D;  5AVB A;  5GT3 A;  1M1A A;  3X1V B;  5B24 A;  1KX3 B;  1P3I C;  4ZUX D;  3C1B A;  4YS3 A;  3LZ1 C;  1ID3 B;  4J8V B;  2JCH A;  4KUD B;  5BO0 B;  3NQJ A;  5AV6 B;  5B2I A;  3REJ A;  5B1M B;  2F8N B;  2HUE B;  5AV5 B;  3O62 B;  3KFU G;  2PYO C;  5E5A C;  2Y2N A;  3AFA A;  1F1E A;  3AZK C;  5B0Z D;  3VH6 T;  3WTP C;  3AZF B;  1P3F C;  5BT1 D;  4Z66 C;  5CPK C;  5JRG B;  3REI D;  1N1J B;  2RIQ A;  5AY8 D;  4Z2M G;  1P3G A;  1M18 C;  3REK D;  1EQZ C;  1P3L C;  5B31 G;  3TU4 B;  4XZQ C;  3AYW C;  3W97 A;  3AV2 D;  2ARO B;  1P3M B;  1P3A A;  1AOI B;  2FJ7 C;  3WKJ D;  4Z5T A;  3X1U A;  3LZ0 D;  3KSY A;  5F99 D;  1P3P A;  3V9R A;  1KX5 B;  3AZH D;  3AZJ A;  4H9S A;  3KWQ C;  4ZBJ C;  1S32 B;  4DRB A;  1ID3 A;  1P3B B;  4KUD A;  5BO0 A;  4WNN B;  1Q9C A;  5DNM D;  5AV6 A;  3W99 A;  3MNN B;  3C1B D;  3LEL D;  3AV1 C;  5FUG B;  4KGC B;  1TZY A;  2Y2Q A;  5KDM A;  5GT0 B;  5GSU D;  1BFM A;  5B40 B;  3X1T C;  1P34 B;  3AZE B;  4YM6 D;  4ZUX B;  3EPL A;  3H0M C;  3X1V C;  3A6N A;  4J8U C;  3TU4 A;  1KX3 C;  3REH A;  3REL A;  3W98 A;  4CAY B;  5B2J A;  4H9N B;  5B1M C;  1BH8 B;  2HUE C;  5AV5 C;  1HTA A;  5B0Z B;  3LJA A;  5CPJ A;  5B32 D;  1BH9 A;  3MVD C;  1M19 C;  3AZF C;  2F2A C;  3REI B;  1P3A D;  5AY8 B;  4R8P A;  3REK B;  4H9P B;  1P3P D;  3C1C A;  5B1L A;  2Y2M A;  3NQU B;  3AZJ D;  5DNN B;  2LY8 A;  2YFW B;  3VH5 A;  3AV2 B;  3WKJ B;  3B0B A;  2DQN C;  3LZ0 B;  4KHA B;  2ARO C;  5F99 B;  1P3M C;  1AOI C;  1U35 D;  1KU5 A;  3W99 D;  5B40 A;  1P34 A;  3AZH B;  3IP4 C;  1KX5 C;  4J8X A;  4AWL B;  2NZD A;  5AVC A;  5AVB B;  1PZR A;  1A7W A;  3P5J B;  1S32 C;  5GT3 B;  2ZM5 A;  5B24 B;  3VH5 W;  3C1B B;  4YS3 B;  3UTB A;  3MNN C;  5GXQ A;  5B0Z A;  3A6N D;  3VH5 T;  5GSU B;  5B2I B;  3REH D;  1W2E A;  3REL D;  3W98 D;  4KGC C;  5B2J D;  5GT0 C;  3AFA B;  5BNV B;  3EPK A;  4H9Q A;  3LJA D;  3W96 D;  3AZE C;  3AZI A;  3MGP C;  3AZM D;  2F8N G;  3KXB C;  3A1K A;  4R8P D;  3AN2 A;  3AV2 A;  4LD9 A;  3WKJ A;  2Y2K A;  5BNX A;  1ZLA A;  5B1L D;  5B32 B;  5CPI A;  2HIO D;  2UWX A;  5B33 D;  4NE6 A;  3VH6 A;  2XD1 A;  5CP6 A;  4E45 A;  3WA9 C;  1P3O D;  3W97 B;  1P3A B;  4CSR A;  3AZH A;  3A1I A;  4NE5 A;  2NQB A;  3B6G D;  1Z2C B;  5G49 A;  1KX4 C;  