5JRGA

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgA00
2HUEC 4KHAB 4E44A 1HQ3D 4XZQB 4H9OA 3REJA 2CV5C 2CV5D 5FUGA 3KXBA 1F1EA 3C1CB 3B6FA 1KU5A 5GSUA 3AV2C 1BFMA 4ZBJC 2PYOD 4WU8B 4KUDA 1P3OB 1P3IB 5B1MA 5BNXA 1B67A 4R8PA 4XUJA 3AZLB 3W97A 4CSRA 5B2JC 5B2JD 4LD9C 3UT9B 4Z66C 3AN2C 3AN2D 3AZNA 1BH8A 1KX4B 1M1AB 3AFAA 1P34C 4QLCC 4QLCD 4J8VB 3AZIA 5GT0A 3VH5T 5E5AA 2F8NH 3AV1A 3B0DB 3R45A 5B24C 1F66C 1F66D 1KX5D 5B2IA 4WNNB 4J8UC 1P3BA 5B1LC 5B1LD 2FJ7C 1U35B 1P3GC 3AZMA 3WA9A 1P3KB 5B32A 1P3MD 1P3AB 3B0CW 3WTPB 4WU9A 3MGPA 4G91C 4EO5C 5DNMC 3LZ1B 4J8XA 3RELB 3VH6T 1N1JB 4ZUXB 2CWEA 4Z5TB 5AV6C 5B40A 5AV6D 4HGAC 5BO0B 4J8WB 3AZHA 3KWQC 1P3PC 3W99D 3X1UB 4G92C 5CHLB 3MVDA 3X1TA 5JRGB 3REKB 1P3FA 3AZFB 5AV9B 1H3OA 2BYMA 1P3LA 2RVQD 5BNVA 1JFIB 4YM6C 4YM6D 3X1SC 1S32C 3X1SD 3MGSD 3UTAA 2JSSA 3WKJD 5B32G 3REHC 3C1BD 2NQBA 3MGRB 4H9OB 5CP6A 5GT3D 3REJB 1AOIA 3AZGA 3KXBB 4WV4B 5AVCA 5C3IC 3AZKD 5B31B 1WWSA 2AROA 2BYKA 5GSUB 3O62A 3B6FB 1ZLAC 1ZLAD 3TU4D 5KDMA 5AVBA 3REIC 3LELC 3WAAA 4KUDB 1ID3A 5CPIC 4X23D 5CPID 3AYWA 1M18D 5F99A 3MNND 4H9QA 1HQ3A 3X1VD 4XUJB 3W97B 4CSRB 2HIOB 1EQZA 1M19B 4XZQC 2CV5A 4XZQD 3A6ND 3V9RA 3B6GB 3AZNB 3LZ0B 3AFAB 3C1CC 2PYOA 3C1CD 3AZEB 3UTBD 3AZIB 4WU8C 4WU8D 3B0BA 5E5AB 1P3OC 1P3OD 4YS3D 3AV1B 1P3IC 1P3ID 3R45B 5B2JA 3MGQD 3AZLC 5B0ZD 3AZJC 3UT9C 3AZJD 4AWLB 3AN2A 5CPKC 5CPKD 5AY8D 4KGCB 4QLCA 1M1AC 3AZMB 3VH5W 3WA9B 5B32B 4J8VC 4J8VD 2F8NB 1KX3A 5BT1C 4WU9B 3MGPB 3AV2D 2NZDB 3B0DC 1F66A 5G49B 1KX5A 4J8XB 4NE3A 5BS7C 5B40B 1BH9A 5B1LA 2YFWA 1B6WA 5B33C 5B33D 4E45A 5DNNB 3MVDB 3X1TB 4LD9D 1H3OB 2BYMB 1P3LB 1P3MA 1TAFA 1P3KC 4Z66D 1P3AC 3UTAB 5AV5C 1P3AD 5AV5D 3WTPC 1P34D 3WTPD 3VH6W 4UUZA 2NQBB 3LZ1C 3LZ1D 1AOIB 5AV6A 3AZGB 4ZUXC 2YFVB 5AVCB 4ZUXD 4Z5TC 3O62B 3KUYA 3W99A 4J8WC 4J8WD 5KDMB 5AVBB 5B24D 3X1UC 1ID3B 3X1UD 5JRGC 3REKC 5JRGD 4YM6A 3REKD 3AZFC 5AV9C 3AZFD 5AV9D 5F99B 3X1SA 3MGSA 4J8UD 4H9QB 1HQ3B 3WKJA 5AV8B 1WWIA 2FJ7D 3LJAA 3C1BA 1P3GD 1EQZB 5GT3A 2CV5B 3MGRC 1TZYB 3MGRD 3V9RB 3REJC 1ULYA 5B0YB 3AZKA 5CPJC 5CPJD 3TU4A 5B31C 2PYOB 5B31D 5DNMD 4X23A 5CPIA 4KUDC 4JJNC 4KUDD 4JJND 1M18A 1HTAA 3MNNA 4Z2MH 3X1VA 3KWQD 1P3PD 4XZQA 2HIOC 3A6NA 2HIOD 1M19C 4H9NB 1M19D 3B6GC 3B6GD 1S32D 3C1CA 3AZNC 4QLCB 3LZ0C 3AFAC 3LZ0D 3REHD 3VH5A 3UTBA 4WU8A 3AZEC 3AZED 3AZIC 3AZID 1KX3B 5FUGB 4YS3A 1P3IA 5E5AC 3AV1C 3MGQA 3REID 5B0ZA 3LELD 3NQUA 2IO5B 1KX5B 5GXQC 3AZJA 5GXQD 5CPKA 5B1MB 5AY8A 1BH9B 5B1LB 5BNXB 2YFWB 4AWLC 3W98C 3W98D 4DRBA 3W96C 4R8PB 3W96D 4KGCC 4KGCD 4J8VA 1P3MB 1TAFB 3WA9C 5B32C 1A7WA 2F8ND 1BH8B 3AV2A 3VH6A 4WU9C 3MGPC 4Z2MG 2NZDC 2NZDD 5GT0B 5AV6B 4J8XC 5B40C 3KUYB 2LY8A 5B33A 3W99B 4LD9A 3AZLD 3NQJA 1R4VA 5DNNC 5DNND 3MVDC 3X1TC 2L5AA 4Z66A 3UT9D 5B2IB 3MGSB 1P3AA 1P3BB 5AV5A 3WKJB 1P34A 1KX4C 3UTAC 1KX4D 1Q9CA 3LJAB 3C1BB 1M1AD 5GT3B 2NQBC 3AZKB 1AOIC 3AZGC 5BT1D 4DRAA 3TU4B 3O62C 4J8WA 4H9PA 5B24A 3X1UA 5AVBC 4X23B 5CPIB 3KSYA 5JRGA 3REKA 3AZFA 1M18B 5AV9A 3MNNB 4J8UA 3X1VB 2FJ7A 5F99C 3AZHB 1HQ3C 1P3GA 5AV8C 5AV8D 5JA4A 1U35C 1U35D 1P3FB 4H9RA 3A6NB 3MGRA 1EQZC 1EQZD 5BNVB 1P3KD 4NE6A 1TZYC 5CPJA 1TZYD 5B0YC 5B0YD 5B31A 5DNMA 3UTBB 2PYOC 5CP6B 4JJNA 3RELC 3RELD 4YS3B 2AROB 2BYKB 4Z5TD 3KWQA 3MGQB 1P3PA 5B0ZB 3W96B 3NQUB 3WAAB 2HIOA 1M19A 3AZJB 3AYWB 5CPKB 5AY8B 3B6GA 1S32A 2HUEB 4H9SC 3REHA 3LZ0A 3AZEA 5B31G 3REJD 4NE5A 1KX3C 1KX3D 3KXBC 3AV2B 3KXBD 1ZLAA 3B6FC 4ZBJB 3B6FD 5GSUC 5GSUD 3REIA 3LELA 4CAYA 5GXQA 2IO5C 1KX5C 3W98A 3WTPE 5B1MC 3W96A 5B1MD 4KHAA 5B33B 5B2JB 4R8PC 4XUJC 4WZSB 4XUJD 3NQJB 4R8PD 3W97C 3W97D 4KGCA 4LD9B 4Z66B 3AN2B 2F8NA 1P3MC 5AV5B 1P34B 2F8NK 3AZND 3AFAD 2NZDA 5G49A 1P3OA 5GT0C 5GT0D 5E5AD 3KUYC 3KUYD 4H9PB 3AV1D 5B24B 3AZLA 1F66B 3W99C 5DNNA 3UT9A 4NFTA 2RVQC 4J8UB 5B2IC 2FJ7B 5B2ID 3MGSC 1P3BC 1KX4A 1P3BD 1M1AA 3WKJC 1P3GB 2F8NG 5JA4B 3LJAC 3C1BC 3LJAD 4H9RB 3AZMC 3AZMD 5GT3C 3WA9D 5B32D 5CPJB 3AZKC 2YFVA 4G91B 4EO5B 5DNMB 4UUZB 4WU9D 3MGPD 3TU4C 3B0CT 4JJNB 5BS7A 4X23C 4J8XD 4HGAB 1M18C 5B40D 4WNNA 3MNNC 3X1VC 5AV8A 3KWQB 4G92B 3AZHC 1P3PB 3AZHD 1U35A 3X1TD 3MVDD 1P3KA 4YM6B 3A6NC 1P3FC 1P3FD 1TZYA 4M6BA 1P3LC 3X1SB 5B0YA 1S32B 1P3LD 3WTPA 3REHB 3UTAD 3LZ1A 3UTBC 2NQBD 5CP6C 5CP6D 3RELA 1N1JA 5C3IB 4ZUXA 1AOID 4Z5TA 3AZGD 1ZLAB 5AVCC 5BO0A 5AVCD 4YS3C 2AROC 2AROD 3O62D 3REIB 3LELB 3MGQC 4CAYB 5GXQB 5AVBD 5B0ZC 3WAAC 3WAAD 1ID3C 4H9NA 1ID3D 3W98B 1JFIA 3AYWC 3AYWD 5AY8C 4H9SA 5F99D
