2PYOC

Drosophila nucleosome core
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoC00
4Z5TC 2CV5A 4AWLC 4Z2MH 1P3IC 3MVDB 4KUDB 4H9SC 4EO5B 5B0ZA 2F8ND 5BNXA 2NQBA 3LZ1A 2IO5C 4UUZB 2NQBB 3LZ1B 4XZQA 3LJAC 3WTPB 3C1CD 3LELD 3REHD 3KUYD 5B40C 1TAFB 1P3MA 5AV8B 4Z5TB 3REKC 4H9RB 3MVDD 4AWLB 1P3IB 3LZ0C 1KX5A 4KUDD 1P3PA 1P3OA 5GSUC 5BNVA 3AZNC 1BH9B 3AV2C 3AZLA 2F8NG 2IO5B 4LD9D 5B1LA 3LJAB 3WTPD 5GXQC 4WU9C 2PYOD 3AZEC 3AZJA 5AV8D 2CWEA 5B40B 5CPKA 3AZIA 4H9OA 4Z5TD 3REKB 1EQZA 5AY8A 3LZ0B 5GSUA 1ULYA 5F99C 5GSUB 3AZNB 3AV2A 3AV2B 5CP6D 2AROC 3UTAA 3W96A 1S32C 3AZEA 3B6FC 5GXQB 4WU9B 3AZEB 5B32A 1KX3D 4HGAC 2RVQC 3REKD 2FJ7A 5E5AA 4Z66C 3W99A 5F99B 3AZND 3A6ND 4J8XC 3X1TD 3X1VA 5BT1C 1P34D 2AROA 2AROB 5GXQD 4WU9D 1S32B 3UTBA 3B6FB 4HGAB 4YM6D 3KWQD 4KGCC 1P3LC 4Z66B 1M19A 3MGQA 5AV9D 5F99D 3VH5T 4WNNA 2NZDC 4J8XB 4WNNB 1KX4C 5B24A 3KXBC 5KDMA 5CPID 1S32D 3B6FD 3X1SA 3MGSC 2RVQD 4R8PA 4Z66D 4KGCB 1P3LB 4G92C 1WWIA 4YS3A 1M1AC 5DNNA 3AYWD 3MGPD 2NZDB 1KX4B 4E44A 3KXBB 3MGSA 3MGSB 1P3AC 5FUGA 3B0BA 1U35D 1P3LD 3REIC 5AVBA 4G92B 1M1AB 4J8VD 5C3IC 3W97D 2NZDD 1KX4D 1AOIC 5AV5C 3NQUB 5B2JD 3KXBD 2F8NA 5B1MC 1P3AB 3RELD 4LD9C 3AFAC 3C1CA 3REIB 1M1AD 3LELA 3REHA 3KUYA 2PYOC 5C3IB 3R45B 5B33D 2HIOD 3MVDA 1AOIB 5AV5B 4KUDA 4JJND 1P3AD 4UUZA 5B1MB 2YFWB 3WTPA 3AFAB 5CP6C 4LD9B 3REID 1TAFA 3NQJB 5AV8A 5AV6C 2PYOB 1KX3C 4H9QB 1P3BD 4Z5TA 4H9RA 1WWSA 5B31C 1AOID 1P3IA 5AV5D 4NE5A 4H9SA 1BH9A 3A6NC 3X1TC 3W98D 5B1MD 3LJAA 4DRBA 5CP6A 3AFAD 1P34C 5CP6B 4J8WC 3AZFC 5B40A 5JA4B 5AV6B 4Z2MG 5B2IC 2YFVA 1KX3B 3REKA 4YM6C 3KWQC 2JSSA 2YFVB 5B31B 3LZ0A 4H9PB 4KHAB 5AV9C 3AZNA 3A6NA 3X1TA 3A6NB 3X1TB 1KU5A 1P34A 1P34B 5CPIC 5JRGC 5GXQA 4J8WB 4WU9A 3AZFB 5AV6D 1JFIB 4YM6A 5B2IB 5B31D 4YM6B 3KWQB 1H3OA 1H3OB 4CSRB 5AV9A 4X23C 5F99A 4CAYA 2L5AA 5AV9B 3AYWC 4CAYB 5GT3D 3MGPC 3AV1C 1P3PD 5CPIA 4J8WD 1S32A 3B6FA 5JRGB 3AZFD 5CPIB 5B2ID 4XUJC 3V9RA 5B31G 1P3FC 3V9RB 4Z66A 1U35C 3AZGC 5CPKD 5GT0C 4X23B 4J8VC 3AYWA 3W97C 4J8XA 3AYWB 3MGPB 1P3KC 4WU8D 3VH6W 5DNMC 3AZMD 3AV1B 4E45A 1Q9CA 5B2JC 4QLCC 5JRGD 1ZLAC 1B6WA 3UTAD 4XUJB 3RELC 4KGCA 1P3FB 1P3LA 3UT9C 3AZKC 3AZGB 1U35B 4X23D 5GT0B 3W97A 3B0CW 4J8VB 2NZDA 2FJ7D 3W97B 3REJC 5B33C 1KX4A 5BO0B 3AV1D 1P3KB 1HQ3C 1F1EA 2HIOC 3MNNC 5DNMB 4ZUXC 5B2JA 3TU4C 3B6GD 3KXBA 3MGRC 5B2JB 4QLCB 4JJNC 1ZLAB 1TZYC 4H9NB 4XUJD 3RELA 1P3FD 3VH6A 3RELB 4J8UC 3UT9B 3AZGD 3AN2D 1M1AA 3AZKB 5GT0D 3WAAC 5B33A 3O62C 1P3BC 2LY8A 3X1UD 3REJB 5B33B 4NE6A 2HIOA 3C1BC 1P3KD 5DNMD 3NQUA 1F66C 3WKJD 1HQ3B 2HIOB 3MNNB 4ZUXB 5B0YD 3TU4B 3MGRB 4QLCD 2F8NK 1BH8B 4JJNB 1P3AA 3W98C 1ZLAD 3WA9D 5AVCC 1TZYB 2BYKB 3X1SD 3REIA 3UT9D 4J8UB 3AZKD 3R45A 4R8PD 2BYMB 3REJD 3O62B 1P3BB 3WAAB 1AOIA 3C1BB 1HQ3D 3MNND 5AV5A 1F66B 4ZUXD 3KUYB 3TU4D 5CPJD 3MGRD 5BS7C 2CV5C 4DRAA 5B1MA 3W98B 2YFWA 1TZYD 1ID3D 4LD9A 3AFAA 5AVCB 4J8UD 5B0ZC 3NQJA 2PYOA 4H9QA 4XZQC 2F8NH 3O62D 3WAAD 3C1BD 1M18D 1F66D 4WV4B 1P3MC 3AZHD 2CV5B 5GT3C 1KX5C 2HUEC 5AVCD 1P3PC 1P3OC 5B0ZB 3AZLC 5BNXB 5JA4A 5AV6A 1KX3A 4XZQB 5B1LC 5B31A 4H9PA 1P3GD 3AZJC 5CPKC 4KHAA 1P3MB 3AZIC 2CV5D 5GT3A 5GT3B 4WU8C 4WZSB 5AY8C 3VH5W 2HUEB 1KX5B 3AZMC 1EQZC 1P3PB 1P3OB 5BNVB 5B0ZD 4J8WA 2NQBD 3LZ1D 3AZFA 3AZLB 1B67A 1JFIA 4XZQD 5B2IA 3UTAC 5B1LB 3KWQA 3W96C 4CSRA 5B32C 1P3MD 3AZJB 5CPKB 3AZIB 4H9OB 1P3ID 3WTPE 2FJ7C 5E5AC 4WU8A 1KX5D 3AZMA 4WU8B 1EQZB 5AY8B 1P3OD 3AZMB 3B6GC 3W99C 3KSYA 3X1VC 5JRGA 3AZLD 3LJAD 5B1LD 3UTAB 3W96B 3VH5A 5B40D 3UTBC 3AZJD 3AN2C 4X23A 5B32B 3AZID 3MGPA 3LZ0D 2FJ7B 1N1JA 5E5AB 3X1UC 5AY8D 3AV1A 1M19C 1EQZD 1N1JB 5GSUD 3MGQC 3B6GA 3WKJC 3B6GB 5B0YC 3W99B 3AV2D 3X1VB 1HTAA 5B24C 3WA9C 4XUJA 3W96D 1P3FA 3AZED 1U35A 3AZGA 3X1SC 3AN2A 5B32D 3UTBB 5GT0A 3AN2B 4J8VA 4R8PC 5E5AD 5BO0A 3X1UA 1P3KA 5DNMA 3X1UB 4YS3C 1M19B 3WKJA 3MGQB 5DNNC 5B0YA 3W99D 3WKJB 5CPJC 5B0YB 5G49A 4QLCA 3X1VD 5G49B 1ZLAA 3WA9A 2AROD 5B24B 4H9NA 3WA9B 1ID3C 5KDMB 3UT9A 3UTBD 3X1SB 3AZKA 4NE3A 5B32G 4G91C 4R8PB 3REJA 1BFMA 5AVBC 1M19D 1HQ3A 3MNNA 1M18C 1R4VA 4ZUXA 3MGQD 3TU4A 4YS3B 3MGRA 5CPJA 5DNNB 4J8XD 5CPJB 3AZHC 1BH8A 4JJNA 5BT1D 5B24D 5CHLB 1TZYA 1ID3A 4NFTA 2BYKA 1ID3B 4J8UA 5FUGB 3B0DC 4G91B 2BYMA 4ZBJC 3O62A 1A7WA 1P3BA 3WAAA 4KGCD 3C1BA 1M18A 3C1CC 4YS3D 5AVBB 3LELC 1M18B 1F66A 3REHC 3KUYC 3VH6T 5DNND 1P3GC 3AZHA 3AZHB 3MVDC 3W98A 4KUDC 5AVCA 4EO5C 4M6BA 3MGSD 2F8NB 2NQBC 3LZ1C 3B0DB 4ZBJB 3WTPC 3B0CT 5AVBD 3C1CB 3LELB 1P3GA 3REHB 5AV8C 1P3GB 5BS7A
