2PYOC

Drosophila nucleosome core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoC00
3C1CA 5AVCD 1KX5A 3LZ0A 2PYOB 3AYWD 1P3GC 4WNNA 3AZND 5B1MC 4Z66A 2HUEB 3B0DB 5GT0D 4CSRA 3REIB 3WKJA 3KXBC 3TU4B 4WV4B 4H9SC 3MGRB 3UT9B 5AV5D 4ZBJB 4XUJC 3AV1D 3AV2C 3X1VA 3MGSD 2IO5C 1H3OA 5F99B 2F8NG 3LELD 5GSUB 5B32A 1U35C 3WTPD 1TAFA 3MGPB 4Z5TB 2FJ7A 4QLCA 4KHAA 2BYKA 4J8UA 5B0ZD 1P3AD 3AZKA 1P3FC 3W98D 2NQBC 3AZLD 1HQ3B 2AROB 1P3IB 2YFWB 1KX5B 5CP6B 2YFVA 3R45B 3X1TD 3REHB 5GT3D 4WNNB 5E5AB 1AOID 2LY8A 4WU9C 1EQZA 5FUGB 5CPKC 5CPIC 3C1BC 5JA4A 5CPJA 2RVQC 3W97D 2F8NB 3O62D 3LZ1C 5B24D 4J8XC 4XZQB 4X23C 5CHLB 1P3MC 3B6FC 4YM6C 5JRGB 3X1SB 2HIOD 3AZIB 2CV5B 1P3GA 1P3OC 5B1MA 4JJNC 4WU8B 3V9RA 2NZDC 3AZFC 4J8UB 3REKA 3KXBA 4H9SA 1JFIA 5BT1C 5B1LB 3AZGB 4XUJA 5C3IC 5DNMB 3AV2A 1S32B 4H9NB 4UUZB 3AZHB 3W96D 4KUDA 4H9OB 3MNND 5AV6B 3VH6T 3NQUA 1U35A 1M1AD 1P3KD 5JA4B 4HGAB 4J8WD 4G92C 1BFMA 1B6WA 4CAYB 5AV9D 1P3FA 3UTBD 5G49B 3MVDD 5AVBC 2NQBA 4H9RB 3AZEB 3AZMB 4E45A 3AZJD 1KX4D 3AN2B 1WWSA 1M18C 5B1MB 3MGQB 1ID3B 1F1EA 3KUYD 1TZYD 4KGCB 3REKB 4J8VC 4WU9A 5CPKA 5CPIA 3KXBB 4YS3B 3C1BA 3A6NC 3UTAC 5AV8D 1P3PC 5B0YD 4J8XA 5B31G 3X1UB 3REJD 4X23A 3NQJB 5B40D 5AVCC 4LD9D 4KUDB 1P3MA 4YM6A 3VH5W 3AYWC 3AFAD 3AZNC 1M19C 4JJNA 3VH6A 5GT0C 2NZDA 3AZFA 1P3FB 2NQBB 5AV5C 2PYOD 4R8PD 4DRBA 3AV1C 4EO5B 1P3BB 5BNXA 3MGSC 5GXQB 3KWQB 3LELC 4WU9B 3TU4D 3MGRD 1P34B 3C1BB 3WTPC 5B31B 1BH9A 5F99D 5B0ZC 2BYMA 1P3AC 3W98C 1BH8A 3W99B 5AVBA 3AZLC 5B2IA 1P3MB 1ZLAB 3X1TC 3MGPD 4DRAA 5GT3C 1M18A 3WA9B 2F8NH 1AOIC 4J8VA 1HQ3D 2AROD 1P3ID 3WTPE 1KX5D 5CP6D 3A6NA 1A7WA 5B33B 3UTAA 3W97C 3REHD 1P3PA 5C3IB 3O62C 5E5AD 5B2JB 5B24C 5AVCA 1P3LB 3LJAB 3AYWA 3AZNA 2F8ND 3RELB 4ZUXD 1M19A 5GT0A 3B6GB 4G91B 4XZQD 5DNNB 1BH8B 5B32G 5AVBB 5AV5A 5JRGD 5B2IB 5AY8B 3X1SD 3AZID 3C1CB 3AV1A 3WAAC 2CV5D 3W96C 3LZ0B 4WU8D 3LELA 1B67A 3MNNC 4J8VB 4Z66B 5B1LD 1M1AC 4CSRB 1P3KC 3AZGD 3WTPA 4J8WC 4AWLB 5DNMD 3WKJB 1S32D 3AZHD 5AV9C 5B0ZA 1P3AA 3W98A 3UTBC 3MVDC 3AZLA 3X1VB 5AV6D 3B0BA 1H3OB 3AZJC 1KX4C 3X1TA 5GT3A 5B32B 1M19B 1AOIA 1TZYC 1TAFB 2FJ7B 1WWIA 3AZMD 3AZED 4QLCB 4KHAB 2BYKB 3AZKB 5AV8C 3W97A 3AN2D 3O62A 1KX3C 5B1MD 3VH5T 5B0YC 5B24A 3MGQD 1ID3D 2YFVB 4LD9C 5B40C 4KGCD 3REKD 1R4VA 4YS3D 5BO0A 3AFAC 1EQZB 1F66C 4NE3A 3X1UD 5CPJB 4KUDD 2PYOC 4R8PC 3WAAA 5BS7C 3W96A 1KU5A 2HUEC 3B0DC 1AOIB 1P3GB 3MNNA 2NQBD 3MGRC 3B0CW 3V9RB 1M1AA 4ZBJC 1P3KA 4J8WA 1P3BD 3W97B 5AV9A 1JFIB 5F99C 5GXQD 4XUJB 3KWQD 3MVDA 1HTAA 4WU9D 3AV2B 3LZ1A 1P34D 2IO5B 3VH5A 3AZJA 1KX4A 5B31D 3MGPC 3B6FA 3NQUB 1U35B 1TZYA 3W99D 1P3OA 1HQ3C 2AROC 1P3IC 1KX5C 1N1JA 1P3MD 5CP6C 1ZLAD 5AV8A 3REHC 3WA9D 3WAAB 1KX3A 5E5AC 3W96B 5B0YA 4LD9A 5B40A 5BNVA 1M1AB 5B33D 3REID 4WZSB 3AFAA 1F66A 4ZUXC 3UT9D 5B2JD 5CPIB 5CPKB 4XZQC 1P3LD 3LJAD 5JRGC 3X1SC 2PYOA 3LZ1B 4J8XB 4R8PA 3AZIC 2CV5C 4X23B 4NFTA 5BS7A 5GSUD 3RELD 3B6FB 4YM6B 4WU8C 3B6GD 3VH6W 4Z5TD 5DNND 4H9QA 1P3OB 5AVBD 3MGRA 4JJNB 5AY8D 5B1LC 5B2ID 2NZDB 3AZGC 3AZFB 3C1CD 5DNMC 1S32C 3LZ0D 3AZHC 1KX3B 5F99A 4J8VD 5AV6C 5BNXB 4Z66D 4HGAC 3MGPA 3WKJD 1F66B 2HIOC 1HQ3A 2AROA 3AZEC 2YFWA 4G92B 3AZMC 3X1VD 5CP6A 1P3IA 1BH9B 2BYMB 4R8PB 3R45A 3AN2C 3REHA 5E5AA 5B32D 3MGQC 1M19D 1ID3C 4KGCC 3REKC 5FUGA 3MGSA 1M18B 4H9QB 2FJ7D 4QLCD 4YS3C 4J8UD 3AZKD 5KDMA 2F8NA 4ZUXA 3A6NB 4XZQA 3X1UC 3UTAB 4KUDC 1P3PB 2JSSA 5JRGA 3X1SA 3AZIA 2CV5A 5AVCB 1EQZD 3B0CT 4WU8A 5CPJD 3AYWB 3AZNB 5B1LA 3KSYA 5GT0B 3KUYC 3AZGA 4H9PA 4EO5C 5DNMA 1P3BC 1S32A 4H9NA 4UUZA 3AZHA 5AV5B 5GXQC 3KWQC 3AV1B 1P3GD 4H9OA 5AV6A 3MGSB 1P34C 2F8NK 3REJC 1ULYA 5B31C 3LELB 5KDMB 3KXBD 4CAYA 4ZUXB 2HIOA 3WTPB 3W99C 4XUJD 5G49A 4H9RA 3AZEA 3AZMA 3AV2D 4Z2MH 5B0ZB 1P3AB 1ZLAC 3W98B 3AN2A 3WA9C 3AZLB 3MGQA 1U35D 1ID3A 4KGCA 3X1TB 5GT3B 4YS3A 1Q9CA 1P3FD 5B33C 4H9PB 3REIC 3TU4C 3WAAD 3UT9C 5B2JC 3X1UA 4Z2MG 3NQJA 1P3LC 3LJAC 3O62B 5B24B 3UTBA 5GSUC 3RELC 5CPKD 5CPID 3C1BD 3B6GC 4G91C 2HIOB 4Z5TC 5DNNC 2RVQD 5BO0B 5AY8C 5B2IC 3LZ1D 3KUYA 4J8XD 3C1CC 4X23D 4M6BA 1P3BA 3LZ0C 3B6FD 4YM6D 5GXQA 3KWQA 1P3OD 4Z66C 1P34A 4JJND 2NZDD 3REJA 3AZFD 4AWLC 5B31A 3WKJC 3MNNB 4E44A 1KX3D 5BT1D 1P3KB 4J8WB 3W99A 3X1VC 5AV9B 1ZLAA 3UTBB 3MVDB 3WA9A 4NE6A 4NE5A 1F66D 5B32C 3AZJB 1KX4B 2FJ7C 4QLCC 4J8UC 3AZKC 3KUYB 5B33A 1TZYB 3REIA 3TU4A 3UT9A 5B2JA 1N1JB 5AV8B 1P3LA 3LJAA 2L5AA 1M18D 5B0YB 3REJB 4LD9B 5B40B 2CWEA 1EQZC 5GSUA 5BNVB 3RELA 3B6GA 3A6ND 5CPJC 4Z5TA 5DNNA 3UTAD 1P3PD 3AFAB 5AY8A