chains in the Genus database with same CATH superfamily
2HUEC 4KHAB 4E44A 1HQ3D 4XZQB 4H9OA 3REJA 2CV5C 2CV5D 5FUGA 3KXBA 1F1EA 3C1CB 3B6FA 1KU5A 5GSUA 3AV2C 1BFMA 4ZBJC 2PYOD 3EPJA 4WU8B 4KUDA 3H0MC 1P3OB 1P3IB 5B1MA 5BNXA 1B67A 4R8PA 4XUJA 3AZLB 3W97A 4CSRA 5B2JC 5B2JD 4LD9C 3UT9B 4Z66C 2DQNC 3AN2C 3AN2D 3AZNA 1BH8A 1KX4B 1M1AB 3AFAA 1P34C 4QLCC 4QLCD 4J8VB 3AZIA 3KFUG 2FFFB 5GT0A 3VH5T 5E5AA 2F8NH 1Z2CB 3AV1A 3B0DB 3R45A 5B24C 1F66C 1F66D 1KX5D 5B2IA 4WNNB 4J8UC 1P3BA 5B1LC 5B1LD 2FJ7C 1U35B 1P3GC 3AZMA 3WA9A 1P3KB 5B32A 1P3MD 1P3AB 3B0CW 3WTPB 4WU9A 3MGPA 4G91C 4EO5C 5DNMC 3LZ1B 4J8XA 3RELB 3VH6T 1N1JB 4ZUXB 3EPHA 2CWEA 4Z5TB 5AV6C 5B40A 5AV6D 4HGAC 5BO0B 4J8WB 3AZHA 3KWQC 1P3PC 3W99D 3X1UB 4G92C 5CHLB 3MVDA 3X1TA 5JRGB 3REKB 1P3FA 3AZFB 5AV9B 1H3OA 2BYMA 1P3LA 2RVQD 5BNVA 1JFIB 4YM6C 4YM6D 2J8PA 3X1SC 1S32C 3X1SD 3MGSD 3UTAA 2JSSA 3WKJD 5B32G 2G5IC 3REHC 2ZY2A 3C1BD 2NQBA 3MGRB 4H9OB 5CP6A 5GT3D 3REJB 1AOIA 3AZGA 2DF4C 2Y2MA 3KXBB 4WV4B 5AVCA 5C3IC 3AZKD 5B31B 1WWSA 1W2EA 2AROA 2BYKA 5GSUB 3O62A 1ZLAC 3B6FB 1ZLAD 3TU4D 5KDMA 5AVBA 3REIC 3LELC 3WAAA 4KUDB 1ID3A 5CPIC 4X23D 5CPID 3AYWA 1M18D 5F99A 3MNND 4H9QA 1HQ3A 3X1VD 4XUJB 2XD5A 3W97B 4CSRB 2HIOB 1EQZA 1M19B 4XZQC 2CV5A 4XZQD 3A6ND 3V9RA 3B6GB 3A1KA 3AZNB 3LZ0B 3AFAB 3C1CC 2PYOA 3C1CD 2Y2HA 3UTBD 3AZEB 3AZIB 4WU8C 4WU8D 3B0BA 5E5AB 1P3OC 1P3OD 3AL0C 4YS3D 3AV1B 1P3IC 1P3ID 3R45B 5B2JA 3MGQD 3AZLC 5B0ZD 3AZJC 3UT9C 3AZJD 4AWLB 3AN2A 5CPKC 5CPKD 5AY8D 4KGCB 4QLCA 1M1AC 3AZMB 3VH5W 3WA9B 5B32B 4J8VC 4J8VD 2F8NB 1KX3A 2JCHA 5BT1C 3MGPB 4WU9B 3AV2D 2NZDB 3B0DC 1F66A 5G49B 1KX5A 4J8XB 4UPKA 4NE3A 1T3UA 5BS7C 5B40B 1BH9A 5B1LA 2YFWA 2Y2KA 1PZRA 1B6WA 5B33C 5B33D 4E45A 5DNNB 3MVDB 3X1TB 4LD9D 1H3OB 2BYMB 1P3LB 1P3MA 1TAFA 1P3KC 4Z66D 1P3AC 3UTAB 5AV5C 1P3AD 5AV5D 2Y2LA 3WTPC 1P34D 3WTPD 3VH6W 4UUZA 2XD1A 2NQBB 3LZ1C 3LZ1D 1AOIB 5AV6A 3AZGB 4ZUXC 2YFVB 4ZUXD 5AVCB 4Z5TC 3O62B 3KUYA 3W99A 3EPKA 4J8WC 4J8WD 5KDMB 5AVBB 5B24D 3X1UC 1ID3B 3X1UD 5JRGC 3REKC 5JRGD 4YM6A 3REKD 3AZFC 5AV9C 3AZFD 5AV9D 5F99B 3X1SA 3MGSA 4J8UD 4H9QB 1HQ3B 3WKJA 5AV8B 1WWIA 2FJ7D 3LJAA 3C1BA 1P3GD 1EQZB 5GT3A 2CV5B 3MGRC 1TZYB 3MGRD 3V9RB 3REJC 1ULYA 5B0YB 3AZKA 3A1IA 5CPJC 5CPJD 3TU4A 5B31C 2PYOB 5B31D 5DNMD 3H0LC 4X23A 5CPIA 4KUDC 4JJNC 4KUDD 4JJND 1M18A 1HTAA 3MNNA 4Z2MH 3X1VA 2F2AC 3KWQD 1P3PD 4XZQA 2HIOC 3A6NA 2HIOD 1M19C 4H9NB 1M19D 3B6GC 2Y2QA 3B6GD 1S32D 3C1CA 3AZNC 4QLCB 3LZ0C 3AFAC 3LZ0D 3REHD 3VH5A 3UTBA 3F6TA 4WU8A 3AZEC 3AZED 3AZIC 3AZID 1KX3B 5FUGB 4YS3A 1P3IA 5E5AC 2ZY5A 3AV1C 3MGQA 3REID 5B0ZA 3LELD 4WJ3C 3NQUA 2IO5B 1KX5B 5GXQC 3AZJA 5GXQD 5CPKA 5B1MB 5AY8A 1BH9B 5B1LB 5BNXB 2YFWB 4AWLC 3W98C 3W98D 4DRBA 3W96C 2Y2IA 4R8PB 3W96D 4KGCC 4KGCD 4J8VA 1P3MB 1TAFB 3WA9C 5B32C 1A7WA 2F8ND 1BH8B 3AV2A 3VH6A 4WU9C 3MGPC 2Y2GA 4Z2MG 4DQYB 2NZDC 2NZDD 5GT0B 5AV6B 4J8XC 2BG1A 5B40C 3KUYB 2LY8A 5B33A 3W99B 2RIQA 4LD9A 3AZLD 3NQJA 1R4VA 5DNNC 5DNND 3MVDC 3X1TC 2L5AA 4Z66A 3UT9D 5B2IB 2Y2OA 3MGSB 1P3AA 1P3BB 5AV5A 3WKJB 1P34A 1KX4C 3UTAC 1KX4D 1Q9CA 3LJAB 3C1BB 1M1AD 5GT3B 2NQBC 2ZY3A 3AZKB 1AOIC 3AZGC 5BT1D 4DRAA 3TU4B 3O62C 4J8WA 4H9PA 5B24A 3X1UA 5AVBC 4X23B 5CPIB 3KSYA 5JRGA 3REKA 3AZFA 1M18B 5AV9A 3MNNB 4J8UA 3X1VB 2FJ7A 5F99C 3AZHB 1HQ3C 1P3GA 5AV8C 5AV8D 5JA4A 2JE5A 1U35C 1U35D 1P3FB 4H9RA 3A6NB 3MGRA 1EQZC 1EQZD 5BNVB 1P3KD 4NE6A 1TZYC 5CPJA 1TZYD 5B0YC 5B0YD 5B31A 5DNMA 3UTBB 2PYOC 5CP6B 4JJNA 3RELC 3RELD 2ZM5A 4YS3B 2AROB 2BYKB 2Y2PA 4Z5TD 3KWQA 3MGQB 1P3PA 5B0ZB 3W96B 3NQUB 3WAAB 2HIOA 1M19A 3AZJB 3AYWB 5CPKB 5AY8B 3B6GA 1S32A 2HUEB 4H9SC 3REHA 3LZ0A 3AZEA 5B31G 3REJD 4NE5A 1KX3C 1KX3D 3KXBC 3AV2B 3KXBD 1ZLAA 3EPLA 3B6FC 4ZBJB 3B6FD 5GSUC 3P5JB 5GSUD 3REIA 3LELA 4CAYA 2Y2NA 5GXQA 2IO5C 1KX5C 3W98A 3WTPE 5B1MC 3W96A 5B1MD 4KHAA 5B33B 5B2JB 4R8PC 4XUJC 4WZSB 4XUJD 3NQJB 4R8PD 3W97C 3W97D 4KGCA 2W8SA 4LD9B 4Z66B 3AN2B 2F8NA 1P3MC 3H0RC 5AV5B 1P34B 2F8NK 2VQRA 3AZND 3AFAD 2NZDA 2G5HC 5G49A 1P3OA 5GT0C 5GT0D 5E5AD 3KUYC 3KUYD 4H9PB 3AV1D 5B24B 3AZLA 1F66B 3W99C 5DNNA 3UT9A 4NFTA 2RVQC 4J8UB 2UWXA 5B2IC 2FJ7B 5B2ID 3MGSC 1P3BC 1KX4A 1P3BD 1M1AA 3WKJC 1P3GB 2F8NG 5JA4B 3LJAC 3C1BC 3LJAD 4H9RB 3AZMC 3AZMD 5GT3C 3WA9D 5B32D 5CPJB 3AZKC 2YFVA 4G91B 4EO5B 5DNMB 3IP4C 4UUZB 4WU9D 3MGPD 3TU4C 2Y2JA 3B0CT 3FDDA 4JJNB 5BS7A 4X23C 4J8XD 4HGAB 1M18C 5B40D 4WNNA 3MNNC 3X1VC 5AV8A 3KWQB 4G92B 3AZHC 1P3PB 3AZHD 1U35A 3X1TD 3MVDD 1P3KA 4YM6B 3A6NC 1P3FC 1P3FD 1TZYA 4M6BA 1P3LC 3X1SB 5B0YA 1S32B 1P3LD 3WTPA 3REHB 3UTAD 3LZ1A 2ZY4A 3UTBC 2NQBD 5CP6C 5CP6D 3RELA 1N1JA 5C3IB 4ZUXA 1AOID 4Z5TA 3AZGD 1ZLAB 5AVCC 3EG5B 5BO0A 5AVCD 2AROC 4YS3C 2AROD 3O62D 3REIB 3LELB 3MGQC 4CAYB 5GXQB 5AVBD 5B0ZC 3WAAC 3WAAD 1ID3C 4H9NA 1ID3D 3W98B 1JFIA 3AYWC 3AYWD 5AY8C 4H9SA 5F99D