3B0C W;  3MGS C;  1P3P B;  3V9R B;  3AZG A;  5B0Y D;  3B0C T;  1HQ3 C;  2Y2I A;  4XUJ A;  5DNM A;  5AV9 A;  3AZJ B;  4G92 B;  4J8X D;  1H3O B;  4Z2M H;  3LEL A;  3WAA D;  5DNN C;  2NZD D;  5AVC D;  4WV4 B;  4J8W C;  5GSU A;  3W99 B;  3AZL D;  1F66 C;  3VH6 W;  3UTB D;  4YM6 A;  5BNV A;  1TZY B;  5GXQ D;  1ULY A;  5KDM B;  4WU8 A;  3WTP A;  4QLC C;  4AWL C;  4Z66 A;  5CPK A;  4G91 B;  5AV8 C;  2VQR A;  2Y2L A;  4WJ3 C;  3AL0 C;  5AVB C;  5GT3 C;  4WZS B;  3A6N B;  3AZI D;  5B24 C;  2Y2J A;  1P3L A;  1M1A C;  5B32 A;  3MGQ D;  4YS3 C;  3C1B C;  3REH B;  3REL B;  3W98 B;  3B6F D;  3AN2 D;  5B2J B;  4JJN C;  3REJ C;  4X23 D;  5B2I C;  2FJ7 A;  4EO5 C;  4LD9 D;  1ZLA D;  3LJA B;  5CPJ B;  3EG5 B;  5CPI D;  2BYM A;  1BH9 B;  2YFV A;  1P3K C;  3AFA C;  5CP6 D;  3UTA C;  2RVQ C;  4WU9 C;  2G5H C;  2CV5 D;  2NQB D;  4R8P B;  3UT9 D;  3MGR D;  1H3O A;  3AZN D;  3C1C B;  1P3G C;  5B1L B;  3AZG D;  2HIO B;  5AV9 D;  4XUJ D;  1U35 A;  2J8P A;  3B0D B;  4DRA A;  1P3I D;  3B6G B;  2IO5 C;  3W97 C;  3AV1 A;  3LZ1 D;  4Z5T C;  1WWI A;  3X1U C;  5B0Y B;  1B6W A;  5E5A D;  4J8X B;  4WU8 D;  3AZK D;  3AZJ C;  4G92 C;  3WTP D;  1JFI A;  2NZD B;  1P3F D;  4H9S C;  5AVC B;  3R45 B;  4Z66 D;  5CPK D;  1ID3 C;  4J8V C;  4KUD C;  1M18 D;  4H9R B;  3UTB B;  5AV6 C;  5GXQ B;  3O62 C;  1P3L D;  3W96 A;  4E44 A;  5C3I B;  1TAF A;  1TZY C;  3AYW D;  2F8N K;  3AZM A;  1M19 A;  2FJ7 D;  4HGA B;  4H9Q B;  3X1S A;  5JRG C;  5JA4 B;  3AZI B;  4NFT A;  2HIO A;  5B33 A;  3B6F B;  3AN2 B;  1P3O A;  3TU4 C;  4X23 B;  3REH C;  4LD9 B;  3REL C;  3W98 C;  1ZLA B;  5BNX B;  3KWQ D;  3B6G A;  5CPI B;  5B2J C;  1WWS A;  5CP6 B;  5CPJ C;  5B0Y A;  4CSR B;  2W8S A;  2NQB B;  3FDD A;  3UT9 B;  5G49 B;  3AV1 D;  3WAA A;  3AZG B;  5B32 G;  5AV9 B;  3H0L C;  4XUJ B;  3R45 A;  3X1T D;  5DNM B;  3C1C C;  3AZL A;  2F8N H;  1P3B C;  3LEL B;  4H9R A;  1P3I B;  3LZ1 B; 
#chains in the Genus database with same CATH homology