chains in the Genus database with same CATH superfamily
3C1CA 5AVCD 1KX5A 3LZ0A 2PYOB 3AYWD 1P3GC 4WNNA 3AZND 5B1MC 2Y2QA 4Z66A 2HUEB 3B0DB 5GT0D 4CSRA 3REIB 3WKJA 3KXBC 3TU4B 4WV4B 4H9SC 3MGRB 3UT9B 5AV5D 4ZBJB 4XUJC 3AV1D 3AV2C 3X1VA 3MGSD 2IO5C 1H3OA 5F99B 3EPLA 2F8NG 3LELD 5GSUB 5B32A 1U35C 3WTPD 1TAFA 3MGPB 4Z5TB 2FJ7A 4QLCA 4KHAA 2BYKA 4J8UA 5B0ZD 1P3AD 3AZKA 1P3FC 3W98D 2NQBC 3AZLD 1HQ3B 2AROB 1P3IB 2YFWB 1KX5B 5CP6B 2YFVA 3R45B 3X1TD 3REHB 5GT3D 4WNNB 5E5AB 1AOID 2LY8A 4WU9C 1EQZA 5FUGB 5CPKC 5CPIC 3C1BC 5JA4A 3A1IA 5CPJA 2RVQC 3W97D 2F8NB 3O62D 3LZ1C 5B24D 4J8XC 4XZQB 4X23C 5CHLB 1P3MC 3B6FC 4YM6C 5JRGB 3X1SB 2Y2LA 3KFUG 2HIOD 3AZIB 2CV5B 1P3GA 1P3OC 5B1MA 4JJNC 4WU8B 3V9RA 2NZDC 3AZFC 4J8UB 3REKA 3KXBA 4H9SA 1JFIA 5BT1C 5B1LB 3AZGB 4XUJA 5C3IC 3F6TA 5DNMB 3AV2A 1S32B 4H9NB 4UUZB 3AZHB 3W96D 3EPHA 4KUDA 4H9OB 3MNND 5AV6B 3VH6T 3NQUA 1U35A 1M1AD 1P3KD 5JA4B 4HGAB 4J8WD 2F2AC 2G5HC 4G92C 1BFMA 2FFFB 1B6WA 4CAYB 2J8PA 5AV9D 1P3FA 2ZY4A 3UTBD 5G49B 3MVDD 5AVBC 2NQBA 4H9RB 3AZEB 3AZMB 2JE5A 4E45A 3AZJD 1KX4D 3AN2B 1WWSA 1M18C 5B1MB 3MGQB 1ID3B 1PZRA 1F1EA 3KUYD 1TZYD 4KGCB 3REKB 4J8VC 4WU9A 5CPKA 5CPIA 3KXBB 4YS3B 3C1BA 3A6NC 3FDDA 3UTAC 5AV8D 2ZY3A 1P3PC 2ZY5A 5B0YD 4J8XA 5B31G 3X1UB 3REJD 4X23A 3NQJB 5B40D 5AVCC 4LD9D 2Y2OA 4KUDB 1P3MA 4YM6A 3VH5W 3AYWC 3AFAD 3AZNC 1M19C 4JJNA 3VH6A 5GT0C 2NZDA 3AZFA 2XD1A 1P3FB 2Y2NA 2NQBB 5AV5C 2PYOD 3H0MC 4R8PD 4DRBA 3AV1C 4EO5B 1P3BB 5BNXA 3MGSC 5GXQB 2Y2KA 3KWQB 3LELC 4WU9B 3TU4D 3MGRD 1P34B 3C1BB 3WTPC 5B31B 1BH9A 5F99D 5B0ZC 2BYMA 1P3AC 3W98C 1BH8A 3W99B 5AVBA 3AZLC 5B2IA 1P3MB 2XD5A 1ZLAB 3X1TC 3MGPD 4DRAA 5GT3C 1M18A 3WA9B 2F8NH 1AOIC 4J8VA 2BG1A 1HQ3D 2AROD 1P3ID 3WTPE 1KX5D 5CP6D 3A6NA 1A7WA 5B33B 3UTAA 3W97C 3REHD 1P3PA 5C3IB 3O62C 5E5AD 5B2JB 5B24C 5AVCA 1P3LB 3LJAB 2G5IC 3AYWA 3AZNA 2F8ND 3RELB 4ZUXD 1M19A 5GT0A 3B6GB 4G91B 4XZQD 5DNNB 3P5JB 1BH8B 5B32G 5AVBB 5AV5A 5JRGD 5B2IB 5AY8B 3X1SD 3AZID 3C1CB 3AV1A 3WAAC 2CV5D 2Y2MA 3W96C 3LZ0B 4WU8D 3LELA 1B67A 3MNNC 4J8VB 4Z66B 5B1LD 1M1AC 4CSRB 1P3KC 3AZGD 3WTPA 4UPKA 4J8WC 4AWLB 5DNMD 3WKJB 1S32D 3AZHD 5AV9C 5B0ZA 1P3AA 3W98A 3UTBC 3MVDC 3AZLA 3X1VB 5AV6D 3B0BA 1H3OB 3AZJC 1KX4C 3X1TA 2Y2IA 5GT3A 5B32B 1M19B 1AOIA 1TZYC 1TAFB 2FJ7B 1WWIA 3AZMD 3AZED 4QLCB 4KHAB 2BYKB 3AZKB 5AV8C 3W97A 3AN2D 3O62A 1KX3C 5B1MD 3VH5T 5B0YC 5B24A 3MGQD 1ID3D 2YFVB 4LD9C 5B40C 4KGCD 3REKD 1R4VA 4YS3D 5BO0A 3AFAC 1EQZB 1F66C 4NE3A 3X1UD 5CPJB 3EPKA 4KUDD 1Z2CB 2PYOC 4R8PC 3WAAA 5BS7C 3W96A 1KU5A 2HUEC 3B0DC 1AOIB 1P3GB 3MNNA 2NQBD 3MGRC 3B0CW 3V9RB 1M1AA 4ZBJC 1P3KA 4J8WA 1P3BD 3W97B 5AV9A 1JFIB 5F99C 5GXQD 4XUJB 3KWQD 3MVDA 1HTAA 4WU9D 3AV2B 3LZ1A 1P34D 2IO5B 3VH5A 3AZJA 1KX4A 5B31D 3MGPC 3B6FA 3EG5B 3NQUB 1U35B 1TZYA 3W99D 1P3OA 1HQ3C 2AROC 1P3IC 1KX5C 1N1JA 1P3MD 5CP6C 1ZLAD 5AV8A 3REHC 3WA9D 3WAAB 1KX3A 5E5AC 3W96B 5B0YA 4LD9A 5B40A 5BNVA 2Y2PA 2Y2HA 1M1AB 5B33D 3REID 4WZSB 3AFAA 1F66A 4ZUXC 3UT9D 5B2JD 5CPIB 5CPKB 4XZQC 1P3LD 3LJAD 5JRGC 3X1SC 2PYOA 3LZ1B 4J8XB 4R8PA 3AZIC 2CV5C 4X23B 4NFTA 5BS7A 5GSUD 3RELD 3B6FB 4YM6B 4WU8C 3B6GD 3VH6W 4Z5TD 5DNND 4H9QA 1P3OB 5AVBD 3MGRA 4JJNB 5AY8D 5B1LC 5B2ID 2NZDB 3AZGC 3AZFB 3C1CD 5DNMC 2W8SA 1S32C 3LZ0D 3AZHC 1KX3B 5F99A 2VQRA 4J8VD 5AV6C 5BNXB 4Z66D 1T3UA 4HGAC 3MGPA 3WKJD 1F66B 2HIOC 2Y2JA 3H0RC 1HQ3A 2AROA 3AZEC 2YFWA 4G92B 3AZMC 3X1VD 5CP6A 1P3IA 1BH9B 2BYMB 4R8PB 3R45A 3AN2C 3REHA 5E5AA 5B32D 3MGQC 1M19D 1ID3C 4KGCC 3REKC 5FUGA 3MGSA 1M18B 4H9QB 2FJ7D 4QLCD 4YS3C 4J8UD 3AZKD 5KDMA 2F8NA 4ZUXA 3A6NB 4XZQA 3X1UC 3UTAB 4KUDC 2DF4C 1P3PB 2JSSA 2ZY2A 3H0LC 3X1SA 5JRGA 3AZIA 2CV5A 5AVCB 1EQZD 3B0CT 4WU8A 5CPJD 3AYWB 3AZNB 5B1LA 3KSYA 5GT0B 3KUYC 3AZGA 4H9PA 4EO5C 2JCHA 5DNMA 1P3BC 1S32A 4H9NA 4UUZA 3AZHA 5AV5B 5GXQC 3KWQC 3AV1B 1P3GD 4H9OA 5AV6A 3MGSB 1P34C 2F8NK 3REJC 1ULYA 2DQNC 5B31C 3LELB 5KDMB 3IP4C 3KXBD 4CAYA 4ZUXB 2HIOA 3WTPB 3W99C 4XUJD 5G49A 4H9RA 3AZEA 3AZMA 3AV2D 4Z2MH 3A1KA 5B0ZB 1P3AB 1ZLAC 3W98B 3AN2A 3WA9C 3AZLB 3EPJA 3MGQA 1U35D 1ID3A 4KGCA 3X1TB 5GT3B 4YS3A 1Q9CA 1P3FD 5B33C 4H9PB 3REIC 3TU4C 3WAAD 3UT9C 5B2JC 3X1UA 4Z2MG 3NQJA 1P3LC 3LJAC 3O62B 5B24B 3UTBA 2RIQA 5GSUC 3RELC 5CPKD 5CPID 3C1BD 3B6GC 4G91C 2HIOB 4Z5TC 5DNNC 2RVQD 5BO0B 2ZM5A 5AY8C 5B2IC 3LZ1D 3KUYA 4J8XD 4WJ3C 3C1CC 4X23D 4M6BA 1P3BA 3LZ0C 3B6FD 4YM6D 5GXQA 3AL0C 3KWQA 1P3OD 4Z66C 1P34A 4JJND 2NZDD 3REJA 3AZFD 4AWLC 5B31A 3WKJC 3MNNB 4E44A 1KX3D 5BT1D 1P3KB 4J8WB 3W99A 3X1VC 5AV9B 1ZLAA 3UTBB 3MVDB 3WA9A 4NE6A 2Y2GA 4NE5A 1F66D 5B32C 3AZJB 1KX4B 2FJ7C 4QLCC 4J8UC 3AZKC 3KUYB 5B33A 1TZYB 4DQYB 3REIA 3TU4A 3UT9A 5B2JA 1N1JB 5AV8B 1P3LA 3LJAA 2L5AA 1M18D 5B0YB 3REJB 4LD9B 5B40B 2CWEA 1EQZC 2UWXA 1W2EA 5BNVB 5GSUA 3RELA 3B6GA 3A6ND 5CPJC 4Z5TA 5DNNA 3UTAD 1P3PD 3AFAB 5AY8A