chains in the Genus database with same CATH topology
2HUEC 4KHAB 4E44A 1HQ3D 4XZQB 4H9OA 3REJA 2CV5C 2CV5D 5FUGA 3KXBA 1F1EA 3C1CB 3B6FA 1KU5A 5GSUA 3AV2C 1BFMA 4ZBJC 2PYOD 3EPJA 4WU8B 4KUDA 3H0MC 1P3OB 1P3IB 5B1MA 5BNXA 1B67A 4R8PA 4XUJA 3AZLB 3W97A 4CSRA 5B2JC 5B2JD 4LD9C 3UT9B 4Z66C 2DQNC 3AN2C 3AN2D 3AZNA 1BH8A 1KX4B 1M1AB 3AFAA 1P34C 4QLCC 4QLCD 4J8VB 3AZIA 3KFUG 2FFFB 5GT0A 3VH5T 5E5AA 2F8NH 1Z2CB 3AV1A 3B0DB 3R45A 5B24C 1F66C 1F66D 1KX5D 5B2IA 4WNNB 4J8UC 1P3BA 5B1LC 5B1LD 2FJ7C 1U35B 1P3GC 3AZMA 3WA9A 1P3KB 5B32A 1P3MD 1P3AB 3B0CW 3WTPB 4WU9A 3MGPA 4G91C 4EO5C 5DNMC 3LZ1B 4J8XA 3RELB 3VH6T 1N1JB 4ZUXB 3EPHA 2CWEA 4Z5TB 5AV6C 5B40A 5AV6D 4HGAC 5BO0B 4J8WB 3AZHA 3KWQC 1P3PC 3W99D 3X1UB 4G92C 5CHLB 3MVDA 3X1TA 5JRGB 3REKB 1P3FA 3AZFB 5AV9B 1H3OA 2BYMA 1P3LA 2RVQD 5BNVA 1JFIB 4YM6C 4YM6D 2J8PA 3X1SC 1S32C 3X1SD 3MGSD 3UTAA 2JSSA 3WKJD 5B32G 2G5IC 3REHC 2ZY2A 3C1BD 2NQBA 3MGRB 4H9OB 5CP6A 5GT3D 3REJB 1AOIA 3AZGA 2DF4C 2Y2MA 3KXBB 4WV4B 5AVCA 5C3IC 3AZKD 5B31B 1WWSA 1W2EA 2AROA 2BYKA 5GSUB 3O62A 1ZLAC 3B6FB 1ZLAD 3TU4D 5KDMA 5AVBA 3REIC 3LELC 3WAAA 4KUDB 1ID3A 5CPIC 4X23D 5CPID 3AYWA 1M18D 5F99A 3MNND 4H9QA 1HQ3A 3X1VD 4XUJB 2XD5A 3W97B 4CSRB 2HIOB 1EQZA 1M19B 4XZQC 2CV5A 4XZQD 3A6ND 3V9RA 3B6GB 3A1KA 3AZNB 3LZ0B 3AFAB 3C1CC 2PYOA 3C1CD 2Y2HA 3UTBD 3AZEB 3AZIB 4WU8C 4WU8D 3B0BA 5E5AB 1P3OC 1P3OD 3AL0C 4YS3D 3AV1B 1P3IC 1P3ID 3R45B 5B2JA 3MGQD 3AZLC 5B0ZD 3AZJC 3UT9C 3AZJD 4AWLB 3AN2A 5CPKC 5CPKD 5AY8D 4KGCB 4QLCA 1M1AC 3AZMB 3VH5W 3WA9B 5B32B 4J8VC 4J8VD 2F8NB 1KX3A 2JCHA 5BT1C 3MGPB 4WU9B 3AV2D 2NZDB 3B0DC 1F66A 5G49B 1KX5A 4J8XB 4UPKA 4NE3A 1T3UA 5BS7C 5B40B 1BH9A 5B1LA 2YFWA 2Y2KA 1PZRA 1B6WA 5B33C 5B33D 4E45A 5DNNB 3MVDB 3X1TB 4LD9D 1H3OB 2BYMB 1P3LB 1P3MA 1TAFA 1P3KC 4Z66D 1P3AC 3UTAB 5AV5C 1P3AD 5AV5D 2Y2LA 3WTPC 1P34D 3WTPD 3VH6W 4UUZA 2XD1A 2NQBB 3LZ1C 3LZ1D 1AOIB 5AV6A 3AZGB 4ZUXC 2YFVB 4ZUXD 5AVCB 4Z5TC 3O62B 3KUYA 3W99A 3EPKA 4J8WC 4J8WD 5KDMB 5AVBB 5B24D 3X1UC 1ID3B 3X1UD 5JRGC 3REKC 5JRGD 4YM6A 3REKD 3AZFC 5AV9C 3AZFD 5AV9D 5F99B 3X1SA 3MGSA 4J8UD 4H9QB 1HQ3B 3WKJA 5AV8B 1WWIA 2FJ7D 3LJAA 3C1BA 1P3GD 1EQZB 5GT3A 2CV5B 3MGRC 1TZYB 3MGRD 3V9RB 3REJC 1ULYA 5B0YB 3AZKA 3A1IA 5CPJC 5CPJD 3TU4A 5B31C 2PYOB 5B31D 5DNMD 3H0LC 4X23A 5CPIA 4KUDC 4JJNC 4KUDD 4JJND 1M18A 1HTAA 3MNNA 4Z2MH 3X1VA 2F2AC 3KWQD 1P3PD 4XZQA 2HIOC 3A6NA 2HIOD 1M19C 4H9NB 1M19D 3B6GC 2Y2QA 3B6GD 1S32D 3C1CA 3AZNC 4QLCB 3LZ0C 3AFAC 3LZ0D 3REHD 3VH5A 3UTBA 3F6TA 4WU8A 3AZEC 3AZED 3AZIC 3AZID 1KX3B 5FUGB 4YS3A 1P3IA 5E5AC 2ZY5A 3AV1C 3MGQA 3REID 5B0ZA 3LELD 4WJ3C 3NQUA 2IO5B 1KX5B 5GXQC 3AZJA 5GXQD 5CPKA 5B1MB 5AY8A 1BH9B 5B1LB 5BNXB 2YFWB 4AWLC 3W98C 3W98D 4DRBA 3W96C 2Y2IA 4R8PB 3W96D 4KGCC 4KGCD 4J8VA 1P3MB 1TAFB 3WA9C 5B32C 1A7WA 2F8ND 1BH8B 3AV2A 3VH6A 4WU9C 3MGPC 2Y2GA 4Z2MG 4DQYB 2NZDC 2NZDD 5GT0B 5AV6B 4J8XC 2BG1A 5B40C 3KUYB 2LY8A 5B33A 3W99B 2RIQA 4LD9A 3AZLD 3NQJA 1R4VA 5DNNC 5DNND 3MVDC 3X1TC 2L5AA 4Z66A 3UT9D 5B2IB 2Y2OA 3MGSB 1P3AA 1P3BB 5AV5A 3WKJB 1P34A 1KX4C 3UTAC 1KX4D 1Q9CA 3LJAB 3C1BB 1M1AD 5GT3B 2NQBC 2ZY3A 3AZKB 1AOIC 3AZGC 5BT1D 4DRAA 3TU4B 3O62C 4J8WA 4H9PA 5B24A 3X1UA 5AVBC 4X23B 5CPIB 3KSYA 5JRGA 3REKA 3AZFA 1M18B 5AV9A 3MNNB 4J8UA 3X1VB 2FJ7A 5F99C 3AZHB 1HQ3C 1P3GA 5AV8C 5AV8D 5JA4A 2JE5A 1U35C 1U35D 1P3FB 4H9RA 3A6NB 3MGRA 1EQZC 1EQZD 5BNVB 1P3KD 4NE6A 1TZYC 5CPJA 1TZYD 5B0YC 5B0YD 5B31A 5DNMA 3UTBB 2PYOC 5CP6B 4JJNA 3RELC 3RELD 2ZM5A 4YS3B 2AROB 2BYKB 2Y2PA 4Z5TD 3KWQA 3MGQB 1P3PA 5B0ZB 3W96B 3NQUB 3WAAB 2HIOA 1M19A 3AZJB 3AYWB 5CPKB 5AY8B 3B6GA 1S32A 2HUEB 4H9SC 3REHA 3LZ0A 3AZEA 5B31G 3REJD 4NE5A 1KX3C 1KX3D 3KXBC 3AV2B 3KXBD 1ZLAA 3EPLA 3B6FC 4ZBJB 3B6FD 5GSUC 3P5JB 5GSUD 3REIA 3LELA 4CAYA 2Y2NA 5GXQA 2IO5C 1KX5C 3W98A 3WTPE 5B1MC 3W96A 5B1MD 4KHAA 5B33B 5B2JB 4R8PC 4XUJC 4WZSB 4XUJD 3NQJB 4R8PD 3W97C 3W97D 4KGCA 2W8SA 4LD9B 