chains in the Genus database with same CATH superfamily
4Z5TC 2CV5A 4AWLC 4Z2MH 1P3IC 3MVDB 4KUDB 4H9SC 4EO5B 5B0ZA 2F8ND 5BNXA 2NQBA 3LZ1A 2IO5C 4UUZB 2NQBB 3LZ1B 4XZQA 3LJAC 3WTPB 3C1CD 3LELD 2ZY5A 3REHD 3KUYD 5B40C 1TAFB 1P3MA 5AV8B 4Z5TB 3REKC 4H9RB 3MVDD 4AWLB 1P3IB 3LZ0C 1KX5A 4KUDD 1P3PA 1P3OA 2JE5A 5GSUC 5BNVA 3AZNC 1BH9B 3AV2C 3AZLA 2F8NG 2IO5B 4LD9D 5B1LA 3LJAB 3WTPD 5GXQC 4WU9C 2PYOD 3AZEC 3AZJA 5AV8D 2CWEA 5B40B 5CPKA 3AZIA 4H9OA 4Z5TD 3REKB 4UPKA 2ZY2A 1EQZA 5AY8A 3LZ0B 5GSUA 1ULYA 5F99C 5GSUB 3AZNB 3AV2A 3AV2B 5CP6D 2AROC 3UTAA 3W96A 1S32C 3AZEA 3B6FC 5GXQB 4WU9B 3AZEB 5B32A 1KX3D 4HGAC 2RVQC 3REKD 2FJ7A 5E5AA 4Z66C 3W99A 5F99B 3AZND 3A6ND 4J8XC 3X1TD 3X1VA 5BT1C 1P34D 2AROA 2AROB 5GXQD 4WU9D 3EPKA 1S32B 3UTBA 3B6FB 4HGAB 4YM6D 3KWQD 3H0RC 4KGCC 1P3LC 4Z66B 1M19A 3MGQA 5AV9D 5F99D 3VH5T 4WNNA 2NZDC 4J8XB 4WNNB 1KX4C 5B24A 4WJ3C 3KXBC 5KDMA 5CPID 1S32D 3B6FD 3X1SA 3MGSC 2RVQD 4R8PA 3AL0C 3FDDA 4Z66D 4KGCB 1P3LB 4G92C 1WWIA 4YS3A 1M1AC 2Y2JA 5DNNA 3AYWD 2G5IC 3MGPD 2NZDB 1KX4B 2Y2HA 4E44A 2RIQA 3KXBB 3MGSA 3MGSB 1P3AC 5FUGA 3B0BA 1U35D 1P3LD 3REIC 5AVBA 4G92B 1M1AB 4J8VD 5C3IC 3W97D 2NZDD 1KX4D 1AOIC 5AV5C 3NQUB 5B2JD 2Y2MA 3KXBD 2F8NA 5B1MC 1P3AB 2Y2KA 3RELD 4LD9C 3AFAC 3C1CA 3REIB 1M1AD 3LELA 3REHA 3KUYA 2PYOC 5C3IB 3R45B 2VQRA 5B33D 2HIOD 3MVDA 3IP4C 1AOIB 1T3UA 5AV5B 4KUDA 4JJND 1P3AD 4UUZA 5B1MB 2Y2OA 2YFWB 3WTPA 3AFAB 5CP6C 4LD9B 3REID 3A1IA 1TAFA 3NQJB 5AV8A 5AV6C 2PYOB 1KX3C 4H9QB 1P3BD 4Z5TA 4H9RA 1WWSA 5B31C 1AOID 1P3IA 5AV5D 4NE5A 4H9SA 1BH9A 3A6NC 3X1TC 3W98D 5B1MD 3LJAA 4DRBA 5CP6A 3AFAD 1P34C 5CP6B 4J8WC 3AZFC 5B40A 5JA4B 5AV6B 4Z2MG 5B2IC 2YFVA 1KX3B 3REKA 4YM6C 3KWQC 2JSSA 2YFVB 5B31B 3LZ0A 4H9PB 2Y2PA 4KHAB 5AV9C 3AZNA 3A6NA 3X1TA 3A6NB 3X1TB 1KU5A 1P34A 1P34B 2DQNC 5CPIC 2F2AC 5JRGC 5GXQA 4J8WB 4WU9A 2G5HC 3AZFB 5AV6D 1JFIB 4YM6A 5B2IB 5B31D 2Y2GA 4YM6B 3KWQB 1H3OA 1H3OB 4CSRB 5AV9A 4X23C 5F99A 4CAYA 2L5AA 5AV9B 3AYWC 4CAYB 5GT3D 3MGPC 3AV1C 1P3PD 3EPLA 5CPIA 4J8WD 1S32A 3B6FA 5JRGB 3AZFD 5CPIB 3H0LC 1W2EA 5B2ID 4XUJC 3V9RA 5B31G 1P3FC 3V9RB 4Z66A 1U35C 3AZGC 5CPKD 5GT0C 4X23B 4J8VC 3AYWA 3W97C 4J8XA 3AYWB 3MGPB 1P3KC 4WU8D 3VH6W 5DNMC 3AZMD 3AV1B 4E45A 1Q9CA 5B2JC 4QLCC 5JRGD 1ZLAC 1B6WA 3UTAD 4XUJB 3RELC 4KGCA 1P3FB 1P3LA 3UT9C 3AZKC 3AZGB 1U35B 4X23D 5GT0B 3W97A 3B0CW 3H0MC 4J8VB 2FJ7D 3W97B 2NZDA 1P3BC 3REJC 5B33C 1KX4A 5BO0B 3AV1D 1P3KB 1HQ3C 1F1EA 2HIOC 3MNNC 5DNMB 4ZUXC 5B2JA 3TU4C 3B6GD 3KXBA 3MGRC 5B2JB 4QLCB 4JJNC 3A1KA 1ZLAB 1TZYC 4H9NB 4XUJD 3RELA 1P3FD 3VH6A 3RELB 4J8UC 3UT9B 3AZGD 3AN2D 1M1AA 3AZKB 2J8PA 5GT0D 3WAAC 1PZRA 5B33A 3O62C 2LY8A 3X1UD 3REJB 5B33B 4NE6A 2HIOA 3C1BC 1P3KD 5DNMD 3NQUA 1F66C 3WKJD 1HQ3B 2HIOB 3MNNB 4ZUXB 5B0YD 3TU4B 2Y2IA 3MGRB 4QLCD 2F8NK 1BH8B 4JJNB 1P3AA 3W98C 1ZLAD 3WA9D 5AVCC 1TZYB 2BYKB 3X1SD 2Y2LA 3REIA 4J8UB 3UT9D 3AZKD 2XD1A 3R45A 4R8PD 2BYMB 3REJD 3O62B 1P3BB 3WAAB 1AOIA 3C1BB 1HQ3D 3MNND 5AV5A 1F66B 4ZUXD 3KUYB 3TU4D 5CPJD 3MGRD 2Y2NA 5BS7C 2CV5C 4DRAA 5B1MA 3W98B 2YFWA 1TZYD 1ID3D 4LD9A 3AFAA 5AVCB 3EG5B 4DQYB 4J8UD 5B0ZC 3NQJA 2PYOA 2JCHA 4H9QA 4XZQC 2F8NH 2ZM5A 3O62D 3WAAD 3C1BD 1M18D 1F66D 4WV4B 1P3MC 3AZHD 2CV5B 5GT3C 1KX5C 2HUEC 5AVCD 1P3PC 1P3OC 2DF4C 5B0ZB 2BG1A 5BNXB 3AZLC 5JA4A 5AV6A 1KX3A 4XZQB 5B1LC 5B31A 4H9PA 1P3GD 3AZJC 5CPKC 4KHAA 1P3MB 3AZIC 2CV5D 5GT3A 5GT3B 4WU8C 4WZSB 5AY8C 3VH5W 2HUEB 1KX5B 3AZMC 1EQZC 1P3PB 1P3OB 5BNVB 5B0ZD 4J8WA 2NQBD 2ZY4A 3LZ1D 3AZFA 3AZLB 1B67A 1JFIA 4XZQD 5B2IA 3UTAC 5B1LB 3KWQA 3W96C 4CSRA 5B32C 1P3MD 3AZJB 5CPKB 3AZIB 4H9OB 1P3ID 3WTPE 2FJ7C 5E5AC 4WU8A 1KX5D 3AZMA 4WU8B 1EQZB 5AY8B 1P3OD 3AZMB 3B6GC 3W99C 3KSYA 3X1VC 5JRGA 3AZLD 3LJAD 5B1LD 3UTAB 3W96B 3VH5A 5B40D 3UTBC 3AZJD 3AN2C 4X23A 5B32B 3AZID 3MGPA 2XD5A 3LZ0D 2FJ7B 1N1JA 5E5AB 3X1UC 5AY8D 3AV1A 1M19C 1EQZD 1N1JB 5GSUD 2Y2QA 3MGQC 3B6GA 3WKJC 3B6GB 5B0YC 3W99B 3AV2D 3X1VB 1HTAA 5B24C 2UWXA 3WA9C 4XUJA 3W96D 1P3FA 3AZED 1U35A 2W8SA 3AZGA 3X1SC 3AN2A 5B32D 3UTBB 5GT0A 3AN2B 4J8VA 4R8PC 5E5AD 5BO0A 3X1UA 1P3KA 5DNMA 3X1UB 4YS3C 1M19B 3WKJA 2FFFB 3MGQB 5DNNC 5B0YA 3W99D 3WKJB 5CPJC 5B0YB 5G49A 4QLCA 3X1VD 5G49B 3P5JB 1ZLAA 3WA9A 2AROD 5B24B 4H9NA 3WA9B 1ID3C 3KFUG 5KDMB 3UT9A 3UTBD 3X1SB 3AZKA 4NE3A 5B32G 4G91C 4R8PB 3REJA 3EPJA 1BFMA 1Z2CB 5AVBC 1M19D 1HQ3A 3MNNA 1M18C 1R4VA 4ZUXA 3MGQD 3TU4A 4YS3B 3MGRA 5CPJA 5DNNB 4J8XD 3EPHA 5CPJB 3AZHC 1BH8A 4JJNA 5BT1D 5B24D 5CHLB 1TZYA 1ID3A 4NFTA 2BYKA 1ID3B 4J8UA 5FUGB 3B0DC 4G91B 2BYMA 4ZBJC 3O62A 1A7WA 1P3BA 3WAAA 4KGCD 3C1BA 1M18A 3C1CC 4YS3D 5AVBB 3LELC 1M18B 1F66A 3REHC 3KUYC 3VH6T 5DNND 1P3GC 3AZHA 3AZHB 3MVDC 3W98A 4KUDC 5AVCA 4EO5C 4M6BA 3MGSD 2F8NB 2NQBC 2ZY3A 3LZ1C 3B0DB 4ZBJB 3WTPC 3B0CT 3F6TA 5AVBD 3C1CB 3LELB 1P3GA 3REHB 5AV8C 1P3GB 5BS7A