chains in the Genus database with same CATH topology
3C1CA 5AVCD 1KX5A 3LZ0A 2PYOB 3AYWD 1P3GC 4WNNA 3AZND 5B1MC 2Y2QA 4Z66A 2HUEB 3B0DB 5GT0D 4CSRA 3REIB 3WKJA 3KXBC 3TU4B 4WV4B 4H9SC 3MGRB 3UT9B 5AV5D 4ZBJB 4XUJC 3AV1D 3AV2C 3X1VA 3MGSD 2IO5C 1H3OA 5F99B 3EPLA 2F8NG 3LELD 5GSUB 5B32A 1U35C 3WTPD 1TAFA 3MGPB 4Z5TB 2FJ7A 4QLCA 4KHAA 2BYKA 4J8UA 5B0ZD 1P3AD 3AZKA 1P3FC 3W98D 2NQBC 3AZLD 1HQ3B 2AROB 1P3IB 2YFWB 1KX5B 5CP6B 2YFVA 3R45B 3X1TD 3REHB 5GT3D 4WNNB 5E5AB 1AOID 2LY8A 4WU9C 1EQZA 5FUGB 5CPKC 5CPIC 3C1BC 5JA4A 3A1IA 5CPJA 2RVQC 3W97D 2F8NB 3O62D 3LZ1C 5B24D 4J8XC 4XZQB 4X23C 5CHLB 1P3MC 3B6FC 4YM6C 5JRGB 3X1SB 2Y2LA 3KFUG 2HIOD 3AZIB 2CV5B 1P3GA 1P3OC 5B1MA 4JJNC 4WU8B 3V9RA 2NZDC 3AZFC 4J8UB 3REKA 3KXBA 4H9SA 1JFIA 5BT1C 5B1LB 3AZGB 4XUJA 5C3IC 3F6TA 5DNMB 3AV2A 1S32B 4H9NB 4UUZB 3AZHB 3W96D 3EPHA 4KUDA 4H9OB 3MNND 5AV6B 3VH6T 3NQUA 1U35A 1M1AD 1P3KD 5JA4B 4HGAB 4J8WD 2F2AC 2G5HC 4G92C 1BFMA 2FFFB 1B6WA 4CAYB 2J8PA 5AV9D 1P3FA 2ZY4A 3UTBD 5G49B 3MVDD 5AVBC 2NQBA 4H9RB 3AZEB 3AZMB 2JE5A 4E45A 3AZJD 1KX4D 3AN2B 1WWSA 1M18C 5B1MB 3MGQB 1ID3B 1PZRA 1F1EA 3KUYD 1TZYD 4KGCB 3REKB 4J8VC 4WU9A 5CPKA 5CPIA 3KXBB 4YS3B 3C1BA 3A6NC 3FDDA 3UTAC 5AV8D 2ZY3A 1P3PC 2ZY5A 5B0YD 4J8XA 5B31G 3X1UB 3REJD 4X23A 3NQJB 5B40D 5AVCC 4LD9D 2Y2OA 4KUDB 1P3MA 4YM6A 3VH5W 3AYWC 3AFAD 3AZNC 1M19C 4JJNA 3VH6A 5GT0C 2NZDA 3AZFA 2XD1A 1P3FB 2Y2NA 2NQBB 5AV5C 2PYOD 3H0MC 4R8PD 4DRBA 3AV1C 4EO5B 1P3BB 5BNXA 3MGSC 5GXQB 2Y2KA 3KWQB 3LELC 4WU9B 3TU4D 3MGRD 1P34B 3C1BB 3WTPC 5B31B 1BH9A 5F99D 5B0ZC 2BYMA 1P3AC 3W98C 1BH8A 3W99B 5AVBA 3AZLC 5B2IA 1P3MB 2XD5A 1ZLAB 3X1TC 3MGPD 4DRAA 5GT3C 1M18A 3WA9B 2F8NH 1AOIC 4J8VA 2BG1A 1HQ3D 2AROD 1P3ID 3WTPE 1KX5D 5CP6D 3A6NA 1A7WA 5B33B 3UTAA 3W97C 3REHD 1P3PA 5C3IB 3O62C 5E5AD 5B2JB 5B24C 5AVCA 1P3LB 3LJAB 2G5IC 3AYWA 3AZNA 2F8ND 3RELB 4ZUXD 1M19A 5GT0A 3B6GB 4G91B 4XZQD 5DNNB 3P5JB 1BH8B 5B32G 5AVBB 5AV5A 5JRGD 5B2IB 5AY8B 3X1SD 3AZID 3C1CB 3AV1A 3WAAC 2CV5D 2Y2MA 3W96C 3LZ0B 4WU8D 3LELA 1B67A 3MNNC 4J8VB 4Z66B 5B1LD 1M1AC 4CSRB 1P3KC 3AZGD 3WTPA 4UPKA 4J8WC 4AWLB 5DNMD 3WKJB 1S32D 3AZHD 5AV9C 5B0ZA 1P3AA 3W98A 3UTBC 3MVDC 3AZLA 3X1VB 5AV6D 3B0BA 1H3OB 3AZJC 1KX4C 3X1TA 2Y2IA 5GT3A 5B32B 1M19B 1AOIA 1TZYC 1TAFB 2FJ7B 1WWIA 3AZMD 3AZED 4QLCB 4KHAB 2BYKB 3AZKB 5AV8C 3W97A 3AN2D 3O62A 1KX3C 5B1MD 3VH5T 5B0YC 5B24A 3MGQD 1ID3D 2YFVB 4LD9C 5B40C 4KGCD 3REKD 1R4VA 4YS3D 5BO0A 3AFAC 1EQZB 1F66C 4NE3A 3X1UD 5CPJB 3EPKA 4KUDD 1Z2CB 2PYOC 4R8PC 3WAAA 5BS7C 3W96A 1KU5A 2HUEC 3B0DC 1AOIB 1P3GB 3MNNA 2NQBD 3MGRC 3B0CW 3V9RB 1M1AA 4ZBJC 1P3KA 4J8WA 1P3BD 3W97B 5AV9A 1JFIB 5F99C 5GXQD 4XUJB 3KWQD 3MVDA 1HTAA 4WU9D 3AV2B 3LZ1A 1P34D 2IO5B 3VH5A 3AZJA 1KX4A 5B31D 3MGPC 3B6FA 3EG5B 3NQUB 1U35B 1TZYA 3W99D 1P3OA 1HQ3C 2AROC 1P3IC 1KX5C 1N1JA 1P3MD 5CP6C 1ZLAD 5AV8A 3REHC 3WA9D 3WAAB 1KX3A 5E5AC 3W96B 5B0YA 4LD9A 5B40A 5BNVA 2Y2PA 2Y2HA 1M1AB 5B33D 3REID 4WZSB 3AFAA 1F66A 4ZUXC 3UT9D 5B2JD 5CPIB 5CPKB 4XZQC 1P3LD 3LJAD 5JRGC 3X1SC 2PYOA 3LZ1B 4J8XB 4R8PA 3AZIC 2CV5C 4X23B 4NFTA 5BS7A 5GSUD 3RELD 3B6FB 4YM6B 4WU8C 3B6GD 3VH6W 4Z5TD 5DNND 4H9QA 1P3OB 5AVBD 3MGRA 4JJNB 5AY8D 5B1LC 5B2ID 2NZDB 3AZGC 3AZFB 3C1CD 5DNMC 2W8SA 1S32C 3LZ0D 3AZHC 1KX3B 5F99A 2VQRA 4J8VD 5AV6C 5BNXB 4Z66D 1T3UA 4HGAC 3MGPA 3WKJD 1F66B 2HIOC 2Y2JA 3H0RC 1HQ3A 2AROA 3AZEC 2YFWA 4G92B 3AZMC 3X1VD 5CP6A 1P3IA 1BH9B 2BYMB 4R8PB 3R45A 3AN2C 3REHA 5E5AA 5B32D 3MGQC 1M19D 1ID3C 4KGCC 3REKC 5FUGA 3MGSA 1M18B 4H9QB 2FJ7D 4QLCD 4YS3C 4J8UD 3AZKD 5KDMA 2F8NA 4ZUXA 3A6NB 4XZQA 3X1UC 3UTAB 4KUDC 2DF4C 1P3PB 2JSSA 2ZY2A 3H0LC 3X1SA 5JRGA 3AZIA 2CV5A 5AVCB 1EQZD 3B0CT 4WU8A 5CPJD 3AYWB 3AZNB 5B1LA 3KSYA 5GT0B 3KUYC 3AZGA 4H9PA 4EO5C 2JCHA 5DNMA 1P3BC 1S32A 4H9NA 4UUZA 3AZHA 5AV5B 5GXQC 3KWQC 3AV1B 1P3GD 4H9OA 5AV6A 3MGSB 1P34C 2F8NK 3REJC 1ULYA 2DQNC 5B31C 3LELB 5KDMB 