4Z66B 3AN2B 2F8NA 1P3MC 3H0RC 5AV5B 1P34B 2F8NK 2VQRA 3AZND 3AFAD 2NZDA 2G5HC 5G49A 1P3OA 5GT0C 5GT0D 5E5AD 3KUYC 3KUYD 4H9PB 3AV1D 5B24B 3AZLA 1F66B 3W99C 5DNNA 3UT9A 4NFTA 2RVQC 4J8UB 2UWXA 5B2IC 2FJ7B 5B2ID 3MGSC 1P3BC 1KX4A 1P3BD 1M1AA 3WKJC 1P3GB 2F8NG 5JA4B 3LJAC 3C1BC 3LJAD 4H9RB 3AZMC 3AZMD 5GT3C 3WA9D 5B32D 5CPJB 3AZKC 2YFVA 4G91B 4EO5B 5DNMB 3IP4C 4UUZB 4WU9D 3MGPD 3TU4C 2Y2JA 3B0CT 3FDDA 4JJNB 5BS7A 4X23C 4J8XD 4HGAB 1M18C 5B40D 4WNNA 3MNNC 3X1VC 5AV8A 3KWQB 4G92B 3AZHC 1P3PB 3AZHD 1U35A 3X1TD 3MVDD 1P3KA 4YM6B 3A6NC 1P3FC 1P3FD 1TZYA 4M6BA 1P3LC 3X1SB 5B0YA 1S32B 1P3LD 3WTPA 3REHB 3UTAD 3LZ1A 2ZY4A 3UTBC 2NQBD 5CP6C 5CP6D 3RELA 1N1JA 5C3IB 4ZUXA 1AOID 4Z5TA 3AZGD 1ZLAB 5AVCC 3EG5B 5BO0A 5AVCD 2AROC 4YS3C 2AROD 3O62D 3REIB 3LELB 3MGQC 4CAYB 5GXQB 5AVBD 5B0ZC 3WAAC 3WAAD 1ID3C 4H9NA 1ID3D 3W98B 1JFIA 3AYWC 3AYWD 5AY8C 4H9SA 5F99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE C;  4KHA B;  4E44 A;  1HQ3 D;  4XZQ B;  4H9O A;  3REJ A;  2CV5 C;  2CV5 D;  5FUG A;  3KXB A;  1F1E A;  3C1C B;  3B6F A;  1KU5 A;  5GSU A;  3AV2 C;  1BFM A;  4ZBJ C;  2PYO D;  4WU8 B;  4KUD A;  1P3O B;  1P3I B;  5B1M A;  5BNX A;  1B67 A;  4R8P A;  4XUJ A;  3AZL B;  3W97 A;  4CSR A;  5B2J C;  5B2J D;  4LD9 C;  3UT9 B;  4Z66 C;  3AN2 C;  3AN2 D;  3AZN A;  1BH8 A;  1KX4 B;  1M1A B;  3AFA A;  1P34 C;  4QLC C;  4QLC D;  4J8V B;  3AZI A;  5GT0 A;  3VH5 T;  5E5A A;  2F8N H;  3AV1 A;  3B0D B;  3R45 A;  5B24 C;  1F66 C;  1F66 D;  1KX5 D;  5B2I A;  4WNN B;  4J8U C;  1P3B A;  5B1L C;  5B1L D;  2FJ7 C;  1U35 B;  1P3G C;  3AZM A;  3WA9 A;  1P3K B;  5B32 A;  1P3M D;  1P3A B;  3B0C W;  3WTP B;  4WU9 A;  3MGP A;  4G91 C;  4EO5 C;  5DNM C;  3LZ1 B;  4J8X A;  3REL B;  3VH6 T;  1N1J B;  4ZUX B;  2CWE A;  4Z5T B;  5AV6 C;  5B40 A;  5AV6 D;  4HGA C;  5BO0 B;  4J8W B;  3AZH A;  3KWQ C;  1P3P C;  3W99 D;  3X1U B;  4G92 C;  5CHL B;  3MVD A;  3X1T A;  5JRG B;  3REK B;  1P3F A;  3AZF B;  5AV9 B;  1H3O A;  2BYM A;  1P3L A;  2RVQ D;  5BNV A;  1JFI B;  4YM6 C;  4YM6 D;  3X1S C;  1S32 C;  3X1S D;  3MGS D;  3UTA A;  2JSS A;  3WKJ D;  5B32 G;  3REH C;  3C1B D;  2NQB A;  3MGR B;  4H9O B;  5CP6 A;  5GT3 D;  3REJ B;  1AOI A;  3AZG A;  3KXB B;  4WV4 B;  5AVC A;  5C3I C;  3AZK D;  5B31 B;  1WWS A;  2ARO A;  2BYK A;  5GSU B;  3O62 A;  3B6F B;  1ZLA C;  1ZLA D;  3TU4 D;  5KDM A;  5AVB A;  3REI C;  3LEL C;  3WAA A;  4KUD B;  1ID3 A;  5CPI C;  4X23 D;  5CPI D;  3AYW A;  1M18 D;  5F99 A;  3MNN D;  4H9Q A;  1HQ3 A;  3X1V D;  4XUJ B;  3W97 B;  4CSR B;  2HIO B;  1EQZ A;  1M19 B;  4XZQ C;  2CV5 A;  4XZQ D;  3A6N D;  3V9R A;  3B6G B;  3AZN B;  3LZ0 B;  3AFA B;  3C1C C;  2PYO A;  3C1C D;  3AZE B;  3UTB D;  3AZI B;  4WU8 C;  4WU8 D;  3B0B A;  5E5A B;  1P3O C;  1P3O D;  4YS3 D;  3AV1 B;  1P3I C;  1P3I D;  3R45 B;  5B2J A;  3MGQ D;  3AZL C;  5B0Z D;  3AZJ C;  3UT9 C;  3AZJ D;  4AWL B;  3AN2 A;  5CPK C;  5CPK D;  5AY8 D;  4KGC B;  4QLC A;  1M1A C;  3AZM B;  3VH5 W;  3WA9 B;  5B32 B;  4J8V C;  4J8V D;  2F8N B;  1KX3 A;  5BT1 C;  4WU9 B;  3MGP B;  3AV2 D;  2NZD B;  3B0D C;  1F66 A;  5G49 B;  1KX5 A;  4J8X B;  4NE3 A;  5BS7 C;  5B40 B;  1BH9 A;  5B1L A;  2YFW A;  1B6W A;  5B33 C;  5B33 D;  4E45 A;  5DNN B;  3MVD B;  3X1T B;  4LD9 D;  1H3O B;  2BYM B;  1P3L B;  1P3M A;  1TAF A;  1P3K C;  4Z66 D;  1P3A C;  3UTA B;  5AV5 C;  1P3A D;  5AV5 D;  3WTP C;  1P34 D;  3WTP D;  3VH6 W;  4UUZ A;  2NQB B;  3LZ1 C;  3LZ1 D;  1AOI B;  5AV6 A;  3AZG B;  4ZUX C;  2YFV B;  5AVC B;  4ZUX D;  4Z5T C;  3O62 B;  3KUY A;  3W99 A;  4J8W C;  4J8W D;  5KDM B;  5AVB B;  5B24 D;  3X1U C;  1ID3 B;  3X1U D;  5JRG C;  3REK C;  5JRG D;  4YM6 A;  3REK D;  3AZF C;  5AV9 C;  3AZF D;  5AV9 D;  5F99 B;  3X1S A;  3MGS A;  4J8U D;  4H9Q B;  1HQ3 B;  3WKJ A;  5AV8 B;  1WWI A;  2FJ7 D;  3LJA A;  3C1B A;  1P3G D;  1EQZ B;  5GT3 A;  2CV5 B;  3MGR C;  1TZY B;  3MGR D;  3V9R B;  3REJ C;  1ULY A;  5B0Y B;  3AZK A;  5CPJ C;  5CPJ D;  3TU4 A;  5B31 C;  2PYO B;  5B31 D;  5DNM D;  4X23 A;  5CPI A;  4KUD C;  4JJN C;  4KUD D;  4JJN D;  1M18 A;  1HTA A;  3MNN A;  4Z2M H;  3X1V A;  3KWQ D;  1P3P D;  4XZQ A;  2HIO C;  3A6N A;  2HIO D;  1M19 C;  4H9N B;  1M19 D;  3B6G C;  3B6G D;  1S32 D;  3C1C A;  3AZN C;  4QLC B;  3LZ0 C;  3AFA C;  3LZ0 D;  3REH D;  3VH5 A;  3UTB A;  4WU8 A;  3AZE C;  3AZE D;  3AZI C;  3AZI