chains in the Genus database with same CATH topology
4Z5TC 2CV5A 4AWLC 4Z2MH 1P3IC 3MVDB 4KUDB 4H9SC 4EO5B 5B0ZA 2F8ND 5BNXA 2NQBA 3LZ1A 2IO5C 4UUZB 2NQBB 3LZ1B 4XZQA 3LJAC 3WTPB 3C1CD 3LELD 2ZY5A 3REHD 3KUYD 5B40C 1TAFB 1P3MA 5AV8B 4Z5TB 3REKC 4H9RB 3MVDD 4AWLB 1P3IB 3LZ0C 1KX5A 4KUDD 1P3PA 1P3OA 2JE5A 5GSUC 5BNVA 3AZNC 1BH9B 3AV2C 3AZLA 2F8NG 2IO5B 4LD9D 5B1LA 3LJAB 3WTPD 5GXQC 4WU9C 2PYOD 3AZEC 3AZJA 5AV8D 2CWEA 5B40B 5CPKA 3AZIA 4H9OA 4Z5TD 3REKB 4UPKA 2ZY2A 1EQZA 5AY8A 3LZ0B 5GSUA 1ULYA 5F99C 5GSUB 3AZNB 3AV2A 3AV2B 5CP6D 2AROC 3UTAA 3W96A 1S32C 3AZEA 3B6FC 5GXQB 4WU9B 3AZEB 5B32A 1KX3D 4HGAC 2RVQC 3REKD 2FJ7A 5E5AA 4Z66C 3W99A 5F99B 3AZND 3A6ND 4J8XC 3X1TD 3X1VA 5BT1C 1P34D 2AROA 2AROB 5GXQD 4WU9D 3EPKA 1S32B 3UTBA 3B6FB 4HGAB 4YM6D 3KWQD 3H0RC 4KGCC 1P3LC 4Z66B 1M19A 3MGQA 5AV9D 5F99D 3VH5T 4WNNA 2NZDC 4J8XB 4WNNB 1KX4C 5B24A 4WJ3C 3KXBC 5KDMA 5CPID 1S32D 3B6FD 3X1SA 3MGSC 2RVQD 4R8PA 3AL0C 3FDDA 4Z66D 4KGCB 1P3LB 4G92C 1WWIA 4YS3A 1M1AC 2Y2JA 5DNNA 3AYWD 2G5IC 3MGPD 2NZDB 1KX4B 2Y2HA 4E44A 2RIQA 3KXBB 3MGSA 3MGSB 1P3AC 5FUGA 3B0BA 1U35D 1P3LD 3REIC 5AVBA 4G92B 1M1AB 4J8VD 5C3IC 3W97D 2NZDD 1KX4D 1AOIC 5AV5C 3NQUB 5B2JD 2Y2MA 3KXBD 2F8NA 5B1MC 1P3AB 2Y2KA 3RELD 4LD9C 3AFAC 3C1CA 3REIB 1M1AD 3LELA 3REHA 3KUYA 2PYOC 5C3IB 3R45B 2VQRA 5B33D 2HIOD 3MVDA 3IP4C 1AOIB 1T3UA 5AV5B 4KUDA 4JJND 1P3AD 4UUZA 5B1MB 2Y2OA 2YFWB 3WTPA 3AFAB 5CP6C 4LD9B 3REID 3A1IA 1TAFA 3NQJB 5AV8A 5AV6C 2PYOB 1KX3C 4H9QB 1P3BD 4Z5TA 4H9RA 1WWSA 5B31C 1AOID 1P3IA 5AV5D 4NE5A 4H9SA 1BH9A 3A6NC 3X1TC 3W98D 5B1MD 3LJAA 4DRBA 5CP6A 3AFAD 1P34C 5CP6B 4J8WC 3AZFC 5B40A 5JA4B 5AV6B 4Z2MG 5B2IC 2YFVA 1KX3B 3REKA 4YM6C 3KWQC 2JSSA 2YFVB 5B31B 3LZ0A 4H9PB 2Y2PA 4KHAB 5AV9C 3AZNA 3A6NA 3X1TA 3A6NB 3X1TB 1KU5A 1P34A 1P34B 2DQNC 5CPIC 2F2AC 5JRGC 5GXQA 4J8WB 4WU9A 2G5HC 3AZFB 5AV6D 1JFIB 4YM6A 5B2IB 5B31D 2Y2GA 4YM6B 3KWQB 1H3OA 1H3OB 4CSRB 5AV9A 4X23C 5F99A 4CAYA 2L5AA 5AV9B 3AYWC 4CAYB 5GT3D 3MGPC 3AV1C 1P3PD 3EPLA 5CPIA 4J8WD 1S32A 3B6FA 5JRGB 3AZFD 5CPIB 3H0LC 1W2EA 5B2ID 4XUJC 3V9RA 5B31G 1P3FC 3V9RB 4Z66A 1U35C 3AZGC 5CPKD 5GT0C 4X23B 4J8VC 3AYWA 3W97C 4J8XA 3AYWB 3MGPB 1P3KC 4WU8D 3VH6W 5DNMC 3AZMD 3AV1B 4E45A 1Q9CA 5B2JC 4QLCC 5JRGD 1ZLAC 1B6WA 3UTAD 4XUJB 3RELC 4KGCA 1P3FB 1P3LA 3UT9C 3AZKC 3AZGB 1U35B 4X23D 5GT0B 3W97A 3B0CW 3H0MC 4J8VB 2FJ7D 3W97B 2NZDA 1P3BC 3REJC 5B33C 1KX4A 5BO0B 3AV1D 1P3KB 1HQ3C 1F1EA 2HIOC 3MNNC 5DNMB 4ZUXC 5B2JA 3TU4C 3B6GD 3KXBA 3MGRC 5B2JB 4QLCB 4JJNC 3A1KA 1ZLAB 1TZYC 4H9NB 4XUJD 3RELA 1P3FD 3VH6A 3RELB 4J8UC 3UT9B 3AZGD 3AN2D 1M1AA 3AZKB 2J8PA 5GT0D 3WAAC 1PZRA 5B33A 3O62C 2LY8A 3X1UD 3REJB 5B33B 4NE6A 2HIOA 3C1BC 1P3KD 5DNMD 3NQUA 1F66C 3WKJD 1HQ3B 2HIOB 3MNNB 4ZUXB 5B0YD 3TU4B 2Y2IA 3MGRB 4QLCD 2F8NK 1BH8B 4JJNB 1P3AA 3W98C 1ZLAD 3WA9D 5AVCC 1TZYB 2BYKB 3X1SD 2Y2LA 3REIA 4J8UB 3UT9D 3AZKD 2XD1A 3R45A 4R8PD 2BYMB 3REJD 3O62B 1P3BB 3WAAB 1AOIA 3C1BB 1HQ3D 3MNND 5AV5A 1F66B 4ZUXD 3KUYB 3TU4D 5CPJD 3MGRD 2Y2NA 5BS7C 2CV5C 4DRAA 5B1MA 3W98B 2YFWA 1TZYD 1ID3D 4LD9A 3AFAA 5AVCB 3EG5B 4DQYB 4J8UD 5B0ZC 3NQJA 2PYOA 2JCHA 4H9QA 4XZQC 2F8NH 2ZM5A 3O62D 3WAAD 3C1BD 1M18D 1F66D 4WV4B 1P3MC 3AZHD 2CV5B 5GT3C 1KX5C 2HUEC 5AVCD 1P3PC 1P3OC 2DF4C 5B0ZB 2BG1A 5BNXB 3AZLC 5JA4A 5AV6A 1KX3A 4XZQB 5B1LC 5B31A 4H9PA 1P3GD 3AZJC 5CPKC 4KHAA 1P3MB 3AZIC 2CV5D 5GT3A 5GT3B 4WU8C 4WZSB 5AY8C 3VH5W 2HUEB 1KX5B 3AZMC 1EQZC 1P3PB 1P3OB 5BNVB 5B0ZD 4J8WA 2NQBD 2ZY4A 3LZ1D 3AZFA 3AZLB 1B67A 1JFIA 4XZQD 5B2IA 3UTAC 5B1LB 3KWQA 3W96C 4CSRA 5B32C 1P3MD 3AZJB 5CPKB 3AZIB 4H9OB 1P3ID 3WTPE 2FJ7C 5E5AC 4WU8A 1KX5D 3AZMA 4WU8B 1EQZB 5AY8B 1P3OD 3AZMB 3B6GC 3W99C 3KSYA 3X1VC 5JRGA 3AZLD 3LJAD 5B1LD 3UTAB 3W96B 3VH5A 5B40D 3UTBC 3AZJD 3AN2C 4X23A 5B32B 3AZID 3MGPA 2XD5A 3LZ0D 2FJ7B 1N1JA 5E5AB 3X1UC 5AY8D 3AV1A 1M19C 1EQZD 1N1JB 5GSUD 2Y2QA 3MGQC 3B6GA 