3IP4C 3KXBD 4CAYA 4ZUXB 2HIOA 3WTPB 3W99C 4XUJD 5G49A 4H9RA 3AZEA 3AZMA 3AV2D 4Z2MH 3A1KA 5B0ZB 1P3AB 1ZLAC 3W98B 3AN2A 3WA9C 3AZLB 3EPJA 3MGQA 1U35D 1ID3A 4KGCA 3X1TB 5GT3B 4YS3A 1Q9CA 1P3FD 5B33C 4H9PB 3REIC 3TU4C 3WAAD 3UT9C 5B2JC 3X1UA 4Z2MG 3NQJA 1P3LC 3LJAC 3O62B 5B24B 3UTBA 2RIQA 5GSUC 3RELC 5CPKD 5CPID 3C1BD 3B6GC 4G91C 2HIOB 4Z5TC 5DNNC 2RVQD 5BO0B 2ZM5A 5AY8C 5B2IC 3LZ1D 3KUYA 4J8XD 4WJ3C 3C1CC 4X23D 4M6BA 1P3BA 3LZ0C 3B6FD 4YM6D 5GXQA 3AL0C 3KWQA 1P3OD 4Z66C 1P34A 4JJND 2NZDD 3REJA 3AZFD 4AWLC 5B31A 3WKJC 3MNNB 4E44A 1KX3D 5BT1D 1P3KB 4J8WB 3W99A 3X1VC 5AV9B 1ZLAA 3UTBB 3MVDB 3WA9A 4NE6A 2Y2GA 4NE5A 1F66D 5B32C 3AZJB 1KX4B 2FJ7C 4QLCC 4J8UC 3AZKC 3KUYB 5B33A 1TZYB 4DQYB 3REIA 3TU4A 3UT9A 5B2JA 1N1JB 5AV8B 1P3LA 3LJAA 2L5AA 1M18D 5B0YB 3REJB 4LD9B 5B40B 2CWEA 1EQZC 2UWXA 1W2EA 5BNVB 5GSUA 3RELA 3B6GA 3A6ND 5CPJC 4Z5TA 5DNNA 3UTAD 1P3PD 3AFAB 5AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C A;  5AVC D;  1KX5 A;  3LZ0 A;  2PYO B;  3AYW D;  1P3G C;  4WNN A;  3AZN D;  5B1M C;  4Z66 A;  2HUE B;  3B0D B;  5GT0 D;  4CSR A;  3REI B;  3WKJ A;  3KXB C;  3TU4 B;  4WV4 B;  4H9S C;  3MGR B;  3UT9 B;  5AV5 D;  4ZBJ B;  4XUJ C;  3AV1 D;  3AV2 C;  3X1V A;  3MGS D;  2IO5 C;  1H3O A;  5F99 B;  2F8N G;  3LEL D;  5GSU B;  5B32 A;  1U35 C;  3WTP D;  1TAF A;  3MGP B;  4Z5T B;  2FJ7 A;  4QLC A;  4KHA A;  2BYK A;  4J8U A;  5B0Z D;  1P3A D;  3AZK A;  1P3F C;  3W98 D;  2NQB C;  3AZL D;  1HQ3 B;  2ARO B;  1P3I B;  2YFW B;  1KX5 B;  5CP6 B;  2YFV A;  3R45 B;  3X1T D;  3REH B;  5GT3 D;  4WNN B;  5E5A B;  1AOI D;  2LY8 A;  4WU9 C;  1EQZ A;  5FUG B;  5CPK C;  5CPI C;  3C1B C;  5JA4 A;  5CPJ A;  2RVQ C;  3W97 D;  2F8N B;  3O62 D;  3LZ1 C;  5B24 D;  4J8X C;  4XZQ B;  4X23 C;  5CHL B;  1P3M C;  3B6F C;  4YM6 C;  5JRG B;  3X1S B;  2HIO D;  3AZI B;  2CV5 B;  1P3G A;  1P3O C;  5B1M A;  4JJN C;  4WU8 B;  3V9R A;  2NZD C;  3AZF C;  4J8U B;  3REK A;  3KXB A;  4H9S A;  1JFI A;  5BT1 C;  5B1L B;  3AZG B;  4XUJ A;  5C3I C;  5DNM B;  3AV2 A;  1S32 B;  4H9N B;  4UUZ B;  3AZH B;  3W96 D;  4KUD A;  4H9O B;  3MNN D;  5AV6 B;  3VH6 T;  3NQU A;  1U35 A;  1M1A D;  1P3K D;  5JA4 B;  4HGA B;  4J8W D;  4G92 C;  1BFM A;  1B6W A;  4CAY B;  5AV9 D;  1P3F A;  3UTB D;  5G49 B;  3MVD D;  5AVB C;  2NQB A;  4H9R B;  3AZE B;  3AZM B;  4E45 A;  3AZJ D;  1KX4 D;  3AN2 B;  1WWS A;  1M18 C;  5B1M B;  3MGQ B;  1ID3 B;  1F1E A;  3KUY D;  1TZY D;  4KGC B;  3REK B;  4J8V C;  4WU9 A;  5CPK A;  5CPI A;  3KXB B;  4YS3 B;  3C1B A;  3A6N C;  3UTA C;  5AV8 D;  1P3P C;  5B0Y D;  4J8X A;  5B31 G;  3X1U B;  3REJ D;  4X23 A;  3NQJ B;  5B40 D;  5AVC C;  4LD9 D;  4KUD B;  1P3M A;  4YM6 A;  3VH5 W;  3AYW C;  3AFA D;  3AZN C;  1M19 C;  4JJN A;  3VH6 A;  5GT0 C;  2NZD A;  3AZF A;  1P3F B;  2NQB B;  5AV5 C;  2PYO D;  4R8P D;  4DRB A;  3AV1 C;  4EO5 B;  1P3B B;  5BNX A;  3MGS C;  5GXQ B;  3KWQ B;  3LEL C;  4WU9 B;  3TU4 D;  3MGR D;  1P34 B;  3C1B B;  3WTP C;  5B31 B;  1BH9 A;  5F99 D;  5B0Z C;  2BYM A;  1P3A C;  3W98 C;  1BH8 A;  3W99 B;  5AVB A;  3AZL C;  5B2I A;  1P3M B;  1ZLA B;  3X1T C;  3MGP D;  4DRA A;  5GT3 C;  1M18 A;  3WA9 B;  2F8N H;  1AOI C;  4J8V A;  1HQ3 D;  2ARO D;  1P3I D;  3WTP E;  1KX5 D;  5CP6 D;  3A6N A;  1A7W A;  5B33 B;  3UTA A;  3W97 C;  3REH D;  1P3P A;  5C3I B;  3O62 C;  5E5A D;  5B2J B;  5B24 C;  5AVC A;  1P3L B;  3LJA B;  3AYW A;  3AZN A;  2F8N D;  3REL B;  4ZUX D;  1M19 A;  5GT0 A;  3B6G B;  4G91 B;  4XZQ D;  5DNN B;  1BH8 B;  5B32 G;  5AVB B;  5AV5 A;  5JRG D;  5B2I B;  5AY8 B;  3X1S D;  3AZI D;  3C1C B;  3AV1 A;  3WAA C;  2CV5 D;  3W96 C;  3LZ0 B;  4WU8 D;  3LEL A;  1B67 A;  3MNN C;  4J8V B;  4Z66 B;  5B1L D;  1M1A C;  4CSR B;  1P3K C;  3AZG D;  3WTP A;  4J8W C;  4AWL B;  5DNM D;  3WKJ B;  1S32 D;  3AZH D;  5AV9 C;  5B0Z A;  1P3A A;  3W98 A;  3UTB C;  3MVD C;  3AZL A;  3X1V B;  5AV6 D;  3B0B A;  1H3O B;  3AZJ C;  1KX4 C;  3X1T A;  5GT3 A;  5B32 B;  1M19 B;  1AOI A;  1TZY C;  1TAF B;  2FJ7 B;  1WWI A;  3AZM D;  3AZE D;  4QLC B;  4KHA B;  2BYK B;  3AZK B;  5AV8 C;  3W97 A;  3AN2 D;  3O62 A;  1KX3 C;  5B1M D;  3VH5 T;  5B0Y C;  5B24 A;  3MGQ D;  1ID3 D;  2YFV B;  4LD9 C;  5B40 C;  4KGC D;  3REK D;  1R4V A;  4YS3 D;  5BO0 A;  3AFA C;  1EQZ B;  1F66 C;  4NE3 A;  3X1U D;  5CPJ B;  4KUD D;  2PYO C;  4R8P C;  3WAA A;  5BS7 C;  3W96 A;  