D;  1KX3 B;  5FUG B;  4YS3 A;  1P3I A;  5E5A C;  3AV1 C;  3MGQ A;  3REI D;  5B0Z A;  3LEL D;  3NQU A;  2IO5 B;  1KX5 B;  5GXQ C;  3AZJ A;  5GXQ D;  5CPK A;  5B1M B;  5AY8 A;  1BH9 B;  5B1L B;  5BNX B;  2YFW B;  4AWL C;  3W98 C;  3W98 D;  4DRB A;  3W96 C;  4R8P B;  3W96 D;  4KGC C;  4KGC D;  4J8V A;  1P3M B;  1TAF B;  3WA9 C;  5B32 C;  1A7W A;  2F8N D;  1BH8 B;  3AV2 A;  3VH6 A;  4WU9 C;  3MGP C;  4Z2M G;  2NZD C;  2NZD D;  5GT0 B;  5AV6 B;  4J8X C;  5B40 C;  3KUY B;  2LY8 A;  5B33 A;  3W99 B;  4LD9 A;  3AZL D;  3NQJ A;  1R4V A;  5DNN C;  5DNN D;  3MVD C;  3X1T C;  2L5A A;  4Z66 A;  3UT9 D;  5B2I B;  3MGS B;  1P3A A;  1P3B B;  5AV5 A;  3WKJ B;  1P34 A;  1KX4 C;  3UTA C;  1KX4 D;  1Q9C A;  3LJA B;  3C1B B;  1M1A D;  5GT3 B;  2NQB C;  3AZK B;  1AOI C;  3AZG C;  5BT1 D;  4DRA A;  3TU4 B;  3O62 C;  4J8W A;  4H9P A;  5B24 A;  3X1U A;  5AVB C;  4X23 B;  5CPI B;  3KSY A;  5JRG A;  3REK A;  3AZF A;  1M18 B;  5AV9 A;  3MNN B;  4J8U A;  3X1V B;  2FJ7 A;  5F99 C;  3AZH B;  1HQ3 C;  1P3G A;  5AV8 C;  5AV8 D;  5JA4 A;  1U35 C;  1U35 D;  1P3F B;  4H9R A;  3A6N B;  3MGR A;  1EQZ C;  1EQZ D;  5BNV B;  1P3K D;  4NE6 A;  1TZY C;  5CPJ A;  1TZY D;  5B0Y C;  5B0Y D;  5B31 A;  5DNM A;  3UTB B;  2PYO C;  5CP6 B;  4JJN A;  3REL C;  3REL D;  4YS3 B;  2ARO B;  2BYK B;  4Z5T D;  3KWQ A;  3MGQ B;  1P3P A;  5B0Z B;  3W96 B;  3NQU B;  3WAA B;  2HIO A;  1M19 A;  3AZJ B;  3AYW B;  5CPK B;  5AY8 B;  3B6G A;  1S32 A;  2HUE B;  4H9S C;  3REH A;  3LZ0 A;  3AZE A;  5B31 G;  3REJ D;  4NE5 A;  1KX3 C;  1KX3 D;  3KXB C;  3AV2 B;  3KXB D;  1ZLA A;  3B6F C;  4ZBJ B;  3B6F D;  5GSU C;  5GSU D;  3REI A;  3LEL A;  4CAY A;  5GXQ A;  2IO5 C;  1KX5 C;  3W98 A;  3WTP E;  5B1M C;  3W96 A;  5B1M D;  4KHA A;  5B33 B;  5B2J B;  4R8P C;  4XUJ C;  4WZS B;  4XUJ D;  3NQJ B;  4R8P D;  3W97 C;  3W97 D;  4KGC A;  4LD9 B;  4Z66 B;  3AN2 B;  2F8N A;  1P3M C;  5AV5 B;  1P34 B;  2F8N K;  3AZN D;  3AFA D;  2NZD A;  5G49 A;  1P3O A;  5GT0 C;  5GT0 D;  5E5A D;  3KUY C;  3KUY D;  4H9P B;  3AV1 D;  5B24 B;  3AZL A;  1F66 B;  3W99 C;  5DNN A;  3UT9 A;  4NFT A;  2RVQ C;  4J8U B;  5B2I C;  2FJ7 B;  5B2I D;  3MGS C;  1P3B C;  1KX4 A;  1P3B D;  1M1A A;  3WKJ C;  1P3G B;  2F8N G;  5JA4 B;  3LJA C;  3C1B C;  3LJA D;  4H9R B;  3AZM C;  3AZM D;  5GT3 C;  3WA9 D;  5B32 D;  5CPJ B;  3AZK C;  2YFV A;  4G91 B;  4EO5 B;  5DNM B;  4UUZ B;  4WU9 D;  3MGP D;  3TU4 C;  3B0C T;  4JJN B;  5BS7 A;  4X23 C;  4J8X D;  4HGA B;  1M18 C;  5B40 D;  4WNN A;  3MNN C;  3X1V C;  5AV8 A;  3KWQ B;  4G92 B;  3AZH C;  1P3P B;  3AZH D;  1U35 A;  3X1T D;  3MVD D;  1P3K A;  4YM6 B;  3A6N C;  1P3F C;  1P3F D;  1TZY A;  4M6B A;  1P3L C;  3X1S B;  5B0Y A;  1S32 B;  1P3L D;  3WTP A;  3REH B;  3UTA D;  3LZ1 A;  3UTB C;  2NQB D;  5CP6 C;  5CP6 D;  3REL A;  1N1J A;  5C3I B;  4ZUX A;  1AOI D;  4Z5T A;  3AZG D;  1ZLA B;  5AVC C;  5BO0 A;  5AVC D;  4YS3 C;  2ARO C;  2ARO D;  3O62 D;  3REI B;  3LEL B;  3MGQ C;  4CAY B;  5GXQ B;  5AVB D;  5B0Z C;  3WAA C;  3WAA D;  1ID3 C;  4H9N A;  1ID3 D;  3W98 B;  1JFI A;  3AYW C;  3AYW D;  5AY8 C;  4H9S A;  5F99 D; 
#chains in the Genus database with same CATH topology
 2HUE C;  4KHA B;  4E44 A;  1HQ3 D;  4XZQ B;  4H9O A;  3REJ A;  2CV5 C;  2CV5 D;  5FUG A;  3KXB A;  1F1E A;  3C1C B;  3B6F A;  1KU5 A;  5GSU A;  3AV2 C;  1BFM A;  4ZBJ C;  2PYO D;  3EPJ A;  4WU8 B;  4KUD A;  3H0M C;  1P3O B;  1P3I B;  5B1M A;  5BNX A;  1B67 A;  4R8P A;  4XUJ A;  3AZL B;  3W97 A;  4CSR A;  5B2J C;  5B2J D;  4LD9 C;  3UT9 B;  4Z66 C;  2DQN C;  3AN2 C;  3AN2 D;  3AZN A;  1BH8 A;  1KX4 B;  1M1A B;  3AFA A;  1P34 C;  4QLC C;  4QLC D;  4J8V B;  3AZI A;  3KFU G;  2FFF B;  5GT0 A;  3VH5 T;  5E5A A;  2F8N H;  1Z2C B;  3AV1 A;  3B0D B;  3R45 A;  5B24 C;  1F66 C;  1F66 D;  1KX5 D;  5B2I A;  4WNN B;  4J8U C;  1P3B A;  5B1L C;  5B1L D;  2FJ7 C;  1U35 B;  1P3G C;  3AZM A;  3WA9 A;  1P3K B;  5B32 A;  1P3M D;  1P3A B;  3B0C W;  3WTP B;  4WU9 A;  3MGP A;  4G91 C;  4EO5 C;  5DNM C;  3LZ1 B;  4J8X A;  3REL B;  3VH6 T;  1N1J B;  4ZUX B;  3EPH A;  2CWE A;  4Z5T B;  5AV6 C;  5B40 A;  5AV6 D;  4HGA C;  5BO0 B;  4J8W B;  3AZH A;  3KWQ C;  1P3P C;  3W99 D;  3X1U B;  4G92 C;  5CHL B;  3MVD A;  3X1T A;  5JRG B;  3REK B;  1P3F A;  3AZF B;  5AV9 B;  1H3O A;  2BYM A;  1P3L A;  2RVQ D;  5BNV A;  1JFI B;  4YM6 C;  4YM6 D;  2J8P A;  3X1S C;  1S32 C;  3X1S D;  3MGS D;  3UTA A;  2JSS A;  3WKJ D;  5B32 G;  2G5I C;  3REH C;  2ZY2 A;  3C1B D;  2NQB A;  3MGR B;  4H9O B;  5CP6 A;  5GT3 D;  3REJ B;  1AOI A;  3AZG A;  2DF4 C;  2Y2M A;  3KXB B;  4WV4 B;  5AVC A;  5C3I C;  3AZK D;  5B31 B;  1WWS A;  1W2E A;  2ARO A;  2BYK A;  5GSU B;  3O62 A;  1ZLA C;  3B6F B;  1ZLA D;  3TU4 D;  5KDM A;  5AVB A;  3REI C;  3LEL C;  3WAA A;  4KUD B;  1ID3 A;  5CPI C;  4X23 D;  5CPI D;  3AYW A;  1M18 D;  5F99 A;  3MNN D;  4H9Q A;  1HQ3 A;  3X1V D;  4XUJ B;  2XD5 A;  3W97 B;  4CSR B;  2HIO B;  1EQZ A;  1M19 B;  4XZQ C;  2CV5 A;  4XZQ D;  3A6N D;  3V9R A;  3B6G B;  3A1K A;  3AZN B;  3LZ0 B;  3AFA B;  3C1C C;  2PYO A;  3C1C D;  2Y2H A;  3UTB D;  3AZE B;  3AZI B;  4WU8 C;  4WU8 D;  3B0B A;  5E5A B;  1P3O C;  1P3O D;  3AL0 C;  4YS3 D;  3AV1 B;  1P3I C;  1P3I D;  3R45 B;  5B2J A;  3MGQ D;  3AZL C;  5B0Z D;  3AZJ C;  3UT9 C;  3AZJ D;  4AWL B;  3AN2 A;  5CPK C;  5CPK D;  5AY8 D;  4KGC B;  4QLC A;  1M1A C;  3AZM B;  3VH5 W;  3WA9 B;  5B32 B;  4J8V C;  4J8V D;  2F8N B;  1KX3 A;  2JCH A;  5BT1 C;  3MGP B;  4WU9 B;  3AV2 D;  2NZD B;  3B0D C;  1F66 A;  5G49 B;  1KX5 A;  4J8X B;  4UPK A;  4NE3 A;  1T3U A;  5BS7 C;  5B40 B;  1BH9 A;  5B1L A;  2YFW A;  2Y2K A;  1PZR A;  1B6W A;  5B33 C;  5B33 D;  4E45 A;  5DNN B;  3MVD B;  3X1T B;  4LD9 D;  1H3O B;  2BYM B;  1P3L B;  1P3M A;  1TAF A;  1P3K C;  4Z66 D;  1P3A C;  3UTA B;  5AV5 C;  1P3A D;  5AV5 D;  2Y2L A;  3WTP C;  1P34 D;  3WTP D;  3VH6 W;  4UUZ A;  2XD1 A;  2NQB B;  3LZ1 C;  3LZ1 D;  1AOI B;  5AV6 A;  3AZG B;  4ZUX C;  2YFV B;  4ZUX D;  5AVC B;  4Z5T C;  3O62 B;  3KUY A;  3W99 A;  3EPK A;  4J8W C;  4J8W D;  5KDM B;  5AVB B;  5B24 D;  3X1U C;  1ID3 B;  3X1U D;  5JRG C;  3REK C;  5JRG D;  4YM6 A;  3REK D;  3AZF C;  5AV9 C;  3AZF D;  5AV9 D;  5F99 B;  3X1S A;  3MGS A;  4J8U D;  4H9Q B;  1HQ3 B;  3WKJ A;  5AV8 B;  1WWI A;  2FJ7 D;  3LJA A;  3C1B A;  1P3G D;  1EQZ B;  5GT3 A;  2CV5 B;  3MGR C;  1TZY B;  3MGR D;  3V9R B;  3REJ C;  1ULY A;  5B0Y B;  3AZK A;  3A1I A;  5CPJ C;  5CPJ D;  3TU4 A;  5B31 C;  2PYO B;  5B31 D;  5DNM D;  3H0L C;  4X23 A;  5CPI A;  4KUD C;  4JJN C;  4KUD D;  4JJN D;  1M18 A;  1HTA A;  3MNN A;  4Z2M H;  3X1V A;  2F2A C;  3KWQ D;  1P3P D;  4XZQ A;  2HIO C;  3A6N A;  2HIO D;  1M19 C;  4H9N B;  1M19 D;  3B6G C;  2Y2Q A;  3B6G D;  1S32 D;  3C1C A;  3AZN C;  4QLC B;  3LZ0 C;  3AFA C;  3LZ0 D;  3REH D;  3VH5 A;  3UTB A;  3F6T A;  4WU8 A;  3AZE C;  3AZE D;  3AZI C;  3AZI D;  1KX3 B;  5FUG B;  4YS3 A;  1P3I A;  5E5A C;  2ZY5 A;  3AV1 C;  3MGQ A;  3REI D;  5B0Z A;  3LEL D;  4WJ3 C;  3NQU A;  2IO5 B;  1KX5 B;  5GXQ C;  3AZJ A;  5GXQ D;  5CPK A;  5B1M B;  5AY8 A;  1BH9 B;  5B1L B;  5BNX B;  2YFW B;  4AWL C;  3W98 C;  3W98 D;  4DRB A;  3W96 C;  2Y2I A;  4R8P B;  3W96 D;  4KGC C;  4KGC D;  4J8V A;  1P3M B;  1TAF B;  3WA9 C;  5B32 C;  1A7W A;  2F8N D;  1BH8 B;  3AV2 A;  3VH6 A;  4WU9 C;  3MGP C;  2Y2G A;  4Z2M G;  4DQY B;  2NZD C;  2NZD D;  5GT0 B;  5AV6 B;  4J8X C;  2BG1 A;  5B40 C;  3KUY B;  2LY8 A;  5B33 A;  3W99 B;  2RIQ A;  4LD9 A;  3AZL D;  3NQJ A;  1R4V A;  5DNN C;  5DNN D;  3MVD C;  3X1T C;  2L5A A;  4Z66 A;  3UT9 D;  5B2I B;  2Y2O A;  3MGS B;  1P3A A;  1P3B B;  5AV5 A;  3WKJ B;  1P34 A;  1KX4 C;  3UTA C;  1KX4 D;  1Q9C A;  3LJA B;  3C1B B;  1M1A D;  5GT3 B;  2NQB C;  2ZY3 A;  3AZK B;  1AOI C;  3AZG C;  5BT1 D;  4DRA A;  3TU4 B;  3O62 C;  4J8W A;  4H9P A;  5B24 A;  3X1U A;  5AVB C;  4X23 B;  5CPI B;  3KSY A;  5JRG A;  3REK A;  3AZF A;  1M18 B;  5AV9 A;  3MNN B;  4J8U A;  3X1V B;  2FJ7 A;  5F99 C;  3AZH B;  1HQ3 C;  1P3G A;  5AV8 C;  5AV8 D;  5JA4 A;  2JE5 A;  1U35 C;  1U35 D;  1P3F B;  4H9R A;  3A6N B;  3MGR A;  1EQZ C;  1EQZ D;  5BNV B;  1P3K D;  4NE6 A;  1TZY C;  5CPJ A;  1TZY D;  5B0Y C;  5B0Y D;  5B31 A;  5DNM A;  3UTB B;  2PYO C;  5CP6 B;  4JJN A;  3REL C;  3REL D;  2ZM5 A;  4YS3 B;  2ARO B;  2BYK B;  2Y2P A;  4Z5T D;  3KWQ A;  3MGQ B;  1P3P A;  5B0Z B;  3W96 B;  3NQU B;  3WAA B;  2HIO A;  1M19 A;  3AZJ B;  3AYW B;  5CPK B;  5AY8 B;  3B6G A;  1S32 A;  2HUE B;  4H9S C;  3REH A;  3LZ0 A;  3AZE A;  5B31 G;  3REJ D;  4NE5 A;  1KX3 C;  1KX3 D;  3KXB C;  3AV2 B;  3KXB D;  1ZLA A;  3EPL A;  3B6F C;  4ZBJ B;  3B6F D;  5GSU C;  3P5J B;  5GSU D;  3REI A;  3LEL A;  4CAY A;  2Y2N A;  5GXQ A;  2IO5 C;  1KX5 C;  3W98 A;  3WTP E;  5B1M C;  3W96 A;  5B1M D;  4KHA A;  5B33 B;  5B2J B;  4R8P C;  4XUJ C;  4WZS B;  4XUJ D;  3NQJ B;  4R8P D;  3W97 C;  3W97 D;  4KGC A;  2W8S A;  4LD9 B;  4Z66 B;  3AN2 B;  2F8N A;  1P3M C;  3H0R C;  5AV5 B;  1P34 B;  2F8N K;  2VQR A;  3AZN D;  3AFA D;  2NZD A;  2G5H C;  5G49 A;  1P3O A;  5GT0 C;  5GT0 D;  5E5A D;  3KUY C;  3KUY D;  4H9P B;  3AV1 D;  5B24 B;  3AZL A;  1F66 B;  3W99 C;  5DNN A;  3UT9 A;  4NFT A;  2RVQ C;  4J8U B;  2UWX A;  5B2I C;  2FJ7 B;  5B2I D;  3MGS C;  1P3B C;  1KX4 A;  1P3B D;  1M1A A;  3WKJ C;  1P3G B;  2F8N G;  5JA4 B;  3LJA C;  3C1B C;  3LJA D;  4H9R B;  3AZM C;  3AZM D;  5GT3 C;  3WA9 D;  5B32 D;  5CPJ B;  3AZK C;  2YFV A;  4G91 B;  4EO5 B;  5DNM B;  3IP4 C;  4UUZ B;  4WU9 D;  3MGP D;  3TU4 C;  2Y2J A;  3B0C T;  3FDD A;  4JJN B;  5BS7 A;  4X23 C;  4J8X D;  4HGA B;  1M18 C;  5B40 D;  4WNN A;  3MNN C;  3X1V C;  5AV8 A;  3KWQ B;  4G92 B;  3AZH C;  1P3P B;  3AZH D;  1U35 A;  3X1T D;  3MVD D;  1P3K A;  4YM6 B;  3A6N C;  1P3F C;  1P3F D;  1TZY A;  4M6B A;  1P3L C;  3X1S B;  5B0Y A;  1S32 B;  1P3L D;  3WTP A;  3REH B;  3UTA D;  3LZ1 A;  2ZY4 A;  3UTB C;  2NQB D;  5CP6 C;  5CP6 D;  3REL A;  1N1J A;  5C3I B;  4ZUX A;  1AOI D;  4Z5T A;  3AZG D;  1ZLA B;  5AVC C;  3EG5 B;  5BO0 A;  5AVC D;  2ARO C;  4YS3 C;  2ARO D;  3O62 D;  3REI B;  3LEL B;  3MGQ C;  4CAY B;  5GXQ B;  5AVB D;  5B0Z C;  3WAA C;  3WAA D;  1ID3 C;  4H9N A;  1ID3 D;  3W98 B;  1JFI A;  3AYW C;  3AYW D;  5AY8 C;  4H9S A;  5F99 D; 
#chains in the Genus database with same CATH homology
 2HUE C;  4KHA B;  4E44 A;  1HQ3 D;  4XZQ B;  4H9O A;  3REJ A;  2CV5 C;  2CV5 D;  5FUG A;  3KXB A;  1F1E A;  3C1C B;  3B6F A;  1KU5 A;  5GSU A;  3AV2 C;  1BFM A;  4ZBJ C;  2PYO D;  3EPJ A;  4WU8 B;  4KUD A;  3H0M C;  1P3O B;  1P3I B;  5B1M A;  5BNX A;  1B67 A;  4R8P A;  4XUJ A;  3AZL B;  3W97 A;  4CSR A;  5B2J C;  5B2J D;  4LD9 C;  3UT9 B;  4Z66 C;  2DQN C;  3AN2 C;  3AN2 D;  3AZN A;  1BH8 A;  1KX4 B;  1M1A B;  3AFA A;  1P34 C;  4QLC C;  4QLC D;  4J8V B;  3AZI A;  3KFU G;  2FFF B;  5GT0 A;  3VH5 T;  5E5A A;  2F8N H;  1Z2C B;  3AV1 A;  3B0D B;  3R45 A;  5B24 C;  1F66 C;  1F66 D;  1KX5 D;  5B2I A;  4WNN B;  4J8U C;  1P3B A;  5B1L C;  5B1L D;  2FJ7 C;  1U35 B;  1P3G C;  3AZM A;  3WA9 A;  1P3K B;  5B32 A;  1P3M D;  1P3A B;  3B0C W;  3WTP B;  4WU9 A;  3MGP A;  4G91 C;  4EO5 C;  5DNM C;  3LZ1 B;  4J8X A;  3REL B;  3VH6 T;  1N1J B;  4ZUX B;  3EPH A;  2CWE A;  4Z5T B;  5AV6 C;  5B40 A;  5AV6 D;  4HGA C;  5BO0 B;  4J8W B;  3AZH A;  3KWQ C;  1P3P C;  3W99 D;  3X1U B;  4G92 C;  5CHL B;  3MVD A;  3X1T A;  5JRG B;  3REK B;  1P3F A;  3AZF B;  5AV9 B;  1H3O A;  2BYM A;  1P3L A;  2RVQ D;  5BNV A;  1JFI B;  4YM6 C;  4YM6 D;  2J8P A;  3X1S C;  1S32 C;  3X1S D;  3MGS D;  3UTA A;  2JSS A;  3WKJ D;  5B32 G;  2G5I C;  3REH C;  2ZY2 A;  3C1B D;  2NQB A;  3MGR B;  4H9O B;  5CP6 A;  5GT3 D;  3REJ B;  1AOI A;  3AZG A;  2DF4 C;  2Y2M A;  3KXB B;  4WV4 B;  5AVC A;  5C3I C;  3AZK D;  5B31 B;  1WWS A;  1W2E A;  2ARO A;  2BYK A;  5GSU B;  3O62 A;  1ZLA C;  3B6F B;  1ZLA D;  3TU4 D;  5KDM A;  5AVB A;  3REI C;  3LEL C;  3WAA A;  4KUD B;  1ID3 A;  5CPI C;  4X23 D;  5CPI D;  3AYW A;  1M18 D;  5F99 A;  3MNN D;  4H9Q A;  1HQ3 A;  3X1V D;  4XUJ B;  2XD5 A;  3W97 B;  4CSR B;  2HIO B;  1EQZ A;  1M19 B;  4XZQ C;  2CV5 A;  4XZQ D;  3A6N D;  3V9R A;  3B6G B;  3A1K A;  3AZN B;  3LZ0 B;  3AFA B;  3C1C C;  2PYO A;  3C1C D;  2Y2H A;  3UTB D;  3AZE B;  3AZI B;  4WU8 C;  4WU8 D;  3B0B A;  5E5A B;  1P3O C;  1P3O D;  3AL0 C;  4YS3 D;  3AV1 B;  1P3I C;  1P3I D;  3R45 B;  5B2J A;  3MGQ D;  3AZL C;  5B0Z D;  3AZJ C;  3UT9 C;  3AZJ D;  4AWL B;  3AN2 A;  5CPK C;  5CPK D;  5AY8 D;  4KGC B;  4QLC A;  1M1A C;  3AZM B;  3VH5 W;  3WA9 B;  5B32 B;  4J8V C;  4J8V D;  2F8N B;  1KX3 A;  2JCH A;  5BT1 C;  3MGP B;  4WU9 B;  3AV2 D;  2NZD B;  3B0D C;  1F66 A;  5G49 B;  1KX5 A;  4J8X B;  4UPK A;  4NE3 A;  1T3U A;  5BS7 C;  5B40 B;  1BH9 A;  5B1L A;  2YFW A;  2Y2K A;  1PZR A;  1B6W A;  5B33 C;  5B33 D;  4E45 A;  5DNN B;  3MVD B;  3X1T B;  4LD9 D;  1H3O B;  2BYM B;  1P3L B;  1P3M A;  1TAF A;  1P3K C;  4Z66 D;  1P3A C;  3UTA B;  5AV5 C;  1P3A D;  5AV5 D;  2Y2L A;  3WTP C;  1P34 D;  3WTP D;  3VH6 W;  4UUZ A;  2XD1 A;  2NQB B;  3LZ1 C;  3LZ1 D;  1AOI B;  5AV6 A;  