 3X1V D;  4J8U D;  5E5A B;  5B31 A;  4YM6 B;  5B40 C;  2F8N D;  5B1M D;  1P34 C;  4WU8 B;  5BS7 C;  3WTP B;  1P3F B;  5JA4 A;  3MVD D;  3KUY A;  4ZUX C;  4Z66 B;  3MGQ A;  5CPK B;  1M19 D;  3AZF D;  3X1S D;  3KXB A;  3B6F A;  1M18 B;  4X23 A;  2ZY3 A;  1P3L B;  5B0Z C;  3AYW B;  2FJ7 B;  5C3I C;  5BT1 C;  2CV5 A;  3UT9 A;  3MGR A;  2BYM B;  2YFV B;  3REI C;  3AZN A;  1P3M D;  4HGA C;  5AY8 C;  3MGS A;  1AOI D;  3REK C;  1HQ3 A;  4UUZ B;  4H9O A;  2G5I C;  1P3I A;  4ZBJ B;  3AV2 C;  3LZ1 A;  1U35 B;  3WKJ C;  4J8W A;  2XD5 A;  3LZ0 C;  5F99 C;  2CWE A;  2PYO A;  5E5A A;  3AV1 B;  3MNN D;  3AZH C;  3AZK A;  1P3F A;  4QLC A;  3X1T B;  4KGC D;  5B31 D;  5AV9 C;  3EPJ A;  5DNM C;  1M18 A;  1JFI B;  3AZE D;  1EQZ A;  3KUY D;  3MGP D;  3LEL C;  4J8U B;  3WTP E;  4XZQ A;  3KXB D;  3AYW A;  5GSU C;  4JJN A;  2FFF B;  3W96 B;  4YM6 C;  1P3K A;  1TAF B;  3MVD B;  4WU8 C;  3WA9 D;  3AZM B;  1M19 B;  3UTA A;  3X1S B;  4WU9 A;  4UUZ A;  1KX4 D;  3MGS D;  3KWQ A;  5B33 B;  1HQ3 D;  1P3O B;  5B32 C;  2Y2P A;  5CHL B;  5DNN D;  2BG1 A;  1P3A C;  4J8W D;  4UPK A;  1T3U A;  1F66 D;  3X1T A;  2ZY4 A;  2PYO D;  1P3P C;  3WAA B;  2Y2G A;  4QLC D;  3X1V A;  1KX3 A;  4J8U A;  3AZL B;  5AV8 D;  4J8V A;  1U35 C;  3W99 C;  5AVB D;  2F8N A;  5B1M A;  1EQZ D;  5AV5 A;  5GT3 D;  3O62 A;  1M1A D;  5B24 D;  2ZY2 A;  4NE3 A;  4YS3 D;  4XZQ D;  1B67 A;  3MVD A;  5B31 B;  4JJN D;  3REJ D;  3AZF A;  5B2I D;  5JRG A;  1P3K D;  4G91 C;  3AFA D;  1N1J A;  3MGP B;  3MGQ B;  3KUY B;  3UTA D;  2RVQ D;  3KXB B;  4WU9 D;  3A6N C;  1R4V A;  2DF4 C;  1P3G D;  1P3M A;  2ARO A;  1AOI A;  3LJA C;  3W96 C;  3WA9 B;  3H0R C;  2CV5 B;  3MGR B;  2Y2H A;  3AZM C;  1KX4 B;  1KX5 A;  3AZN B;  3W97 D;  3MGS B;  3X1S C;  4R8P C;  2Y2O A;  4Z5T D;  2L5A A;  2BYK B;  3X1U D;  1HQ3 B;  5B1L C;  1S32 A;  2HIO C;  5B33 C;  4H9O B;  1P3B A;  4WNN A;  1P3O C;  3EPH A;  3B0D C;  3MNN A;  1KX3 D;  4J8W B;  3B6G C;  1F66 B;  5FUG A;  4KGC A;  3F6T A;  4J8V D;  1ID3 D;  2PYO B;  4KUD D;  5GT0 A;  5AV6 D;  5B0Y C;  5AV5 D;  3AZK B;  3O62 D;  5BS7 A;  3AZE A;  4J8X C;  4QLC B;  1TZY D;  3MGP A;  3WAA C;  4ZUX A;  2ZY5 A;  2NZD C;  5AV8 B;  5AVC C;  3AZL C;  5JRG D;  1EQZ B;  1M1A B;  3UTB C;  4CAY A;  4H9N A;  5GXQ C;  4XZQ B;  1BH8 A;  3WA9 A;  4JJN B;  3NQJ B;  3REJ B;  3TU4 D;  4EO5 B;  1KX4 A;  5B31 C;  1P3K B;  2ARO D;  3REI A;  5AY8 A;  5CPJ D;  2BYK A;  3REK A;  3UTA B;  3AZI C;  4H9P A;  4WU9 B;  3KUY C;  3MGQ C;  1KX5 D;  3KWQ B;  2JE5 A;  3NQU A;  1P3G B;  5DNN A;  3AN2 