1KU5 A;  2HUE C;  3B0D C;  1AOI B;  1P3G B;  3MNN A;  2NQB D;  3MGR C;  3B0C W;  3V9R B;  1M1A A;  4ZBJ C;  1P3K A;  4J8W A;  1P3B D;  3W97 B;  5AV9 A;  1JFI B;  5F99 C;  5GXQ D;  4XUJ B;  3KWQ D;  3MVD A;  1HTA A;  4WU9 D;  3AV2 B;  3LZ1 A;  1P34 D;  2IO5 B;  3VH5 A;  3AZJ A;  1KX4 A;  5B31 D;  3MGP C;  3B6F A;  3NQU B;  1U35 B;  1TZY A;  3W99 D;  1P3O A;  1HQ3 C;  2ARO C;  1P3I C;  1KX5 C;  1N1J A;  1P3M D;  5CP6 C;  1ZLA D;  5AV8 A;  3REH C;  3WA9 D;  3WAA B;  1KX3 A;  5E5A C;  3W96 B;  5B0Y A;  4LD9 A;  5B40 A;  5BNV A;  1M1A B;  5B33 D;  3REI D;  4WZS B;  3AFA A;  1F66 A;  4ZUX C;  3UT9 D;  5B2J D;  5CPI B;  5CPK B;  4XZQ C;  1P3L D;  3LJA D;  5JRG C;  3X1S C;  2PYO A;  3LZ1 B;  4J8X B;  4R8P A;  3AZI C;  2CV5 C;  4X23 B;  4NFT A;  5BS7 A;  5GSU D;  3REL D;  3B6F B;  4YM6 B;  4WU8 C;  3B6G D;  3VH6 W;  4Z5T D;  5DNN D;  4H9Q A;  1P3O B;  5AVB D;  3MGR A;  4JJN B;  5AY8 D;  5B1L C;  5B2I D;  2NZD B;  3AZG C;  3AZF B;  3C1C D;  5DNM C;  1S32 C;  3LZ0 D;  3AZH C;  1KX3 B;  5F99 A;  4J8V D;  5AV6 C;  5BNX B;  4Z66 D;  4HGA C;  3MGP A;  3WKJ D;  1F66 B;  2HIO C;  1HQ3 A;  2ARO A;  3AZE C;  2YFW A;  4G92 B;  3AZM C;  3X1V D;  5CP6 A;  1P3I A;  1BH9 B;  2BYM B;  4R8P B;  3R45 A;  3AN2 C;  3REH A;  5E5A A;  5B32 D;  3MGQ C;  1M19 D;  1ID3 C;  4KGC C;  3REK C;  5FUG A;  3MGS A;  1M18 B;  4H9Q B;  2FJ7 D;  4QLC D;  4YS3 C;  4J8U D;  3AZK D;  5KDM A;  2F8N A;  4ZUX A;  3A6N B;  4XZQ A;  3X1U C;  3UTA B;  4KUD C;  1P3P B;  2JSS A;  5JRG A;  3X1S A;  3AZI A;  2CV5 A;  5AVC B;  1EQZ D;  3B0C T;  4WU8 A;  5CPJ D;  3AYW B;  3AZN B;  5B1L A;  3KSY A;  5GT0 B;  3KUY C;  3AZG A;  4H9P A;  4EO5 C;  5DNM A;  1P3B C;  1S32 A;  4H9N A;  4UUZ A;  3AZH A;  5AV5 B;  5GXQ C;  3KWQ C;  3AV1 B;  1P3G D;  4H9O A;  5AV6 A;  3MGS B;  1P34 C;  2F8N K;  3REJ C;  1ULY A;  5B31 C;  3LEL B;  5KDM B;  3KXB D;  4CAY A;  4ZUX B;  2HIO A;  3WTP B;  3W99 C;  4XUJ D;  5G49 A;  4H9R A;  3AZE A;  3AZM A;  3AV2 D;  4Z2M H;  5B0Z B;  1P3A B;  1ZLA C;  3W98 B;  3AN2 A;  3WA9 C;  3AZL B;  3MGQ A;  1U35 D;  1ID3 A;  4KGC A;  3X1T B;  5GT3 B;  4YS3 A;  1Q9C A;  1P3F D;  5B33 C;  4H9P B;  3REI C;  3TU4 C;  3WAA D;  3UT9 C;  5B2J C;  3X1U A;  4Z2M G;  3NQJ A;  1P3L C;  3LJA C;  3O62 B;  5B24 B;  3UTB A;  5GSU C;  3REL C;  5CPK D;  5CPI D;  3C1B D;  3B6G C;  4G91 C;  2HIO B;  4Z5T C;  5DNN C;  2RVQ D;  5BO0 B;  5AY8 C;  5B2I C;  3LZ1 D;  3KUY A;  4J8X D;  3C1C C;  4X23 D;  4M6B A;  1P3B A;  3LZ0 C;  3B6F D;  4YM6 D;  5GXQ A;  3KWQ A;  1P3O D;  4Z66 C;  1P34 A;  4JJN D;  2NZD D;  3REJ A;  3AZF D;  4AWL C;  5B31 A;  3WKJ C;  3MNN B;  4E44 A;  1KX3 D;  5BT1 D;  1P3K B;  4J8W B;  3W99 A;  3X1V C;  5AV9 B;  1ZLA A;  3UTB B;  3MVD B;  3WA9 A;  4NE6 A;  4NE5 A;  1F66 D;  5B32 C;  3AZJ B;  1KX4 B;  2FJ7 C;  4QLC C;  4J8U C;  3AZK C;  3KUY B;  5B33 A;  1TZY B;  3REI A;  3TU4 A;  3UT9 A;  5B2J A;  1N1J B;  5AV8 B;  1P3L A;  3LJA A;  2L5A A;  1M18 D;  5B0Y B;  3REJ B;  4LD9 B;  5B40 B;  2CWE A;  1EQZ C;  5GSU A;  5BNV B;  3REL A;  3B6G A;  3A6N D;  5CPJ C;  4Z5T A;  5DNN A;  3UTA D;  1P3P D;  3AFA B;  5AY8 A; 
#chains in the Genus database with same CATH topology
 3C1C A;  5AVC D;  1KX5 A;  3LZ0 A;  2PYO B;  3AYW D;  1P3G C;  4WNN A;  3AZN D;  5B1M C;  2Y2Q A;  4Z66 A;  2HUE B;  3B0D B;  5GT0 D;  4CSR A;  3REI B;  3WKJ A;  3KXB C;  3TU4 B;  4WV4 B;  4H9S C;  3MGR B;  3UT9 B;  5AV5 D;  4ZBJ B;  4XUJ C;  3AV1 D;  3AV2 C;  3X1V A;  3MGS D;  2IO5 C;  1H3O A;  5F99 B;  3EPL A;  2F8N G;  3LEL D;  5GSU B;  5B32 A;  1U35 C;  3WTP D;  1TAF A;  3MGP B;  4Z5T B;  2FJ7 A;  4QLC A;  4KHA A;  2BYK A;  4J8U A;  5B0Z D;  1P3A D;  3AZK A;  1P3F C;  3W98 D;  2NQB C;  3AZL D;  1HQ3 B;  2ARO B;  1P3I B;  2YFW B;  1KX5 B;  5CP6 B;  2YFV A;  3R45 B;  3X1T D;  3REH B;  5GT3 D;  4WNN B;  5E5A B;  1AOI D;  2LY8 A;  4WU9 C;  1EQZ A;  5FUG B;  5CPK C;  5CPI C;  3C1B C;  5JA4 A;  3A1I A;  5CPJ A;  2RVQ C;  3W97 D;  2F8N B;  3O62 D;  3LZ1 C;  5B24 D;  4J8X C;  4XZQ B;  4X23 C;  5CHL B;  1P3M C;  3B6F C;  4YM6 C;  5JRG B;  3X1S B;  2Y2L A;  3KFU G;  2HIO D;  3AZI B;  2CV5 B;  1P3G A;  1P3O C;  5B1M A;  4JJN C;  4WU8 B;  3V9R A;  2NZD C;  3AZF C;  4J8U B;  3REK A;  3KXB A;  4H9S A;  1JFI A;  5BT1 C;  5B1L B;  3AZG B;  4XUJ A;  5C3I C;  3F6T A;  5DNM B;  3AV2 A;  1S32 B;  4H9N B;  4UUZ B;  3AZH B;  3W96 D;  3EPH A;  4KUD A;  4H9O B;  3MNN D;  5AV6 B;  3VH6 T;  3NQU A;  1U35 A;  1M1A D;  1P3K D;  5JA4 B;  4HGA B;  4J8W D;  2F2A C;  2G5H C;  4G92 C;  1BFM A;  2FFF B;  1B6W A;  4CAY B;  2J8P A;  5AV9 D;  1P3F A;  2ZY4 A;  3UTB D;  5G49 B;  3MVD D;  5AVB C;  2NQB A;  4H9R B;  3AZE B;  3AZM B;  2JE5 A;  4E45 A;  3AZJ D;  1KX4 D;  3AN2 B;  1WWS A;  1M18 C;  5B1M B;  3MGQ B;  1ID3 B;  1PZR A;  1F1E A;  3KUY D;  1TZY D;  4KGC B;  3REK B;  4J8V C;  4WU9 A;  5CPK A;  5CPI A;  3KXB B;  4YS3 B;  3C1B A;  3A6N C;  3FDD A;  3UTA C;  5AV8 D;  2ZY3 A;  1P3P C;  2ZY5 A;  5B0Y D;  4J8X A;  5B31 G;  3X1U B;  3REJ D;  4X23 A;  3NQJ B;  5B40 D;  5AVC C;  4LD9 D;  2Y2O A;  4KUD B;  1P3M A;  4YM6 A;  3VH5 W;  3AYW C;  3AFA D;  3AZN C;  1M19 C;  4JJN A;  3VH6 A;  5GT0 C;  2NZD A;  3AZF A;  2XD1 A;  1P3F B;  2Y2N A;  2NQB B;  5AV5 C;  2PYO D;  3H0M C;  4R8P D;  4DRB A;  3AV1 C;  4EO5 B;  1P3B B;  5BNX A;  3MGS C;  5GXQ B;  2Y2K A;  3KWQ B;  3LEL C;  4WU9 B;  3TU4 D;  3MGR D;  1P34 B;  3C1B B;  3WTP C;  5B31 B;  1BH9 A;  5F99 D;  5B0Z C;  2BYM A;  1P3A C;  3W98 C;  1BH8 A;  3W99 B;  5AVB A;  3AZL C;  5B2I A;  1P3M B;  2XD5 A;  1ZLA B;  3X1T C;  3MGP D;  4DRA A;  5GT3 C;  1M18 A;  3WA9 B;  2F8N H;  1AOI C;  4J8V A;  2BG1 A;  1HQ3 D;  2ARO D;  1P3I D;  3WTP E;  1KX5 D;  5CP6 D;  3A6N A;  1A7W A;  5B33 B;  3UTA A;  3W97 C;  3REH D;  1P3P A;  5C3I B;  3O62 C;  5E5A D;  5B2J B;  5B24 C;  5AVC A;  1P3L B;  3LJA B;  2G5I C;  3AYW A;  3AZN A;  2F8N D;  3REL B;  4ZUX D;  1M19 A;  5GT0 A;  3B6G B;  4G91 B;  4XZQ D;  5DNN B;  3P5J B;  1BH8 B;  5B32 G;  5AVB B;  5AV5 A;  5JRG D;  5B2I B;  5AY8 B;  3X1S D;  3AZI D;  3C1C B;  3AV1 A;  3WAA C;  2CV5 D;  2Y2M A;  3W96 C;  3LZ0 B;  4WU8 D;  3LEL A;  1B67 A;  3MNN C;  4J8V B;  4Z66 B;  5B1L D;  1M1A C;  4CSR B;  1P3K C;  3AZG D;  3WTP A;  4UPK A;  4J8W C;  4AWL B;  5DNM D;  3WKJ B;  1S32 D;  3AZH D;  5AV9 C;  5B0Z A;  1P3A A;  3W98 A;  3UTB C;  3MVD C;  3AZL A;  3X1V B;  5AV6 D;  3B0B A;  1H3O B;  3AZJ C;  1KX4 C;  3X1T A;  2Y2I A;  5GT3 A;  5B32 B;  1M19 B;  1AOI A;  1TZY C;  1TAF B;  2FJ7 B;  1WWI A;  3AZM D;  3AZE D;  4QLC B;  4KHA B;  2BYK B;  3AZK B;  5AV8 C;  3W97 A;  3AN2 D;  3O62 A;  1KX3 C;  5B1M D;  3VH5 T;  5B0Y C;  5B24 A;  3MGQ D;  1ID3 D;  2YFV B;  4LD9 C;  5B40 C;  4KGC D;  3REK D;  1R4V A;  4YS3 D;  5BO0 A;  3AFA C;  1EQZ B;  1F66 C;  4NE3 A;  3X1U D;  5CPJ B;  3EPK A;  4KUD D;  1Z2C B;  2PYO C;  4R8P C;  3WAA A;  5BS7 C;  3W96 A;  1KU5 A;  2HUE C;  3B0D C;  1AOI B;  1P3G B;  3MNN A;  2NQB D;  3MGR C;  3B0C W;  3V9R B;  1M1A A;  4ZBJ C;  1P3K A;  4J8W A;  1P3B D;  3W97 B;  5AV9 A;  1JFI B;  5F99 C;  5GXQ D;  4XUJ B;  3KWQ D;  3MVD A;  1HTA A;  4WU9 D;  3AV2 B;  3LZ1 A;  1P34 D;  2IO5 B;  3VH5 A;  3AZJ A;  1KX4 A;  5B31 D;  3MGP C;  3B6F A;  3EG5 B;  3NQU B;  1U35 B;  1TZY A;  3W99 D;  1P3O A;  1HQ3 C;  2ARO C;  1P3I C;  1KX5 C;  1N1J A;  1P3M D;  5CP6 C;  1ZLA D;  5AV8 A;  3REH C;  3WA9 D;  3WAA B;  1KX3 A;  5E5A C;  3W96 B;  5B0Y A;  4LD9 A;  5B40 A;  5BNV A;  2Y2P A;  2Y2H A;  1M1A B;  5B33 D;  3REI D;  4WZS B;  3AFA A;  1F66 A;  4ZUX C;  3UT9 D;  5B2J D;  5CPI B;  5CPK B;  4XZQ C;  1P3L D;  3LJA D;  5JRG C;  3X1S C;  2PYO A;  3LZ1 B;  4J8X B;  4R8P A;  3AZI C;  2CV5 C;  4X23 B;  4NFT A;  5BS7 A;  5GSU D;  3REL D;  3B6F B;  4YM6 B;  4WU8 C;  3B6G D;  3VH6 W;  4Z5T D;  5DNN D;  4H9Q A;  1P3O B;  5AVB D;  3MGR A;  4JJN B;  5AY8 D;  5B1L C;  5B2I D;  2NZD B;  3AZG C;  3AZF B;  3C1C D;  5DNM C;  2W8S A;  1S32 C;  3LZ0 D;  3AZH C;  1KX3 B;  5F99 A;  2VQR A;  4J8V D;  5AV6 C;  5BNX B;  4Z66 D;  1T3U A;  4HGA C;  3MGP A;  3WKJ D;  1F66 B;  2HIO C;  2Y2J A;  3H0R C;  1HQ3 A;  2ARO A;  3AZE C;  2YFW A;  4G92 B;  3AZM C;  3X1V D;  5CP6 A;  1P3I A;  1BH9 B;  2BYM B;  4R8P B;  3R45 A;  3AN2 C;  3REH A;  5E5A A;  5B32 D;  3MGQ C;  1M19 D;  1ID3 C;  4KGC C;  3REK C;  5FUG A;  3MGS A;  1M18 B;  4H9Q B;  2FJ7 D;  4QLC D;  4YS3 C;  4J8U D;  3AZK D;  5KDM A;  2F8N A;  4ZUX A;  3A6N B;  4XZQ A;  3X1U C;  3UTA B;  4KUD C;  2DF4 C;  1P3P B;  2JSS A;  2ZY2 A;  3H0L C;  3X1S A;  5JRG A;  3AZI A;  2CV5 A;  5AVC B;  1EQZ D;  3B0C T;  4WU8 A;  5CPJ D;  3AYW B;  3AZN B;  5B1L A;  3KSY A;  5GT0 B;  3KUY C;  3AZG A;  4H9P A;  4EO5 C;  2JCH A;  5DNM A;  1P3B C;  1S32 