3WKJC 3B6GB 5B0YC 3W99B 3AV2D 3X1VB 1HTAA 5B24C 2UWXA 3WA9C 4XUJA 3W96D 1P3FA 3AZED 1U35A 2W8SA 3AZGA 3X1SC 3AN2A 5B32D 3UTBB 5GT0A 3AN2B 4J8VA 4R8PC 5E5AD 5BO0A 3X1UA 1P3KA 5DNMA 3X1UB 4YS3C 1M19B 3WKJA 2FFFB 3MGQB 5DNNC 5B0YA 3W99D 3WKJB 5CPJC 5B0YB 5G49A 4QLCA 3X1VD 5G49B 3P5JB 1ZLAA 3WA9A 2AROD 5B24B 4H9NA 3WA9B 1ID3C 3KFUG 5KDMB 3UT9A 3UTBD 3X1SB 3AZKA 4NE3A 5B32G 4G91C 4R8PB 3REJA 3EPJA 1BFMA 1Z2CB 5AVBC 1M19D 1HQ3A 3MNNA 1M18C 1R4VA 4ZUXA 3MGQD 3TU4A 4YS3B 3MGRA 5CPJA 5DNNB 4J8XD 3EPHA 5CPJB 3AZHC 1BH8A 4JJNA 5BT1D 5B24D 5CHLB 1TZYA 1ID3A 4NFTA 2BYKA 1ID3B 4J8UA 5FUGB 3B0DC 4G91B 2BYMA 4ZBJC 3O62A 1A7WA 1P3BA 3WAAA 4KGCD 3C1BA 1M18A 3C1CC 4YS3D 5AVBB 3LELC 1M18B 1F66A 3REHC 3KUYC 3VH6T 5DNND 1P3GC 3AZHA 3AZHB 3MVDC 3W98A 4KUDC 5AVCA 4EO5C 4M6BA 3MGSD 2F8NB 2NQBC 2ZY3A 3LZ1C 3B0DB 4ZBJB 3WTPC 3B0CT 3F6TA 5AVBD 3C1CB 3LELB 1P3GA 3REHB 5AV8C 1P3GB 5BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T C;  2CV5 A;  4AWL C;  4Z2M H;  1P3I C;  3MVD B;  4KUD B;  4H9S C;  4EO5 B;  5B0Z A;  2F8N D;  5BNX A;  2NQB A;  3LZ1 A;  2IO5 C;  4UUZ B;  2NQB B;  3LZ1 B;  4XZQ A;  3LJA C;  3WTP B;  3C1C D;  3LEL D;  3REH D;  3KUY D;  5B40 C;  1TAF B;  1P3M A;  5AV8 B;  4Z5T B;  3REK C;  4H9R B;  3MVD D;  4AWL B;  1P3I B;  3LZ0 C;  1KX5 A;  4KUD D;  1P3P A;  1P3O A;  5GSU C;  5BNV A;  3AZN C;  1BH9 B;  3AV2 C;  3AZL A;  2F8N G;  2IO5 B;  4LD9 D;  5B1L A;  3LJA B;  3WTP D;  5GXQ C;  4WU9 C;  2PYO D;  3AZE C;  3AZJ A;  5AV8 D;  2CWE A;  5B40 B;  5CPK A;  3AZI A;  4H9O A;  4Z5T D;  3REK B;  1EQZ A;  5AY8 A;  3LZ0 B;  5GSU A;  1ULY A;  5F99 C;  5GSU B;  3AZN B;  3AV2 A;  3AV2 B;  5CP6 D;  2ARO C;  3UTA A;  3W96 A;  1S32 C;  3AZE A;  3B6F C;  5GXQ B;  4WU9 B;  3AZE B;  5B32 A;  1KX3 D;  4HGA C;  2RVQ C;  3REK D;  2FJ7 A;  5E5A A;  4Z66 C;  3W99 A;  5F99 B;  3AZN D;  3A6N D;  4J8X C;  3X1T D;  3X1V A;  5BT1 C;  1P34 D;  2ARO A;  2ARO B;  5GXQ D;  4WU9 D;  1S32 B;  3UTB A;  3B6F B;  4HGA B;  4YM6 D;  3KWQ D;  4KGC C;  1P3L C;  4Z66 B;  1M19 A;  3MGQ A;  5AV9 D;  5F99 D;  3VH5 T;  4WNN A;  2NZD C;  4J8X B;  4WNN B;  1KX4 C;  5B24 A;  3KXB C;  5KDM A;  5CPI D;  1S32 D;  3B6F D;  3X1S A;  3MGS C;  2RVQ D;  4R8P A;  4Z66 D;  4KGC B;  1P3L B;  4G92 C;  1WWI A;  4YS3 A;  1M1A C;  5DNN A;  3AYW D;  3MGP D;  2NZD B;  1KX4 B;  4E44 A;  3KXB B;  3MGS A;  3MGS B;  1P3A C;  5FUG A;  3B0B A;  1U35 D;  1P3L D;  3REI C;  5AVB A;  4G92 B;  1M1A B;  4J8V D;  5C3I C;  3W97 D;  2NZD D;  1KX4 D;  1AOI C;  5AV5 C;  3NQU B;  5B2J D;  3KXB D;  2F8N A;  5B1M C;  1P3A B;  3REL D;  4LD9 C;  3AFA C;  3C1C A;  3REI B;  1M1A D;  3LEL A;  3REH A;  3KUY A;  2PYO C;  5C3I B;  3R45 B;  5B33 D;  2HIO D;  3MVD A;  1AOI B;  5AV5 B;  4KUD A;  4JJN D;  1P3A D;  4UUZ A;  5B1M B;  2YFW B;  3WTP A;  3AFA B;  5CP6 C;  4LD9 B;  3REI D;  1TAF A;  3NQJ B;  5AV8 A;  5AV6 C;  2PYO B;  1KX3 C;  4H9Q B;  1P3B D;  4Z5T A;  4H9R A;  1WWS A;  5B31 C;  1AOI D;  1P3I A;  5AV5 D;  4NE5 A;  4H9S A;  1BH9 A;  3A6N C;  3X1T C;  3W98 D;  5B1M D;  3LJA A;  4DRB A;  5CP6 A;  3AFA D;  1P34 C;  5CP6 B;  4J8W C;  3AZF C;  5B40 A;  5JA4 B;  5AV6 B;  4Z2M G;  5B2I C;  2YFV A;  1KX3 B;  3REK A;  4YM6 C;  3KWQ C;  2JSS A;  2YFV B;  5B31 B;  3LZ0 A;  4H9P B;  4KHA B;  5AV9 C;  3AZN A;  3A6N A;  3X1T A;  3A6N B;  3X1T B;  1KU5 A;  1P34 A;  1P34 B;  5CPI C;  5JRG C;  5GXQ A;  4J8W B;  4WU9 A;  3AZF B;  5AV6 D;  1JFI B;  4YM6 A;  5B2I B;  5B31 D;  4YM6 B;  3KWQ B;  1H3O A;  1H3O B;  4CSR B;  5AV9 A;  4X23 C;  5F99 A;  4CAY A;  2L5A A;  5AV9 B;  3AYW C;  4CAY B;  5GT3 D;  3MGP C;  3AV1 C;  1P3P D;  5CPI A;  4J8W D;  1S32 A;  3B6F A;  5JRG B;  3AZF D;  5CPI B;  5B2I D;  4XUJ C;  3V9R A;  5B31 G;  1P3F C;  3V9R B;  4Z66 A;  1U35 C;  3AZG C;  5CPK D;  5GT0 C;  4X23 B;  4J8V C;  3AYW A;  3W97 C;  4J8X A;  3AYW B;  3MGP B;  1P3K C;  4WU8 D;  3VH6 W;  5DNM C;  3AZM D;  3AV1 B;  4E45 A;  1Q9C A;  5B2J C;  4QLC C;  5JRG D;  1ZLA C;  1B6W A;  3UTA D;  4XUJ B;  3REL C;  4KGC A;  1P3F B;  1P3L A;  3UT9 C;  3AZK C;  3AZG B;  1U35 B;  4X23 D;  5GT0 B;  3W97 A;  3B0C W;  4J8V B;  2NZD A;  2FJ7 D;  3W97 B;  3REJ C;  5B33 C;  1KX4 A;  5BO0 B;  3AV1 D;  1P3K B;  1HQ3 C;  1F1E A;  2HIO C;  3MNN C;  5DNM B;  4ZUX C;  5B2J A;  3TU4 C;  3B6G D;  3KXB A;  3MGR C;  5B2J B;  4QLC B;  4JJN C;  1ZLA B;  