C;  2YFW A;  3B6F C;  4M6B A;  4X23 C;  4LD9 C;  1ZLA C;  4DQY B;  3C1C D;  5CPI C;  1S32 D;  1F66 A;  3LZ0 A;  4KHA A;  1P3B D;  5F99 A;  5CP6 C;  2IO5 B;  2NQB C;  2CV5 C;  4Z5T B;  3UT9 C;  3MGR C;  3X1U B;  3AZN C;  5GT0 D;  3AZG C;  2JSS A;  5B40 D;  5AV8 A;  4XUJ C;  1P34 D;  5AVB A;  5GT3 A;  1M1A A;  3X1V B;  5B24 A;  1KX3 B;  1P3I C;  4ZUX D;  3C1B A;  4YS3 A;  3LZ1 C;  1ID3 B;  4J8V B;  2JCH A;  4KUD B;  5BO0 B;  3NQJ A;  5AV6 B;  5B2I A;  3REJ A;  5B1M B;  2F8N B;  2HUE B;  5AV5 B;  3O62 B;  3KFU G;  2PYO C;  5E5A C;  2Y2N A;  3AFA A;  1F1E A;  3AZK C;  5B0Z D;  3VH6 T;  3WTP C;  3AZF B;  1P3F C;  5BT1 D;  4Z66 C;  5CPK C;  5JRG B;  3REI D;  1N1J B;  2RIQ A;  5AY8 D;  4Z2M G;  1P3G A;  1M18 C;  3REK D;  1EQZ C;  1P3L C;  5B31 G;  3TU4 B;  4XZQ C;  3AYW C;  3W97 A;  3AV2 D;  2ARO B;  1P3M B;  1P3A A;  1AOI B;  2FJ7 C;  3WKJ D;  4Z5T A;  3X1U A;  3LZ0 D;  3KSY A;  5F99 D;  1P3P A;  3V9R A;  1KX5 B;  3AZH D;  3AZJ A;  4H9S A;  3KWQ C;  4ZBJ C;  1S32 B;  4DRB A;  1ID3 A;  1P3B B;  4KUD A;  5BO0 A;  4WNN B;  1Q9C A;  5DNM D;  5AV6 A;  3W99 A;  3MNN B;  3C1B D;  3LEL D;  3AV1 C;  5FUG B;  4KGC B;  1TZY A;  2Y2Q A;  5KDM A;  5GT0 B;  5GSU D;  1BFM A;  5B40 B;  3X1T C;  1P34 B;  3AZE B;  4YM6 D;  4ZUX B;  3EPL A;  3H0M C;  3X1V C;  3A6N A;  4J8U C;  3TU4 A;  1KX3 C;  3REH A;  3REL A;  3W98 A;  4CAY B;  5B2J A;  4H9N B;  5B1M C;  1BH8 B;  2HUE C;  5AV5 C;  1HTA A;  5B0Z B;  3LJA A;  5CPJ A;  5B32 D;  1BH9 A;  3MVD C;  1M19 C;  3AZF C;  2F2A C;  3REI B;  1P3A D;  5AY8 B;  4R8P A;  3REK B;  4H9P B;  1P3P D;  3C1C A;  5B1L A;  2Y2M A;  3NQU B;  3AZJ D;  5DNN B;  2LY8 A;  2YFW B;  3VH5 A;  3AV2 B;  3WKJ B;  3B0B A;  2DQN C;  3LZ0 B;  4KHA B;  2ARO C;  5F99 B;  1P3M C;  1AOI C;  1U35 D;  1KU5 A;  3W99 D;  5B40 A;  1P34 A;  3AZH B;  3IP4 C;  1KX5 C;  4J8X A;  4AWL B;  2NZD A;  5AVC A;  5AVB B;  1PZR A;  1A7W A;  3P5J B;  1S32 C;  5GT3 B;  2ZM5 A;  5B24 B;  3VH5 W;  3C1B B;  4YS3 B;  3UTB A;  3MNN C;  5GXQ A;  5B0Z A;  3A6N D;  3VH5 T;  5GSU B;  5B2I B;  3REH D;  1W2E A;  3REL D;  3W98 D;  4KGC C;  5B2J D;  5GT0 C;  3AFA B;  5BNV B;  3EPK A;  4H9Q A;  3LJA D;  3W96 D;  3AZE C;  3AZI A;  3MGP C;  3AZM D;  2F8N G;  3KXB C;  3A1K A;  4R8P D;  