A;  4H9N A;  4UUZ A;  3AZH A;  5AV5 B;  5GXQ C;  3KWQ C;  3AV1 B;  1P3G D;  4H9O A;  5AV6 A;  3MGS B;  1P34 C;  2F8N K;  3REJ C;  1ULY A;  2DQN C;  5B31 C;  3LEL B;  5KDM B;  3IP4 C;  3KXB D;  4CAY A;  4ZUX B;  2HIO A;  3WTP B;  3W99 C;  4XUJ D;  5G49 A;  4H9R A;  3AZE A;  3AZM A;  3AV2 D;  4Z2M H;  3A1K A;  5B0Z B;  1P3A B;  1ZLA C;  3W98 B;  3AN2 A;  3WA9 C;  3AZL B;  3EPJ A;  3MGQ A;  1U35 D;  1ID3 A;  4KGC A;  3X1T B;  5GT3 B;  4YS3 A;  1Q9C A;  1P3F D;  5B33 C;  4H9P B;  3REI C;  3TU4 C;  3WAA D;  3UT9 C;  5B2J C;  3X1U A;  4Z2M G;  3NQJ A;  1P3L C;  3LJA C;  3O62 B;  5B24 B;  3UTB A;  2RIQ A;  5GSU C;  3REL C;  5CPK D;  5CPI D;  3C1B D;  3B6G C;  4G91 C;  2HIO B;  4Z5T C;  5DNN C;  2RVQ D;  5BO0 B;  2ZM5 A;  5AY8 C;  5B2I C;  3LZ1 D;  3KUY A;  4J8X D;  4WJ3 C;  3C1C C;  4X23 D;  4M6B A;  1P3B A;  3LZ0 C;  3B6F D;  4YM6 D;  5GXQ A;  3AL0 C;  3KWQ A;  1P3O D;  4Z66 C;  1P34 A;  4JJN D;  2NZD D;  3REJ A;  3AZF D;  4AWL C;  5B31 A;  3WKJ C;  3MNN B;  4E44 A;  1KX3 D;  5BT1 D;  1P3K B;  4J8W B;  3W99 A;  3X1V C;  5AV9 B;  1ZLA A;  3UTB B;  3MVD B;  3WA9 A;  4NE6 A;  2Y2G A;  4NE5 A;  1F66 D;  5B32 C;  3AZJ B;  1KX4 B;  2FJ7 C;  4QLC C;  4J8U C;  3AZK C;  3KUY B;  5B33 A;  1TZY B;  4DQY B;  3REI A;  3TU4 A;  3UT9 A;  5B2J A;  1N1J B;  5AV8 B;  1P3L A;  3LJA A;  2L5A A;  1M18 D;  5B0Y B;  3REJ B;  4LD9 B;  5B40 B;  2CWE A;  1EQZ C;  2UWX A;  1W2E A;  5BNV B;  5GSU A;  3REL A;  3B6G A;  3A6N D;  5CPJ C;  4Z5T A;  5DNN A;  3UTA D;  1P3P D;  3AFA B;  5AY8 A; 
#chains in the Genus database with same CATH homology
 3C1C A;  5AVC D;  1KX5 A;  3LZ0 A;  2PYO B;  3AYW D;  1P3G C;  4WNN A;  3AZN D;  5B1M C;  2Y2Q A;  4Z66 A;  2HUE B;  3B0D B;  5GT0 D;  4CSR A;  3REI B;  3WKJ A;  3KXB C;  3TU4 B;  4WV4 B;  4H9S C;  3MGR B;  3UT9 B;  5AV5 D;  4ZBJ B;  4XUJ C;  3AV1 D;  3AV2 C;  3X1V A;  3MGS D;  2IO5 C;  1H3O A;  5F99 B;  3EPL A;  2F8N G;  3LEL D;  5GSU B;  5B32 A;  1U35 C;  3WTP D;  1TAF A;  3MGP B;  4Z5T B;  2FJ7 A;  4QLC A;  4KHA A;  2BYK A;  4J8U A;  5B0Z D;  1P3A D;  3AZK A;  1P3F C;  3W98 D;  2NQB C;  3AZL D;  1HQ3 B;  2ARO B;  1P3I B;  2YFW B;  1KX5 B;  5CP6 B;  2YFV A;  3R45 B;  3X1T D;  3REH B;  5GT3 D;  4WNN B;  5E5A B;  1AOI D;  2LY8 A;  4WU9 C;  1EQZ A;  5FUG B;  5CPK C;  5CPI C;  3C1B C;  5JA4 A;  3A1I A;  5CPJ A;  2RVQ C;  3W97 D;  2F8N B;  3O62 D;  3LZ1 C;  5B24 D;  4J8X C;  4XZQ B;  4X23 C;  5CHL B;  1P3M C;  3B6F C;  4YM6 C;  5JRG B;  3X1S B;  2Y2L A;  3KFU G;  2HIO D;  3AZI B;  2CV5 B;  1P3G A;  1P3O C;  5B1M A;  4JJN C;  4WU8 B;  3V9R A;  2NZD C;  3AZF C;  4J8U B;  3REK A;  3KXB A;  4H9S A;  1JFI A;  5BT1 C;  5B1L B;  3AZG B;  4XUJ A;  5C3I C;  3F6T A;  5DNM B;  3AV2 A;  1S32 B;  4H9N B;  4UUZ B;  3AZH B;  3W96 D;  3EPH A;  4KUD A;  4H9O B;  3MNN D;  5AV6 B;  3VH6 T;  3NQU A;  1U35 A;  1M1A D;  1P3K D;  5JA4 B;  4HGA B;  4J8W D;  2F2A C;  2G5H C;  4G92 C;  1BFM A;  2FFF B;  1B6W A;  4CAY B;  2J8P A;  5AV9 D;  1P3F A;  2ZY4 A;  3UTB D;  5G49 B;  3MVD D;  5AVB C;  2NQB A;  4H9R B;  3AZE B;  3AZM B;  2JE5 A;  4E45 A;  3AZJ D;  1KX4 D;  3AN2 B;  1WWS A;  1M18 C;  5B1M B;  3MGQ B;  1ID3 B;  1PZR A;  1F1E A;  3KUY D;  1TZY D;  4KGC B;  3REK B;  4J8V C;  4WU9 A;  5CPK A;  5CPI A;  3KXB B;  4YS3 B;  3C1B A;  3A6N C;  3FDD A;  3UTA C;  5AV8 D;  2ZY3 A;  1P3P C;  2ZY5 A;  5B0Y D;  4J8X A;  5B31 G;  3X1U B;  3REJ D;  4X23 A;  3NQJ B;  5B40 D;  5AVC C;  4LD9 D;  2Y2O A;  4KUD B;  1P3M A;  4YM6 A;  3VH5 W;  3AYW C;  3AFA D;  3AZN C;  1M19 C;  4JJN A;  3VH6 A;  5GT0 C;  2NZD A;  3AZF A;  2XD1 A;  1P3F B;  2Y2N A;  2NQB B;  5AV5 C;  2PYO D;  3H0M C;  4R8P D;  4DRB A;  3AV1 C;  4EO5 B;  1P3B B;  5BNX A;  3MGS C;  5GXQ B;  2Y2K A;  3KWQ B;  3LEL C;  4WU9 B;  3TU4 D;  3MGR D;  1P34 B;  3C1B B;  3WTP C;  5B31 B;  1BH9 A;  5F99 D;  5B0Z C;  2BYM A;  1P3A C;  3W98 C;  1BH8 A;  3W99 B;  5AVB A;  3AZL C;  5B2I A;  1P3M B;  2XD5 A;  1ZLA B;  3X1T C;  3MGP D;  4DRA A;  5GT3 C;  1M18 A;  3WA9 B;  2F8N H;  1AOI C;  4J8V A;  2BG1 A;  1HQ3 D;  2ARO D;  1P3I D;  3WTP E;  1KX5 D;  5CP6 D;  3A6N A;  1A7W A;  5B33 B;  3UTA A;  3W97 C;  3REH D;  1P3P A;  5C3I B;  3O62 C;  5E5A D;  5B2J B;  5B24 C;  5AVC A;  1P3L B;  3LJA B;  2G5I C;  3AYW A;  3AZN A;  2F8N D;  3REL B;  4ZUX D;  1M19 A;  5GT0 A;  3B6G B;  4G91 B;  4XZQ D;  5DNN B;  3P5J B;  1BH8 B;  5B32 G;  5AVB B;  5AV5 A;  5JRG D;  5B2I B;  5AY8 B;  3X1S D;  3AZI D;  3C1C B;  3AV1 A;  3WAA C;  2CV5 D;  2Y2M A;  3W96 C;  3LZ0 B;  4WU8 D;  3LEL A;  1B67 A;  3MNN C;  4J8V B;  4Z66 B;  5B1L D;  1M1A C;  4CSR B;  1P3K C;  3AZG D;  3WTP A;  4UPK A;  4J8W C;  4AWL B;  5DNM D;  3WKJ B;  1S32 D;  3AZH D;  5AV9 C;  5B0Z A;  1P3A A;  3W98 A;  3UTB C;  3MVD C;  3AZL A;  3X1V B;  5AV6 D;  3B0B A;  1H3O B;  3AZJ C;  1KX4 C;  3X1T A;  2Y2I A;  5GT3 A;  5B32 B;  1M19 B;  1AOI A;  1TZY C;  1TAF B;  2FJ7 B;  1WWI A;  3AZM D;  3AZE D;  4QLC B;  4KHA B;  2BYK B;  3AZK B;  5AV8 C;  3W97 A;  3AN2 D;  3O62 A;  1KX3 C;  5B1M D;  3VH5 T;  5B0Y C;  5B24 A;  3MGQ D;  1ID3 D;  2YFV B;  4LD9 C;  5B40 C;  4KGC D;  3REK D;  1R4V A;  4YS3 D;  5BO0 A;  3AFA C;  1EQZ B;  1F66 C;  4NE3 A;  3X1U D;  5CPJ B;  3EPK A;  4KUD D;  1Z2C B;  2PYO C;  4R8P C;  3WAA A;  5BS7 C;  3W96 A;  1KU5 A;  2HUE C;  3B0D C;  1AOI B;  1P3G B;  3MNN A;  2NQB D;  3MGR C;  3B0C W;  3V9R B;  1M1A A;  4ZBJ C;  1P3K A;  4J8W A;  1P3B D;  3W97 B;  5AV9 A;  1JFI B;  5F99 C;  5GXQ D;  4XUJ B;  3KWQ D;  3MVD A;  1HTA A;  4WU9 D;  3AV2 B;  3LZ1 A;  1P34 D;  2IO5 B;  3VH5 A;  3AZJ A;  1KX4 A;  5B31 D;  3MGP C;  3B6F A;  3EG5 B;  3NQU B;  1U35 B;  1TZY A;  3W99 D;  1P3O A;  1HQ3 C;  2ARO C;  1P3I C;  1KX5 C;  1N1J A;  1P3M D;  5CP6 C;  1ZLA D;  5AV8 A;  3REH C;  3WA9 D;  3WAA B;  1KX3 A;  5E5A C;  3W96 B;  5B0Y A;  4LD9 A;  5B40 A;  5BNV A;  2Y2P A;  2Y2H A;  1M1A B;  5B33 D;  3REI D;  4WZS B;  3AFA A;  1F66 A;  4ZUX C;  3UT9 D;  5B2J D;  5CPI B;  5CPK B;  4XZQ C;  1P3L D;  3LJA D;  5JRG C;  3X1S C;  2PYO A;  3LZ1 B;  4J8X B;  4R8P A;  3AZI C;  2CV5 C;  4X23 B;  4NFT A;  5BS7 A;  5GSU D;  3REL D;  3B6F B;  4YM6 B;  4WU8 C;  3B6G D;  3VH6 W;  4Z5T D;  5DNN D;  4H9Q A;  1P3O B;  5AVB D;  3MGR A;  4JJN B;  5AY8 D;  5B1L C;  5B2I D;  2NZD B;  3AZG C;  3AZF B;  3C1C D;  5DNM C;  2W8S A;  1S32 C;  3LZ0 D;  3AZH C;  1KX3 B;  5F99 A;  2VQR A;  4J8V D;  5AV6 C;  5BNX B;  4Z66 D;  1T3U A;  4HGA C;  3MGP A;  3WKJ D;  1F66 B;  2HIO C;  2Y2J A;  3H0R C;  1HQ3 A;  2ARO A;  3AZE C;  2YFW A;  4G92 B;  3AZM C;  3X1V D;  5CP6 A;  1P3I A;  1BH9 B;  2BYM B;  4R8P B;  3R45 A;  3AN2 C;  3REH A;  5E5A A;  5B32 D;  3MGQ C;  1M19 D;  1ID3 C;  4KGC C;  3REK C;  5FUG A;  3MGS A;  1M18 B;  4H9Q B;  2FJ7 D;  4QLC D;  4YS3 C;  4J8U D;  3AZK D;  5KDM A;  2F8N A;  4ZUX A;  3A6N B;  4XZQ A;  3X1U C;  3UTA B;  4KUD C;  2DF4 C;  1P3P B;  2JSS A;  2ZY2 A;  3H0L C;  3X1S A;  5JRG A;  3AZI A;  2CV5 A;  5AVC B;  1EQZ D;  3B0C T;  4WU8 A;  5CPJ D;  3AYW B;  3AZN B;  5B1L A;  3KSY A;  5GT0 B;  3KUY C;  3AZG A;  4H9P A;  4EO5 C;  2JCH A;  5DNM A;  1P3B C;  1S32 A;  4H9N A;  4UUZ A;  3AZH A;  5AV5 B;  5GXQ C;  3KWQ C;  3AV1 B;  1P3G D;  4H9O A;  5AV6 A;  3MGS B;  1P34 C;  2F8N K;  3REJ C;  1ULY A;  2DQN C;  5B31 C;  3LEL B;  5KDM B;  3IP4 C;  3KXB D;  4CAY A;  4ZUX B;  2HIO A;  3WTP B;  3W99 C;  4XUJ D;  5G49 A;  4H9R A;  3AZE A;  3AZM A;  3AV2 D;  4Z2M H;  3A1K A;  5B0Z B;  1P3A B;  1ZLA C;  3W98 B;  3AN2 A;  3WA9 C;  3AZL B;  3EPJ A;  3MGQ A;  1U35 D;  1ID3 A;  4KGC A;  3X1T B;  5GT3 B;  4YS3 A;  1Q9C A;  1P3F D;  5B33 C;  4H9P B;  3REI C;  3TU4 C;  3WAA D;  3UT9 C;  5B2J C;  3X1U A;  4Z2M G;  3NQJ A;  1P3L C;  3LJA C;  3O62 B;  5B24 B;  3UTB A;  2RIQ A;  5GSU C;  3REL C;  5CPK D;  5CPI D;  3C1B D;  3B6G C;  4G91 C;  2HIO B;  4Z5T C;  5DNN C;  2RVQ D;  5BO0 B;  2ZM5 A;  5AY8 C;  5B2I C;  3LZ1 D;  3KUY A;  4J8X D;  4WJ3 C;  3C1C C;  4X23 D;  4M6B A;  1P3B A;  3LZ0 C;  3B6F D;  4YM6 D;  5GXQ A;  3AL0 C;  3KWQ A;  1P3O D;  4Z66 C;  1P34 A;  4JJN D;  2NZD D;  3REJ A;  3AZF D;  4AWL C;  5B31 A;  3WKJ C;  3MNN B;  4E44 A;  1KX3 D;  5BT1 D;  1P3K B;  4J8W B;  3W99 A;  3X1V C;  5AV9 B;  1ZLA A;  3UTB B;  3MVD B;  3WA9 A;  4NE6 A;  2Y2G A;  4NE5 A;  1F66 D;  5B32 C;  3AZJ B;  1KX4 B;  2FJ7 C;  4QLC C;  4J8U C;  3AZK C;  3KUY B;  5B33 A;  1TZY B;  4DQY B;  3REI A;  3TU4 A;  3UT9 A;  5B2J A;  1N1J B;  5AV8 B;  1P3L A;  3LJA A;  2L5A A;  1M18 D;  5B0Y B;  3REJ B;  4LD9 B;  5B40 B;  2CWE A;  1EQZ C;  2UWX A;  1W2E A;  5BNV B;  5GSU A;  3REL A;  3B6G A;  3A6N D;  5CPJ C;  4Z5T A;  5DNN A;  3UTA D;  1P3P D;  3AFA B;  5AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...