1TZY C;  4H9N B;  4XUJ D;  3REL A;  1P3F D;  3VH6 A;  3REL B;  4J8U C;  3UT9 B;  3AZG D;  3AN2 D;  1M1A A;  3AZK B;  5GT0 D;  3WAA C;  5B33 A;  3O62 C;  1P3B C;  2LY8 A;  3X1U D;  3REJ B;  5B33 B;  4NE6 A;  2HIO A;  3C1B C;  1P3K D;  5DNM D;  3NQU A;  1F66 C;  3WKJ D;  1HQ3 B;  2HIO B;  3MNN B;  4ZUX B;  5B0Y D;  3TU4 B;  3MGR B;  4QLC D;  2F8N K;  1BH8 B;  4JJN B;  1P3A A;  3W98 C;  1ZLA D;  3WA9 D;  5AVC C;  1TZY B;  2BYK B;  3X1S D;  3REI A;  3UT9 D;  4J8U B;  3AZK D;  3R45 A;  4R8P D;  2BYM B;  3REJ D;  3O62 B;  1P3B B;  3WAA B;  1AOI A;  3C1B B;  1HQ3 D;  3MNN D;  5AV5 A;  1F66 B;  4ZUX D;  3KUY B;  3TU4 D;  5CPJ D;  3MGR D;  5BS7 C;  2CV5 C;  4DRA A;  5B1M A;  3W98 B;  2YFW A;  1TZY D;  1ID3 D;  4LD9 A;  3AFA A;  5AVC B;  4J8U D;  5B0Z C;  3NQJ A;  2PYO A;  4H9Q A;  4XZQ C;  2F8N H;  3O62 D;  3WAA D;  3C1B D;  1M18 D;  1F66 D;  4WV4 B;  1P3M C;  3AZH D;  2CV5 B;  5GT3 C;  1KX5 C;  2HUE C;  5AVC D;  1P3P C;  1P3O C;  5B0Z B;  3AZL C;  5BNX B;  5JA4 A;  5AV6 A;  1KX3 A;  4XZQ B;  5B1L C;  5B31 A;  4H9P A;  1P3G D;  3AZJ C;  5CPK C;  4KHA A;  1P3M B;  3AZI C;  2CV5 D;  5GT3 A;  5GT3 B;  4WU8 C;  4WZS B;  5AY8 C;  3VH5 W;  2HUE B;  1KX5 B;  3AZM C;  1EQZ C;  1P3P B;  1P3O B;  5BNV B;  5B0Z D;  4J8W A;  2NQB D;  3LZ1 D;  3AZF A;  3AZL B;  1B67 A;  1JFI A;  4XZQ D;  5B2I A;  3UTA C;  5B1L B;  3KWQ A;  3W96 C;  4CSR A;  5B32 C;  1P3M D;  3AZJ B;  5CPK B;  3AZI B;  4H9O B;  1P3I D;  3WTP E;  2FJ7 C;  5E5A C;  4WU8 A;  1KX5 D;  3AZM A;  4WU8 B;  1EQZ B;  5AY8 B;  1P3O D;  3AZM B;  3B6G C;  3W99 C;  3KSY A;  3X1V C;  5JRG A;  3AZL D;  3LJA D;  5B1L D;  3UTA B;  3W96 B;  3VH5 A;  5B40 D;  3UTB C;  3AZJ D;  3AN2 C;  4X23 A;  5B32 B;  3AZI D;  3MGP A;  3LZ0 D;  2FJ7 B;  1N1J A;  5E5A B;  3X1U C;  5AY8 D;  3AV1 A;  1M19 C;  1EQZ D;  1N1J B;  5GSU D;  3MGQ C;  3B6G A;  3WKJ C;  3B6G B;  5B0Y C;  3W99 B;  3AV2 D;  3X1V B;  1HTA A;  5B24 C;  3WA9 C;  4XUJ A;  3W96 D;  1P3F A;  3AZE D;  1U35 A;  3AZG A;  3X1S C;  3AN2 A;  5B32 D;  3UTB B;  5GT0 A;  3AN2 B;  4J8V A;  4R8P C;  5E5A D;  5BO0 A;  3X1U A;  1P3K A;  5DNM A;  3X1U B;  4YS3 C;  1M19 B;  3WKJ A;  3MGQ B;  5DNN C;  5B0Y A;  3W99 D;  3WKJ B;  5CPJ C;  5B0Y B;  5G49 A;  4QLC A;  3X1V D;  5G49 B;  1ZLA A;  3WA9 A;  2ARO D;  5B24 B;  4H9N A;  3WA9 B;  1ID3 C;  5KDM B;  3UT9 A;  3UTB D;  3X1S B;  3AZK A;  4NE3 A;  5B32 G;  4G91 C;  4R8P B;  3REJ A;  1BFM A;  5AVB C;  1M19 D;  1HQ3 A;  3MNN A;  1M18 C;  1R4V A;  4ZUX A;  3MGQ D;  3TU4 A;  4YS3 B;  3MGR A;  5CPJ A;  5DNN B;  4J8X D;  5CPJ B;  3AZH C;  1BH8 A;  4JJN A;  5BT1 D;  5B24 D;  5CHL B;  1TZY A;  1ID3 A;  4NFT A;  2BYK A;  1ID3 B;  4J8U A;  5FUG B;  3B0D C;  4G91 B;  2BYM A;  4ZBJ C;  3O62 A;  1A7W A;  1P3B A;  3WAA A;  4KGC D;  3C1B A;  1M18 A;  3C1C C;  4YS3 D;  5AVB B;  3LEL C;  1M18 B;  1F66 A;  3REH C;  3KUY C;  3VH6 T;  5DNN D;  1P3G C;  3AZH A;  3AZH B;  3MVD C;  3W98 A;  4KUD C;  5AVC A;  4EO5 C;  4M6B A;  3MGS D;  2F8N B;  2NQB C;  3LZ1 C;  3B0D B;  4ZBJ B;  3WTP C;  3B0C T;  5AVB D;  3C1C B;  3LEL B;  1P3G A;  3REH B;  5AV8 C;  1P3G B;  5BS7 A; 
#chains in the Genus database with same CATH topology
 4Z5T C;  2CV5 A;  4AWL C;  4Z2M H;  1P3I C;  3MVD B;  4KUD B;  4H9S C;  4EO5 B;  5B0Z A;  2F8N D;  5BNX A;  2NQB A;  3LZ1 A;  2IO5 C;  4UUZ B;  2NQB B;  3LZ1 B;  4XZQ A;  3LJA C;  3WTP B;  3C1C D;  3LEL D;  2ZY5 A;  3REH D;  3KUY D;  5B40 C;  1TAF B;  1P3M A;  5AV8 B;  4Z5T B;  3REK C;  4H9R B;  3MVD D;  4AWL B;  1P3I B;  3LZ0 C;  1KX5 A;  4KUD D;  1P3P A;  1P3O A;  2JE5 A;  5GSU C;  5BNV A;  3AZN C;  1BH9 B;  3AV2 C;  3AZL A;  2F8N G;  2IO5 B;  4LD9 D;  5B1L A;  3LJA B;  3WTP D;  5GXQ C;  4WU9 C;  2PYO D;  3AZE C;  3AZJ A;  5AV8 D;  2CWE A;  5B40 B;  5CPK A;  3AZI A;  4H9O A;  4Z5T D;  3REK B;  4UPK A;  2ZY2 A;  1EQZ A;  5AY8 A;  3LZ0 B;  5GSU A;  1ULY A;  5F99 C;  5GSU B;  3AZN B;  3AV2 A;  3AV2 B;  5CP6 D;  2ARO C;  3UTA A;  3W96 A;  1S32 C;  3AZE A;  3B6F C;  5GXQ B;  4WU9 B;  3AZE B;  5B32 A;  1KX3 D;  4HGA C;  2RVQ C;  3REK D;  2FJ7 A;  5E5A A;  4Z66 C;  3W99 A;  5F99 B;  3AZN D;  3A6N D;  4J8X C;  3X1T D;  3X1V A;  5BT1 C;  1P34 D;  2ARO A;  2ARO B;  5GXQ D;  4WU9 D;  3EPK A;  1S32 B;  3UTB A;  3B6F B;  4HGA B;  4YM6 D;  3KWQ D;  3H0R C;  4KGC C;  1P3L C;  4Z66 B;  1M19 A;  3MGQ A;  5AV9 D;  5F99 D;  3VH5 T;  4WNN A;  2NZD C;  4J8X B;  4WNN B;  1KX4 C;  5B24 A;  4WJ3 C;  3KXB C;  5KDM A;  5CPI D;  1S32 D;  3B6F D;  3X1S A;  3MGS C;  2RVQ D;  4R8P A;  3AL0 C;  3FDD A;  4Z66 D;  4KGC B;  1P3L B;  4G92 C;  1WWI A;  4YS3 A;  1M1A C;  2Y2J A;  5DNN A;  3AYW D;  2G5I C;  3MGP D;  2NZD B;  1KX4 B;  2Y2H A;  4E44 A;  2RIQ A;  3KXB B;  3MGS A;  3MGS B;  1P3A C;  5FUG A;  3B0B A;  1U35 D;  1P3L D;  3REI C;  5AVB A;  4G92 B;  1M1A B;  4J8V D;  5C3I C;  3W97 D;  2NZD D;  1KX4 D;  1AOI C;  5AV5 C;  3NQU B;  5B2J D;  2Y2M A;  3KXB D;  2F8N A;  5B1M C;  1P3A B;  2Y2K A;  3REL D;  4LD9 C;  3AFA C;  3C1C A;  3REI B;  1M1A D;  3LEL A;  3REH A;  3KUY A;  2PYO C;  5C3I B;  3R45 B;  2VQR A;  5B33 D;  2HIO D;  3MVD A;  3IP4 C;  1AOI B;  1T3U A;  5AV5 B;  4KUD A;  4JJN D;  1P3A D;  4UUZ A;  5B1M B;  2Y2O A;  2YFW B;  3WTP A;  3AFA B;  5CP6 C;  4LD9 B;  3REI D;  3A1I A;  1TAF A;  3NQJ B;  5AV8 A;  5AV6 C;  2PYO B;  1KX3 C;  4H9Q B;  1P3B D;  4Z5T A;  4H9R A;  1WWS A;  5B31 C;  1AOI D;  1P3I A;  5AV5 D;  4NE5 A;  4H9S A;  1BH9 A;  3A6N C;  3X1T C;  3W98 D;  5B1M D;  3LJA A;  4DRB A;  5CP6 A;  3AFA D;  1P34 C;  5CP6 B;  4J8W C;  3AZF C;  5B40 A;  5JA4 B;  5AV6 B;  4Z2M G;  5B2I C;  2YFV A;  1KX3 B;  3REK A;  4YM6 C;  3KWQ C;  2JSS A;  2YFV B;  5B31 B;  3LZ0 A;  4H9P B;  2Y2P A;  4KHA B;  5AV9 C;  3AZN A;  3A6N A;  3X1T A;  3A6N B;  3X1T B;  1KU5 A;  1P34 A;  1P34 B;  2DQN C;  5CPI C;  2F2A C;  5JRG C;  5GXQ A;  4J8W B;  4WU9 A;  2G5H C;  3AZF B;  5AV6 D;  1JFI B;  4YM6 A;  5B2I B;  5B31 D;  2Y2G A;  4YM6 B;  3KWQ B;  1H3O A;  1H3O B;  4CSR B;  5AV9 A;  4X23 C;  5F99 A;  4CAY A;  2L5A A;  5AV9 B;  3AYW C;  4CAY B;  5GT3 D;  3MGP C;  3AV1 C;  1P3P D;  3EPL A;  5CPI A;  4J8W D;  1S32 A;  3B6F A;  5JRG B;  3AZF D;  5CPI B;  3H0L C;  1W2E A;  5B2I D;  4XUJ C;  3V9R A;  5B31 G;  1P3F C;  3V9R B;  4Z66 A;  1U35 C;  3AZG C;  5CPK D;  5GT0 C;  4X23 B;  4J8V C;  3AYW A;  3W97 C;  4J8X A;  3AYW B;  3MGP B;  1P3K C;  4WU8 D;  3VH6 W;  5DNM C;  3AZM D;  3AV1 B;  4E45 A;  1Q9C A;  5B2J C;  4QLC C;  5JRG D;  1ZLA C;  1B6W A;  3UTA D;  4XUJ B;  3REL C;  4KGC A;  1P3F B;  1P3L A;  3UT9 C;  3AZK C;  3AZG B;  1U35 B;  4X23 D;  5GT0 B;  3W97 A;  3B0C W;  3H0M C;  4J8V B;  2FJ7 D;  3W97 B;  2NZD A;  1P3B C;  3REJ C;  5B33 C;  1KX4 A;  5BO0 B;  3AV1 D;  1P3K B;  1HQ3 C;  1F1E A;  2HIO C;  3MNN C;  5DNM B;  4ZUX C;  5B2J A;  3TU4 C;  3B6G D;  3KXB A;  3MGR C;  5B2J B;  4QLC B;  4JJN C;  3A1K A;  1ZLA B;  1TZY C;  4H9N B;  4XUJ D;  3REL A;  1P3F D;  3VH6 A;  3REL B;  4J8U C;  3UT9 B;  3AZG D;  3AN2 D;  1M1A A;  3AZK B;  2J8P A;  5GT0 D;  3WAA C;  1PZR A;  5B33 A;  3O62 C;  2LY8 A;  3X1U D;  3REJ B;  5B33 B;  4NE6 A;  2HIO A;  3C1B C;  1P3K D;  5DNM D;  3NQU A;  1F66 C;  3WKJ D;  1HQ3 B;  2HIO B;  3MNN B;  4ZUX B;  5B0Y D;  3TU4 B;  2Y2I A;  3MGR B;  4QLC D;  2F8N K;  1BH8 B;  4JJN B;  1P3A A;  3W98 C;  1ZLA D;  3WA9 D;  5AVC C;  1TZY B;  2BYK B;  3X1S D;  2Y2L A;  3REI A;  4J8U B;  3UT9 D;  3AZK D;  2XD1 A;  3R45 A;  4R8P D;  2BYM B;  3REJ D;  3O62 B;  1P3B B;  3WAA B;  1AOI A;  3C1B B;  1HQ3 D;  3MNN D;  5AV5 A;  1F66 B;  4ZUX D;  3KUY B;  3TU4 D;  5CPJ D;  3MGR D;  2Y2N A;  5BS7 C;  2CV5 C;  4DRA A;  5B1M A;  3W98 B;  2YFW A;  1TZY D;  1ID3 D;  4LD9 A;  3AFA A;  5AVC B;  3EG5 B;  4DQY B;  4J8U D;  5B0Z C;  3NQJ A;  2PYO A;  2JCH A;  4H9Q A;  4XZQ C;  2F8N H;  2ZM5 A;  3O62 D;  3WAA D;  3C1B D;  1M18 D;  1F66 D;  4WV4 B;  1P3M C;  3AZH D;  2CV5 B;  5GT3 C;  1KX5 C;  2HUE C;  5AVC D;  1P3P C;  1P3O C;  2DF4 C;  5B0Z B;  2BG1 A;  5BNX B;  3AZL C;  5JA4 A;  5AV6 A;  1KX3 A;  4XZQ B;  5B1L C;  5B31 A;  4H9P A;  1P3G D;  3AZJ C;  5CPK C;  4KHA A;  1P3M B;  3AZI C;  2CV5 D;  5GT3 A;  5GT3 B;  4WU8 C;  4WZS B;  5AY8 C;  3VH5 W;  2HUE B;  1KX5 B;  3AZM C;  1EQZ C;  1P3P B;  1P3O B;  5BNV B;  5B0Z D;  4J8W A;  2NQB D;  2ZY4 A;  3LZ1 D;  3AZF A;  3AZL B;  1B67 A;  1JFI A;  4XZQ D;  5B2I A;  3UTA C;  5B1L B;  3KWQ A;  3W96 C;  4CSR A;  5B32 C;  1P3M D;  3AZJ B;  5CPK B;  3AZI B;  4H9O B;  1P3I D;  3WTP E;  2FJ7 C;  5E5A C;  4WU8 A;  1KX5 D;  3AZM A;  4WU8 B;  1EQZ B;  5AY8 B;  1P3O D;  3AZM B;  3B6G C;  3W99 C;  3KSY A;  3X1V C;  5JRG A;  3AZL D;  3LJA D;  5B1L D;  3UTA B;  3W96 B;  3VH5 A;  5B40 D;  3UTB C;  3AZJ D;  3AN2 C;  4X23 A;  5B32 B;  3AZI D;  3MGP A;  2XD5 A;  3LZ0 D;  2FJ7 B;  1N1J A;  5E5A B;  3X1U C;  5AY8 D;  3AV1 A;  1M19 C;  1EQZ D;  1N1J B;  5GSU D;  2Y2Q A;  3MGQ C;  3B6G A;  3WKJ C;  3B6G B;  5B0Y C;  3W99 B;  3AV2 D;  3X1V B;  1HTA A;  5B24 C;  2UWX A;  3WA9 C;  4XUJ A;  3W96 D;  1P3F A;  3AZE D;  1U35 A;  2W8S A;  3AZG A;  3X1S C;  3AN2 A;  5B32 D;  3UTB B;  5GT0 A;  3AN2 B;  4J8V A;  4R8P C;  5E5A D;  5BO0 A;  3X1U A;  1P3K A;  5DNM A;  3X1U B;  4YS3 C;  1M19 B;  3WKJ A;  2FFF B;  3MGQ B;  5DNN C;  5B0Y A;  3W99 D;  3WKJ B;  5CPJ C;  5B0Y B;  5G49 A;  4QLC A;  3X1V D;  5G49 B;  3P5J B;  1ZLA A;  3WA9 A;  2ARO D;  5B24 B;  4H9N A;  3WA9 B;  1ID3 C;  3KFU G;  5KDM B;  3UT9 A;  3UTB D;  3X1S B;  3AZK A;  4NE3 A;  5B32 G;  4G91 C;  4R8P B;  3REJ A;  3EPJ A;  1BFM A;  1Z2C B;  5AVB C;  1M19 D;  1HQ3 A;  3MNN A;  1M18 C;  1R4V A;  4ZUX A;  3MGQ D;  3TU4 A;  4YS3 B;  3MGR A;  5CPJ A;  5DNN B;  4J8X D;  3EPH A;  5CPJ B;  3AZH C;  1BH8 A;  4JJN A;  5BT1 D;  5B24 D;  5CHL B;  1TZY A;  1ID3 A;  4NFT A;  2BYK A;  1ID3 B;  4J8U A;  5FUG B;  3B0D C;  4G91 B;  2BYM A;  4ZBJ C;  3O62 A;  1A7W A;  1P3B A;  3WAA A;  4KGC D;  3C1B A;  1M18 A;  3C1C C;  4YS3 D;  5AVB B;  3LEL C;  1M18 B;  1F66 A;  3REH C;  3KUY C;  3VH6 T;  5DNN D;  1P3G C;  3AZH A;  3AZH B;  3MVD C;  3W98 A;  4KUD C;  5AVC A;  4EO5 C;  4M6B A;  3MGS D;  2F8N B;  2NQB C;  2ZY3 A;  3LZ1 C;  3B0D B;  4ZBJ B;  3WTP C;  3B0C T;  3F6T A;  5AVB D;  3C1C B;  3LEL B;  1P3G A;  3REH B;  5AV8 C;  1P3G B;  5BS7 A; 
#chains in the Genus database with same CATH homology
 4Z5T C;  2CV5 A;  4AWL C;  4Z2M H;  1P3I C;  3MVD B;  4KUD B;  4H9S C;  4EO5 B;  5B0Z A;  2F8N D;  5BNX A;  2NQB A;  3LZ1 A;  2IO5 C;  4UUZ B;  2NQB B;  3LZ1 B;  4XZQ A;  3LJA C;  3WTP B;  3C1C D;  3LEL D;  2ZY5 A;  3REH D;  3KUY D;  5B40 C;  1TAF B;  1P3M A;  5AV8 B;  4Z5T B;  3REK C;  4H9R B;  3MVD D;  4AWL B;  1P3I B;  3LZ0 C;  1KX5 A;  4KUD D;  1P3P A;  1P3O A;  2JE5 A;  5GSU C;  5BNV A;  3AZN C;  1BH9 B;  3AV2 C;  3AZL A;  2F8N G;  2IO5 B;  4LD9 D;  5B1L A;  3LJA B;  3WTP D;  5GXQ C;  4WU9 C;  2PYO D;  3AZE C;  3AZJ A;  5AV8 D;  2CWE A;  5B40 B;  5CPK A;  3AZI A;  4H9O A;  4Z5T D;  3REK B;  4UPK A;  2ZY2 A;  1EQZ A;  5AY8 A;  3LZ0 B;  5GSU A;  1ULY A;  5F99 C;  5GSU B;  3AZN B;  3AV2 A;  3AV2 B;  5CP6 D;  2ARO C;  3UTA A;  3W96 A;  1S32 C;  3AZE A;  3B6F C;  5GXQ B;  4WU9 B;  3AZE B;  5B32 A;  1KX3 D;  4HGA C;  2RVQ C;  3REK D;  2FJ7 A;  5E5A A;  4Z66 C;  3W99 A;  5F99 B;  3AZN D;  3A6N D;  4J8X C;  3X1T D;  3X1V A;  5BT1 C;  1P34 D;  2ARO A;  2ARO B;  5GXQ D;  4WU9 D;  3EPK A;  1S32 B;  3UTB A;  3B6F B;  4HGA B;  4YM6 D;  3KWQ D;  3H0R C;  4KGC C;  1P3L C;  4Z66 B;  1M19 A;  3MGQ A;  5AV9 D;  5F99 D;  3VH5 T;  4WNN A;  2NZD C;  4J8X B;  4WNN B;  1KX4 C;  5B24 A;  4WJ3 C;  3KXB C;  5KDM A;  5CPI D;  1S32 D;  3B6F D;  3X1S A;  3MGS C;  2RVQ D;  4R8P A;  3AL0 C;  3FDD A;  4Z66 D;  4KGC B;  1P3L B;  4G92 C;  1WWI A;  4YS3 A;  1M1A C;  2Y2J A;  5DNN A;  3AYW D;  2G5I C;  3MGP D;  2NZD B;  1KX4 B;  2Y2H A;  4E44 A;  2RIQ A;  3KXB B;  3MGS A;  3MGS B;  1P3A C;  5FUG A;  3B0B A;  1U35 D;  1P3L D;  3REI C;  5AVB A;  4G92 B;  1M1A B;  4J8V D;  5C3I C;  3W97 D;  2NZD D;  1KX4 D;  1AOI C;  5AV5 C;  3NQU B;  5B2J D;  2Y2M A;  3KXB D;  2F8N A;  5B1M C;  1P3A B;  2Y2K A;  3REL D;  4LD9 C;  3AFA C;  3C1C A;  3REI B;  1M1A D;  3LEL A;  3REH A;  3KUY A;  2PYO C;  5C3I B;  3R45 B;  2VQR A;  5B33 D;  2HIO D;  3MVD A;  3IP4 C;  1AOI B;  1T3U A;  5AV5 B;  4KUD A;  4JJN D;  1P3A D;  4UUZ A;  5B1M B;  2Y2O A;  2YFW B;  3WTP A;  3AFA B;  5CP6 C;  4LD9 B;  3REI D;  3A1I A;  1TAF A;  3NQJ B;  5AV8 A;  5AV6 C;  2PYO B;  1KX3 C;  4H9Q B;  1P3B D;  4Z5T A;  4H9R A;  1WWS A;  5B31 C;  1AOI D;  1P3I A;  5AV5 D;  4NE5 A;  4H9S A;  1BH9 A;  3A6N C;  3X1T C;  3W98 D;  5B1M D;  3LJA A;  4DRB A;  5CP6 A;  3AFA D;  1P34 C;  5CP6 B;  4J8W C;  3AZF C;  5B40 A;  5JA4 B;  5AV6 B;  4Z2M G;  5B2I C;  2YFV A;  1KX3 B;  3REK A;  4YM6 C;  3KWQ C;  2JSS A;  2YFV B;  5B31 B;  3LZ0 A;  4H9P B;  2Y2P A;  4KHA B;  5AV9 C;  3AZN A;  3A6N A;  3X1T A;  3A6N B;  3X1T B;  1KU5 A;  1P34 A;  1P34 B;  2DQN C;  5CPI C;  2F2A C;  5JRG C;  5GXQ A;  4J8W B;  4WU9 A;  2G5H C;  3AZF B;  5AV6 D;  1JFI B;  4YM6 A;  5B2I B;  5B31 D;  2Y2G A;  4YM6 