3AN2 A;  3AV2 A;  4LD9 A;  3WKJ A;  2Y2K A;  5BNX A;  1ZLA A;  5B1L D;  5B32 B;  5CPI A;  2HIO D;  2UWX A;  5B33 D;  4NE6 A;  3VH6 A;  2XD1 A;  5CP6 A;  4E45 A;  3WA9 C;  1P3O D;  3W97 B;  1P3A B;  4CSR A;  3AZH A;  3A1I A;  4NE5 A;  2NQB A;  3B6G D;  1Z2C B;  5G49 A;  1KX4 C;  3B0C W;  3MGS C;  1P3P B;  3V9R B;  3AZG A;  5B0Y D;  3B0C T;  1HQ3 C;  2Y2I A;  4XUJ A;  5DNM A;  5AV9 A;  3AZJ B;  4G92 B;  4J8X D;  1H3O B;  4Z2M H;  3LEL A;  3WAA D;  5DNN C;  2NZD D;  5AVC D;  4WV4 B;  4J8W C;  5GSU A;  3W99 B;  3AZL D;  1F66 C;  3VH6 W;  3UTB D;  4YM6 A;  5BNV A;  1TZY B;  5GXQ D;  1ULY A;  5KDM B;  4WU8 A;  3WTP A;  4QLC C;  4AWL C;  4Z66 A;  5CPK A;  4G91 B;  5AV8 C;  2VQR A;  2Y2L A;  4WJ3 C;  3AL0 C;  5AVB C;  5GT3 C;  4WZS B;  3A6N B;  3AZI D;  5B24 C;  2Y2J A;  1P3L A;  1M1A C;  5B32 A;  3MGQ D;  4YS3 C;  3C1B C;  3REH B;  3REL B;  3W98 B;  3B6F D;  3AN2 D;  5B2J B;  4JJN C;  3REJ C;  4X23 D;  5B2I C;  2FJ7 A;  4EO5 C;  4LD9 D;  1ZLA D;  3LJA B;  5CPJ B;  3EG5 B;  5CPI D;  2BYM A;  1BH9 B;  2YFV A;  1P3K C;  3AFA C;  5CP6 D;  3UTA C;  2RVQ C;  4WU9 C;  2G5H C;  2CV5 D;  2NQB D;  4R8P B;  3UT9 D;  3MGR D;  1H3O A;  3AZN D;  3C1C B;  1P3G C;  5B1L B;  3AZG D;  2HIO B;  5AV9 D;  4XUJ D;  1U35 A;  2J8P A;  3B0D B;  4DRA A;  1P3I D;  3B6G B;  2IO5 C;  3W97 C;  3AV1 A;  3LZ1 D;  4Z5T C;  1WWI A;  3X1U C;  5B0Y B;  1B6W A;  5E5A D;  4J8X B;  4WU8 D;  3AZK D;  3AZJ C;  4G92 C;  3WTP D;  1JFI A;  2NZD B;  1P3F D;  4H9S C;  5AVC B;  3R45 B;  4Z66 D;  5CPK D;  1ID3 C;  4J8V C;  4KUD C;  1M18 D;  4H9R B;  3UTB B;  5AV6 C;  5GXQ B;  3O62 C;  1P3L D;  3W96 A;  4E44 A;  5C3I B;  1TAF A;  1TZY C;  3AYW D;  2F8N K;  3AZM A;  1M19 A;  2FJ7 D;  4HGA B;  4H9Q B;  3X1S A;  5JRG C;  5JA4 B;  3AZI B;  4NFT A;  2HIO A;  5B33 A;  3B6F B;  3AN2 B;  1P3O A;  3TU4 C;  4X23 B;  3REH C;  4LD9 B;  3REL C;  3W98 C;  1ZLA B;  5BNX B;  3KWQ D;  3B6G A;  5CPI B;  5B2J C;  1WWS A;  5CP6 B;  5CPJ C;  5B0Y A;  4CSR B;  2W8S A;  2NQB B;  3FDD A;  3UT9 B;  5G49 B;  3AV1 D;  3WAA A;  3AZG B;  5B32 G;  5AV9 B;  3H0L C;  4XUJ B;  3R45 A;  3X1T D;  5DNM B;  3C1C C;  3AZL A;  2F8N H;  1P3B C;  3LEL B;  4H9R A;  1P3I B;  3LZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...