3AZG B;  4ZUX C;  2YFV B;  4ZUX D;  5AVC B;  4Z5T C;  3O62 B;  3KUY A;  3W99 A;  3EPK A;  4J8W C;  4J8W D;  5KDM B;  5AVB B;  5B24 D;  3X1U C;  1ID3 B;  3X1U D;  5JRG C;  3REK C;  5JRG D;  4YM6 A;  3REK D;  3AZF C;  5AV9 C;  3AZF D;  5AV9 D;  5F99 B;  3X1S A;  3MGS A;  4J8U D;  4H9Q B;  1HQ3 B;  3WKJ A;  5AV8 B;  1WWI A;  2FJ7 D;  3LJA A;  3C1B A;  1P3G D;  1EQZ B;  5GT3 A;  2CV5 B;  3MGR C;  1TZY B;  3MGR D;  3V9R B;  3REJ C;  1ULY A;  5B0Y B;  3AZK A;  3A1I A;  5CPJ C;  5CPJ D;  3TU4 A;  5B31 C;  2PYO B;  5B31 D;  5DNM D;  3H0L C;  4X23 A;  5CPI A;  4KUD C;  4JJN C;  4KUD D;  4JJN D;  1M18 A;  1HTA A;  3MNN A;  4Z2M H;  3X1V A;  2F2A C;  3KWQ D;  1P3P D;  4XZQ A;  2HIO C;  3A6N A;  2HIO D;  1M19 C;  4H9N B;  1M19 D;  3B6G C;  2Y2Q A;  3B6G D;  1S32 D;  3C1C A;  3AZN C;  4QLC B;  3LZ0 C;  3AFA C;  3LZ0 D;  3REH D;  3VH5 A;  3UTB A;  3F6T A;  4WU8 A;  3AZE C;  3AZE D;  3AZI C;  3AZI D;  1KX3 B;  5FUG B;  4YS3 A;  1P3I A;  5E5A C;  2ZY5 A;  3AV1 C;  3MGQ A;  3REI D;  5B0Z A;  3LEL D;  4WJ3 C;  3NQU A;  2IO5 B;  1KX5 B;  5GXQ C;  3AZJ A;  5GXQ D;  5CPK A;  5B1M B;  5AY8 A;  1BH9 B;  5B1L B;  5BNX B;  2YFW B;  4AWL C;  3W98 C;  3W98 D;  4DRB A;  3W96 C;  2Y2I A;  4R8P B;  3W96 D;  4KGC C;  4KGC D;  4J8V A;  1P3M B;  1TAF B;  3WA9 C;  5B32 C;  1A7W A;  2F8N D;  1BH8 B;  3AV2 A;  3VH6 A;  4WU9 C;  3MGP C;  2Y2G A;  4Z2M G;  4DQY B;  2NZD C;  2NZD D;  5GT0 B;  5AV6 B;  4J8X C;  2BG1 A;  5B40 C;  3KUY B;  2LY8 A;  5B33 A;  3W99 B;  2RIQ A;  4LD9 A;  3AZL D;  3NQJ A;  1R4V A;  5DNN C;  5DNN D;  3MVD C;  3X1T C;  2L5A A;  4Z66 A;  3UT9 D;  5B2I B;  2Y2O A;  3MGS B;  1P3A A;  1P3B B;  5AV5 A;  3WKJ B;  1P34 A;  1KX4 C;  3UTA C;  1KX4 D;  1Q9C A;  3LJA B;  3C1B B;  1M1A D;  5GT3 B;  2NQB C;  2ZY3 A;  3AZK B;  1AOI C;  3AZG C;  5BT1 D;  4DRA A;  3TU4 B;  3O62 C;  4J8W A;  4H9P A;  5B24 A;  3X1U A;  5AVB C;  4X23 B;  5CPI B;  3KSY A;  5JRG A;  3REK A;  3AZF A;  1M18 B;  5AV9 A;  3MNN B;  4J8U A;  3X1V B;  2FJ7 A;  5F99 C;  3AZH B;  1HQ3 C;  1P3G A;  5AV8 C;  5AV8 D;  5JA4 A;  2JE5 A;  1U35 C;  1U35 D;  1P3F B;  4H9R A;  3A6N B;  3MGR A;  1EQZ C;  1EQZ D;  5BNV B;  1P3K D;  4NE6 A;  1TZY C;  5CPJ A;  1TZY D;  5B0Y C;  5B0Y D;  5B31 A;  5DNM A;  3UTB B;  2PYO C;  5CP6 B;  4JJN A;  3REL C;  3REL D;  2ZM5 A;  4YS3 B;  2ARO B;  2BYK B;  2Y2P A;  4Z5T D;  3KWQ A;  3MGQ B;  1P3P A;  5B0Z B;  3W96 B;  3NQU B;  3WAA B;  2HIO A;  1M19 A;  3AZJ B;  3AYW B;  5CPK B;  5AY8 B;  3B6G A;  1S32 A;  2HUE B;  4H9S C;  3REH A;  3LZ0 A;  3AZE A;  5B31 G;  3REJ D;  4NE5 A;  1KX3 C;  1KX3 D;  3KXB C;  3AV2 B;  3KXB D;  1ZLA A;  3EPL A;  3B6F C;  4ZBJ B;  3B6F D;  5GSU C;  3P5J B;  5GSU D;  3REI A;  3LEL A;  4CAY A;  2Y2N A;  5GXQ A;  2IO5 C;  1KX5 C;  3W98 A;  3WTP E;  5B1M C;  3W96 A;  5B1M D;  4KHA A;  5B33 B;  5B2J B;  4R8P C;  4XUJ C;  4WZS B;  4XUJ D;  3NQJ B;  4R8P D;  3W97 C;  3W97 D;  4KGC A;  2W8S A;  4LD9 B;  4Z66 B;  3AN2 B;  2F8N A;  1P3M C;  3H0R C;  5AV5 B;  1P34 B;  2F8N K;  2VQR A;  3AZN D;  3AFA D;  2NZD A;  2G5H C;  5G49 A;  1P3O A;  5GT0 C;  5GT0 D;  5E5A D;  3KUY C;  3KUY D;  4H9P B;  3AV1 D;  5B24 B;  3AZL A;  1F66 B;  3W99 C;  5DNN A;  3UT9 A;  4NFT A;  2RVQ C;  4J8U B;  2UWX A;  5B2I C;  2FJ7 B;  5B2I D;  3MGS C;  1P3B C;  1KX4 A;  1P3B D;  1M1A A;  3WKJ C;  1P3G B;  2F8N G;  5JA4 B;  3LJA C;  3C1B C;  3LJA D;  4H9R B;  3AZM C;  3AZM D;  5GT3 C;  3WA9 D;  5B32 D;  5CPJ B;  3AZK C;  2YFV A;  4G91 B;  4EO5 B;  5DNM B;  3IP4 C;  4UUZ B;  4WU9 D;  3MGP D;  3TU4 C;  2Y2J A;  3B0C T;  3FDD A;  4JJN B;  5BS7 A;  4X23 C;  4J8X D;  4HGA B;  1M18 C;  5B40 D;  4WNN A;  3MNN C;  3X1V C;  5AV8 A;  3KWQ B;  4G92 B;  3AZH C;  1P3P B;  3AZH D;  1U35 A;  3X1T D;  3MVD D;  1P3K A;  4YM6 B;  3A6N C;  1P3F C;  1P3F D;  1TZY A;  4M6B A;  1P3L C;  3X1S B;  5B0Y A;  1S32 B;  1P3L D;  3WTP A;  3REH B;  3UTA D;  3LZ1 A;  2ZY4 A;  3UTB C;  2NQB D;  5CP6 C;  5CP6 D;  3REL A;  1N1J A;  5C3I B;  4ZUX A;  1AOI D;  4Z5T A;  3AZG D;  1ZLA B;  5AVC C;  3EG5 B;  5BO0 A;  5AVC D;  2ARO C;  4YS3 C;  2ARO D;  3O62 D;  3REI B;  3LEL B;  3MGQ C;  4CAY B;  5GXQ B;  5AVB D;  5B0Z C;  3WAA C;  3WAA D;  1ID3 C;  4H9N A;  1ID3 D;  3W98 B;  1JFI A;  3AYW C;  3AYW D;  5AY8 C;  4H9S A;  5F99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...