B;  3KWQ B;  1H3O A;  1H3O B;  4CSR B;  5AV9 A;  4X23 C;  5F99 A;  4CAY A;  2L5A A;  5AV9 B;  3AYW C;  4CAY B;  5GT3 D;  3MGP C;  3AV1 C;  1P3P D;  3EPL A;  5CPI A;  4J8W D;  1S32 A;  3B6F A;  5JRG B;  3AZF D;  5CPI B;  3H0L C;  1W2E A;  5B2I D;  4XUJ C;  3V9R A;  5B31 G;  1P3F C;  3V9R B;  4Z66 A;  1U35 C;  3AZG C;  5CPK D;  5GT0 C;  4X23 B;  4J8V C;  3AYW A;  3W97 C;  4J8X A;  3AYW B;  3MGP B;  1P3K C;  4WU8 D;  3VH6 W;  5DNM C;  3AZM D;  3AV1 B;  4E45 A;  1Q9C A;  5B2J C;  4QLC C;  5JRG D;  1ZLA C;  1B6W A;  3UTA D;  4XUJ B;  3REL C;  4KGC A;  1P3F B;  1P3L A;  3UT9 C;  3AZK C;  3AZG B;  1U35 B;  4X23 D;  5GT0 B;  3W97 A;  3B0C W;  3H0M C;  4J8V B;  2FJ7 D;  3W97 B;  2NZD A;  1P3B C;  3REJ C;  5B33 C;  1KX4 A;  5BO0 B;  3AV1 D;  1P3K B;  1HQ3 C;  1F1E A;  2HIO C;  3MNN C;  5DNM B;  4ZUX C;  5B2J A;  3TU4 C;  3B6G D;  3KXB A;  3MGR C;  5B2J B;  4QLC B;  4JJN C;  3A1K A;  1ZLA B;  1TZY C;  4H9N B;  4XUJ D;  3REL A;  1P3F D;  3VH6 A;  3REL B;  4J8U C;  3UT9 B;  3AZG D;  3AN2 D;  1M1A A;  3AZK B;  2J8P A;  5GT0 D;  3WAA C;  1PZR A;  5B33 A;  3O62 C;  2LY8 A;  3X1U D;  3REJ B;  5B33 B;  4NE6 A;  2HIO A;  3C1B C;  1P3K D;  5DNM D;  3NQU A;  1F66 C;  3WKJ D;  1HQ3 B;  2HIO B;  3MNN B;  4ZUX B;  5B0Y D;  3TU4 B;  2Y2I A;  3MGR B;  4QLC D;  2F8N K;  1BH8 B;  4JJN B;  1P3A A;  3W98 C;  1ZLA D;  3WA9 D;  5AVC C;  1TZY B;  2BYK B;  3X1S D;  2Y2L A;  3REI A;  4J8U B;  3UT9 D;  3AZK D;  2XD1 A;  3R45 A;  4R8P D;  2BYM B;  3REJ D;  3O62 B;  1P3B B;  3WAA B;  1AOI A;  3C1B B;  1HQ3 D;  3MNN D;  5AV5 A;  1F66 B;  4ZUX D;  3KUY B;  3TU4 D;  5CPJ D;  3MGR D;  2Y2N A;  5BS7 C;  2CV5 C;  4DRA A;  5B1M A;  3W98 B;  2YFW A;  1TZY D;  1ID3 D;  4LD9 A;  3AFA A;  5AVC B;  3EG5 B;  4DQY B;  4J8U D;  5B0Z C;  3NQJ A;  2PYO A;  2JCH A;  4H9Q A;  4XZQ C;  2F8N H;  2ZM5 A;  3O62 D;  3WAA D;  3C1B D;  1M18 D;  1F66 D;  4WV4 B;  1P3M C;  3AZH D;  2CV5 B;  5GT3 C;  1KX5 C;  2HUE C;  5AVC D;  1P3P C;  1P3O C;  2DF4 C;  5B0Z B;  2BG1 A;  5BNX B;  3AZL C;  5JA4 A;  5AV6 A;  1KX3 A;  4XZQ B;  5B1L C;  5B31 A;  4H9P A;  1P3G D;  3AZJ C;  5CPK C;  4KHA A;  1P3M B;  3AZI C;  2CV5 D;  5GT3 A;  5GT3 B;  4WU8 C;  4WZS B;  5AY8 C;  3VH5 W;  2HUE B;  1KX5 B;  3AZM C;  1EQZ C;  1P3P B;  1P3O B;  5BNV B;  5B0Z D;  4J8W A;  2NQB D;  2ZY4 A;  3LZ1 D;  3AZF A;  3AZL B;  1B67 A;  1JFI A;  4XZQ D;  5B2I A;  3UTA C;  5B1L B;  3KWQ A;  3W96 C;  4CSR A;  5B32 C;  1P3M D;  3AZJ B;  5CPK B;  3AZI B;  4H9O B;  1P3I D;  3WTP E;  2FJ7 C;  5E5A C;  4WU8 A;  1KX5 D;  3AZM A;  4WU8 B;  1EQZ B;  5AY8 B;  1P3O D;  3AZM B;  3B6G C;  3W99 C;  3KSY A;  3X1V C;  5JRG A;  3AZL D;  3LJA D;  5B1L D;  3UTA B;  3W96 B;  3VH5 A;  5B40 D;  3UTB C;  3AZJ D;  3AN2 C;  4X23 A;  5B32 B;  3AZI D;  3MGP A;  2XD5 A;  3LZ0 D;  2FJ7 B;  1N1J A;  5E5A B;  3X1U C;  5AY8 D;  3AV1 A;  1M19 C;  1EQZ D;  1N1J B;  5GSU D;  2Y2Q A;  3MGQ C;  3B6G A;  3WKJ C;  3B6G B;  5B0Y C;  3W99 B;  3AV2 D;  3X1V B;  1HTA A;  5B24 C;  2UWX A;  3WA9 C;  4XUJ A;  3W96 D;  1P3F A;  3AZE D;  1U35 A;  2W8S A;  3AZG A;  3X1S C;  3AN2 A;  5B32 D;  3UTB B;  5GT0 A;  3AN2 B;  4J8V A;  4R8P C;  5E5A D;  5BO0 A;  3X1U A;  1P3K A;  5DNM A;  3X1U B;  4YS3 C;  1M19 B;  3WKJ A;  2FFF B;  3MGQ B;  5DNN C;  5B0Y A;  3W99 D;  3WKJ B;  5CPJ C;  5B0Y B;  5G49 A;  4QLC A;  3X1V D;  5G49 B;  3P5J B;  1ZLA A;  3WA9 A;  2ARO D;  5B24 B;  4H9N A;  3WA9 B;  1ID3 C;  3KFU G;  5KDM B;  3UT9 A;  3UTB D;  3X1S B;  3AZK A;  4NE3 A;  5B32 G;  4G91 C;  4R8P B;  3REJ A;  3EPJ A;  1BFM A;  1Z2C B;  5AVB C;  1M19 D;  1HQ3 A;  3MNN A;  1M18 C;  1R4V A;  4ZUX A;  3MGQ D;  3TU4 A;  4YS3 B;  3MGR A;  5CPJ A;  5DNN B;  4J8X D;  3EPH A;  5CPJ B;  3AZH C;  1BH8 A;  4JJN A;  5BT1 D;  5B24 D;  5CHL B;  1TZY A;  1ID3 A;  4NFT A;  2BYK A;  1ID3 B;  4J8U A;  5FUG B;  3B0D C;  4G91 B;  2BYM A;  4ZBJ C;  3O62 A;  1A7W A;  1P3B A;  3WAA A;  4KGC D;  3C1B A;  1M18 A;  3C1C C;  4YS3 D;  5AVB B;  3LEL C;  1M18 B;  1F66 A;  3REH C;  3KUY C;  3VH6 T;  5DNN D;  1P3G C;  3AZH A;  3AZH B;  3MVD C;  3W98 A;  4KUD C;  5AVC A;  4EO5 C;  4M6B A;  3MGS D;  2F8N B;  2NQB C;  2ZY3 A;  3LZ1 C;  3B0D B;  4ZBJ B;  3WTP C;  3B0C T;  3F6T A;  5AVB D;  3C1C B;  3LEL B;  1P3G A;  3REH B;  5AV8 C;  1P3G B;  5BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...